3GHBL

Crystal structure of anti-hiv-1 fab 447-52d in complex with v3 peptide w2rw020
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
216
structure length
216
Chain Sequence
b'QSVLTQPPSVSAAPGQKVTISCSGSSSNIGNNYVLWYQQFPGTAPKLLIYGNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEADYFCATWDSGLSADWVFGGGTKLTVLSQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab 447-52D, light chain
publication title Structural basis of the cross-reactivity of genetically related human anti-HIV-1 mAbs: implications for design of V3-based immunogens
pubmed doi rcsb
molecule tags Immune system
total genus 44
structure length 216
sequence length 216
chains with identical sequence M
ec nomenclature
pdb deposition date 2009-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ghbL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ghbL01
3ZDXE 2J6EH 5B8CC 3CXHK 2NYYC 2BSED 3U7WH 4JLRA 4WHYG 1OM3L 3HC0A 3ME0A 5DI8A 5KTEL 3OJMB 5JXED 4X8JA 1S9YB 4DZ8A 5LGKA 4CDGC 1MRCL 2VE6B 4PTUA 4Y2DA 1QFWI 2CLRA 1E27A 3OJDB 4PRPA 2WWKT 4RDQF 4WVRA 5D7KD 4JM2C 2EO1A 2VLKD 3FQRA 1T3FB 4G8GB 5CUSH 4JDVA 4F9LA 1IM3A 4DGVH 4YGAB 3WO4C 3JTSB 4C56D 2WINA 4NZTH 4E0RB 5T1KA 2DI7A 1LO2L 4EBQH 1YEEL 3GEWB 2VDML 5GS2D 3P73B 1DQJA 1E4WH 3MFGB 4WI5A 2XN9E 1UM5H 1MHEA 1BFVH 3MREB 4Y4FB 3HMXA 2D0GA 2HFFB 4UIMA 4OCYH 1B9ZA 2P24A 3FQUB 4OI8A 4PJ5A 2MCG1 1LGVA 4GG8B 2R1WA 2KQMA 3QXDB 3MBED 4WEBL 4LLAA 3N1PC 4K71C 2WWMC 1D5XB 3M45A 3CAFA 3DX8A 4H1LH 3A0OA 4TTDC 1G7QA 1A22B 1CG9A 4ELKA 2VXSH 3WFZA 2FD6H 2O26U 2RFXA 3JWDL 4LLMA 1XGQB 2JK5B 1UGNA 4Q9RL 1UADC 1D9KB 3A6CH 3KPOB 4N0FB 4NPYB 3H9YA 1MIML 1A0QL 2AVGA 1RAMA 3JV4A 2CD0A 2AXFA 2MQ0A 3FKUS 4OB5H 3C6LB 4JR9L 4Z7WA 4EI5B 4OLYH 4LHUA 1R5VA 3HB3C 3QQNA 3JXAA 2PR4L 5CZXD 4U7SA 3EDKA 5HGBB 4L3CA 3TN0D 4IOSD 1U8HB 2NTFA 4E41A 3DXAA 3HC3L 1HEZB 3H9ZA 5J8OA 4ZTPH 3IVKA 2RCSH 4OI7A 2A74B 1G7LB 3BGMA 3MTRA 3STLA 1R3KB 4MAYB 4D8PB 5HYSA 5GRJH 4LSRL 4JVPA 3BH8A 1N7ML 4LNVA 3BMWA 3MRCB 3RVXC 4DGVL 3QEQE 1FNSL 3BKCL 1J8HD 4LSSL 1XF4B 1QLFB 2WBKA 2X9WA 3RAJL 3EGSA 4JRXB 4CADB 3NZ8B 4HK3J 4U6HA 1HKFA 3P0VH 4TQEH 5F44A 3DGGB 3T0WA 1OSZB 1EEUA 3X13B 1C5BL 3C2AL 4OLWH 5EUKB 4WFED 3I2CH 4HG4K 4NO0D 3F12B 4NZDA 3RUGF 2XZAH 4L4JA 1G9NC 2CDGA 3OXSB 1B6UA 1WITA 1NC4D 4Y1AE 1ORQA 1A1MA 1BOGA 2P8LA 2GT9B 2JCCA 4F33B 4HMEA 3EO0A 5BRZB 3PXHA 4WENB 3TNNB 3FT2B 4NYLA 2VZTA 4TUOA 5HJ3A 5I66A 5LJYH 2GJ6B 5EN2A 4W4NA 1XF5B 4R96B 5BV7C 5FOBA 3X11A 1HH9B 4U49A 3IU4H 3ARFA 3IDMA 5I8KL 5CP7B 4HJGB 1ZLWH 4LQFH 1D7FA 4NO5A 5CMAB 2Y36H 4HLZH 1F90H 3D2UB 3L5XL 1UH4A 3TPKA 3HE7B 4I9WE 5JXEC 5FIEA 1EEYB 1R6VA 1IGYA 1ZXQA 4FOMA 3QDJB 1RK0A 5D7SH 3FT3A 3MA7A 2M8XA 4X4ME 3WJJA 1S7QA 1ODAA 4K94C 2WBJD 1QSVA 3Q2CA 1IGIH 2ZUWA 3SEPA 1QR1A 4DTGL 2D7PA 5DHYB 4ZFZA 1JHTB 5FYJE 3F7YA 4HC1H 3THMH 4FG6D 1OF2B 4U1NA 3QQ9D 4MJ5A 2AJYL 1NANI 3MUJA 1J0ZA 4FQQB 4N8CH 4XP4H 4F15B 2I07A 3W0WD 1I1AB 5INDB 5DRWB 2A9MH 2ZG1A 2PCPB 4XNUH 3VCLB 5IB5B 2QQLL 1ZA3A 1JNNH 3AS3A 4KY1H 2P45B 1QLEH 2Q7NA 4X98A 3ZTJG 1TVHA 3FOLA 4TQEL 1CFSA 3FB8A 3T2NH 1KSRA 1LK2B 1FZKB 5F1NB 5IVXF 3DX6B 2X1QA 5GHWH 1N6QH 2R9HC 3SDCC 2C1PB 2O5ZH 3VGAC 3NCBB 5JHDA 4MA8L 1K3ZA 4X5WA 5T3XL 2XKSA 2IF7A 1D5IH 4IMKA 5ADOL 3W2DL 1I8MB 2JELL 4KTYA 3AROA 3GJFH 1CD1B 4IMLA 3GIVB 4BZ1L 1OCWH 2OSLB 1OQXA 2OTUA 4ZPTA 2EO9A 5CD3A 2PETA 3UJJH 3QNXA 3L7EB 3GSVB 2GUOB 4Y4KA 3TN0C 3INUL 4XRCB 1NMCB 1IC4H 2OXHA 2Y1VA 3DWTA 3HS0A 4R0LA 3RTQC 5AUMB 4N9GA 1PFCA 4PRHE 1A1NA 3L5HA 3GMLB 3IDYC 2PTVA 4PJ9C 2AKRB 1IGIL 5FCUH 2CPCA 5F9OH 3MSPA 4PLNC 1MJJB 4PJFB 4XMKH 4KGLA 3KPRA 3O3AB 1MCJA 2AEQH 5KANI 3B9EA 2FX7H 4O2FB 3RU8L 5B4MC 1FG9C 1WEJL 1AFVH 1EA9C 1RZKC 2E6QA 4KU1A 1IC5L 1S8DA 3UJTL 3HI1B 2YRPA 1JRHL 1U92A 2R2EA 5DC4B 1EGJL 2BVUA 3CVHH 3VXQB 1CXEA 5J1SC 3DRTB 1BQHA 5DURB 4XNUL 4PJDF 4JY4B 1TIUA 5HGAB 1JNNL 4N1CA 4JPIB 3OKKB 5F3BA 1YY9D 5D2NC 1ERNA 4HIHA 4JY5H 2CLZA 4LHQB 1WCBB 3CFBA 1GOGA 5GGQL 4JGMA 2A6JA 3FCTA 4HJ0D 4Z9KB 1A7PH 4YDIL 3VXRE 3NABL 3ARBA 2IALA 5B3JF 4PYHA 4X7FC 3ECBB 4RIRA 3RZWA 2WP3O 1T1ZA 4U1KB 2XWTB 3RWJB 1SBSL 3O41A 3SQOH 2ZKHH 1MLCB 1HKLH 1L6ZA 1FFRA 4L8SA 4S1QL 3JWNC 2CGRL 5IQ7H 4WNQA 1CDGA 4KI5F 5TDPB 4YZFE 3F7PC 4Z7VB 4PJCA 2FH8A 1HINL 3BDYH 1B2WL 3ZKMD 4I3GA 1HILB 4QO1A 2AABH 4F3FA 2F53E 1UZ8A 1T1WA 4W81A 5GSRA 4PGEB 2ICCA 3VG9B 1CLYH 3IFNH 5DRZA 5IWLC 3R4DA 4NO3B 2ZZUT 5E1AA 2X05A 4R26H 3QQ9C 3PDDA 4R97B 1OTTD 4TSCL 4U3CA 3QCUL 5H37G 3BD5A 5C09B 3VFVA 5F9OL 4YHOH 3SJVD 4WO4D 43C9B 4YQXL 4Z77A 5DWUH 3P77A 5E4IA 3WKMH 4YEFA 5MEQB 1JYWA 5DLML 2FX9H 5FCSH 2RB8A 4BQ6A 3C5SB 1F8TH 2HRLA 2IBZX 1XCTB 1JWUA 1HNFA 3QNYA 2VH5L 5TE6L 1TCRA 4PPTA 4NOBA 1YEKL 1ZHLB 1RVFL 3RVUD 2X4RB 2BNQA 1G7JA 4HCRA 1KJ2A 2L4OA 2LTQB 2FGWH 5EZLA 2DF3A 4ZUSA 