3GHBH

Crystal structure of anti-hiv-1 fab 447-52d in complex with v3 peptide w2rw020
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
235
structure length
235
Chain Sequence
EVQLVESGGGLVKPGGSLRLTCVASGFTFSDVWLNWVRQAPGKGLEWVGRIKSRTDGGTTDYAASVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYSCTTDGFIMIRGVSEDYYYYYMDVWGKGTTVTVSSASTKGPSVFPLAPCSRSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYTCNVNHKPSNTKVDKRVELKTPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of the cross-reactivity of genetically related human anti-HIV-1 mAbs: implications for design of V3-based immunogens
pubmed doi rcsb
molecule tags Immune system
molecule keywords Fab 447-52D, light chain
total genus 46
structure length 235
sequence length 235
chains with identical sequence I
ec nomenclature
pdb deposition date 2009-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ghbH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ghbH02
4LLWB 5E2UL 5F88A 4WFGD 1N0XL 4K71C 1A02N 3KR3L 1LE5A 4PJGB 3SJVB 4ZS6C 5C86A 3LN9A 3CZFB 4Y16C 4YNYB 4CADB 5KS9A 4P9ML 2C9AA 4LIQH 3DV4B 2YUXA 1JPFA 1K3ZA 5EU6D 1HH6A 3UYRL 2DWEB 1DQDH 1DVFA 3RWEB 5C0AD 4F9PC 3LSOB 2XQYG 1NEZA 2HKHH 3TVMC 4HS8H 4X6EB 3AVEA 4LP4A 2GK2A 5F7YC 5DMIH 1F8TH 1NJ9B 1M71B 4HX1A 5HTSA 4DUWA 4I48A 1RVFL 1J5OH 3W0WD 5D7KE 4KJQC 5GGSB 5BVPL 1MIEL 5JW4M 5I15L 1LO4H 3RPIB 1YEHL 5KVDH 2ESVD 3D3VD 4HT1L 4OZIE 4KDVA 3S34L 3S88L 5LGJB 5IROC 3SE3A 4R4ND 5HHOB 3C9NB 1Z2KA 3ARFA 2QHRL 1NKOA 5D6DA 3O9WC 1OP5K 5JQHC 1HXMA 5HYSA 3AY4A 1YUHB 4P9HC 4MWFB 3G5YA 5C0CE 5E2TH 5GRXG 3V6ZA 3BYYA 1X5FA 5C0AA 3ZYJA 1F4WH 3AGVA 1X44A 5CSGA 4JQXC 4PLNC 1FL6B 3RKDC 4NNPH 4Z6AT 4C56D 2CRZA 2VDNH 1BFSA 1IT9L 2EIZA 4KMLB 1RUQH 1Z9LA 3O6ML 1CQKA 3KJ4B 3QUKA 4KK6C 1H3GA 4WWKC 2X4PA 4G8EB 4MJIB 4NQVA 4XB8A 4PJEA 4RGNC 4OCRH 4X9FA 4B7LA 3GJFH 3I6KB 1XIWA 3PNWA 3QDGB 1KC5L 4L9LB 4G9DA 1P1ZB 1GIGH 3UBXI 1D3CA 5J8OA 3A6OA 4OGXH 5E1HB 1NC2D 5JDSB 1JPGA 4HWEL 4XX1E 2DIJA 5DJ2A 1QBLH 4XCEB 4PGEB 2XRAH 4EXKA 4XCNB 4NQTA 4EUPB 3K4DA 3BX7C 1RFDL 2PYEA 2WMPA 1MJ8L 1OAQH 5JOFA 5DEFB 4DTGH 1FO0L 3O6LL 5ILTL 1MCWM 1JNJA 2FGWH 5C6TH 2OLDA 2XKNB 2VN7A 1AC0A 1JGVH 1GC1L 3LH2H 1UH3A 4NC2B 3DXAD 5E99L 1NEUA 2IADA 1CDYA 1CD9B 3L5WA 1KJMA 1P7KA 3KS0J 4PRBB 4Q2ZA 4NO2B 4NZUL 5KSAA 1HHKB 5CZXC 3RX5A 2F8OA 1T1YA 4ZDHA 3BD4A 4KTDL 2YUVA 4P5MB 1T0PB 5GISL 4PJIA 5E95B 5KSBE 1F3JB 1WZLA 2Q3AA 3RGVB 1R24A 5E8NA 4X99A 3OAYH 4GS7C 2L7JA 4ODSH 5B3NA 5ELIA 3SGDH 1URLA 3MRMB 3IGAA 3PL6A 3V0WH 1DBBH 2FH6A 1A5FH 2OL3L 4JCMA 3MACH 2HTKC 4FG6C 4JM2A 5GS2H 4KZEL 1WF5A 5F9WC 4HIEA 2BOCB 4CUCA 4FXGB 2V7HB 5GJTH 3IF1B 2DBLL 5LXGL 1WIPA 3WNMA 3AAZB 1BFTA 3RTQC 4W6WB 4F57H 1KELH 2BVQB 3HCVB 2ESVA 4FN0A 4ZXBD 2NR6D 3LEVH 5DEGA 1S7VB 5ALBL 3QFDB 4Y4HC 4JFXA 3U0PB 4JLRA 1DUZA 1HSAB 4GAYB 1IL1A 1A0QH 4MSWA 5TFSL 1SM3H 2AEWA 4MD5B 1KPRB 1DEDA 1D5ZB 2FATL 5IV2B 2Y6SD 1NDMB 4TRPH 3QDGD 1I1CA 1JUFA 3X17A 4HG4K 3D3VB 2XRAL 1I85C 4R7DB 4RDQG 5HHQA 1JGLH 1A7OL 1C5BL 4HUNB 4PJXA 2V5RA 4KKNA 3QXVA 3KPRD 4U1KA 2VDOH 3BWAB 3MGTA 4NZDA 1LO3L 5B4MD 4KI5F 4P59H 1ZHBB 3L3HB 4PRHA 5L2KB 3ZYOA 3NPZB 1FNLA 3EOAA 4XVSH 1IC4H 5DA0B 2CIKA 3C60D 5CIPB 1MJUH 2OJEB 3DXAE 4GKSA 5I1DB 2C3XA 4WY7H 1XR9A 2QSCH 4C56B 3PQYE 4HCRA 2Z92A 3ZE1E 3HPJB 2WBJB 4GW5B 4ZO9A 2E9WA 3E1F1 1X5HA 5GRUL 3O8XB 5KSBB 3BSZL 2R4SL 4WHTB 2E9IA 4L8DA 1J8KA 1EAJA 2XKUA 2C3GA 1INDH 4KVNH 2NY7H 1RK0A 2Y5TA 3FN0H 4YFLF 2XA8H 2UUDK 1P7HL 3OPZL 2H45A 5ID1A 4UNVA 4HXAL 4PJ9A 1T3FA 3V0WL 1MRFH 4XPBL 4Y2DC 3C2AL 4XAWL 2HT2C 3QFJA 4UINL 4M93C 3MV7E 5DQ9B 2E27H 3O2WH 3EYSH 4QT5B 3NTCL 1KTLA 3MLUL 2EEDA 2QBWA 1RIVL 4OFDA 4CJ0A 4WUUD 4G5ZL 3WDIA 1HHGA 2DWEA 4OGYH 2V2XA 5IBLD 3RWEA 4L8CA 2A73B 2F19H 1CR9L 4X6EA 4RMVA 3VD9A 2NZ9D 3HI5L 4PJAA 1HHIB 2V5MA 5MI0C 1OGAE 1J18A 3MOBH 4KVNL 3IU4H 3VXPB 3ZTJG 1JWMB 3ZL4L 4RFNB 4P2QE 1QFUH 4WGWB 3RY6A 2G60L 5BS0A 5E9DA 2CGRH 3ARDC 4Z7NF 1CXIA 4LLWA 2OBGA 2YD9A 3CFJB 2AK4E 4RAUB 5I30L 2V9TA 3RUGF 3ARFB 2NTFB 3KPQB 5CUSL 1YZZA 3UPAA 1MIEH 4GBXB 5F9JA 3HB3C 1MAML 5CSZA 3FQWA 4L3EE 4PV9B 4DKEH 2A6JA 5F1IA 1I3GL 5C1MB 1QRND 3U46A 1SVCP 2QHLA 1QP1A 3S34H 1YEDB 5DHYA 5C7XL 3P0VL 3PWPE 3ZO0A 3DRTA 1RURL 3N1PC 3NA4A 3TT3H 4HLZG 1NEZB 2P8PB 4Z76B 4FTVB 5E6IC 5EU6A 1AXSA 3DHJA 1I1AD 2XKSA 4S2SA 4OLZH 2V7NA 1R0AH 1XH3B 4K3HA 5DRXA 5KVGH 5IK3B 5C9JB 2A83B 3OAZH 1F4YL 2ARJB 5FUCE 2AW2A 1D9KD 1MCQA 5J11B 2BOBA 3VXNB 4YDIL 3MRNB 4QRRB 1EGJA 4S1SL 3BEWB 4G8EA 4MJIA 2P4AB 2C1OA 5A16A 5K9QI 5SWZD 1NGWB 5GRVL 1AGFB 2PO6D 4JQIH 4L9LA 2Z9TA 4G9DB 3QSKB 1RUQL 3O6MH 2Z31B 3QEHA 2CSPA 1LDPH 4NQCE 1S7XA 4WHYH 2A9MH 1FG9C 1W0VB 1VEPA 5CBEB 4QXUH 1BOGB 1ZANH 2R0LL 2AGJH 4HXBH 3BUYA 4TNWK 1UM4L 3CVHH 3CC5B 4XPAH 3IETA 3WO3B 5IM7B 2XZAL 4EI5B 3GMNB 3V5HA 5E56A 3RKPA 2V9QA 1OW0C 3EHBD 3BP6B 4Y88A 3CFCH 2J8UA 4HKZA 2KZWA 4PTUB 2YS4A 3UO1L 1KB5L 1X5IA 3ARBC 3QUML 1HKFA 4AMKL 3T8XA 3O3UN 5TE6L 1BD2B 3S36X 5FO9A 4N90D 2ADGA 2YD5A 1I9IH 1B0WA 1KTKE 2MQ3A 4I2XE 1LD9A 2IADB 1I1YB 3C5JB 4GRMB 4JZNA 4M7KL 5F96H 1DL7H 3S6CA 1KACB 4V2BA 4M7LL 4G43B 2XWBB 4PG2A 1LP9A 3ZKND 3S3JA 3C5SA 3D0LB 5SX5H 4FQ2L 1Q9KA 3H3KA 4LDLB 4PJIB 3ARBB 3QIWC 2UWEB 3CVHL 5D96B 4NNYA 5JXAL 5D6DC 1BBDH 3IFLH 1FGNH 1E4WH 2PTTB 4HH9B 4S1QL 4OZIB 5T3XD 5CJOL 3HE6D 3PL6B 2PKDA 1BP3B 4NOFA 5C0BA 4AT6B 2IG2H 3LQAL 1J10A 1UENA 1NAKL 3MCKB 3QDJA 3P9LB 3MLSL 3QXDA 5T3XH 2R0WL 5E24E 4XHJD 1FNGA 1AHWA 4FA8A 5IKCA 2QQLL 4DKFH 3DROB 4WFHE 3WL9A 1NUFA 5HJ3B 4KKAC 3AREC 3GMMB 3T3MF 4FQJH 3BRDA 4RMTA 5DF0A 2VDQH 2ZWLT 2O93L 4KAQH 1KLUA 3BD5A 3R06B 5MHSE 4JLRB 4OFIA 1X5AA 3SE8L 4GAYA 4Z78B 5GGVH 2X9XA 3T0EA 2NY3D 1FLTX 4WI5A 4DZBA 3LRGA 1XCQB 4F58L 5D7JC 4X0KB 2H1PL 4K8RH 4PJFB 5B39B 1RSFA 4PTTB 2Z35A 5MEOA 3ZYIA 1Q9OA 5FO8B 2VLKE 1CE1H 5D2NE 2YRZA 4HBCH 4M43H 1Z5LA 4M6MH 1YNKH 4IRJD 4AEHH 5A40E 1BIIA 2DQGH 4F7EB 4S1DD 1OCWL 2BVQA 3HCVA 5IHZA 3GSWB 4R3SB 1QFWH 1T7WA 3B5GA 5DK0A 3T04D 1BD2D 1V3KA 2NY5L 3TV3L 5TE4H 5DC9B 2OL3A 1A6TA 4LCUB 4PG9A 2LTQB 4YAQB 4MXQD 4X9IA 3T0ED 2ZG1A 5GGVY 3TLRA 2WIIB 4KJYB 4X4ME 4BM7A 2HKFH 2V2TB 1F8TL 5IFHH 3TGXA 1BBJA 2AXFA 1AGDB 5DJZB 1FRGL 4QXGH 3P0GB 2VLME 3FAXA 4L8DB 3W82A 1OTUD 5ALCL 3PWPB 3ROLA 1FL3A 5EN2A 1RJLB 4L29B 1G0DA 1KIUA 2L7UA 1YYLH 4P4KC 4U1KB 4GUPA 4OF0A 3TIDA 4KDWA 4FQLL 3LQAH 4LQ1A 4EI5C 3KXFD 3PWJA 3BH8B 4YWGL 3ULVF 1MCKA 3HS0A 4I4WB 1S7SA 3KPPA 4OLUL 2DTSA 4WI9A 4PREA 1R5VB 1T0MB 4X6DF 1S7UA 5E5UB 3KG5A 3RZCB 1A3QA 2YPVH 3MYJA 2MJWA 4KMQA 4ODUB 2FGZA 1VKXA 4QOKD 4XNZC 3WHXA 1QLEH 1MFCL 4HMCA 1MPAL 3ARUA 1UM6H 4XC3L 4BA8A 1A1MA 5MP6H 5GS0C 1MCIA 2BFVL 5ALCH 1CFSB 3G5VA 4E5XB 5L2KE 3RUGB 2WSKA 4FQ1L 4F7PA 5ID0B 4LNRB 5FKAB 1W72B 2QQKH 1GGUA 4O00A 4WFFD 4PJ8B 5EFIB 5BS0B 4Z8FH 3O0RL 5FM5M 1RZJH 3AUVA 2EYRA 3A6CH 3GBNH 4MNQE 1ONQB 2PTVA 4RAUA 3ETBF 3THMH 4OGXL 4MAYC 5D71L 4LSPL 4QT5A 4N0UB 4GJTB 4P2QA 4ORGA 5EO9A 4LMQI 3RVTC 3E8UL 2XQBL 1VFMA 3JWDH 1F6AA 4XCCL 1A1NA 3DRTB 3FZUD 5FYKE 4L8CB 3QDAA 4WENB 3E6FB 5EBWB 2P8PA 5I8OL 3BJ91 1KJVA 3BAEL 3GSNH 5EZOH 3WIHH 1P84J 2X40A 3VH8A 4U6TA 1U8JA 3MTRA 3CAFA 1NCWH 5L8JB 2PR4L 3AFLA 2EIDA 4U0RC 5DUML 3MLVH 3OZ9H 4LEOA 1HHJA 3P73B 2LABA 1BQLL 3GBML 4Y16D 1JPST 5A16B 3VD3A 2EH8H 4BZ1H 3U48A 4XWOC 4YBLC 4G5ZH 5ETUB 1QFWM 2VXVH 5CWSA 3ORJA 1X6LA 2G9HA 4UBDC 2MNUA 2YA2A 4KUCD 4RRPG 3T77A 2R9HC 4R2GB 1T7VA 2ZUXA 3WD5L 1MI5E 1R3IL 2H32H 2DRUA 5BOZG 2Z4QB 4UOW0 5GRWA 1FNEB 3U9PH 1NCUA 5HGHB 3RVVC 4U6XA 4LHUB 3OR6B 5C9KA 1HIMH 3PF2A 3OGCA 3BOVA 2J8UB 5BO1H 2A9ML 4XGZB 2V7NB 3VXRE 3VXRD 3STBA 5IT2H 35C8L 3K2MC 1YPZE 2OMBA 5AWNH 4WU7A 1JIBA 4QRTB 3D85B 4QGYA 1NBVH 3VXNA 1UC6A 3Q48A 5DFVD 3MLXL 3DX6A 3GSNA 1H3PH 5F71A 2XWBA 1YMHA 1C5CL 3DO3A 1D5MA 2Z31A 4NO0B 4XPTH 4TVPL 3VXMD 1YEGL 3TWCH 3BRGC 4XRCA 2PYED 5EIQA 1AXTL 1X5ZA 3FOMB 4PGEA 3BZ4A 4Y4KB 2CIIA 3PABB 3TZVC 2X4UA 2D03L 3CC5A 4TNVK 2FX7L 2ZUUA 3EFDL 1X5JA 5DEFA 5HI4D 1C1EH 1G7HA 5T3ZD 1AI1L 5TDNA 3JWDL 4JRYD 3ZKXC 1OL0A 4OIBA 4LARL 4PTUA 4KJPD 4CVWA 5FA3A 5FFLA 1WWBX 2N4IA 3RWCB 4FABL 1J11A 3O45B 1E4WL 4Y4KC 4NCDA 5FYKD 1C8PA 1SMAA 4JKWA 1UG9A 2CLZB 3Q6FA 4G9FB 5EBLA 2F53E 5DJXA 3TVMD 3TNMB 1LP9B 4YE4L 4KU1A 4J3TA 3MRDA 4BZ2L 1T1YB 4ZDHB 4XTRD 2RHEA 3C5SB 1ACYH 1UADC 1YDPA 4WY7L 5FB8B 1IILE 1GZPB 4OZFB 5HBBA 1XR8B 1Q0YL 1T89A 3VFWB 1BHGA 4ZPVB 4X99B 5E2TL 1R3KA 1A7NL 1VFBA 3X13A 4HWNA 1P4LB 4BFEA 4GAJH 5A2LH 4X6DA 1ROWA 1S9KC 1J0KA 3QWQB 1N8ZA 1G7JB 3WE6A 1MWAL 3SE8H 4V2CB 2VZ1A 4KDTA 1B90A 3RKDD 5MEOB 4F7CB 4OB5L 2NXYB 3KYNB 4JN2A 4MD0B 2AVGA 1ORSA 4GMSL 3C2AH 1I9EA 3R0NA 3MRQB 1NBZB 1ZXQA 1N6VA 2QEJA 4R7NA 4I3RL 3NPSC 2V5TA 4OCRL 3ZHDA 3PQYA 5B38A 5J9PB 1FG2A 1MHEA 3VG9B 1YEFH 2V2WA 4MAUL 3R06A 4MQTB 1KCUH 2GSIA 4NN5B 4FFWC 1BJ1J 1T1XA 1YNKL 3H6JA 3U4BH 4I18A 3FO9B 3P9MA 3RA7L 3B5TA 3PGCA 3SKMB 5TQ0L 1M6OA 3BEVA 4YDIH 3VXSE 4NQDA 3MNVB 4M4RA 2BC4B 4R7DA 5AZEH 1J8HD 1FGVH 4YPJA 3SDDA 4KRMB 3PDOA 5ILTH 4OQTA 1AO7A 4G8IA 5ICZB 3ROLB 4D9LL 1ED3A 1KFAL 1BVZA 4F3FB 3R8BB 1JGVL 4XHQA 1CGYA 2G60H 4OJFL 3K81A 2IPUK 1YNLL 4IM8A 4Y1AE 5J11C 3DVNA 3WNKA 2HFEB 3MRLB 4IMKA 2M1KA 5DQDH 4XVTH 4Z7QE 3MA7A 3KPPB 1ADQL 2DQJL 3VXUE 1RZFL 3PWPD 4HLJA 3E2HB 1ZEAL 1Q72L 1T7YA 4R3SA 2ITDA 4NRZB 1MNUH 5DTFB 2FIRT 4APQC 2H2SC 4KRPB 2HJFA 3MLTA 4MXVE 4Y4KD 5IFJB 2FHFA 2AK1L 3GSUA 3DUSA 2Z92B 5FYJD 3RRQA 4XNXH 4KJYA 1LWRA 3JUZA 2W9DH 5AD0A 1YMMA 2B4CH 3IDNA 4I0PD 1U8PA 1QFOA 5ENWA 1A1MB 1CFSA 2FH8A 3LQAC 4QRUB 3S7GA 3QZWG 4ZODA 4LNRA 3KLDA 2H9GB 5K9OA 1U92B 4FP8L 2DJUA 4AM0B 1PZ5B 2BY3A 4LRNH 1QLEL 1QRKA 3CH1B 2AJYL 3LB6C 1L7TL 4M6OL 4CMHC 1JCKA 1S7QA 1T20B 3JTSA 5CZKA 4HBQA 4MJ6A 1CDJA 2R29L 5EUKA 4F57L 3UJJH 4U3CA 3JSSA 5IQ9A 4OSUL 2BDNH 4Z9KB 3LD8C 2UY6A 2E6QA 3C8HA 3MYJB 2LV4A 3RIFF 4X4YA 2F74B 1JZ5A 3RI5K 3I6GA 4H1LA 4WTZA 3E6FA 4BUGA 4ODUA 1E27B 4QTIL 1F42A 3P11H 5B22A 4OCWL 5EOTB 4IOFC 4JO3L 1A9BB 4PJAF 4KTDH 3TYGH 1BF2A 1SEQL 4Z95H 3MLZH 4LQFL 2R0KL 3QA3A 1PW3A 1Q9LA 5CILL 1VFAA 4P4RA 3H9SA 4DVRL 3OWEA 1JNNL 3F7RA 3I6LE 3GI9H 3FB5B 4GKNB 3F7PC 4JFFE 4UNTA 4YEEA 2VDOL 5E9DB 1ETZB 4MNGB 1MI5D 1R3JA 3B9DA 3UYRH 3WLWC 2COQA 5I73B 5ETUA 5AAWA 3C8KB 3QT2A 4LOUD 1VGKA 4RBPK 3GGWA 1J8HB 1CXFA 1B3JA 3V0VA 1CBVH 5D70L 5CSZB 3FQWB 1SQ2N 1X5XA 5EO9B 1N3NB 4RWHA 4ZFZA 2HRLA 1FZOA 3HZVA 