4DW2L 1YQ2A 3ETBF 1RURL 1T2JA 3AC0A 3DROA 3LKNB 4XAKD 4Z6AT 2R0ZL 4H25B 1N2RA 4N5EC 32C2B 1EV2E 2KUTA 2X4UA 5T1MA 5F89B 1OPGL 4X6DA 4S10A 3HMXH 3W9DB 4WW2F 2JE8A 2AEIT 4HZLA 1QSFB 2IGFL 3H9HA 3GMRA 3HG1E 1KIQB 5HYIA 1I1YB 3LEVL 4MJIB 3QHFH 4IS6A 4WFGE 5CIPA 4JFEA 4Y4FD 5D7LD 3K2MC 4YFLI 4UNVA 2F19H 1NCWL 2GCYB 4L8DA 3U30C 3D9AL 2XNAB 4LCCB 5D1ZD 2P8MB 1E4XL 4F8QA 3NACH 4YHLL 4OD3L 2CLVA 4H8WH 2DWEB 4FFWC 1RFDL 2IQAB 4GSDH 3ZTNL 3B9DA 4PJBB 3RPKA 1AQDA 1MRFL 3PV6A 5C1MB 3F62A 2AJVH 1T66C 5IMKA 3GMOA 3HPJB 5H35A 2R1YB 1YY9C 5BS0E 2X1XR 4CBPA 4QNPF 5EO0B 4WTXA 1PLGL 3BO8A 3EYOA 2XFXB 1J05A 2IQ9H 4JJ5B 4YEEA 1A3RL 1JK8B 1H3WM 1Q8MA 1Q0YL 4IDJH 43CAB 3HAEA 3WLBB 5JQ6H 4Y16A 3L1OH 4BK5A 2LQRA 3ARDB 3WNKA 3BXNB 1T0MB 2O61A 5D7JA 5K9JH 4MJ2A 2IMMA 2RIKA 3Q5TA 3VJ6B 4XCEA 1GZPA 3Q1SH 1FBIL 1OGAB 2ICWA 2NY5H 3GB7A 1KCKA 1DE4B 1ZLVH 1BQLH 4APQB 1MHCB 4YX2L 4NQCD 2GJZB 2NY0D 3TNMB 3FL7A 2A9NH 4KRPD 1P9MC 3ZT5A 4OKVA 1FL5A 1NMBH 4PJGB 3ZKMC 3AREB 2GTZA 2CO7B 4MB4A 3C9NA 3VH8A 4X6FA 3QPXL 1XGUA 4XX1G 3CFCL 2DJUA 2N56A 3BP7B 3X3GL 1RU9L 1OTTC 2GSGA 5GJSL 3VFPA 1IAIH 3MFFB 1MCBA 2BVYA 4CRPA 3C5JB 2F19L 1UJ3B 1JNHA 1P6AB 4YXKL 4AEIL 4BJLA 4NGHH 2VZVA 4N0RA 4TYUA 3BVNA 2FJFA 3LQAH 5IG7A 4GJTB 3V6ZA 2HJFA 2B1HH 1DVFB 2LABA 5BRZD 3MGAA 3IKCA 3EUUA 5I76A 5E8PB 1QSEB 3RVUC 2YZ8A 4L29B 3MCLH 4B0MM 4L4VB 1X44A 3D2UD 3VRLF 5EOCL 5GGRB 1OAYH 5AEAA 3GSWB 3QZWA 5E94B 1ES0A 1BIIB 1DFBH 3QDJD 5DMGD 3GMNB 5D72H 1KPUB 5GJTL 2GK0B 2HG5A 3K7UA 1P4BH 1TENA 3VXUB 5IK3B 1KOAA 3V6OC 4KVNH 2NNAA 3SY0B 1LD9A 1YPZF 4JY6B 5E08L 3TH2T 4M9OA 2B8OT 2NY5L 1XIWB 4JFQA 1ZGLP 4UT9L 1Y6MR 3E8UL 1G7MB 2FH6A 1RUAL 4NKIH 4CUCA 2YD1A 3CC5A 2P49B 5T33L 4D0CA 5EUOF 4QOKE 3QFJE 4F58H 4H26A 4EVNA 5FHBL 2PTTA 4A2MA 2GITA 1INEL 4FFVC 4PFEA 4LHJB 1NL0L 4OFDA 1N5YH 5I30H 1JUFA 4Y4FC 1PYWB 2MKLC 35C8H 2WIMA 4NQSA 4Z7NE 2GI7A 5KVDL 1T04B 1BAFL 1XGPA 1AGCB 1IQWL 4G8FB 5CJ5A 4JN2A 4I0PB 4OBRA 5HDOA 5F88A 4QHMB 1IAIL 1ZT4A 3MGTB 2ITCA 3MV8A 3QIUB 5D2LB 5DRNA 1MY5A 1FCGA 5FK9B 2OL3L 3HUJF 3LHPL 4MGXA 1LHZA 3OPZL 3HE6A 5B39B 1A6VH 1A3LH 4PTUB 2CLRB 3T2OA 2DQUH 1MWAA 3KLSA 1G0DA 3RNKB 3B9KD 3U46B 4WWID 4UBDC 3WN5C 3QIWD 1OP5H 4LCUA 2KL6A 3FQRB 5L6YL 3RGHA 4LRNL 5EBWB 1S9WB 5ENWB 2EE3A 2EDXA 5FO7A 5HDQL 5HGHA 3FO2B 4BYHA 3DHMA 4MXVF 4PGZA 1DLHA 1MFDH 4RBPH 4G7YL 1NFKA 4ODTH 5CBAA 3EFFA 4BM7A 4CVXA 2BXZA 3BDXA 4H5SA 5ESVA 1WAAE 4UIMB 4N8VB 2I60L 2NY0C 4JHWL 1MFCL 1J0KA 3LH2L 2R1WB 3GSXA 3DUHA 1YEJH 3ZYJA 5CLWA 3DX8B 1VACB 3EYFA 1A7OH 4L9DA 1XAUA 3F6LA 4LGRB 4OTXH 4D9QD 3VWKA 2P42B 1FRGH 1BJ1J 4NZUL 3ULVE 1KIPB 5DURD 1H15A 1YEGH 5EOTB 3KJ6L 3EHBD 1I7RA 1QVOB 4GAYA 3JV4B 2AXFB 4HGMA 1A7RL 5I16A 5F6IC 5I8EB 2HFGL 1F5WA 2YKLH 3VI4E 3HZVB 4LHUB 3SE3C 3F58L 4LASH 5IMOA 3O6KH 5DUBB 5BMFL 3G6AB 5MHSD 5F6HJ 3T3MF 1MVFA 3KPMA 3U0WH 1SYSB 1BWMA 5I17B 4NNXA 3T4AB 2IPUK 3WEXB 2VQ1A 4IRSA 4LRIA 2ZCHH 3BGAA 3HE7C 1S7SA 1EX0A 1TQCB 5DHXB 4ZO8A 4EUPA 3MX0A 5DMGC 3R1GH 1GZQB 2KQNA 4GKNB 3U1SL 1RJLB 3HZMA 4OFYD 1YY8A 4QTHA 3KAAA 3GMQA 3RWIB 1QQDB 4YK4B 1BVKA 4GH7B 1CIUA 5KVMC 3QEQA 2VAJA 5CJQH 3P4OA 4XHJD 3CXDH 4F15C 1I1AC 4OGAC 5T3ZH 1BBJB 3SKMA 1VFOA 4FZ8L 5JW4R 4PV9B 4HCRH 4AK1A 3L5WA 1KJ2H 1BOGB 2EDKA 2JCCB 2XKNB 3U36B 4LBEA 3EO0B 1LMKA 4OTXL 3QUXA 4I2XB 3TO4D 5J6GA 1R3JB 5HJ3B 5C0IB 5JQHC 5EN2B 3DX9A 3X11B 1BZ9A 1JF6A 2PO6A 2EC9T 4WRLA 4Y1AA 3QDGB 4XHQA 5TDNA 5HYQA 1AJ7L 1MCFA 2X40A 4K7FA 2YN3A 3REVA 4P9ML 1YJDH 2ZUVA 4OBSA 4LLWA 3HNTH 4B7IA 5JA8B 2NLJB 3MOQA 3S37L 2FEEL 4KROB 3WNOA 4ZOEA 3KPLA 1LDPL 4W70A 3TYGH 1F4WL 3KLHD 3K2UH 4NJAL 5ALCH 3B9KC 1J12A 1K4CB 1UACH 3CPLB 4OF5A 4ZYKB 2VLJE 5CIPH 1EFQA 1ZANH 4ZFZB 3PP3K 1G6VK 4Z78B 5JPMB 1BFTA 5JDSB 1U8JB 4PJEA 4XVUC 5GISH 3CGTA 4PY8J 3AB0C 3MRBA 3MLXL 4X4MA 4MS8D 1SJEA 5KSAB 5E2VH 1NMCC 3OL2A 3IDXH 3N50A 1MAJA 5F9JB 3BHBB 2CRYA 4MQXD 4G9FB 1NJ9B 5JTWA 4X6BB 2ZG2A 2BVTA 4XZUA 3BP6B 1K8DA 4GBXB 4FTVE 1OY3B 5LQBH 1HYSC 2R69L 3KJ4B 3IJHA 4OD1H 4X98B 4P5TA 1NBYB 1CE1L 1WBYB 3P9WB 4L9LB 5E9DB 3BQUB 5KSVA 3FOLB 5J6HA 2R1XB 5L8LB 5BZDA 4Q9BA 4UB0H 1IKFL 4P4KB 4FFZH 2Q7YA 1IGJA 3ZO0A 5IMMA 3HAEH 3W82A 5EU6E 2K9UA 2HT2D 3S34H 1DQML 2JIXA 1KJ2L 1LILA 1T03H 2QQKL 4HFUH 4NDMA 2G5BB 3VXSD 5K9KB 1DUYB 2UVFA 4R90H 2AQ3A 1PSKH 4FQIH 4IMLB 4OZFG 3T8XA 2JJVA 4KPHH 1U8LA 5CGYD 1MCPH 3L3KB 1AHWB 2OTUB 1JTOA 3BP5A 5B21A 1AGEA 1D6EA 4AL8H 5DK2B 1I3RB 3DX7B 3T0ED 3AS1A 4R0LB 3RWFB 1I1FA 4DN4H 4PRDA 3LKOB 1HIMH 3TYGL 3MGOB 3RI5K 3DRQA 1AY1H 4OZHF 4XCNB 5E5UB 5IVNA 2WUCH 5GS0D 1DDHB 3MZGB 3OKMA 5CEZD 5GISL 3ARED 2Q8AL 4NQXB 4PRHA 1IGFH 3C6SB 4KUCD 5C07E 4X9IA 1PG7W 3OKDA 4HFWB 3SDXE 5EULV 5DEFA 1J9CT 2H8PB 5TDOA 4R97C 5FO8B 3GSRA 1B0GA 1INQA 4BSJA 2XWJA 3NIGF 3H0TA 3H7BA 3WNNA 3TPUA 4XHJC 5IQ9A 3FN9A 3L3HA 