4QCIA 5DGQA 3S9DB 5K9KA 3TBTB 4U6YB 4XP6L 4NSKA 2IQ9H 2J8HA 1AXSB 4N90E 4XBPB 3NZHL 4RX4D 3SGKA 2JCCE 3MUGB 2VLLB 3M07A 4J12A 2ADJB 2IAMD 3BDYH 1RFDH 4WUKH 4U1NB 3GI9L 3WFZA 3GMRB 4JPIA 4U31A 5C07D 3BKYL 3GNMH 2IWGA 1UWGL 5DJ0A 1OP5H 5ICYB 5HYSG 5J13B 2FIKA 4UDUB 2FHCA 2DTML 1RZIB 2P8MB 2YMXH 1U3ZA 5AYUH 1IC7L 5CINL 1BGXH 3IDJB 2WW8A 4K07A 1S7XB 4BH7B 4Q6IC 4MDIA 4NOBA 2NY4D 5F9DC 2OR9L 3PWVA 4DQOL 1IAIH 1J05B 2Z4QA 2FX9H 4MHHG 4U05A 3C6LB 1V8HA 3K80A 2JE8A 1BQHB 3QEQA 4OSUH 4PP1C 1HNGA 3OR6A 1DBAH 5FECB 2WZPD 2VABA 3BP6A 3WBDA 4JHBA 1UWEL 3ZTJH 2Y06H 3C8DA 3TBYA 5I8CB 3I3DA 3B4NA 3FQNA 4FQXD 4MQXC 1QUNA 2GUOB 3GJFA 2VXTH 2MHAA 3MRKB 3KJ6L 1SEQH 5I16B 3BXNB 1MCOL 4KROD 5L2JA 3LOWA 3LKRA 4LLDA 2BSSA 4R97C 1PGRB 1LP9F 3BPNB 3T2QA 2BHZA 4DTGL 1YC7A 3ARBA 5FB8A 2HT2D 1BFVL 4XP5H 3V4VH 4XPBH 3QO1A 4FQHB 3LDBC 4O2FB 1XR8A 4AEEA 1NPUA 1OP3H 4JY6B 3LEVL 1DBJL 1JV5B 4AIZB 4OZIA 4D3CH 2LU7A 1G7HB 4FZEL 2IMNA 3G5ZB 2FEDC 3I84A 1SJHB 4L4JA 1ZLVK 1BEYL 1JL8A 1H3PL 4F7CA 4YIQA 1LE9A 4TN9A 3UCRA 4NT6B 3VFPB 3DOSA 3HZMA 5E8DH 1IKNA 1XGPB 1ZLVH 3ZDZF 5HGBB 5GXBB 4GXVL 5IJVA 2WANA 1F02I 5I66B 5DHVB 3HE7A 3MRDB 2DMBA 1P7QD 5DVKA 1CDBA 2X41A 1ZK9A 5D7IA 4E42B 1CIUA 3FFCE 3I50L 1T1XB 3DX8B 1MHPH 4WFGE 1GZPA 1IGCL 4OZFA 5JHLH 3PGCB 1RUMH 2E9BA 4DZBB 1M05A 1KN4L 5DQJA 4DK6A 1KXVC 5C0RL 5BMFL 3LS4L 1AO7B 2NY0B 1KB5H 5D7LD 4XAKD 2BSTA 5AG9A 4H20H 4G8GA 3QHFH 4U6VH 4LLVB 2OR8A 5CLWA 5GRUH 3AXLB 4LIQL 1IKFH 1NCBH 5DD0L 5KVMC 1K3IA 2YC1B 2M26A 3RY6C 2CKBA 1UB5B 2XA8L 4HLZH 3QUYC 2FATH 3L5IA 4LKXA 1KFAH 4I3SL 3QZWA 1E6OH 5HHNA 1FQ9C 1G0YR 5TGBA 1KXTB 5KN5B 4HK3J 3PDDA 3M8OH 5JA8B 3HC4H 5HSFA 3DX7A 3C6LD 4U1LB 3UJTL 4K8RD 1P7QA 5DLML 3O11B 4HIIB 5IP4A 1Z0NA 4LPVA 1U3HD 1UT9A 4EJ1C 2GJ6B 4DWHA 2BC4A 1MNUL 5T3XE 1R6VA 4QHUA 3ARYA 4HG4J 4KRPD 1NBQA 4U6VL 1ACZA 2NY2D 2W65B 1A3LH 1K6QH 2BNQA 5IW1B 4FQXB 3HI5H 3HR5B 3NH7L 3VWJC 3TIEA 1QSEE 3UC0H 2EIBA 3ILPB 3BN9C 1ZS8A 1YEJH 5EPMB 3D9AL 5JIHA 3VXQB 1PKQB 1R5IB 2EYTA 1QFUL 1F4WL 3UTPE 4QF1A 3RY4A 5H37G 4CNIA 2MQ0A 1WAAE 3IU3A 3V5KB 2PF6A 5EDXA 5IG7A 5J13C 3BPOC 4N9GA 2BP3A 4LDEB 3WIHA 4JHAL 1IGJB 2KBGA 5FO7A 3OKLB 3N50A 1CT8A 4XAKE 5ENWB 1CU4H 2YEZA 1OTTD 5T33H 1I7ZA 4OZGF 1IGYA 2IPKA 1ZHLA 5KW9H 3MROA 2R9HD 1CS6A 2GQHA 1RIVH 4N1CA 1Q1JL 1OGAB 2GJ6E 4YXLH 5ERWA 1OOAA 4P2RB 1RULH 3ZMRA 3O4LE 2YA0A 1RJCA 3QDJE 2W0FB 4JKKA 4X7EC 5EIIA 1J8HA 3AROA 1NMAL 4N0UA 4NCC1 3JXAA 1VFOA 4P3CH 2JCCB 2ZSVA 3G6JF 3GKWL 5JNYB 1NBYB 3GO1L 3V52L 4ZO6A 3NVQA 3F58L 4LSSH 5DR5L 3BT2H 4M3JA 5K9KB 3CH8A 5DRZA 3GIZH 4H1LB 5IROA 5D2NB 2XN9D 2H3NA 2AJXL 1MLBB 1KJVB 2YWYA 4OBSA 2EC8A 1A9BA 1CFNB 4ELME 4MXWH 4F37F 5F8QC 4JFDD 2AJZB 1Q1JH 3DVGA 4MAUH 5A2KH 3VG0H 8FABB 1HN1A 3HMXL 3RWGA 4KVCL 3GKZA 4M5YH 4MCYA 3KPMB 5DJ8B 4A2LA 1TITA 4RX4A 4WUKL 5B8CC 5C3TA 4WTZG 4KRNA 4WW2F 1DDHA 5JPNB 4HPYH 3BGFC 3D5OF 4Q9CA 4MJ4A 5IJKC 4JFQA 2DIBA 3C5ZD 3C6LA 4F33B 3L7EB 2DQUH 4HS8L 5HDQL 3VWJA 3MRFB 3OGCB 2VZ3A 4XBPA 3UJIL 2OR9H 2W60B 1LMKA 5MENA 4PRIE 5I15H 4PFEA 2R2EA 3VWKC 3RJQB 1NUDA 2Y36L 4G6JH 3MMEA 1RJZA 3DV4A 3QRGL 3NCJL 4TSCH 3FHQA 4YHLH 4OIAA 2G5BB 3U36B 5HYEA 3PP4L 1B0GB 3O2VH 4LHUD 3QIUD 4PD4J 1FFPB 3HRZB 4PRPD 1X7QB 3BZFB 4NO0A 3K1DA 2IGFL 4JJHA 1A6VL 4XRCB 2X44D 2CIIB 3G5XB 1JYXA 1U3HB 5MEPA 2DMKA 4EUPA 3QUXD 4EEEA 4HWUA 4F80A 4OFYA 2RCSL 3RWIB 2VABB 2Y5EA 3GO1H 3GNML 3WXWL 3B2UD 5M95B 4OF5A 3NIDE 3WS6C 2AJXH 3VXUB 5HHOD 4POUB 2UV3A 1B4RA 2XI9A 4YR6B 4AEFA 2EC9T 4K9EC 1BPVA 2MHAB 3C60B 4EIGB 1P7KB 2ICWJ 3R8QA 4NGHL 5FGCB 4FQQA 3MOQA 5HGGS 4I0PA 4I13B 1BMGA 5I66A 1TJGH 3QAZB 4YHML 2R0ZL 1KENL 4I1NB 3IDUA 9CGTA 1EBAA 3O2DA 4HEME 5IESH 3X11A 4IMLA 5D5MA 2OZ4A 3IAGC 3QUKB 3U6RB 3L95A 3VXOA 1DQQA 3BGMB 4PJEB 2DLFH 5FOJA 3MFFB 2WAHA 3WHE0 4X6FA 2A74B 1P1ZA 2EE3A 3VW3H 1DUYA 2QSVA 3O3DA 4HIEB 5FYKH 4NM8L 5EH1A 5JDSA 4JFDB 4OFPA 4M6OH 3S4SA 4MS8C 5MEND 1JNLL 5ANMB 3SBWA 2HLFD 3N1QC 3N1GC 3WJLA 4Z0BL 1HH9B 3HE7B 3QHFL 4KUZL 2V2WB 4XPTL 3H9YA 4O02L 4O58H 4BSWA 5TGBB 2MFNA 1YEKH 2NXYD 2AV1A 1RHHB 4MB3A 1OAZH 3LKPA 4WW1B 3DX7B 3QWOA 1D5ZA 4ZS7H 4JRYB 1U9KA 5F3BA 5GGRB 4L3CA 1UJTA 5E9DE 4F7MB 1OSZA 3LB6D 3HAEB 4Y5VA 5D8JH 4WTWA 3WIFB 3B9VA 2NY7L 5HI3D 3L1OH 1V3MA 4EIZC 1FFQA 4M1GL 2YPKB 4OUUA 5DD3H 4X6CF 1IQWH 5D1QC 3S5LB 1ZHBA 3L3HA 2VITA 3D18B 4EOWL 4WV1A 3S35X 1FFOB 4X5XA 1DZBA 4G80B 3CVHA 2VC2H 4MXQC 3MRMA 3DTXA 5A2JH 4LOUC 4RMWA 3VXUD 2FLBT 1PSKL 4F8QA 4YDKH 4H1LH 3WHE1 1UJ3A 2VWEE 5KG9B 4OZHA 1G1CA 1EJ6A 2FD6H 4NHUA 3C6LC 3CDCA 5JXEA 1GGBH 4QRQA 3QXWA 4X5LA 1DQTA 2YEZB 5D7LE 3BDYL 4JFHE 3K7UA 1FV1A 2Y5TB 3RWDA 1FORH 1MY7A 1U8OB 1SBSH 4ODSL 1U92A 3GSNL 1S7VA 1TMCB 1MCSA 2BNQB 1I9RL 2F5AH 2CRYA 4EUPG 5IW1A 3HR5A 2MKWA 3FQRA 2DLFL 1IL1B 3MLVL 4MSWB 4WNQB 3GSRA 4XT1C 5EC2A 5T33L 2WNGA 5IQ9B 1KUMA 4OQTH 3VXQA 5IV2A 4JFED 1DQLH 1MIML 5SWZE 3EOBB 2ZJSH 2J8UE 1CLCA 3GSVA 4P48A 3K8MA 2OK0H 4Y5XB 3GEWB 5D2NA 1KCRL 2NW3B 1FH5H 2EYSA 5KTEL 4C4KT 4BYHA 4LSRL 5HPOA 4PUBL 1Q9LB 3LHPH 4ZS7L 3L3JB 4JB9L 1G1YA 1NCAL 4XVUC 4CU7A 4PJ5D 4XVJH 1A22B 3FB5A 1P9MA 1RIUL 1ETZA 1S5HB 4OJFH 4MNGA 1EEUA 1ZVSA 1SY6A 4KQ3L 