3V8CA 3SGJA 5EOQH 3S9DB 4NHUA 5K59F 2DM2A 4OF7A 1MRDL 2ATKB 1A6TA 1TJGL 3BD4A 3LRSA 5EO9A 4DZBB 2A6JB 3RHWK 4HF5H 4ZSOE 1CT8A 3O8XA 1KTLA 3TO4C 4B5EA 3ZDZF 5EZIH 5C0CB 3QUKA 1QSED 5FYJU 3BFOA 4EI6A 4ESKA 4GXUM 1T1ZB 4PJHE 2QHRL 2YD9A 4OM0H 5F96L 2BVOB 4JG0H 1SM3H 2ARJB 2LTQC 5J1AB 3NFNB 4WNQB 5AWNH 2KH2B 2PNDA 4JFDD 3VXRA 4ZUVB 4MDIA 3N85H 2F54A 2CQVA 5HYJE 3KLHC 4KXZH 2UWEF 5IKCA 1KXQE 4HUMB 3NPZB 5GSRB 1J0HA 4NP4L 3V6BR 2A0LD 4WHTA 3IXAB 5I73C 1RHHB 2FGZA 4WI6A 4DN4L 1TQBB 1J86A 4FMKA 4P0DA 5DZOA 1KCRH 4X9FA 1RUKL 4MQ7A 2J8UF 4MS8C 1FFQA 2F53A 3P0GB 1MJ8H 2BMKA 1A4JA 5IR1B 3JSSA 4KK9C 4Z77B 1TJHH 1J88A 1KCVL 3VG0L 4MCZA 1IEBA 1OT2A 4RMVA 4CDHA 3HR5A 4HAFA 2J12B 4YO0A 1A6WH 1VEOA 1V7MH 4X4ZA 2A6KA 1S7UB 3NZHH 3Q6FB 4RFEB 4LCCC 3QNYB 1NAMA 1NMAL 1IGML 5CEYB 4Y5YB 1YEIH 4LSUH 5BOPA 3IS0X 5T1LA 1MWAH 2R23A 1CZ8H 1EH9A 2H32A 3LN5A 2P5WE 4WIQA 4XPGH 5IJKA 2AJSH 2E8ZA 3SGDH 1N6UA 5DF0A 1N0XL 2W60B 3TYFA 4EIZC 4ZUSB 4KTDH 2HT2C 1MFBL 3FB6B 1G7IA 1KB9J 3UMTA 2X4PA 1MOEA 3O9WA 3MV9E 4PTTB 4YHZL 3KHQA 4Y5VB 4WDIA 4WWKB 1U91B 1M71A 5EBMA 1ZHKA 4GW1A 5ERWA 5IJVA 5CGYC 2FECI 4QRRB 4ORGB 4NKQB 1NLDH 1T1XB 1T21B 2ORBL 4LNRB 3T1WA 2CKBB 1FGNL 1MIEL 3VD5A 5LBSL 1H8OA 2QQNL 4OCRL 3H9HB 3GMRB 5I2IA 1AKJD 5CSGA 4LDLB 5D7KE 5K9OA 2XTLA 4APQC 1I8LC 3V4VL 5IEKA 1LEIA 3S4SG 3WDJA 5ELIA 1UB5A 4KK8D 1U8IA 1U2HA 2P4AB 1OARH 5GS0C 4HD9A 4LF3A 5GRVL 3HG1A 3OAUL 5DJYA 1J18A 4GAJH 3AREC 5BOZG 1X5HA 4X4XB 4D0DA 2EIZB 4GW5A 1EVUA 3FQNB 2YBRA 3KGRA 4NC2B 2FYYB 4BFEA 5ESAB 2P7TA 2VKWA 1QBLH 4X9BA 5FFLA 5I1IH 4FXLA 4WHDA 3CUPA 3PV6B 5GRUH 3C8KA 5GS1B 5DT1L 5FV1L 5D7IE 2NZIA 4F80A 4OZGB 3FHAA 3G6DH 2GJJA 3EYOB 1J05B 2XTJD 4OD2B 4KMLB 3WFDH 3RL2A 3HAEB 4Y16B 3MLRH 4N0UE 1DVFC 3RWCB 1T22A 2HVKA 2NZ9D 3BESR 4XPGL 5KS9B 4ZO7A 5L2JA 1KLFA 3FB7B 1B3JA 4EUPH 5D7JB 4XMPL 1UB6A 5BS0A 3V95A 5IT2L 4M6NH 2ZJSL 3UXFA 4ALAH 5SX5K 3HA0A 5AYUL 1P4IH 1ZEAL 3OAZH 4X9HA 1AP2B 3DOSA 3RX8A 3CDYA 4OQTL 1IM9D 1WIPA 2AEPH 2AJZA 4CAGA 2BFVL 5DZLA 2HJLB 1JFQL 4LLYA 2JF1A 3G6JE 3QT2A 4I0KA 3PV7A 3C9NB 1IJ9A 4QRSB 3NN8B 1D5BA 2A0LC 5DD6A 1XIWC 3DMMA 4IEFB 3QXWA 4D9RE 3S35L 3PNWB 3VD7A 3WNLA 2GSGB 3MOBL 1SY6L 3MCKB 4K9EL 4UV4H 4L4TD 3CLEL 4XGZB 1JWMB 2RGSA 2OQJA 4MX7B 5A2IH 5FGBA 1AXSB 1XGRB 1EFXB 5JW3H 3BVNB 4GAJL 3OZ9H 4R2GB 5IG7B 3ZMRA 5J4MA 4XNYL 1PG7X 1KCLA 4KQ3H 1BM3H 1Q1JH 5I1LA 3IKCB 1FN4A 1QBLL 4NKOA 5I76B 4I0PC 2R2HA 4ZO9A 5D2NE 1UWEH 5EOCJ 2E5EA 2CRIA 3U9UA 4Q74A 2ITDB 2XICA 4DQOH 4PP2A 3VXMD 3PWNB 3QIUC 2VLLA 1WWAX 5C0FA 5DUPH 3M17A 3FQWB 2X6MA 2XQYK 2X4OA 2GHWB 3WFDL 3PGFL 4D9LH 3DLQR 4GRWE 5HGDA 2NW2A 1X5YA 3BW9A 4NWTL 4DGYH 4DKDC 2XT1B 4P2YA 4Z7UB 4S1DD 2ADFL 1IT9H 1JWSB 4OV5B 3QWOA 4PRAA 5GQBA 3IDJB 5FYJH 3OBAA 1ZVSA 4WU7A 5CLTA 3KDMA 1FFNA 1NC2A 1P53A 5CZVL 4D0CB 1M7XA 4OCSH 5KSAD 2D3VA 4W4OC 1ZLSH 4EVNB 2PTTB 4CJ0A 4R9HA 3MLSH 2B4CC 4GBXD 1PX3A 1FVEA 2LU7A 3MUHL 3PHOA 5EZJA 4QOKA 15C8H 5E9DD 5E8NB 3AM8A 1RZGA 2X1WL 3W0WE 1F3JA 2YUZA 5F88B 3DUSA 1ZT4B 1ZWIB 3LEYH 2VDQH 4P4KD 2YSSB 4S1SL 4TULH 4EDXB 2MOVA 2WANA 4G6ML 2CSPA 5FKPA 1BIHA 5MERA 5FYLD 2YPKA 4YHIA 4G5ZL 1U42A 3CVIH 4HV8B 3GSUA 2APVA 3HE6B 1I9IL 4KQ3L 4S0TD 3FB5A 5K93A 4MXQD 3GI9H 5I1CL 3QO0A 4NM4H 4AG4H 3MRNA 3TVMA 1OWWA 2XTJC 4ZNCD 2AJUL 2EH8L 3MV7A 4OAWA 1FJ1B 1A6AB 4KMTH 4WCYL 2NZ9C 5ANME 3WDIA 4A2LA 2JB5L 5FO7B 3VXTA 1YEDA 5D5ME 1FLTX 2QLVB 1MNUH 5TFSL 2FJGA 3BPLC 5FUOH 2VDRL 1L7IH 5CBAB 2I5YL 3EFFB 1NCUA 5ESVB 1T6VN 3B2UD 2H6PA 4BSWA 2EECA 5KVEH 1VENA 1FORL 1TQCC 5IGXH 5E1HB 4J4PD 5FYJL 3P4LA 5D70L 3EYSL 5AZEH 5SV4A 1RD6A 3EYFB 4OCSL 5FDWA 4U2YA 1WAAA 1WZKA 2NXYD 3O2VL 5C08B 4J3TA 3MJ9L 3VWKB 4OFVA 4G6FD 1IAOA 1RZ8A 2G75A 3MLSL 3PIQB 2LV4A 3CFJB 3SO3B 1AGFB 4AM0A 1G0YR 3GJEA 3FN0L 3GSNA 1I7RB 1W2KT 1FCCA 3EKCA 3BISA 3SDDA 1AXTH 1Z5LB 3ZE1E 4OZ4A 2CMRL 3QH3B 1J0IA 3VFWB 4HJJH 1Z9MA 5HHOB 1ZS8A 1NGXB 5IMOB 3V52H 5D6CB 5FXCH 5C0DA 5I19H 2Z93B 3KYNA 1ZSDB 3KPMB 4QRUA 3UZEA 5C0CD 1VEMA 1KT2B 4AMKL 2VXUL 5EC1B 4F37K 4NNXB 3TJEH 3QUYA 2VDKH 4IRSB 5ESQB 3L6FA 1JNJA 1ZHNA 3RZCB 3D85B 2R29H 5E56A 5IBTL 4UT6L 4KROC 2V9RA 3QJHA 3BZEA 1NGZB 3Q3GB 1NCBL 2EH7H 3AGVA 4D2NA 5B38A 1Q9OA 2DQTH 3UTSE 4QTHB 3UZVB 4P23A 2HFEB 3ZT6A 3C5ZB 5FUOL 4QGYA 1QKZL 3GMQB 2VZSA 2PKDA 1DBAL 4JG1H 4PUBH 1AD0A 1OAXL 1MHPH 1BGXL 1NAMH 5KSAC 4DEPB 3ROLB 4CVUA 1F11B 2VWEC 3SKMB 1D6VL 5F21B 2H32H 4WI2A 1R5WB 3L5WB 1KN4H 4GBXC 3TA3B 5IESH 1D5MA 3KJ4C 3AS2A 4P5KA 2VUYA 1FFOA 5J6GB 4L9LC 5FA3B 3BQUC 5EWIL 5JIHA 3SJVE 1BZ9B 5TE7H 5HHQB 3WXWL 2F15A 1MCRA 3I75B 4X80H 4P4KC 3UTPE 1LO0L 4HKZA 2XZZA 3REVB 5EIVA 3PL6D 2FX8L 2W65A 3RA7L 2VDOL 4LCYB 4UT7L 1MJUH 2HKFL 4YNYB 5JXAL 3A67H 1FYTD 2B5IB 2ZPKL 4CW1B 4PB0L 1TMCB 1YNKH 3LKSA 4R6UA 5MP6H 4HXBH 2X2YA 1AHWC 3F6IA 3PHQB 4PJEB 2NPLX 4QY8A 3ROOB 4R4ND 4XAKE 5EC2A 3VFOB 5L88H 4M1DL 4ZNEE 4RISH 4EEEA 5E2UH 3HI6L 3RWEB 3A6BL 5DJ2B 2VLJA 5IIEB 4M03A 1QNZL 1G84A 3V6OE 4G8GE 4XCFL 1HXYA 2DKSA 2N7AA 2WBWB 5D96B 4Q6YA 1HQ4A 3O4LA 1NFIA 1SMOA 4Q0XL 1TFHA 1A7NH 1EJOL 2ZOLA 4R4BB 4J4PC 5HI5C 1IE5A 3P0YL 3N06B 5J9PA 4LSVL 4RFOH 3SE9H 2GTWB 4U1MA 3QO1B 2BSTA 3TBYA 4W68A 3GKWL 4FTVA 4MA7L 4I5BB 2Q7YB 1E28A 3WJLA 3H8NA 1UCTA 4B41A 4IRZL 7FABL 4P46B 2FHCA 5SX4H 1UJTA 4JPWH 4RAUA 3NIFF 1UM6H 4MXWH 1JPSH 4NDMB 2R0LL 2OJEA 2CIIA 2D7QA 5C70A 1ZV5A 4KJWC 1IC7H 1JTTA 3V5KA 2HRPL 1UKTA 3T8XB 2VQTA 5EU6A 3C08H 3P4NA 2Z8WC 3LCYA 1IQDA 1X5KA 4DVRL 4HKXA 2FIKA 5DMKB 3CDGB 1TJIL 5BXFB 3ARGB 5B8CA 1I1FB 1DR9A 1JV5A 2V5SA 4XVSL 4HUKB 3T4YB 4M48H 5I75B 4OZIF 2F5BL 4HIXL 4PRIA 1FAIH 2ADIA 4JCLA 2YC1A 5DD3H 5JR1H 4BSVA 4JAMB 3UBXG 2H41A 4JM2A 4X7SH 4Z76B 5DQJB 3S8WA 2C3GA 1EDQA 2EZ0D 4H1LG 3WDHA 3OKDB 3SGEI 4M7JH 3I84A 4QRPD 3UPAA 4KK6C 4ODVH 2J88L 1TQBC 1DQDH 2A83A 3U4BH 2QHLA 3I6KB 5L7XL 1WWCA 1I7UB 2ARWA 4XCCH 2D2OA 1IGCL 1OOAA 1KTDA 3FFDA 5C07A 3DO7A 4RX4A 3SDXA 1DBJL 4JRXE 3L9RB 3BI9X 4NHUB 1Y18A 4R2GD 1N5AB 3WFCL 3LRSB 3V0VB 4X4YB 3MODL 2ZCLL 1T0NB 2Q8BL 4PIRF 2P1YA 4Y5YC 3MLWH 3PXJA 4FQ1H 3ET9F 3LKPA 4JANA 3PP4L 3WUWG 3DUUB 2FATH 4PD4J 1K6QL 5BRZE 4ZSOA 4HQQH 3PL6C 5HVHB 3VXRB 4UTAH 1QPXA 3P9MB 2GJ6E 5IB1B 1MELA 4PB9H 1ZA6A 2F54B 4PJHA 4QHUA 5IKCB 1QEWB 4Y5VC 1S9KC 5DJAB 3ES6A 2BHZA 4WWKC 1KN2H 1FG2A 3BPCB 2VNCA 5TQ2L 4NKDA 4XVJH 4WHTB 2ILLA 4PJ7E 4HLJA 1QLRB 5CILH 4IHOB 1BEYH 5HHMD 3UTTD 2A6IB 4R4NC 4GMSL 3QDJE 5HYJA 5CJOL 1EUTA 3MPCA 4X5LA 2QL1A 2F53B 4V1DB 3NCJL 4ONOA 3TIDA 2J4WL 4ZS7H 3W11D 4QHNB 2CXKA 4B7LA 1Q9LB 3OTTA 1AGDA 4O2EA 4BFIB 2AXHA 4BZ2H 4ODWB 3G5YA 2CXGA 5M7QA 4XNQB 3S5LG 5JOEA 1DP0A 1F3DJ 4U1LB 2PYFB 3VXOA 3O6MH 1C16B 1LQSR 3NH7L 5T1LB 3V7AE 3IKKA 2R23B 3LN5B 1KXTB 1ED3B 1Z3GH 3MUGB 5HI3D 3UTZB 4JFOB 3GHEL 3TYFB 4HBCL 4G6AD 4HLZG 2MPAH 4P59H 2GAZA 5GS1C 3FMGL 4TPRH 2HLFD 1QFUH 5DQ9B 1P84K 3MNVA 5E2JA 2P5WA 3O3DB 4GW1B 4EDWH 5IJVB 4FQ1L 5EFIB 4HDIA 4Q6IB 4CJ1A 1ADQL 3O11B 4JEGB 2FDBP 3VE0B 4YDLB 3L3IB 1PG7L 4XC1L 3BUYB 3MV9A 4Y8AA 2XQBH 5TJWK 2O5XL 4ZD3H 2WP3T 3MRDA 5E00A 5FB8B 4XC3L 3C87A 1VGEL 3K81A 5JXEA 1LEIB 3HTLX 1A4KB 5FV2A 4CU8A 2VR9A 5KSUB 2QSTA 3MNWA 3VDCA 3IFOA 5DJYB 5JLZA 4NQDD 3GSNH 2VLKA 1JZ7A 4GW5B 4Y19B 4MMXC 2YBRB 4YR6B 3VWJD 5KW9L 4TVPL 1G9MH 4ODUA 5EZOH 3ULVH 3KS0H 3L3JB 4HGKC 4PJFE 5ECJE 2DQGH 5GZOD 1TTFA 2Z92B 2V17L 3C8KB 5MEOA 1QP1A 3GZKA 2DM4A 1ZMYA 2E6PA 2AJXL 3O6ML 2EDYA 2R8SH 3DIFA 4R2GC 2I24N 3BT2L 4C57C 5I8CB 5HHOD 1T22B 5D93B 2FO4A 5D7IA 1OTSD 3EZ8A 3PWPD 2KDGA 1GGIL 1CQYA 2MPAL 1UKSA 4P59L 4P2OB 1J0YA 3SDCA 5F7FA 4FQJH 2QSCH 4N0YL 5ISZB 2FZ3A 5C7XH 2A73B 4N0UA 1S3KH 2W92A 1U6AH 3RZCD 2ZSWA 3RIAK 2F58L 2A1WL 2AJZB 3H6JA 5F7DB 3P11H 1QO3A 2AV1B 3QDMD 1G7HB 3CU1A 4CVWA 5E6IB 3F5WA 1X5IA 1HOCB 3DPBA 3DTXB 1ETZB 4F7TB 2CDFB 1JTPA 1E4KC 1LO3L 3P4MB 3VRIA 1VHPA 2H3NA 2IAMD 2JJSC 4P2RB 1RZJH 1BD2D 4PR5A 4WY7L 4Z7VE 5DMIH 1X4YA 3TN0A 4MDJA 2ZP0T 1SEBA 1F00I 3G6JA 4U1GB 3RTQA 1Q9KB 4Q9QH 3V4PH 2VOTA 1MCEA 3GM0A 4GOSA 3DBXA 1H3VA 5C6PB 3W11C 4XP1H 3STZA 5IMLB 4PJ9A 1T7YA 4X8XA 4A6YL 5FDYA 5IBUG 4OSUH 2OMNA 4UDUB 1TTUA 5TF1L 2J1KA 5CSBA 1EAJA 2AXJA 4WFHD 1QBML 1DBMH 1G9ML 5C0AB 5DD5L 4KK5D 5E8OA 5L2KB 1S9XB 4PJXB 5C8JA 2W59A 4EXPX 1MCKA 1RULL 5EB9A 1UXSB 3G5ZA 1MCWM 5SWSD 1JVKA 4ERSL 1JHLL 4ZFOA 1FZMA 2UUDK 2DIAA 2VLLB 4KKCC 3M1BB 1T89C 3JWOL 4NQED 3WSQL 3QRFM 2MHAB 4LKCA 2R8SL 4G6AC 1L9NA 2JJWA 1QRNB 2X4OB 1JF1A 2UZIH 4NO0A 5IB3B 2YPLD 3NA9L 1YMMB 5D2NA 3SPVA 2NW2B 1F4XH 2HLFC 4OKDA 3RVVD 5C9KA 4R8WH 4LLDB 5I1KL 1RIHL 4M8QB 1M1SA 1ZGLA 3UYRL 1ZVSB 4WU7B 2H1PH 2NCMA 1QFWH 3QI9B 3KLAA 5H2BB 2VZUA 3BWAA 1HI6A 2DLTA 1OAUH 1A14H 3JWDC 5HHXL 1CD0A 1MJ7L 3NTCH 5DD1H 3MRHB 4K7PH 1O0VA 4TOYL 5E4EC 1UXWB 4U0QB 5T3XD 4H20H 5HPMA 4RGND 3VMPA 1UZ6F 3VFUA 2EE2A 3ULUC 1J1PH 1PVHA 3VFTA 3LS4H 1AR1C 3WHXA 4CU6A 1QSFE 4PGJA 1JGEA 5BO1H 2ZNXA 1YMHA 5BVPH 1N3NA 2VABB 2DQCL 1PZ5A 4MJIE 3DUSB 1AO7D 3OX8A 2YPVL 5KSBE 3O6LH 1GHFH 3V4PL 4LSTL 5HBBA 1OQOA 5IWLA 3V2AR 3UAJD 3VWJC 2JJTC 1MHHA 1UKQA 1GSMA 4LQ1A 1NKOA 3IFLH 3C60B 5CEXA 4NBZB 4JZOB 4P46D 1KPVA 4FFYH 2YUWA 3SO3C 4XH2B 3GSQA 5GZOC 3W0WA 1YEFH 2X7LA 5DVLA 3DVGA 3VXPB 4N8PA 1GJIA 4JFYA 3QO0B 4G9DA 3CZFA 4PJIB 3MRNB 3LZFH 3MXVL 4IOIB 3F65A 4PJBE 2OR9H 3MV7B 4U3HA 5GGSB 5HI4D 1M05A 1UM4H 2BCKA 3SBWC 2A2QT 1OTSC 3VXTB 1D5ZB 1RMFL 1YEDB 3VXSE 3ARGD 1CR9L 4ZPVB 3UC0L 3GHBH 4OLEA 3KYKL 3IDNA 1NAKL 1A47A 4U6YA 4MA1B 4OT1H 4NT6B 1Z2KA 3R06A 3RZCC 5DA0B 5IW1B 5ANMA 1INDL 1R3HB 4LVEA 4GS7C 1RJCA 5EBGA 4OLZL 4AIZB 4YXLL 5D5MA 1NGWB 2C4FU 4M9PA 1WTGT 3ARSA 1JZ3A 3PWLB 1UWXK 4JKMA 1QFWL 1XCQA 4QCIB 1Q72L 2E27L 4U1SB 1WJ3A 5TQ0L 5DTFA 1K2DA 2P8PA 