4UT6H 5CKGA 2EKJA 2AQ2A 2RJMA 1LEIB 4PB9L 2RIKA 4LLAA 1MIMH 1IQWL 1U95B 3PIQA 4M9OA 5DZOA 3HG1D 2F54B 3BMWA 3CLFH 3DWTA 4W4OC 5I2IA 5C0BE 1A14H 2PR4H 4PRDB 1DANT 3QUYA 4KK5D 2JJVA 4F33A 5I1EL 3EDKA 4FQXC 1H15B 4R4BB 3MRFA 2ID5A 4HF5L 1WSST 4OKDA 2MCPL 2JLLA 4GO6B 3MRIB 3HTLX 2VLRB 1OGAD 2GYSA 4JREC 2VLLA 1MJJA 1XH3A 1T7XA 4Y2OA 5FDYA 2J4WL 4AJ0A 1K9TA 1FFNB 3RA7H 1NUNB 1NMCC 3SDXA 1QD0A 3ZL4H 3GBLA 3GMRA 3UTSE 3D69A 1BQHG 1KTLB 4NQDE 1EJOL 1VACA 3ET9F 2P49B 3QDHA 4PJ7E 4HGKC 2YBRA 2F58H 4JVPA 4MCZB 5ICYA 1HQ4A 2OTWB 1KB9J 1ERNA 5HHMB 3WKNA 3HRZA 4M7LH 3ZE1F 1X7QA 2JELH 3BE1H 1I9RH 2C7UB 1P4BH 2GK0B 4XWOD 1W0VA 1MFNA 5CJ8A 3ARDB 3DIFB 5CP7A 2ERJB 4QHMB 3QQ9C 3HLAB 4AK1A 1BOGA 2NY4C 4KKAD 4XX1G 4L1DA 4EI5A 4JO1H 5BQ7A 3D0VB 3HNVL 3NTCH 3AREB 3VXPA 5IR1A 3SKOB 3FFDA 4U1MA 3HKFA 3LY6A 4S1QH 2NX5A 4J7RA 4RGNB 4K23L 3TBWA 4KMTH 1A7BA 3VD5A 2KUTA 4JRXA 5F9JB 1YMME 1RJZB 1KLGA 2QQLH 3VXSB 4DKFL 4BQ9A 5F1IB 3U46B 3C5JA 1IAKA 2C3HA 4GRMA 1NMBH 3HFMH 4FQQB 4N5EC 3QQ3A 4UDTA 4ELKB 2ZUQB 1M7IB 4FTVA 3EDJA 1A47A 3ULVH 4KHTL 3IDMB 1MCFA 1QQDB 4NNYB 4IMLB 5D5MB 2I60L 3HE6A 4P23B 2NY3B 1BWWA 4JDTL 3S8WA 1YEFL 3B9KB 4MQXD 5TE7H 2R0ZH 1I3GH 3RWIA 4XNUH 1A14L 2C1OB 1NFDA 2NY6C 2G2RB 4NYLA 4JKPH 4X6FB 3CD4A 1BOYA 5SWQA 4QXTB 4ONOA 2R2HA 5C0CB 1PG7H 4HMEA 4OLUH 2DQFA 3S36L 3VRJB 3SKJL 1KCVH 4JJ5A 3INUH 4X8JB 4GQ9L 1P53A 4APQD 3H9SE 4YXKL 3MLRL 2FNBA 4I0PB 5IW6A 1CFVH 1HH9A 1TQBB 4FFVC 4NM8H 1J1PH 4MJIE 2E7MA 1YEIL 3A67L 5JA9A 4N5UA 1VB9A 3WIIH 1BECA 5HHME 1UWXK 3BWUC 2CRMA 1QBBA 2NY2C 4UV7H 2DWDA 4U4BA 1OTUC 2AXGB 1RQ5A 3L95B 1LD9B 4J2XA 4JPWH 2BXZA 3VGDA 3T1WA 3W5NA 1D6EA 1JJUA 4AZ8A 3VFUA 3WIFA 1PEZA 3VFMB 2H2PD 2XICA 3DSFH 5TDPA 3UZQA 4K94H 4XNXL 3I75B 1QSFA 5JW4N 4I0KA 5FA4B 2HH0H 3TF7C 3D0LA 4RZCA 1HCFX 4IRZL 3AXLA 4JFDA 4LMQE 5C6PB 5I18H 5INCB 1QTYT 3HE6C 3H0TB 5HHVL 1TNMA 4QRSA 4POZD 3RGHA 2E7LA 5EZLA 4OGZA 2XACC 4J3WA 1KTRL 4F9LC 4ERSL 5AUMA 4HHAB 1S9XB 3CSPA 2DLIA 3JUYA 3L7FA 1GGCL 1DVFD 3EYFA 4PG9B 4YAQA 2P5EE 1ZGLM 2VDML 4JFOA 5KJRH 4EOWH 4BSVA 1LNUA 1QKZH 4YK4C 4EDWH 2XN9E 1MPAH 3QI9A 1MJUL 5FYKU 3CXDH 1P4IL 2DM2A 3MOAL 4HWBL 1EHLL 3TCXA 1EERB 2EDYA 1FL3B 4PJ5A 1PD6A 2X4RA 5EN2B 1XF4B 5ESQB 1AD0B 2QSCL 3ZSTA 2O61A 1FGNL 5SWSA 5JW3H 4RCAA 1MI5A 1SY6L 2DQIL 3QEGH 4PJ8D 4LNVA 4AEHL 3NCCB 3S5LA 2HFGL 4RSVA 1T22A 1U91B 3O6FB 5DUPH 4DVRH 4PRNB 3IFNL 1BD2E 1X4XA 2HLAA 5EPMA 3SDXF 4ERSH 3DRQA 3QNZA 3S36H 3LN5A 4TNVF 1SJVA 1KB5A 5CHNB 2EH7L 5D1QB 3TV3H 2AEQH 1W0WA 4GRLB 4XP4L 5B39A 3VD7A 1NLBH 4BFGA 3B2VL 3VE0A 4PV8A 3BP5B 1QO3B 4X98B 2R1WB 4OKVA 4IDLA 5FYLD 1AE6L 4OCYH 2W9LA 3ARZA 5DUBB 5FO7B 2DI8A 1S9YB 4MS8D 5K9JL 3WNOA 1JGUL 3G5VB 4PRHE 4E5XA 5HD8C 1U42A 3L3JA 4E41E 5FKAA 4JPVH 5C0CD 1EXUB 1PQZA 4F15B 1FH5L 2H1PH 2PO6C 3H8NA 3VJ6B 1N6QL 4I8DA 2OL3B 3QPXH 1DEEA 4DGIH 4FQPA 1ONQA 1O7SA 4RGNE 3MOBL 5H94A 3H3PL 4WO4C 3EO0B 3C60C 1LEIA 2WIIA 2V2TA 4BFIB 4RGMC 4P23D 3IRPX 4KJQD 3EOBA 4YC2B 2FB4H 3V6FB 5DFVC 1CGTA 1A1NB 4HS6B 4YHOH 4HMDA 1EDQA 5EBWA 1CQYA 3VXMB 2DAVA 4XZUB 2AKRA 2EDFA 4UOJA 3S96A 3CXHK 3T65A 3G04B 4UUJA 1G7IB 4LCYB 3IJSA 4QTHA 1FFNA 3Q5YA 1U3HC 1BLNB 1FAKT 4RGMB 1F3DH 3NMEA 1G84A 2X1PA 3QXTA 4O4YL 4NZTH 3TT3L 1JYVA 1R5VA 1T0MA 3EYSL 2VH5H 1H3UA 2Y06L 3QB7C 3U7YH 1HQ4B 3BGFB 3IDXH 3PGFL 3QCUH 3TBSA 1CF8H 2A38A 3GM0A 2ERJC 1ZT1B 1EO8L 1F2XK 4FZ8L 2OK0L 5KVFH 5DMGC 5F93C 4Q9RH 2IQ9L 3P77A 4ONHB 1UA6L 1VKXB 2WQRA 3TZVD 2JB5H 5FHBH 1FNEA 4S10A 4BQ8A 2IANE 3HE7C 3H7LA 4NKIH 1NQBA 2E3VA 2Y23A 1IQDA 4F7PB 2Q8AH 5ID0A 3D0VA 2QV2A 3KPSE 3GJEB 1H15A 2I9TB 2FYYB 3C6SB 4BH8B 4Y8AA 5H35B 5CCKL 1MJJB 1LDSA 3HMWL 4DK3A 4NN7C 5DURD 1EMTL 4PJGA 3SJVA 1J1XL 1BQUA 3KNBA 4PJ9C 2QADB 4NKOA 3F12A 4O4YH 1J1OL 5I19H 4PB9H 4H1LG 5FGSA 5GJTL 1VACB 1YJDL 4XWGL 4ORGB 2HA1A 4M00A 4J3VA 1CICB 2BFVH 3BISA 3BFOA 3GSNB 4QRPE 3IJYB 4WVRA 1DVFB 5D6CB 3NZ8A 4NCC2 2A6IA 1Q9WA 1M7IA 3DNKA 4XP9L 2PXYD 3MREB 1X4ZA 4MA8H 1K6QL 3IS0X 4Y7MA 4JR9L 3RWFA 3F5WB 1LEGA 1OT2A 2FJHA 2OZ4H 1A3RL 4P23A 1TZIB 3WDHA 5HYQB 4XVUD 3NCEB 4LPUA 3WEXB 1OARH 1XCTA 3MRCA 4I5BA 3TNNB 4WUUA 3IDGA 2UYLB 3EOTH 4GH7B 4XAWH 2L4OA 1MEXL 3V5DB 3H42H 5SWQB 1RI8A 5C0CA 3MR9A 3G08A 4POYA 5TQ2L 3W11D 2XWTA 4D9QE 3ZE0E 5IBLC 5F7HA 1MRDH 2R56H 4LBEA 2HTLD 1JE6A 2VUYA 3Q6GL 2RR3A 4U0QB 2DD8L 4NNXB 3Q6FB 2AS5M 5C0AB 2VNCA 1BX2A 5JTWA 2P1YA 4Y1AD 5JZ7D 4PUBH 3EYUH 4IRSB 2AJVH 5FEBA 3I2CL 3VXRB 3OG4B 2VDKH 1AQDB 1T4KB 1VFBB 4O5LL 1CZ8H 5EULV 1UH2A 4GG8A 3U6RA 1CLZL 2WWKO 4ODHH 5FHBL 4I2XA 3BGMA 1D6VH 3K74B 3TZVB 4BELD 3EZJB 3E6HB 5DK2B 5HPMB 1DQDL 1MRDL 2CUHA 4PLJD 3S4SB 1N26A 4JJ5B 3FOMA 2UZXB 4QNPE 4URTB 2QJDA 2VR5A 1S8DB 4NQXB 5EZLB 2E6PA 3NA9H 4JZOA 1QSFE 5T5NF 4HHAA 4KKCC 1CE1L 5D7SL 2BNQE 3IFLL 2RB8A 4LCWB 4P4KB 5F7MC 4EI5D 4TPRL 2XZQL 2NY1B 4Z77A 3EYFB 3EJJX 5GS0H 3S5LG 1OD7A 4QEGA 3SKMA 3KWWA 3KXFE 4F37K 2HVJB 2YD1A 2YUWA 3MLYL 5GGRA 5JPMA 1ZGLA 4JFFA 2KPNA 2X70B 1QFWI 4ONGL 4K3JH 2J8UF 3L5WB 1D6EB 4Y0GA 1KJMB 4OZGE 4Y2DB 4G8IB 4Q2ZB 5DJXB 1DBML 5E8EA 3RNKA 4KY1L 1JZ3A 2DF3A 5ISZD 4OCNC 2DYPB 2ZCHH 2GKIA 5DMYA 5D70H 1CL7H 4LRNL 1F3JA 1F90H 1UM4H 1X5YA 