4LDEB 2H9GB 2YD5A 1N4XH 4PJAF 4FXGB 4U6TA 3C5ZC 4RGMB 2IBBA 4G8IB 5DD1L 2EXWD 1RZ8B 1KBGH 3IETB 5F1IA 4QTIL 2EYRB 1P4LA 3WL9A 4PJGE 4JO2H 1NBVH 2R2CA 3MRLA 3PGCB 4JPKH 5F6HI 1FHGA 4GRLB 3SDDB 4G7VH 4RMSA 4JQIH 1GYAA 2DMCA 3TA3C 3D0VB 2IBZY 2HLAA 5HYSG 3CJJA 4KK5C 1VFBB 1GPOL 5C0DB 4Y4HD 5E0QA 4FFYL 4LPCA 4S0SD 5C0EB 1AR2A 3HZKA 5IP4A 1IRAY 4PJ8B 4XPHH 3Q6GH 4QYOB 4XPFH 5AAWA 4B53A 1PQZA 1I1CA 3QUZB 2X9XA 3IDIB 3CFKA 3P30L 1H8NA 1CE6B 3DVIA 1UWGL 3BPOB 4JQXC 3QIBD 1EHXA 5IHZA 4F57L 2ZCKH 4GG6B 1QBAA 2X44D 3QJHB 3X12A 1MUJA 1T1YA 1QSEE 6FABL 3RVVC 3QUML 2B5IC 4BZYA 5B38B 1T5WA 1DBBH 2NX5D 2ESVD 4M7KH 1MCCA 2VITB 2XA8H 3D69A 1FVCA 3GFUA 5F7EH 1FAKT 1E6OL 4AQOA 3TO2A 4JFDE 5BZWA 1CFTA 3EOYG 4CN1A 1R3IL 2BHYA 5L8JB 5E5RB 5C9JA 1ZLVK 1C5CH 2J8OA 4I3RH 3PP3H 4KZEH 3LKRA 4JCMA 4XP5H 2MCPL 4K2UH 3IDGA 1QSZA 1Q9WA 4MD4A 4U33A 4ELMB 3DO3A 3X3FL 5JW4N 1RIVL 3CMOL 3IS1X 5D96C 4RGNC 4GKSA 5KVFH 1P9MA 4ODHH 1JPFA 3WD5L 4HUVA 3BN9D 1H3PL 1NANH 4O58H 4GAGL 4UOW1 2Y06L 3HCVA 1UYWH 4PRBA 4Z7WF 3ZL4L 1NGQH 2DB8A 2ICES 5LGHH 5CCKL 5EIIB 4HG4J 3KXFD 1G9NH 4K8RL 1HXMA 3NAAL 2HWZL 1XGTB 3U6RA 3O45A 4M61B 3UAJC 1KCUL 3UYPA 1NCNA 4HKZB 4U1HB 5A16B 1MF2H 3O6FB 4M5YH 5C0GA 1M6OB 2VDPH 2IAND 4FQLH 3V4UL 3AU1A 4P46C 2BVPA 1C5DA 2W65B 4NN6B 2R4SH 4QT5B 4YHKL 3SJVA 5BV7H 1NEZA 4PY8I 2DWDA 4NZRH 2V2TB 4LOUC 1YQVH 3FO0H 4RAVB 5D2LE 3HC4H 1WT5C 3Q6GL 5JORA 3IF1A 2EYSA 5HI4C 2E9BA 4XPFL 2QADD 5CFHA 3ARGC 4K94H 3MUZ1 1A2YA 1TVBB 4NBYB 3T77B 1FO0L 1I7TB 3ZKXB 1UFUA 3RX7A 4TRPH 5DGRA 4JDTH 5I75C 3O4LB 4LAQH 1S9YA 1REIA 3U0PB 2VE6A 4ZNEA 2ZOLB 3OJDA 3VMNA 3BEWB 3VFGL 3V6OA 2ZWLT 1IILE 1A9EA 1T3FA 2YK1L 4G8GA 4I3RL 4PRPD 4Y19D 4HAGA 5K9QI 2FRGP 1UH2A 4FRWA 3JTSA 4O9HH 4OIAA 4E0RA 4H88H 4LDOB 4LGSB 1FIGH 4LCWB 5FHAH 1CL7L 1K5NA 4LEXL 3TH4T 4ZFFA 2YS4A 3MREA 4P48A 2D0FA 4TSAH 2OJEB 2R56H 4Y4FA 1V8HA 3QEGL 2A38A 1JGUH 5IFAH 2E7HA 4GG8A 2H2SD 3QXDA 3EFDL 3V0WH 2DKMA 1EHLL 3QAZB 2K7PA 1D5XA 5JDJA 2VXTH 2DLIA 4JQVC 1F4HA 1JRHI 4ENED 4MD0B 2AQ1A 2XTJE 2RJMA 4NQVA 3U7YH 4TSBH 4M6OL 1XGQA 2JK5A 5EO1B 3GMPB 4PRIB 3B43A 4GQ9H 3FO0L 1YYMH 5GGTA 5HVHC 3KPOA 4JKWA 4N0FA 4NPYA 4BUHA 5D71H 1BQHG 4OLXH 3WN5A 5A43C 3PQYB 2MSPA 1FZOB 3UPRB 1UEMA 4M6ML 5DK0A 1EXUA 1JGVH 4KAQH 4OCMC 3IDUA 4LLUA 1U8HA 4JDTL 1QHOA 2D0HA 3RGVB 2Z0BA 1HWGB 3SCMD 1A5FL 1HEZA 2OJZH 5DJZB 3MA9L 1RZKH 1G7LA 2A74A 1CBVL 3Q5YA 4E41D 5EBLA 3DXAD 4D8PA 1BF8A 4NQCA 4UILL 1YECH 4P9HL 3MRCA 2DTMH 1CFVH 4YLQT 2XY1A 5L2KD 1XF4A 1QLFA 1FIGL 3PDGA 4L4TE 4FN0A 2IMNA 2EEDA 5TH2B 4F2MA 1ZVYA 3BIKA 5T5FH 3MOAL 4POZD 3T2PA 3T08A 2R56L 4UIKH 2BNRB 3DGGA 1L0QA 4JVUA 2B1AL 2JCCE 3X13A 1QYGL 5CSZA 5D8JH 5EUKA 4MNHB 2WMPA 1QRND 4I2XE 5LAXB 4GRWH 3GIZH 3V0WL 4TUKH 2BERA 1U8KB 5A2JH 1UH3A 4QHUB 4I13B 3PDOB 4S1RL 1WUNT 3ES6B 3QDGE 3QEUB 1KELH 3SE3A 2GT9A 4F33A 5BRZA 3ARYA 4Q6IC 3TNNA 3FT2A 3AXLB 1FPTL 2GJ6A 4TSBL 1BMGA 4YDLC 3SDYH 4R96A 5ICYA 5JIPA 3TFKC 25C8H 1HH9A 1FV1A 4KVCL 1DZBA 1WWWX 4L8BB 3TIDB 1WZ1H 4ODXB 1SJXA 4XMLH 5CMAA 2DQJH 4HS8H 3ARFD 4FQXB 3D2UA 4PJ7A 4HK0B 5AG8A 1YC7A 3HE7A 2DYPB 4XPAL 3BDBA 4HZAA 3QDJA 3CFDB 3VXOB 3K8MA 1KEGL 3MCG1 3NIDF 3OR6B 4LPTA 4LVNB 1WGOA 2VWEE 1LO4H 4G9FE 1HCVA 1JHTA 5BJTB 2Y25A 2Y07H 1OF2A 1IEAB 1P7QB 3C60D 4CVZB 3OKLB 4J23A 4NZJA 1MI5B 1HSAB 3IT8D 4QF1A 4PBXA 1KJVB 4FQQA 5I1GH 5E9DE 4G6JL 4ZFOL 1I1AA 5INDA 5DRWA 4HWEL 1M7IA 2J3SA 3QJFA 2Q3AA 4OUOA 3WFBH 1EZVX 1LP9E 2PCPA 4KKBD 2P5WB 3VCLA 5IB5A 3RJQB 2FLRT 4PJCF 4UUJB 1UVQB 4IM8A 2H2SC 5FYLE 5T5FL 5D93C 4NNPH 5F7NC 1F6LL 2HTLC 4Z7QF 1E4XI 5HSFA 4PG2C 5IBLD 1LK2A 5IF0B 1FZKA 5F1NA 2K1MA 3ZDYF 4ENEC 1ACZA 4LVOB 5E00B 4P2OC 1JF5A 5DJDA 4LFHG 1UA6H 1NGPH 4AJ0A 3QG7H 2EEAA 5SX5H 5F9AC 1EERB 1F58H 2EDRA 1KGCD 3EW3B 2WQRA 3TT3H 3IFOB 3B9KA 4JN1H 3VXNB 5JLZB 1CD1A 4NJ9L 5E6IC 1V7NL 1S7VB 2VLKB 4UI2A 3RIFF 3QXAB 4KGJA 4HX1B 2EDNA 2OSLA 4C56B 3QCVL 5GIRA 4XMLL 1BP3B 3EOTH 3L7EA 1JL8A 3GSVA 1IFHL 2GUOA 5KZCD 2Z91A 4U1GC 1AQKH 5AUMA 3SCMC 4ZTOL 3I9GL 1DSFH 2MQCA 3BAEH 3GMLA 5IFHL 1I8IB 3QHZL 4HEME 2Q6WB 2AKRA 1EO8L 4GMTH 2WM0A 3SQBA 4PS4L 2BY0A 2VXQH 1MJJA 3BZFB 2R0KH 1TNMA 1S78D 4PJFA 3MBEB 2Y07L 4HIEB 4I77L 5HD8C 4M1CC 3O3AA 2DD8H 2Z31B 3VI3E 4X6DF 3QWRA 5ACZA 3HPLB 4O2FA 4X5XB 1LVEA 3KPRD 1XGYH 2EXYD 3HI1A 3W5MA 4EZMA 4POZC 4U0RC 3WFBL 2FZ3B 3DRTA 1B6DA 5EU4B 3QUZD 3VH8G 1XT5A 4JY4A 5HGAA 4JPIA 5A40E 3OKKA 5DRXB 5AAMA 1I3UA 1OGTA 3OV6A 4JE4B 4Y88A 5C0CE 2BJMH 4NNPL 2CJUL 2OK0L 4PLOB 1S7XB 3F5WB 1TVDA 5C6TH 1WCBA 2ZOKA 3VRIB 3SKUD 4FXKA 2Y6SC 1FGVH 5HDBF 4Z7OE 1X4ZA 2M2DA 5C0JA 4PR5B 3TN0B 3RDTB 4JFPA 1NGPL 4LPYA 3ECBA 1WBZB 1B0WA 3EDDA 2C26A 1KLGA 3QI9C 3S36X 1FVDA 3PUCA 2XWTA 4U1KA 3RWJA 3DBXB 4NCC2 3ZYIA 5EORL 2BRQA 4GKOA 3TV3H 2J7LA 4ONFH 1J5OL 3UYOD 4TUJA 5KVGH 2DLFH 4Z7VA 1GH7A 2HJKB 3GK8L 2FBJH 4M8VA 4YIQB 1RZ7L 3SKJL 3MUY1 1J8HB 1HILA 1FH5H 1JMZA 2VDNH 5C8JB 1AI1H 3K80A 4PGEA 2NW3A 3ZYOA 3QZWG 4OFYA 1I9JL 4GXVH 4NO3A 1NFDE 4K3DH 3HRPA 4LSQL 3MBXH 3O6FD 4OGYL 3C60C 3MXWL 3UROR 2L7UA 4Z0BH 4NO0B 1C1EH 3G5XB 2HT4D 43C9A 4QXUL 4R7DB 3BGFC 4KKBC 1NC4B 1CD9B 1NCDH 1MFNA 3C5SA 4K23H 1CWVA 3TO4A 3VGEA 4YBHA 1CGXA 1ZHLA 2XWBB 4GRWB 5IBLC 1IAII 1I7ZA 4KHXL 4D3CL 1ZTXH 3AY4C 2CK0L 3AFLA 2C3VB 1JJUA 2IJ0C 4YPJA 3JV0A 2C9AA 2BNQD 1S7WB 2VO5A 4QRRE 4MA1C 1F4YL 5FYKE 3EO1B 2A6DA 4XP6H 5SWZD 3UDWC 3LKNA 2J2ZA 4LIQL 3VFTB 3WHXB 5JPNB 32C2A 1JGEB 3NFPB 1FGVL 4ZDHB 2WBJB 2FWOA 2H2PD 5F89A 2DIBA 1P7KA 2VTFA 1S5IL 2X4QA 3W9DA 1OAKH 4N1EA 5IM7B 3NCYP 1KYOK 3EAKA 3D3VB 3D39D 4YBQD 1KPVB 3U0TB 5D9SB 3GSQB 1KIQA 1I1YA 4B50A 3DVGB 4MJIA 5KSBA 4J3UA 4GRLC 3CZFB 5SWQB 5ITBH 2GCYA 2V5YA 4PG9B 4G6KL 4ZFGH 2XNAA 1S78C 4LCCA 4OLVL 2IH3B 2P8MA 1OSPL 5GGTH 3MBXL 1I9RL 4AEEA 5IOPB 2DQIH 2FSEA 4OZGE 2BSRB 5ALBL 2DWEA 4PJ8C 2IQAA 4LFHD 1VPOL 2PN5A 4YDKH 4PJBA 3BH9B 2K3TA 1QFHA 3GI8H 3QUZC 4X83A 4X9GA 2V2XB 5JUEL 2W1NA 4YPGB 5ANMB 3KPSD 4OLUL 5KS9E 3HPJA 4O4YL 3BPOC 3HNVH 4K23L 4PY7B 2FEDD 4ZUTB 3VXSA 1OW0C 3MRJB 5D5MB 1WFTA 3KNBB 5EO0A 2BHUA 3RP1A 4JJ5A 5HHPA 3PQYD 1HHKA 1XCQB 43CAA 2Y7QB 2P8PB 5C92A 1SJVA 1H5BB 3BXNA 1T0MA 4KRLB 2DTSA 4ISVB 5F1IB 5DUMH 5GGVY 2XXMB 3VJ6A 5IHUH 3WL9B 4YHML 3MRLB 2YHGA 4O5LH 4M62L 1DE4A 4APQA 1I8LA 1MHCA 4ZAKB 4J6RH 2GJZA 1F97A 3TNMA 3RUGB 3U30B 1CLOH 3ARXA 3ZDXF 5IVZB 4WV1C 4EQ2A 1NEUA 5A3ID 1IC1A 4PJGA 2CR6A 3AREA 2YR3A 3P9LA 5JW4Q 1OLLA 4BFGA 4ODBD 4EUPG 2LVEA 3HZKB 3EYUH 4KDVA 4C55A 4OM1H 3BP7A 2UY7A 4JKPH 3TLRA 2VZ1A 3O6FC 5I74B 3CFKB 3MFFA 1QTYT 4I18B 1SEQH 3WS6C 4V2CB 4CKVX 3C5JA 5DD0L 5ITBL 1CU4H 2HT4C 4YUEL 3I6GB 5IHZB 3DVNB 2C3HA 4NN6C 4BH8A 2DBJA 4HH9B 2BOBA 2E7BA 1CD8A 5GGTL 1UCBL 2YMXL 12E8H 1S7RB 2BNUB 4DGIH 4YDJA 1MQKL 2ERJC 1YYLL 3D69B 1DVFA 1U3JA 4QXWA 1WFOA 1GC1L 2B39A 5E8PA 5BZWB 1U36A 3RVTC 5C9JB 4RDQG 1QSEA 3G04B 3QXTA 3LKRB 3MROA 5C2BL 1KC5H 4LKXA 4L29A 1KPRB 4XPTH 3IDGB 2ZUTA 4Z7UE 1TZIB 3HNVL 4OUUB 3ZKXC 5I1JH 5DJCA 4ZUUB 5IV2B 5GGRA 4FABH 2DYPD 3GSWA 4XP9H 4L8CB 1TETL 4JFDA 2BP3A 1JPFB 2FEEI 4UV7H 1VGKB 4TNWF 5E8DH 5E94A 5H37H 3GMNA 1KPUA 1KUMA 5LXGH 2GK0A 4HMDA 2ZUYA 5CWSB 5DVKA 2VSCA 2H2PC 2SEBB 5IK3A 3TJHD 4DAGL 3BKJH 4NWUH 4JY6A 2K7QA 1CK0L 4FS0A 3BIBX 1XIWA 4I48B 3NIFE 1G7MA 1PKQB 2UZXB 4DN3H 1II4E 2BRRL 2W9EL 4AEHL 5GZND 2HMIC 3GRWL 4YBQC 3AU1B 3OKYA 4JO4H 4X6CE 1DL7H 4POYA 3SJVB 4WO4B 5IUSA 1E4JA 2AAVA 1PYWA 4RMWA 5BQ7B 1J1XH 2IFFH 1T04A 4X0KB 5FGRA 2Y4SA 1AGCA 3LSOB 4G8FA 3NMEA 4I0PA 3VFRA 5CHNB 4P2QB 3ZE0E 2KBGA 3ZYZA 4QHMA 4ETYA 5BW7C 3MGTA 2XACC 2E3VA 2XZCH 1A2YB 2AV7B 3SE8H 2X42A 3QIUA 5D2LA 4Y5XB 3ULSB 5M95B 3MV8D 4F7MB 5FK9A 3O0RH 3TWCL 5B39A 2VDLH 3BSZL 2C1OB 3WXVL 2FEDC 3TF7C 2FHFA 5JHLL 3RNKA 3U46A 3JTTB 2DBLL 3S6CA 4WI9A 2E7CA 1A9EB 1KC5L 1GGBL 1YC8A 4DJMA 1HZHL 5EBWA 1S9WA 1H3TA 5DHVB 5ENWA 2OLDA 2Y5TB 2IH1A 1DLFH 2DLHA 3ULUE 5I1EL 3FO2A 2ID5A 4XP9L 1K5NB 3H3PH 4W4OA 1N64H 5FUZL 4ZFFB 3RGVC 4MNQD 5E8DL 3SN6N 1EO5A 4WUKL 5HGGS 3MJGX 1W72A 2HKHH 4PJDB 5D7LB 5DO2D 3RWGB 5F7HA 4N8VA 4PGBA 5C08E 1U8PA 1KIUA 5CGTA 5L8KB 2VYRE 4WU5B 5A3IC 5D1ZB 2Z31D 3BYTA 2XYCA 1VACA 4BA8A 1JGDB 1MCOL 3ALXA 2XN9D 2QSVA 3RX5A 8FABB 1NLBH 5FKAA 4NQVB 3VGDA 1KIPA 5ILTL 4GKZB 5HHOE 5EOTA 2EE6A 2DDQH 1CI5A 3LB6D 4Q9CA 2YEZB 4XVTL 3PWPE 1QVOA 5LG1A 5J89A 1WWBX 3WN5B 2R0WH 1QOKA 5I8EA 3TBSB 1WIOA 3HZVA 4FP8L 4LP4A 5DK0B 1EXUB 2J6EL 5DUBA 2Y5EA 4LEOB 3G6AA 1KENH 3KWWB 4GW4B 3U7WL 2X4NA 4LLUB 5E7FA 3RDTD 1SYSA 3CX5J 5I17A 1DUZB 4NUGH 3T4AA 1C08B 3WEXA 3ARWA 4I0CC 3RPIB 1IBGH 2JTDA 2DJ4A 5EBLB 4IRJB 4FQXC 4NQCB 2NY0B 1KIRB 5E2TH 3TCXA 4XWOD 4KRPB 5CUSL 5T1DH 2PW1B 4WHCA 1BQSA 5CKAA 2HH0H 3TZVB 4DKEH 3S36H 3QQ3B 4NZTL 5GGSY 3RWDB 4EBQL 1GZQA 3GNMH 4GKNA 4LVNC 1R3LB 3PJSB 1RJLA 1PZUB 3HHRB 4F2MB 1E4WL 3TJHC 1N64L 4ZS6C 1UM5L 1GGCH 3BIKB 4FQ2H 4N0CC 4XXCC 1BFVL 3FZUC 5GRWA 4J2XA 3QG6B 3RWIA 1QQDA 4K3JH 4WFHE 2AGJH 5CSZB 5GZNC 5JNYB 4OCYL 1T20B 3HN3A 4GFTB 2IEPA 5LWYH 4PGCB 1LE5B 4L4TA 3HI5H 1A1OB 4PLKD 4UU9A 1BBJA 3R8QA 4UTBH 1QPPA 5JMOC 5F6IB 3K46A 4PV9A 5F7KC 4HW6A 2XKNA 3MACH 3U36A 4E42B 4HEPG 1EEZB 2VXSL 4JFFD 1KACB 2FD6L 4I2XA 5F7LB 4ZQKA 3QFDB 1P5VA 1R3JA 5C0IA 3EOBB 2C7UA 2MJWA 3S88H 5ICYB 4NUJB 3QUXD 1FV1B 3RVWD 4WW2B 3HNSH 2GFBB 3B2VH 4FNLH 3A6CL 3QDGA 2WLYA 4LVOC 3IJYB 1CDBA 2ICEB 4PJ7B 4OB5L 4P57A 4RAHA 3GO1H 2R0WL 2NLJA 4OLYL 4PJEE 3QQ4B 4L5FH 1PX4A 1T83C 3BP4B 2YXFA 1FE8H 4JHBA 1CVRA 1K4CA 3CPLA 5DQDH 4ZYKA 4NUGL 3ISWA 4NN5B 4OCWH 5T3XE 4U7MA 1U3HB 4Z78A 5JPMA 4RGNE 5JDSA 4ZTPL 1U8JA 2RCSL 3RJDA 3B6SB 3D3VD 4I9WD 4QF1B 5GRJL 5ITFB 3MLZH 3G08B 5KSAA 5T1DL 1SQ2N 2E9WA 1U58B 3AMLA 3BHBA 5F9JA 3D48R 