3FB7A 3BPNC 5BRZB 4IIQA 3I02B 3QNZB 5EORL 4JFFD 25C8H 3DTXB 4YXLL 1WGOA 3I6LD 1Q94B 3G6JE 2I5YL 1FFRA 4HCRL 1G7JA 3WE6B 3WLWD 1EFXD 1ES0A 1KNOA 3HG1A 4WWKA 3FB6B 3IT8D 2CDEB 2HVKA 1N2RA 1U8PB 4K3JL 2DOCA 4AL8L 2E5EA 5D1QD 4X80L 1JWSA 1QBLL 1RZ7H 2NY6D 1YEJL 1CWVA 4GMTH 4XMKH 1D5XB 1XF4A 1GHFH 5LAXB 2HAZA 2N1KA 4AENB 3WUWA 5IB3B 4TUKL 5LVEA 5B3JE 5CGMA 2GITB 2QR0A 3FO9A 4TVSa 1AR1C 4D2NA 5F7DB 4YBQC 1RHFA 5CZXD 1YPZA 4LGPB 3M1BB 4MLIA 3VCLA 2IG2L 1MSPA 2YK1L 1QPXA 1ZANL 3V6FA 1IGMH 3B3IA 4J3SA 1ZWIA 3C87A 5MERA 3FKUS 4UBDD 3CFBA 4G8FB 2D7OA 4L4VE 3U7WL 5C0FA 3R0MA 1KCUL 3HI6H 2Y4SA 3INUL 3HZKB 3NPSB 2VZOA 4JFZL 1FJ1A 2PUQT 3ARQA 5I0DA 4KI5E 1ZLSH 5ADOL 4YFEA 2OM5A 4FXKB 4QHLA 4GW1B 4NRZA 3K3QA 1NFIA 4MVBC 1T0NB 2IANB 4TTDC 1XR9B 5DYOB 3EAKA 3UP1A 2LU4A 5DFWH 3BUTA 1U95A 3PIQB 2HTKD 5GGTL 3LMJH 1ZVHA 4PB0L 5DO2C 5C09A 5I2IB 4RFEA 1MLCA 1RJYB 1J5OL 4U2YA 2ARWA 5SX5K 5FUZH 3ZDYF 1B4JH 3IXTB 1I8KA 3TBTA 2R2CA 3ULUD 3RAJL 5C92A 5ITFB 3P11L 4WJ5B 1MJ7H 4AM0A 2D2OA 5BRZD 1PZ5A 2VLRA 4GW4A 3Q1SH 2AKRB 3S96B 1XF5B 1S7QB 1AXIB 3PXHA 4I9WD 3RVTD 2DQGL 4U1GB 1G9ML 1I8IA 5T3XL 5TFSH 5L6YH 3TO2B 1Z9SA 5E00B 5M94B 2BY1A 4DW2H 5A43C 2Y1VA 1WITA 2YBRB 4NQEE 5ACLA 5ISZB 4TRPL 3QUZB 3MJ9A 5HYJB 1QNZH 2VLJD 4MJ5B 1HHGB 1W72L 3ES6B 3T2NL 3TBSB 3VXTB 4GG6F 2WINA 5BV7C 2J12B 3S98A 3NZ8B 3FONA 3OKNB 2A9NL 1DQML 2VLRD 3P77B 4ONHA 2EDRA 3MCG1 4GLRH 4NJAH 5CMAB 1G7MB 5T1MB 2GK0A 2X4NA 5EOTA 4NNPL 5CP7B 3EYVB 4RIRB 5F7KC 1KXQE 2XPGA 4U1GC 1WFNA 1JGDA 5IEKB 4EVNB 2Y36H 2ICCA 3AREA 4XP6H 5B8CA 1JWMA 2PN5A 2DLEA 1CR9H 3MRJB 3C6SA 2J3SA 3MBXL 4LSVH 3JV4A 2UYLA 4KTEH 2NX5B 4LASL 4UIKL 4X4XA 4ORZC 5HHMD 3TBYB 5I8CA 1LO2H 3PV7A 3G08B 5LQBH 2I27N 4GRWE 1OLLA 4PJ9D 4NKMB 5D9SA 5HVHC 2NY2B 4LSTH 1H3WM 3ZKQD 5I18L 3CUPA 3H2WA 4R90L 4ZFZB 2R0KH 3M17A 4R26L 1RU9L 1FHGA 5HHXH 2ORBL 1XF2A 2IALA 1AO7E 3CMOH 3QCTL 2APWA 1BX2B 2VKXA 4PD4K 4WO4D 4AIOA 5FF6B 3NCYS 1D9KB 1H3TA 1WWAX 4PJDB 1X3DA 1M71A 3QO1B 3T0DA 5E8PA 1QQDA 2PTUA 1UXWA 5L9DL 6FABL 3WCYA 4QY8A 35C8H 4LLMB 1EEYB 3QUYD 1TVHB 1L4IA 3LEYL 4AYFA 3CIQA 3CSBA 4JFDE 2Z31D 1UWEH 1UJ3C 3IDGB 5LKNA 1QSEA 1CGVA 1MVUA 3DUUB 1AGFA 2UZYB 4UV4H 5BMFH 5LQBL 3IDJA 1WJ3A 5IQ7H 3TH3T 1G9NC 2YKLH 1WT5A 3KJ6H 2UY7A 3OKEA 3FO1A 2FB4L 1EBPA 5D1XB 5LG1A 3G5YB 2C3WA 2J6EA 4H8WH 5TF0A 2NZ9C 1AFVH 5J0BA 2HFFA 4DKAA 1GXEA 1MWAH 2F15A 4JZOB 4JPKH 2CJUH 2LTQC 4UIMB 4C83A 2B4CC 4GS7B 4U0RB 1FL6A 3WSQH 5E4IA 1AGCB 1VGEL 4J8RB 5BW7C 4FRWA 3CPLA 2CMRL 3T8XB 2A9NH 1M05B 2AGJL 1WBZB 5FO9B 1TENA 2GUOA 3GJFB 1U0QA 3UJTH 4LDOB 1WVZA 2ENYA 2X70A 3NCFB 4I2XB 3BXNA 2XNAB 1A1OA 2VE6A 4O2CA 2YN3A 1UXSB 1BEYH 5FV2A 3VMNA 3W9DB 3QJFB 2BSSB 3QAZC 4XNMB 2PW1A 2VMFA 3OKOA 1JRHH 4NUGH 4CL7A 1IBGL 1G7QA 1JPGB 4YXHH 5FAAA 2OS7A 3O0RH 1NCDH 3QQ9D 4OV5A 5D96C 5AZEL 4LKCA 2UWEA 3MRRB 4OZGA 4M7KH 5F96L 2CKBB 1UB5A 5KVGL 3RX8A 4Z7OF 2PYEB 3SGJC 4QWWC 4HK3N 5F7UA 3P0YH 4AIZA 5JOFB 4YX2L 4L3AA 4LCWA 4P4KA 3TFKC 4Z77B 3C5ZA 3BVNB 3PWLB 1SJHA 3MLPA 1ES0B 4RFNC 4D9QD 3P9LA 5F7FA 2XZCL 3F8UB 4U1LA 2JJWA 4LCCA 4UTAL 4W68A 4OB5H 3MBED 2IBBA 4XWGH 1FC2D 1MQ8A 4G6AD 4JFFB 2ZJSL 4PJCE 1A7PL 3N9GH 1XGPA 1NFKA 4M8QB 5T1KA 3RU8L 1Q8MA 2BJMH 3EYOB 3HMXH 4ESKA 2W65A 1YEGH 3W0WE 2R0WH 4F9PA 1YYMH 4X7TA 3ME0A 1MFAH 4LGRB 3MCLH 5IB2A 4YDLB 3G6DL 4Z78A 4H88H 1SEBB 3VA2C 1MCBA 3MBEC 3O3BA 5C0EA 1JHLH 2NQCA 8CGTA 2I24N 5L88L 4MAYD 1KB5B 5DQJB 1N6UA 2ED7A 4WCYL 5DJDB 4PGBA 4OM0L 5E4EB 4I0CC 4H8WL 4NJ9H 3B3IB 1HDMB 3GZKA 4PTTA 3VDCA 1ZWIB 1WAAF 5MENE 3F58H 4OZFH 5FO8A 2F5BH 2C3VB 1EEZB 2XWJB 3ZLQC 1NLDL 1CN4A 1Q0XL 4DOHE 2DYPD 3SQOH 4HZLB 2CD0A 1S9YA 2VDLH 5DD1L 1F11A 2B1AL 2X2YA 1WQVT 2OXHA 3MV01 2DD8H 3C2SA 5JUEH 5TJWK 4Y89A 1KOAA 4UINH 1FNSL 4J3XA 1IGYB 3KPSD 3NCBB 1G6RB 1EXUA 4JZJC 5LAXA 3T2PA 4K7PX 4JANB 5KVDL 3ALWA 4AENA 2EXYD 4M43L 2IANA 2YSSA 1A6TB 4LCUA 4LVEA 1JFQH 3GMOB 1OF2A 4IS6A 2LVCA 5I9QB 5DT1L 4BFIA 4MDJA 2X9WA 3VCLB 1JUFB 2B4CL 3VRLF 2OTUB 1T21A 4WEBL 1V7NH 4QHUB 1G9EA 4ONFH 2R4RH 3LZFL 2FEEL 2IMMA 4RFOH 1S9WB 4NC1E 1IC1A 1LDPL 3MLRH 3VXMA 4U1SB 4XZUA 2JJTA 3MGTB 1CDUA 2CKNA 5EU7E 5IFHL 3DX9B 3EDEA 4LARH 3T65B 4K3DL 1KIQB 1U2HA 2ZOLA 5IVXF 5IUSA 4C55A 4U1JA 3RHWF 2ZKHL 1IEAA 2V17H 2C5DC 3SDDD 3RZCA 1NFIB 2J7LA 4CNIB 4IOFD 4BZYA 4YPGB 3VFRA 3OKNA 5D5ME 3SDCB 2XY1A 5DWUL 5I1AA 5F7NC 1KV3A 3WHXB 2WBJA 1MFAL 4GW5A 3UBXG 1X5KA 1MHHB 2V6HA 3OKLA 4IRZH 3O8XA 5C09B 1G7LA 2ZCKH 4POZC 1U36A 5I1GL 2XPGB 3MC0A 5DJ6A 3GHBL 4FNLL 1X6NA 5DSCB 2H41A 2EKSB 1JGDB 5IEKA 3TO4B 3ZT5A 4HDIA 3QUXB 4ZSOE 1BZ7A 1MY5A 4L1HA 1LO0L 3G6JB 4KHTH 4X4XB 2SEBA 5D7IE 2X05A 1KCSH 1I75A 4P2RA 4BJLA 5MENB 3I85A 4ZFGH 4KJWD 1Y0LA 3TPKA 1F6FB 3MMEB 4LCIL 1HYSD 3ECBB 4KZDL 2YD6A 5I1HH 5MI0B 4KUZH 2G5BA 3KDMA 4KTEL 4LASH 1FNSH 3BYTA 1JZ8A 4NHCL 1WZKA 1PG7L 2O5XL 1RUAL 2H3NB 1MLBA 3AB0C 2RAMA 5CMAA 2MCG1 3NAAL 4PJAB 1KCVL 3CFCL 2H2SD 1K8IA 2O26U 1KTDA 1HK6A 2BNUB 2FJHB 4HKBB 3SKNA 1X4YA 4JDZA 2WLYA 1NGXB 4L5FH 3OSKA 5TE6H 2CDFA 4E41B 2F8XC 4FQCL 2B39A 3MZTA 1AGEA 3EDDA 3O8XD 4N8PA 3JV4B 1MVUB 4PJBF 2G9HB 2HKHL 6FABH 4X7DC 3ZKMC 4TQEH 3NABH 1J87A 4LBEB 3B6SB 