1M7IB 3QJFB 3GBMH 4DKEL 3HMWH 1AO7E 1LO5A 1NJ9A 4G9FA 3TIEA 4KZDH 4X6BA 2FO1A 3BP6A 4GBXA 4GT7A 5EH1A 3SDAD 5JOPE 5FYJD 1J1OH 1GGCL 3MBEC 1NBYA 1WBYA 3AAZB 5E9DA 4L9LA 3TBVA 3BQUA 3P0VL 1FNEB 2Z31C 1JPST 1EVTC 4K3JL 2R1XA 4OLWL 1LP9A 3I2CL 4YZFF 4P4KA 3QP3A 2XZAL 2KPNA 3WLWD 3LKQA 5DJDB 3MR9B 5KOVC 2EYTB 1MCQA 4K9EC 4XNXH 3ABZA 3UJIH 3QISA 3LB6C 2G5BA 5CS7A 4NBXB 4L3ED 5K9KA 2JIXD 1DUYA 1H8SA 3K4DA 3B9KB 3JUYA 4AENB 3O2DA 4I4WB 1V3KA 3QIWB 1OP3K 3KR3H 2DJSA 1PY9A 2H26B 3IU4L 4BQBA 3L3KA 3B2VL 1AHWA 5GIRB 1CXLA 4LQFL 5CZXC 2Y36L 3AB0B 5F3HA 1F90L 1U3YA 3DYOA 3RDTC 3MRIB 5DK2A 5GS0H 1I3RA 3DX7A 2Z91B 3WNMA 3RWFA 2B2XH 1BREA 5CJBA 4L5FL 5DZNA 2E9JA 5D7SL 4HS6B 3LKOA 3MGOA 3JV6A 4ZAKD 4IIQB 4XCNA 4XBPA 4XWOC 2ATPB 3DURB 3IAQA 4J4PA 1DDHA 4HC1L 3G9VA 3THML 1KJ3H 5ACZB 4NQXA 2NY6B 3C6SA 4N8CL 4XP4L 4PREB 1KTKE 4G80A 4HFWA 3Q5OA 2QKIA 2H8PA 2A9ML 5FO8A 2OZ4A 1ACYH 2X89D 5ADPH 2IFGA 4JO3H 4KY1L 1QLEL 4RMUA 1OGTB 2UUDH 3J7HA 4PLKC 2O5YH 4A6YB 4X99B 3T3PE 4JGUA 4XPBH 3T2NL 1QA9B 1WLHA 3NGBB 2ATKA 4K7PY 1U3ZA 4DZBA 2ZOKB 3MO1A 5GHWL 4FXKB 1N6QL 4Z18A 5D1QD 2O5ZL 5C0JB 3QULB 1A02N 5C0CA 4JFPB 1TPXB 1YPZB 2F54E 1D5IL 1KLGB 1FVDB 4QRTB 3RVWC 3B83A 1VSCA 3UTQA 3O3UN 2BVOA 2ESVE 1BWWA 3D87B 2ARJA 5J1AA 3LPGA 5EUOB 4KV5E 3NFNA 2HN7B 4QHLB 4DVBB 2L0DA 4R7NB 4TUJB 4ZUVA 3V7MA 1OCWL 1A9BA 2EDDA 1CF8H 1JZ4A 3FRUB 4J3XA 3H42H 4MA3B 3K4AA 3ZT7A 2WBJC 4V1DE 3UJJL 2NW3B 1JNLH 5DR5H 3OJ2C 4G42A 1IC4L 3IXAA 1RHHA 1WVZA 2B2XL 5AZ2H 4KTEH 3VD4A 1RUPH 4FG6C 2WQ8A 4JRYD 3VGFA 4OQ1A 2EDOA 1ROWA 4Q97A 5FCUL 1WCQA 4ODSH 2CO6B 4HWBA 5IR1A 4XMKL 1SJHA 2AEQL 1NFDA 1YA5A 3HUJB 2FX7L 2CUHA 4NIKB 1AFVL 5FM5O 3SDAC 2HT3D 1S7UA 3Q6FA 2IANE 4RFEA 3ARUA 3TO4B 3SOBH 3CVHL 1MQ8A 5CEYA 2AJ3A 4P2QD 4Y5YA 3OJVC 3ZKQD 1HK6A 3OR7A 1I7ZB 1TZHB 5ADPL 1J0JA 4YJZL 3WLWC 1MCNA 3FOMA 3NFSH 2IG2H 4NQTA 2W60A 1CFNB 4JY5L 3HFMH 3PL6A 2A6DB 2A77H 3FB6A 1JGLH 3QA3A 3LVEA 5MENB 2CDEB 1B88A 1X6LA 4LLQB 4MD5A 4PTTA 1A7PL 2X5PA 4Y5VA 2FWOB 4WWKA 1U91A 1X5ZA 3DV6A 1P7KB 4RWHA 2VXVH 4G43A 4QRRA 5I73B 2X4QB 4ORGA 5D4QA 1W72H 2Z4QA 4GLRI 2B4CH 2ZKHL 3SQOL 1HKLL 2BSSB 1T1XA 1T21A 1UWXH 2R4RH 4LNRA 1H5BC 1M7DB 2CKBA 3QRGH 2X70A 5IQ7L 5FM4A 3OAYK 1HH6A 2OP4H 4NCC1 4M5ZH 3L3GB 5KSBB 1JYVA 3BDYL 4MHHI 2AABL 4Y19E 2DQDH 4OI9A 4UZGA 4ZAKC 3HZYA 2WLZA 1CLYL 3IFNL 3G9AB 1AE6H 4R26L 4KQ4H 4X4XA 2EIZA 1CQKA 1CS6A 2FSEB 4U6VH 5TE4H 3M8OH 3D1MC 3FQNA 2FYYA 3CSYA 2ZNWA 5ESAA 4LSPH 4YHOL 5DWUL 1G7PB 3WKML 2F8OA 4FQHB 1DQQB 5I74C 1RSFA 4I18C 5MEPB 5GS1A 2FX9L 1F8TL 5T5NF 3VXSB 1HSBA 4OZGA 2V9QA 1XR8A 4KI5D 5HHPB 4OD2A 5KJRH 1HHKB 3LIZH 1QUNA 5ISZE 3RWCA 2OYPA 1Z6JT 4HJ0C 5JO5A 5KS9A 4RZCA 1G1CA 1E6JH 2FGWL 5D1QC 3FB7A 5EPMB 5F7UA 3MJ8A 3T0EB 4Z7NF 5FGSA 4ZUWA 1DANU 2RHEA 1GAFH 5BS0D 4LAJH 4HHAB 1AP2A 3I3EA 4IRJD 1LE9B 2V2WB 1EMTH 4P2RE 1G9EA 3DSNA 2HJLA 3HMXL 5GPRA 1YNLH 1DN0B 3TZVD 3QUMB 4QRQB 3P9LB 4UOJA 2IWGA 1C7SA 1W0WB 4YBLC 4XB7A 4QRSA 4YWGH 3NN8A 2FHBA 1TNNA 3WS3B 3QHFL 2VL5A 3GBNH 3PNWA 5FGCB 2FJHA 3MLUH 3MCKA 1KB5B 3DMMD 5C0AE 5I18H 5L2KE 4XGZA 1IARB 4PJXE 3EJYD 3ZHKA 3FHQA 4BH8B 1CICD 1JWMA 1G6RA 4WO4C 1IZJA 4MX7A 5C0BB 5FYKU 1AXSA 3ZE2E 1XGRA 2BOBB 1EFXA 5EU5B 3NACL 5I1HH 3OHXA 3N0PB 4JZNB 4YDJB 1HQRB 4H8WL 1HCFX 4GSDL 2PW2A 4LSPL 4LPUA 3WIHA 1QRNE 2AK1H 1OAZH 3GKZA 3MRMA 1YMME 1KEMH 1WAAF 2AJVL 3MROB 2AS5M 1Z9OA 4LKXB 2ITDA 5C3LD 3MLVH 3PWNA 5DJCB 2Q86A 4Y5XC 2IQ9L 3FQWA 4HWUA 4IDJL 4JFDB 4J3VA 5DVNA 5JQ6L 3L1OL 1FYHB 1DTUA 4Z7UA 2BDNH 5DVOA 3ULVF 5CINH 1JWSA 1UQSB 2EC8A 5K9JL 4OV5A 2IC2A 1MLBB 4X7CC 4K3GA 1E4KA 3IDJA 1ZHBA 3Q1SL 1U3HD 2JJSA 4HK3N 5IHLB 1KCSH 1CIDA 1KFAH 4OJFH 1BQLL 3P2TA 4HUWA 4LARH 4ONGH 1M4KA 3QCTH 2MWCA 4BQ8A 3VI4F 2A9NL 1FO0B 1NC2D 1NMBL 4YE4H 4QXTA 1CDJA 2NY7H 3H9SB 3MMEB 1ZT7B 5FYLH 4X6CA 5E8NA 5D1ZC 3VFRB 3GBNL 2D7OA 4QOKD 3QFJD 5E99H 1ZWIA 4DUVA 4TVPD 4HGWB 1X7QB 3O2DH 4PJIE 5CBEA 2YSSA 4EDXA 1HHHA 2V5TA 1T89A 4NGHL 1XF1A 3BZDA 3MV7E 3LQAL 4MNGB 4HV8A 2DICA 5EU3B 3KYMB 2B1HL 4OZIA 1A6UH 4LPWA 1WBXB 1DQLH 1HHGB 4OZHB 4KI5C 3ESUF 3F7VA 5DSCB 3I50H 3IU3B 2YN5A 5C2UB 5DA4A 3MCLL 4D0BB 3TVMD 4TN9A 1FJ1A 1A6AA 1EBAA 4EN3D 3IJSB 4UINH 2IH1B 1OAYL 1MAMH 5E2WH 1AKJB 3OB0K 3TM6A 1FNHA 5HHVH 1DFBL 5D72L 1S5HB 1U0QA 3K0WA 1BVLB 1W72B 2WIIB 1CGUA 1P4BL 3SGEH 4IRJC 4PGBB 1U8PB 3FRPA 1ZE3C 4KRPC 4KVNL 4LK4A 2XZQH 2OZ4H 4RWYH 1CXIA 2AW2A 3LD8B 3TZVC 3OKNB 4NKIL 1MVUB 1VKXA 5ID1B 2NY6D 3PWUB 4BK4A 3FO9B 4R4FH 3VWJA 4F58L 4GAFB 5C08A 2JJTA 4OF0A 3OF6D 3G5VB 4YDVB 5FKAB 2X4TB 1N5YL 5I30L 3PIQA 35C8L 3CFJA 1WF5A 3KPQA 4AY0A 1AGFA 4YHPB 2QBWA 1WZLA 3ARRA 2IPUG 2X1PA 3EJYC 1RZFH 1CICC 1GL4B 4OZFB 1FNFA 1OL0A 2XTJB 1Z5LA 1YN7B 1B90A 3QH3A 1O7SA 3VFWA 5HHOA 1NGXA 3ARZA 3KPPA 1DBKH 4U7KA 3SBWA 4WTWA 3LN4B 1HWHB 5D6CA 3MQIA 