5DMKB 2ZP0T 1QSVA 1U8NB 5DHYB 1HWHB 3AU1A 1KIRB 3U83A 2ZKHH 5K33A 3CFIC 3CVIL 5JW4R 4PJDA 3EJZC 4TTGA 1N5YL 1R3IH 4IRSA 5AG8A 3VGHA 3CPLB 3X11B 1XF3B 3O41A 3UTZA 2XFXA 4IMKC 1N5AA 3LAFA 3RHWK 1KIPB 4V1DE 4PJ7A 1CLYH 4G42B 5JQ6L 3ULUC 5GGQH 2FECI 5I1GH 2XNAA 4X80H 3U36A 1QSEB 5J1TC 3IFOA 2KL6A 1B0GA 3L5XH 1WAAA 3VFGH 4GBXC 1EMTH 1XIWD 3O3DB 3BZFA 2FO1A 1TPXC 3MXVL 4K8RC 3SJVD 3QQNA 5J89A 1I8MA 3S3SA 3FO1B 5ANMA 1IM9D 3MRRA 4OZGB 4ZXBB 3PABA 1L6XA 3GMLB 2Q86B 4R6UA 3OF6A 1MF2L 5E7BA 2FRGP 1BREA 1PEWA 4F58H 3VI3F 2JJSA 1IBGH 1JZ6A 2Y07L 2YPLB 4R4FL 3C5ZB 1L9MA 4ZUWB 5FA3B 5TF1L 2AV1B 3QG7H 1VADB 5JDJA 4NO5A 1BD2A 4G9FD 3J8F7 1ZLWH 4G3YH 3DBXB 1YECH 4WI3A 4YR6A 1HE7A 2WBKA 2J6EL 1GVIA 3BDXA 4OI8A 3B2VH 3C60A 2CR3A 2DLTA 5AYUL 4Z7UA 1GGIH 1AE6H 1IZJA 1OCWH 5IVZA 2J88L 3SDCD 2BMKA 4H25B 3QNYB 1C7TA 1Q9KB 4YDVB 4JFYB 1A7PH 2X09A 3I50H 3O8XC 1A9EA 1B2WL 1BIHA 1CE6A 3VFWA 5HGAA 2WLZA 2B5IC 3P0VH 5CBAB 1R3KB 1FFOA 4X5XB 4G80A 1RZKL 4OIIL 1WT5C 5I0ZA 3UPRB 1BZQK 2EDJA 5C2BH 4Z8FL 3VXOB 1I7RB 4FMFA 4K7FB 4N0RA 2APFA 1HWGB 4MMZC 4MNQB 5HVFB 2C3VA 2VXUH 1I9JL 3RVUC 3D39B 1J86A 1CYGA 3CVIH 3JWOH 1A7NH 1N2RB 3OAUL 4QOKB 5HGDA 4RWYH 4QRQB 5KTEH 5D8JL 3TVMA 5IF0B 4OM0H 4CN1A 2LQRA 2YR3A 5HHXL 4O9HH 1IM9A 1X9QA 5F21B 3PQYB 1ZMYA 3H9HA 3MGOB 3LKSB 3LS5H 4OAWB 2R69L 4OI9A 5D2NC 5EZOL 3WIHL 1KLUB 5DJCA 4BSWB 2GSIB 2J2ZA 3SE4A 2GITA 2QR0B 3VGGA 3BPLC 2DTMH 4TUJA 1LK2A 5DDHA 4IS6B 3FAWA 4UT6L 4NM4L 1INEH 2KDGA 3KPSB 3M1BA 1QHPA 4FABH 4X0KA 4BQCA 4KK5C 1ZTXH 3FHAA 5EC1B 4X8XA 1OSZB 4ODTH 1I1FB 1S78C 1V7ML 3KYKH 3Q6GH 1A6UL 1H8OA 5C0IA 4Y5XA 5E08H 2DBJA 3HB3D 4QLRA 3L3IB 1ED3B 5KANI 4JG0L 1P6AB 2FL5B 3QDMB 2XWJA 5HYIA 3EO9H 1YY8B 4CAGA 4QYOB 3ARDD 3V4PL 1H8SA 4X7SL 1PY4A 3LPFA 1P2CA 4ONFL 4M5ZL 4U1JB 3QIWA 3DI2B 3VI4F 5IHZB 4X4ZA 5T1LD 4LVOB 5F1OB 4FTVE 2N56A 5ACMA 4HXAH 4JANA 2FBOJ 1T0NA 1NH6A 3QH3A 4L3ED 5AZ2H 1CDIA 1E4JA 3ZT6A 4YPGA 1ITCA 2VXSH 1J9CT 3FQXB 5FHAL 5KG9A 2AXFB 4XBGB 3ARGD 4PJCB 4XP5L 3V4VL 2WUBL 3ZKSD 1L0YA 5CJOH 4OGYL 3CSGA 1WZ1L 2FEEI 4ZO8A 2EO1A 1TZGL 4HC1L 2VSDA 1FE8L 1ZA6A 3HNVH 3TIDB 4U1SA 1U8IA 3QQ4B 3T1FB 3DPBA 3DX9A 4G6AC 3CLEH 5HDBE 2X4QA 1RZ7L 4PY7A 3EFDH 5C0AE 1NEZG 2BVEA 2ATPB 1KJ3L 2YRLA 1OAYL 2P47B 3R1GL 5ISZA 4NO3B 4WUUE 2QL1A 1PVHA 5K93A 5GZND 3AY4C 1INDL 1BVKA 4RMUA 5I1LB 3KPNA 2HT3C 4G6FD 3QR2A 2HWZL 2C7UA 1UQSA 2NW3A 3ARPA 2X4NB 1RMFH 2ZCHL 1FZMB 4YO0B 4PJEE 1RZ8A 1LHZA 5GS3A 3WFBL 1NGXA 2BJML 3REWB 3H9SB 5IHLB 3GK8L 4IRSC 5AWNL 3RDTD 4KGJA 3KLHD 1DQLL 1BZ7B 3B9KD 5EFIA 1S5HA 25C8L 3G6JA 3LV3B 1R3LA 2WBWB 2OTPA 4MQ7B 2EYRB 1I1AC 5F88B 3TYGL 3TBWB 4WFEE 1LE5B 3FFCD 1WTGT 4YNYA 4CADA 5I71C 1WBYB 1JNNH 2ZUYA 3P4NA 3LIZH 3I3EA 4ENEC 3DURB 1JPSH 4RDQF 1S7RA 1QR4A 2DQCL 1UFUA 1CI5A 4ZOEA 4FFVD 4KQ4L 4ELKA 3IFPB 3SPVA 3SQOL 43C9B 2HKFL 3X3FL 3AMLA 2N7AA 5DD5H 1XGUA 1FSKB 2W59A 2BVTA 4PJFE 1MFBH 4D0DA 1UXWB 3SE3C 4GG6A 2ICWB 3FJTA 4JRWA 4FQIH 2C4XA 3UTZB 2XZAH 5D1ZB 3WIIL 4LPYA 2OR7A 5CUSH 1IT9H 1QLRB 1TVHA 5SWSE 2GI7A 3RAJH 1CTNA 1WBXA 4YC2C 5J1AA 4M7JL 1HI6B 2NY4B 2FIKB 3RU8H 5LGJA 1DVFC 2YK1H 4UDUA 3KXFA 2FJFB 5HHOA 5IB1A 1NMAH 5IOPA 1KBGH 1YYML 3BESR 4BH7A 1NDGB 2C1PB 3U82B 3OKEB 4LF3A 4LCWE 1QR1B 1HXMB 3ARDA 3DIFA 3GKWH 4MWFA 3QWRA 32C2B 4DKDC 5C0DB 2Q86A 1U8HA 5HHVH 1DBBL 3FO0L 1N4XL 3L5XL 4L5FL 2VLKB 4C83B 1MCJA 4PRAA 3SKOA 4XC1H 3UTQB 4U1MB 4ODHL 4FQ2H 3X3FH 3I9GL 2RCSH 4KK8D 4J8RA 1REIA 4K2UL 3T0BA 5I6XC 2I60H 4S0TD 1EGJH 3LKOA 2EIZB 3AS2A 5J12B 3EW3B 1FNFA 1F6LL 1OGTB 4LSQH 5GRJH 2M8XA 5TPWL 4H8WC 4Z0BH 1PKOA 4PJ7B 1KLGB 5KS9F 3MBXH 5SWZA 1J0IA 1IAKB 4PRHD 2NY1C 4DFHA 5IMMB 3FRPG 4G6KH 1G7QB 2BMKB 1QVOA 1ZT4A 3LN4B 2VLRE 5DFTA 4JY4B 1FDLL 4N0FA 2D9QB 3TBVB 4XCEA 2FBJH 3ULUF 2D7NA 4XCNA 1QA9B 5HGAB 5CBAA 1OAUL 4D0CB 4Q6IB 1G9MH 1GHFL 4JY6A 1QEWA 3MRGA 1DBKL 4OD2B 3B9KA 3L1OL 5DVNA 3V8OA 2PW2A 2G2RA 4TUOB 3ZT7A 2DKMA 4I9WE 1S5IH 4KQ4H 3OJMB 1JBJA 4OIIH 3O45A 2GTZA 1F90L 3VFSA 2WBJC 5HGBA 1C12A 2O5XH 3UDWC 2QKIA 1MQKH 1BWMA 4JREB 4PRBA 4NO2A 2X4SA 5KSAB 1FVDB 4PGDB 2HH0L 5EIVA 5K59F 3R4DA 5IIEA 1RV6X 1Z3GL 4X7TB 5F9OL 2RFXA 5J6GA 3DX8A 3QDJD 1LK2B 3VGAB 2VZUA 4M5YL 3RGVA 2V5SA 1CXLA 3ZHLA 3K2UH 3PL6D 1AO7D 2NY0D 1JI1A 3X13B 2DWDB 3L3DA 3EKCA 2AXGA 2CQVA 1GGCH 3BP5A 4UT7L 1INQA 2BSTB 2NR6C 4XCCH 4N1EA 5KJRL 1QSFB 1CFVL 4FG6D 3IDYC 4HZLA 4HJJH 1ORSB 4PB0H 4RZCB 5I19L 3VRIB 2VLKD 4OM1L 1GH7A 1ORQA 1F97A 2YC1A 3HE7D 3ULVE 4KXZI 4ZNEE 1H3XA 3LKSA 1MHEB 5TPWH 4J3UA 1NL0L 2Q3ZA 4OAWA 4IOIB 2BK8A 3L7FB 3QIWD 5DJCB 4XNYH 2YSSB 3V6OA 3FB8B 5J3HC 2VERN 4A6YL 5JZ7C 1OWRM 1A2YA 3EO0A 4GKZA 2A0LC 4MDJB 2CKBH 1FL5A 3QISA 3FRPA 5CGYC 1OB1B 2AEQL 1QFHA 5J6HB 5IBTL 3QI9B 1UEYA 5FKPA 4BKLA 2VXSL 1NC4A 1LP9E 4PRIB 4HSQA 2K7PA 3DO7A 2YPLE 1MI5B 1YY8A 1N0LA 4I77L 5CP3A 4QYOA 5I8KH 3MRLA 1G7IA 1AIFB 4LCYA 1ZS8B 4NUJA 2VDMH 4MJ2A 1UZ6E 3VG9C 5LBSH 4HJ0C 2ITDB 5FIEA 5SWSD 2AP2A 4ZUSB 2BVUA 4XPHL 3F65A 1FCGA 4C56A 5H8DA 1OAZL 2H6PB 2Y7QB 4ETQB 1TJGL 1IVLA 3VI4E 3EO1B 4KV5E 2HJLB 3W11C 1YMMB 1SY6H 4OLVH 5ISZE 2DM4A 3EO9L 1KGCD 3PXJA 1MCOH 2G75B 4HQQL 4CJ1A 4Z7WA 5DJ6B 4X5WB 2GJJA 3OX8B 3CDYA 2P44B 4ZFFA 2D03H 1CGXA 1PQZB 4HUUA 3KLSA 3QQ4A 5I1JL 3CH1A 2ADFL 4G7VL 1N59B 1NCWL 5ERWB 4LGSB 3B8SA 5EZIH 4KK6D 1CU4L 3EFFA 5DQ9A 3MV7B 2WP3O 2ED8A 4NZTL 1GPOH 1KEMH 3RL2A 3BZDA 5J57B 1QSFD 2JCCA 2X10A 1IAIL 1UKSA 5D2LB 3U1SL 3F6LA 1T66D 5D6CA 3ROOA 3U79A 1JHKL 5DRZB 4QHNA 4YBHA 3NACL 4PJXF 1TZGH 4RWYL 4EDXB 1OM3L 1J12A 3EDFA 4NN6B 4KK9D 1G7PB 3RWHB 3BPOB 3CU1A 2ICWA 4JDZB 3PJSA 5GZOD 4JEGB 3JZ7A 4UU9A 5HYQA 4LSPH 1AC6A 1F4YH 5KSAD 2H26A 1AGEB 1XCTB 3MRCB 4HIJA 1Y18A 4WI6A 1TZHB 4GAJL 5CCKH 2W0PA 5A3ID 5CEYA 1JGLL 3CFJA 1QLFA 2DQTL 3RWGB 4ZUVA 5IB1B 1LK3L 5JR1H 5EOCH 4HWBA 5DJYA 1AJ7L 3O3EB 4R4NC 2P42B 1J0JA 1QRNE 3SDDC 1NAKH 2EEBA 3L7EA 3NFSL 1CK0L 1KCRH 4PRAB 2VXQL 3UTQA 1Z9MA 2FYYA 4FZEH 1S7WA 4OFKA 15C8H 4BH8A 5F72S 3IDXL 3PGFH 3LKOB 1AQDA 1T4KA 1EFQA 5IVXB 4Q9QL 4KTYA 5CJXA 2XXCB 2HT4D 1DJSA 3FMGL 4G42A 4WI7A 1IARB 3PHQB 1AI1H 5DJ0B 1ZLUH 3MA9L 2IFGA 1HI6A 2AJYH 2X7LA 3QEUB 1EFXB 4PP2B 3RFZC 5JW5B 4Z5RB 2DM3A 2R69H 2A6IB 3GIZL 5IOPB 2CLVA 3VXME 4NZRH 4QOKE 1T03L 5F89A 2R56L 4X6CE 4TOYH 1WISA 4MDIB 4LF3B 1NGZB 3PWVB 1EA9C 3DXAA 3I3BA 5CBEA 3G5XA 1S8DA 2EDXA 5JHLL 4YGVA 1QA9A 3NFPA 4Q6IA 3O2WL 2VLKA 1E6JH 3L3OB 1KCLA 3MV7D 3NAAH 5FGBA 5HYJE 4HT1H 4JM4L 4FHBD 5DHVH 4OFYD 1A6AA 1F4AA 1NCCL 5D1XD 2GY5A 1ZT7B 4KVCH 1RUKH 5ADOH 4LAQL 5J4MA 4WV1C 3MRKA 5EOQH 1EHXA 2F58L 3T0WA 1WWCA 4H0IA 1TVDA 3QIUA 1EVTC 5SWZB 3SGEH 3RGVD 1MAKA 1T04B 4HGMA 2X4SB 3O6KH 1OWWA 1AY1H 5LWYH 1E6OL 5IIEB 1IAIM 1QVOB 3ZHKA 3LH2L 4KJPC 3T4YB 4YDVA 4NRXB 3GSOB 4GXUM 1LO0H 3TBVA 1FRGH 4HUXB 4QXGL 1KJ2L 3MJGX 3O9WD 5BRZA 1B4JL 3QO0B 5F7LB 4FOMA 1QEWB 1JV5A 3MRGB 4GG8B 4JO2H 4LCCC 4LL9A 1I7RA 4KZDH 2PW2B 1TDQA 5IEHB 4K7FA 5CZVL 1IM3B 3U4BL 2J1KA 4MVBD 4TUOA 5FYLL 3MFFA 3TZVA 1INQB 1RURH 3EZ8A 3QDJB 2A74A 2J8OA 1FNGB 5HGDB 5E70A 2AEIT 3TPUB 2RGSA 2AJ3A 4MA7H 3TVMB 3RTQA 1IZKA 1XAUA 5B39G 1NMBL 2FBJL 4GFTB 5KZCB 3O4OC 2P7TB 1D5XA 1GZQB 5DHVA 2E8ZA 3CCHB 4XI5C 4ACPA 3SQBA 4KPHH 2O5YH 2RFXB 4CDHA 4G7YH 2DBLH 3FB8A 4U49A 2CK2A 3O6LH 1IGTB 2P5EA 3N0PB 4B7IA 2EZ0D 1BBDL 3HI1B 3X12A 2NNAA 5KANG 5E0QA 1RMFL 1ZGLB 1AP2B 3WN5B 2XN9A 2UZIL 2VLJE 1HSBA 5GS2D 4YUEL 1OPGH 3SDAD 2Z35B 4BKLB 5MERB 5FUZL 4XI5D 3MPCA 3RNKB 2Z91B 3H7BA 3OBAA 2FECL 2VZVA 4YQXH 5C0JA 1KCKA 2ZCLH 2P45B 3K8LA 2VITB 4APQA 3V4UH 4XMKL 2IBGA 2O5ZL 4F7EA 1HEZA 1A7OH 2HRPH 1JGEA 1I9IL 2FJGA 1IC5L 1FYTA 3B5HA 1BF8A 2ZNXA 1PJ9A 4IOIA 1Q94A 3E3QC 2NX5D 3QUZD 5DYOA 3T2NH 2DI7A 3RY5A 3T3ME 1QBMH 5LWYL 1CD1B 2AABH 3QCVL 3KPLB 5ICXA 4OZHB 1P7QB 2CDEA 2HVKB 3O11A 4U1IA 4HUWA 4XBGA 3PE9A 2GJ6A 4RFEB 2P8LA 3PP4H 3Q2CA 2CR6A 4WO4A 1CF8L 3PWPA 3FTGB 5DHXB 4EN3A 1FZKB 3SDCC 3IVKA 5L7XL 3T3PF 1U8IB 2CO6B 2VR4A 4PBWD 4BQ6A 5IB3A 5ABDE 4GSDL 1XGRB 5IJKA 3NBNA 1ZGLP 3NFNA 3V4UL 3HS0B 4TYUA 1R3HA 4LEXL 2BVOA 4NWUH 1D5BA 4TSBH 4LHUG 5FUOL 4MA7L 1N64L 5GS0D 1H0DB 3BKJL 2X1XR 1LO5B 3ES6A 3LQZB 2EDEA 1N7MH 3VXTA 3ARVA 3TM6A 4F2MB 5JXEC 5GGUB 1UQSB 5EA0L 1IGJA 1F4XL 4NFDA 4IJ3B 4LVNC 5C0FB 4OQTL 1FZMA 4M1GH 3HZKA 5HVGB 1RZ8B 3QDMD 4HGWA 2FHBA 3FT4A 4Y5XC 4UU9B 1D7FA 3PHOA 4ZUUB 5T3ZL 1KYOK 4LCIH 3RVXC 3AB0B 5ADPL 1R3LB 3LV3A 4YHPA 4Y4FC 3TH2T 1N59A 4BZ1L 2UWEE 3V4PH 2AEPH 2ICEB 1GRWA 4UNUA 2A77H 3IS1X 4ISVB 4KRPC 1NCAH 4PJHE 4P99A 3OAUH 4GRWH 4IRJB 1TLKA 2R2BA 4LLUA 5FK9A 4PJFF 1NBYA 5D2LA 3H9SD 4ZTOL 2OL3H 5FDWB 4IHOA 3TA3C 4DGVH 2R39A 5HI5D 2HG5A 4K7PL 3UTSA 4GW4B 5IBUG 5C71A 4KKLC 4Q6YA 2R8SL 4L4TE 4D9RD 5MP6L 4DKEL 1OD9A 2KKQA 4CGTA 4QGTA 5GSRA 1IGCH 4QY8B 4XMLL 3SDAB 3WUWG 1HHJB 3P73A 3SDXB 5BXFA 2AJZA 3L9RA 2W91A 4P9HH 2VYRE 4OLYH 5CJQH 3RL1B 5C08B 3GRWL 3WDJA 3QUZA 5C09E 4DCQB 1GL4B 2ZPKH 2X7LB 4HWBH 3MOAH 3QEUA 1FPTH 5CEYB 2PCPB 2E8YA 5JW5A 4Z5RA 1VHPA 3OKYA 4JGUA 2CLVB 2VL5B 3IJHA 3BKCL 4JVUA 5D93C 1KENH 4XCFH 1TETH 1QR1A 1MCEA 3C08L 4LSDA 1WTLA 32C2A 4JFQB 1QFPA 5HGHA 2XG4A 5J56B 5BQ7B 4JQIL 1GYAA 2EZ0C 2B5IB 4JFEE 2IAMB 5C8JA 1T03H 7FABH 1P4BL 1B2WH 1MH5B 2VZSA 3A6BL 1IC7H 2AK4A 2HJKA 3OR7B 2E7LC 4NKMA 4WU7B 3MBEB 3ARBD 4OQ1A 4CBPA 3JTTA 3N1FC 4XC3H 5EZJB 1EPFA 5D7IF 5HY9A 5GS0L 1LEKB 1AGBA 4XNMA 2PW1B 2BSED 1D5MB 4TULH 1ZT4B 3LN4A 1ND0B 2CUIA 2VUOA 5FF6A 1D9KA 3DYMA 1ZA3A 1RZJL 3MJ8B 2BNRD 5L0QB 1U3HA 5MEPB 3G6DH 1FGVL 2X4UB 2D4FA 4Y4HD 2Q8AL 1M4KA 1R5WA 3HZYA 1JHLL 2N7BA 3GIVA 3VFTA 3OKKB 5E1AA 1HOCA 1NFDB 5B4MC 4AQ1B 1OTSD 1AKJB 5EBMB 3MV8D 1CDCA 4FQIL 3VXUA 1TPXB 2FO4B 3AS1A 4WI4A 2CXGA 3K46A 3KPRE 4MNHB 2CK0L 5C0RH 4NRYB 1FC1A 5T3ZE 2FR4A 5CZVH 1G6RH 5FCUH 3EYOA 1VCAA 3C09C 4PJBE 3NCMA 2AK1H 5IW6B 1E6JL 4XPHH 4LFHG 3GSOA 1I3UA 3AM8A 1HKLL 4DFIA 4UV4L 4TPRH 1OP9A 3STZA 5JW4Q 2ZG3A 4ZPVA 5E6IA 2IPUG 3D1MC 5LCVH 5GS1B 1P4LA 5DC4B 3MQIA 4RNRA 4D94A 1CFQA 1T2QL 1N8ZB 4QRRE 1IM3A 43CAA 4P2RE 1K2DB 2WBJD 3EHBC 3VFMA 3FN0L 3LZFH 2Z91A 3VFNA 3KYNA 1U8MB 4JN2B 1ZHKB 1MCWW 1OQXA 2AJSH 2VAJA 1MRFL 1ORQB 3SN6N 4L3EA 4ZOAA 5F6HJ 1NBZA 4FFYH 4APQB 5BV7H 1QZ1A 3O9WB 5B38B 1UACL 1YQVH 3F7VA 4CDGC 5J9PA 1G6RA 1HEZB 1IFHH 3HR6A 3HPLB 4OZHE 2B0SL 3MX0A 3PGDB 4NBZB 3DMMC 3SDAC 2EXWD 5FOBB 3P9MB 2X42A 3GMOA 3S88H 4JM2D 5CILH 6CGTA 1M6OB 3BEVB 2X6MA 4JRYA 4JFOB 4C4KO 5CJ5A 3CZFA 3HI1A 4NQDB 4L3CB 4XNQB 4JY5L 5J6HA 3WN5A 4NC1C 4KROC 4F7MA 3P40A 1DSFL 3QG6B 4RGOL 3W2DH 4RA0C 4QHKJ 4JB9H 1NC2A 3FTGA 4Q0XH 1Y6KR 2X4RB 5ESQA 2O61B 3SO3B 4F3FA 3EJYC 3GM8A 2XTJD 2AI0L 1RIUH 3MNZA 4NQCA 2LE9A 1OHQA 5IB2B 5E4EC 1B88A 3BPLB 4KPHL 1C16A 1EO5A 2Q87A 1UWXH 2VL4A 5E99H 5KAQG 1T22B 1IFHL 3M8OL 1D5BB 1A7QH 3LN5B 4NZUH 2FJGB 4KV5F 4OZIF 4WHYG 5DJDA 3SDYL 3W39A 2W07A 3UO1H 3VE0B 5L8KB 2ARJQ 4F2MA 3VFRB 1QO3A 1XEDA 5TQ0H 4X98A 1CXHA 5GGUA 1BM3H 1C5DB 1G0XA 2MCPH 2H8PA 2G75A 1G7LB 3DGCR 5HYSB 3CLEL 4K7PY 4P5TD 3EGSB 4Q0XL 1U8LA 4LP5A 1N7ML 3MLZL 4LQFH 5DRNB 2UVFA 3QUXA 1CZ8L 2DDQL 1JYWA 3QDGE 3IVKB 1S7TB 2GTWB 4HJJL 3OKDA 1BZ9B 4CVXB 4Y5YA 3CXHJ 1T20A 3NFNB 5HVWA 3QFJE 3HN3A 5EUKB 4B50A 1YY9C 3U0TB 4XP1L 3MODL 3VGBA 3KVQA 1MCHA 3GSVB 4GRLD 3F7QA 1H9VA 4NQVB 1I1AB 4J4PA 5FDWA 4IHOB 1K8DA 3NA9L 3MLSH 1KPVB 4GRWB 1A4KB 3QG7L 3SDXE 1XIWB 3PNWB 1K5NB 3GMPA 3DV6B 2ITCA 2DQEH 5F9WB 4UILH 1KTDB 4MA1B 5DJ2B 3QA3B 2XQBH 5EO1B 4IOSD 5EU3A 3IKCA 2YA1A 4MZ2A 3L9RB 2BNRA 1CTOA 3ULVC 5AAMA 1Y18B 5KS9E 1FP5A 1MHCB 2MOVA 1CGWA 1UEMA 1U2CA 4OCLC 1XZ0B 2PCPA 1VGKB 2E7CA 3T0EE 3PQYD 2JTDA 4XMLH 2AI0H 4H5SB 1UYWH 3SGKC 4K3GA 4XVSL 5HDOA 2WP3T 3O3EA 4QNPF 4YHLL 4U1HB 2WK2A 1FZOB 5FK9B 5F7EH 4QCIB 4ZNEA 3MRPA 4WI8A 4U6YA 5DGRA 3GJEA 1NCNA 3WO4C 2I9TA 3MRHB 4LLYB 5BZDB 3KJ4C 3MRIA 4M7JH 4HK0B 2H2PC 2K3TA 3ILQC 3V6OE 2EE9A 3V9FA 3VH8G 2AK4B 2XFXB 5TF1H 1TCRA 4NKOB 4U1NA 1KIPA 3GI8L 1VDGA 5DRWA 1QFWL 2CKBL 2DQDH 1O0VA 1YQ2A 5JO5B 2IEPA 4MCZA 3ZTNH 4R90H 3IFOB 5I1JH 3HC0B 4MXVF 2ZUVA 3STLA 5JMOC 1BFOA 4YXKH 4DAGH 3MJ9L 1CGUA 1LEKA 3V7AG 5IT2L 4JM2B 3MREA 2XQYK 3RX7A 3WYRA 1NGZA 3UJIH 2B1HH 1CGSH 1TVBA 1K8IB 2GEEA 3HNSL 1YJDH 2V7HA 3CK0L 1E4XI 3QHTC 4TVPD 3AAZA 2KQMA 3QHZL 1FIGL 1TJHH 4UTBH 4PGJA 1Z3GH 3FFDB 4JG1H 2NCMA 5C8JB 4TSCL 1QOKA 3NIFE 5GRYA 5AEAA 4ZUTB 3V5DA 4F7TA 4ZUWA 1DUZB 3L3KB 1HSAA 1RUAH 4NO5B 3QNXB 2VXVL 3RNQA 4JRXB 1KPUB 5IHBA 3FO2A 2W0KA 5ECJE 1AR2A 3CFKB 4RISL 1CDGA 2YKLL 3VXSA 1C7SA 3QIUB 3MLWH 1T04A 3MJ9H 5CLTA 5L2JB 4YZFE 3QXAB 3G9AB 4W4OA 1T89C 4KI5C 5FHAH 4PJXB 3LS5L 3DSNA 2EDOA 1OAQL 1AQKL 1ND0A 5D72H 3UEZA 4YFDB 4RMRA 3UZVB 3TJEL 5FYJE 5EOCL 1FYHB 5E94B 5K9JH 1MAMH 3IDMA 5EU4B 1S5IL 2IF7A 5C6TL 3VXRA 4ZQKA 5T3ZH 4PRHB 5L2KA 3PWUB 4YHKL 3KGRA 3CSYA 4WHCA 3BQUD 2Z8RA 4NQSB 5LGHH 2Q20A 3OKKA 1HOCB 4KDTC 3RJDA 43CAB 2EDQA 4XPGL 4ALAH 4MNQA 3UTTB 3E6HA 5DK2A 1SYVA 4YIQB 3THML 5INDB 3D39A 1Z0MA 2D7TL 4H20L 4TULL 4LHQB 2AJ3B 3JVGC 4JO4H 4DUXA 1I8MB 2HMID 4OF3A 1HINL 1IKFL 1NCBL 3N1MC 1IM9B 4WHTA 3F7VB 4RAVA 4LEXH 1D9KC 2NLJA 3HPLA 3U30B 5C07B 4DVBB 3VXSD 1MVFA 4RAHA 2FX8H 2YPLA 4OZ4B 3VWKA 5HXMA 2I26N 4GRLC 4DEPC 3CDGB 3OZ9L 3STZB 1K85A 3KWWB 2ILLA 1VERA 1DBJH 3DBXA 1KN2H 5TQ2H 4LHJB 1CG9B 4S0SD 2MPAL 4XBEH 4JM4H 5C0IB 4Y2DA 5KVFL 4ODXA 3LRSA 2V2XB 2LVEA 3VFNB 5IVZB 4GRWF 1RUKL 4H25A 4RQQA 2IPTH 4N8VG 2BVYA 4P9MH 4JY5H 3NH7H 3HC3H 1WFTA 3F6IA 1LO2L 3FB7B 1M1SA 2APVA 2DQCH 1T2XA 1FORL 1EH9A 2VJXA 5DVLA 4LSTL 1F58H 1RK1A 5IBTH 4LU5H 3UMTA 5CGTA 2XTJB 2LAAA 2ATKA 4MA3A 4L4TB 4ELMA 3HMWH 5JOPD 3QUZC 1INEL 1PBYA 4XXDB 3ZKNC 1SJEA 2F54D 3HG1B 1TQCC 1C5DA 4NKQB 4O2EA 4XVTL 4PJXE 3FB6A 1LNUB 3WFEH 4OT1H 4QOKA 1E4XL 3BN9D 4PJHF 1IGIH 2F53D 3MLXH 3D3VE 1JWSB 5DUMH 2OXGA 1YEDA 4F9LA 1YQVL 4NUGL 2Z8VC 2GCYA 3LEYH 4XP9H 4OLXL 1IEBA 3MNZB 2W9DL 1XGQA 1GSMA 4OF7A 4KI1A 4WTXA 1U91A 1EO8H 3O6FA 4FZ8H 4PJIE 3MNWB 5F7DA 5E2UH 5D5MF 1TTFA 1UB6B 4PY7B 1OARL 4ZAKC 2IH3A 2ATPA 1FN4A 4LU5L 1RAMA 4LVNB 5D1QA 3P4LA 1U41A 4FP8H 1LO5A 5E8DL 3IAQA 3P4MB 1T83A 1I1FA 4KKBC 2Z8SA 4KQ3H 1OW0A 5IG7B 1KPVA 1TTGA 2XZCH 1A4KA 1JYNA 4YK4B 2D7PA 1RZJC 3DVFA 4YHIB 5JXED 5DUBA 5HHPB 3ULUH 3ZDZE 5DD5L 1UZ8B 5I74B 1FJ1B 4HKJA 5EUOE 3BUYB 1ZHLB 3IETB 3JWDC 4P0DA 1IAOA 1C08B 1I4FA 4YHPB 1ZEAH 3EYUL 3OKDB 3VJ6A 3T0VA 3X3GH 4DGYH 1CICC 4HFUH 4RA3A 5EIIB 1KSRA 3NACH 4Z7OE 4ISVA 2NY3C 2EIEA 2IPTL 4IRJA 2NY0C 1PLGH 1K4CA 3TESA 1YN7B 3FFCA 1I7UA 2HT3D 1VFUA 4OD1L 2ZCKL 4I3GA 2ZUWA 1I1YA 5T1DL 3MRPB 1I8KB 3VD4A 1UH4A 4PS4L 2BY0A 3IFPA 5GGSY 2VISA 5EO0A 5IFAL 5ITFA 2XTJC 4WJ5A 4U6HA 3T1FA 4AY0A 1CICD 4JAMA 1XGUB 2DB8A 3DLQR 3G04A 4QRPA 3ARGA 4DN4H 1I7TA 4D0BA 1FVCB 4OTXH 5JORB 1I8IB 5JR1L 5BXFB 1OSPH 1M7XA 4LRIA 1E4XH 2A6DA 4JGJA 3UJJL 4QXWA 2DKSA 4GLRI 4P5KB 4DCQA 5HYJA 3OXRB 4MJ5A 4HIHB 2DL2A 3STLB 5C0BB 4AT6A 2WINB 1OPGL 4OBRA 3KXFB 2FJFA 3ALPA 3UBXB 5I76B 2AXHA 5T1MA 4H5SA 5CD5C 4Y4FB 1Q38A 1CLYL 5JPNA 4PIRF 1NFDF 4TTDD 4KKLD 1A7RH 4NN7B 3GMMA 1VESA 4B41A 3MRJA 5CS7A 4BSJA 1H5BC 2IQAB 1MCLA 1MJ8H 3WKMH 1FO0A 4F7TB 2DQHH 1EAPB 5EUOF 1OGTA 1WWWX 3VWKD 5DRWB 4H26B 4JG1L 3CX2A 5JO5A 3NABL 4WWID 2GW5A 2Y25A 4XNYL 4NN5C 5BJTB 2IALB 4XCYA 3PDGA 2YD3A 4LPCA 3RVUD 3SPVB 3BRFA 3EYQC 4W81A 4G3YL 2NY5C 5FYLE 2IC2A 3MXWH 3NZHH 3F5WA 4X83A 5CJBA 4ZQKB 1N4XH 1L0XA 4L8SC 3VMPA 2XA3A 3PWUA 3UDWA 3RUGE 1FLRL 4ODWA 1DN0B 4S1RH 3I9GH 5JOEA 4WUUB 2DQDL 1B0RB 3P30L 3TCLA 1L7TH 2YD4A 5D7LB 4XP4H 3TN0B 3B2UC 4XMPL 3FOLB 4J23A 4PS4H 1SYVB 5INDA 3O6FC 4DAGL 4ZFGL 5L9DH 3NIDF 1NDGA 3MXVH 4ZAKA 1IKNC 4MNHA 2NY1D 1JK8B 2VH5L 4YDJA 1O7VA 1B6UA 2IBZX