2X4NB 4OGXH 2Z93A 1VA9A 1ZSDA 3PWPA 2EEBA 4NHCH 4G8EB 4OCXH 4XBGB 4GG6E 1KT2A 5EC1A 3BPLB 4WW2C 2VMFA 2YA2A 4FZEH 1A6VL 1A3LL 4EOWH 2DQUL 5ESQA 4GUPB 1C7TA 3RZCA 2J8UB 3Q0HA 3D85A 3QUYD 4K3EH 1IM9B 5TPWH 4CNIA 3KPNB 3IXTB 5KG9B 4Q7DA 3BE1H 1NGZA 3Q3GA 1U95B 3T0BA 3FTGB 3MLYH 1I3GH 4HWBH 4JPVH 1IAIM 2DQHH 4ELME 2KKQA 4PD4K 1IL1B 1MFDL 4NN5C 1I4FB 2HFEA 1U3HC 3C5ZA 4ODTL 1YUHB 2WZPD 1JPGA 1Q94B 4P23D 1UT9A 3OG6B 1OB1A 3PHSA 3VW3H 4L4TB 3ROLA 3U48A 4MB3A 1FFPB 3WFHB 4UU9B 5LCVH 3W39B 1F11A 1MFAH 3WIIH 1YEJL 1R5WA 5F1SA 1B4JH 3TA3A 1RQ5A 2BVQB 1A7OL 4YXHH 4DKFH 1R0AH 4ZQKB 2UZYB 4JM2F 5FA3A 1FRGL 2C7UB 3X14A 2XRAH 1YEGL 4ZOAA 5HHQA 1RPQA 3DGCR 3I75A 1F2QA 3VXMB 1RZFL 2F5AH 3MYZA 4URTB 4P57B 5FYKH 1CXFA 4P4RB 4JQXA 2YKLL 4LCYA 5JIIA 2CKBH 4PV8A 4YNYA 1U93B 1CLZH 1AIFB 3KG5A 3SDXF 5MEND 1JN6B 4LASL 3O6KL 5HPOA 1YEHH 3U0WL 4CW1A 3QIWC 1FL3A 2FL5A 3W9EB 3CDCA 4NKMB 3PHQA 4EN3C 3O4LE 5SWZE 3ROOA 2ZCHL 3VFOA 3HR6A 1J10A 1FC1A 2NY2D 3BKMH 3D25A 4PGDB 3BJ91 3RWEA 5DJ2A 5IIEA 1BOYA 3FN3A 1LO5B 3NCYS 4HPOH 3TIEB 3R1GL 2WUBH 5CGMA 1F6AB 4IIQC 4Q58C 1NQBA 5E5MB 4RGOH 1NCCH 4JM4H 4PJHF 5BVJA 4LCWE 4R4BA 1MFEH 3TBVB 1X5FA 1HHIB 3V5DB 3WKNA 4AIXA 4NQUA 1AO7A 1LK3H 1GGTA 2GTWA 1LP9B 2NY6C 2XV6B 3CZJA 5CJQL 3QO1A 5MI0B 5ICZB 1A6ZB 3CXDL 1CGSH 4I5BA 4M43H 5T3ZL 2F8VA 3LKQB 4M7LH 4HUUA 4P46A 4FTVD 4ZXBD 4HCRL 3CSPA 3OQ3B 1B4JL 3WNPA 1EHNA 1YN6B 3CLFH 5GRZA 3EHBC 4JFZH 4BQ9A 4XBEH 4LCIH 1R0AL 3VFMB 1OWRM 2GYSA 5E6YA 1MEXH 1R24B 1BFSA 2XRAL 3NGBC 4UQ3B 1WT5A 2EDFA 5DMJB 1KXVC 4PRIE 4U6XB 1AC0A 3I6LE 3H3KA 3KPSE 4YHNB 2DM7A 5DMKA 3CDGA 3PWVB 3CH8A 5F3HB 2I9TA 5BXFA 3ARGA 1YJDL 1TPXC 3HNTL 1A7QH 1EGJA 2QQQA 5KANG 3LMJH 3NPSB 4JZJB 3MRPB 3PQYE 3T4YA 3S4SB 4JFHE 3JWOC 2NTSP 3K2UL 2NYYD 4JO1H 3TCLB 5ALCL 3JV6B 3I02A 1RUMH 4XBPB 2AI0H 1UACL 1ZANL 1L7TH 3ALPA 4Y7MA 1R5IA 1XR9A 2MTPA 4JAMA 4JKLA 2DN7A 2OMBA 5DQJA 1MPAH 1G6RH 4Z76A 3L95B 5E2VL 2NXYB 4G80B 5DEGB 4Z95H 3EJJX 3IDXL 2C4FT 4JM2D 2QKIB 4G6FB 3TT1H 2APBA 1MREH 3I6KA 1I7UA 5LQBL 3WIHH 4HPYH 5CP3A 1L9MA 3GUTB 4OD1L 1JIBA 4POUB 1CFQB 3QWQB 1X5XA 5C0BD 4XTRD 3PG2A 3L9RA 1N5AA 5C07D 2BNRE 2W9DH 4UB0L 3V0VA 3MO1B 4X4YA 1CGSL 4LU5H 4FFZL 4F7PB 1NUNB 1T0NA 1DEDA 1WK0A 4JQVA 3T1FB 4K8RD 3S34L 4NC0B 1T03L 5DYOB 3RL1A 1Q0XH 4HFUL 3UTQB 4TTDD 3RI5F 4LCIL 3DUUA 4HSQA 2DQEH 4R90L 2OBGA 4WUUB 5I8OH 1PSKL 2YRZA 4FQIL 4KPHL 4DFHA 3P9MA 5IB1A 1A9BB 1MCPL 1FDLH 1CCZA 1WFNA 1QEWA 3B9VA 4S2SB 5DJAA 5TGBB 2ESVA 4IDLA 1NGYA 2CIKA 4NC1C 1OM3H 4AL8L 1C12B 3BPCA 4G42B 1A7QL 2Z9TA 5KTEH 5D7IF 1QLRA 1HIML 4IHOA 2P48B 1MRCH 1NH6A 2A6IA 4JO1L 1AY1L 4MCYA 4HIJB 4HIIA 3VFNB 2NY2C 2IPTH 5E6ZA 5F8RC 4V1DA 2WUCL 1HE7A 2CK2A 3S98A 4C83B 1SJHB 3B5TA 4QHNA 3JZ7A 2AP2A 3MC0A 4MQXC 1Q9LA 5IB2B 4BFIA 1N59B 1NFDB 4ODWA 1IGFL 1LO2H 2JLLA 3H9SD 1YEEH 4XNQA 3RHWF 4AH2B 2VC2H 2VDMH 4U1LA 1MI5E 2PYFA 4XI5D 1C16A 2AJ3B 3OR7B 2YD2A 1KNOB 1ED3A 3MUGA 3UTZA 3FFCD 4JFOA 3FOMB 3G6JF 3ZLQC 4WEBH 2IANA 5EOQL 1H0DB 4ZXBC 3PL6B 3QA3B 1HN1A 5DQ9A 4HF5L 1FYTB 4MD5B 3O3DA 3JWDH 5EZIL 3OKEA 1PW3A 3DV6B 3E1F1 1S7TB 4G43B 5EFIA 1Z0NA 2Z4QB 4Q6IA 3KYOA 4CMMB 2P5EB 4OM0L 3O11A 5ETUB 4Q9RH 4JG0L 5F70A 3VE0A 1SM3L 1HYRC 2X70B 1Y6NR 3L3IA 3NCEB 3ULUH 1BJ1H 3BUYA 3DNKA 4X7EC 1MIMH 1A0QH 5AWNL 2F74A 1HH6B 3P3YA 4JR9H 3T0EC 3TESA 3CFEB 3N85L 5FB8A 3MV9D 2VLKE 2DI8A 1B4RA 4EJ1C 2PR4H 3HZYB 4C56E 1A4KA 2OTWA 3C8DA 5KSUA 1EPFA 4F9PC 1KG0B 4U1JB 3RRQA 3T0XA 3HC3H 2C5DC 3AUVA 5DJ8B 1TITA 4MNQE 1KCRL 1BLNB 2BY3A 3MYJB 1CGWA 4Y19A 3QPQD 2IPTL 4YR6A 1MJ8L 2YD4A 3CSYB 4LSRH 4GRWF 4X7TB 1TJHL 3UPCA 1N7MH 3O2WH 1BZ7A 3L3JA 1FNSH 3BKCH 4LSSH 1A6WL 1V7ML 2Z92A 4GO6B 2VC2L 1HSBB 3NZHL 3RAJH 1XR8B 4C4KO 4XTRC 1YEIL 4KI1A 4LSUL 7CGTA 1P69B 3O3BB 5IROC 3OMZA 1MWAL 1C5BH 3C2AH 1CZ8L 3LOWA 5I8CA 4Y89A 5JO5B 2AJSL 4RZCB 1EIBA 4PG2A 2H45A 3DARA 3MJ8B 4K8RC 4KTDL 4ZUWB 4P2OA 5KN5B 5ISZA 2A73A 4Z0XB 1HHJB 4R3SB 2R9HD 3SDCD 2IADB 1RHFA 3VDBA 5F7DA 1AGBB 3EOAB 2AV1A 2CH8A 1IZKA 1G7HA 4YFLF 1NLDL 2X4SB 4HT1H 5I8KH 1SYVB 5E6IA 4F8TA 3ULUL 3RY5A 1HOCA 2Q3ZA 1ZT1B 3DTXA 1ETZA 3L5XH 2CDFA 3P4MA 4NRYB 4F7TA 3IGAB 4HUXB 4P2RA 4QRPB 2VL5B 2OI9C 4LVHB 4M93B 2FJHB 1Q9KA 3OG4B 1J8HE 3SCMA 3J8F7 4M7ZC 4DTGH 1G6RB 1AXIB 1OARL 3R8BB 3RTQD 1EZVY 1B0RB 5IMLA 4PBVC 4UDUA 2XQYG 3OHXB 5D5MF 2AJYH 4PJ9D 2Q76B 2PW2B 3FQXB 4D9RD 2PF6A 4WFEE 4XI5C 5C0AA 5L2KA 1S9XA 3O2WL 1EAPB 4PJXA 5I1IL 3MRMB 2YD8A 5L0QB 1RJZB 5GRUL 1UXSA 2ZSVA 2QQLH 5B4MD 1YNTA 3G6DL 1U8MB 2Q86B 3M1BA 2MHAA 1I9EA 4JFFE 4U1IA 1QRNA 1NDGA 5IB3A 3FT4B 1YMMA 3MLRL 4K55A 4KHTH 3BZ4B 2ADGA 2Z35A 4RSVA 4LLDA 2I9LB 4KDWA 4M6NL 2NY1D 3K4ZA 3LY6A 4RMQA 4MA8H 4M8QA 1ZHBB 5T3XH 1NEZG 4ALAL 1CYGA 1WSST 5ADOH 3W2DH 1P4IL 5HHMB 2NXZD 4HUWB 3UTTB 3V6FA 2JELH 3QI9A 4KKAD 5H2BA 3ZE1F 3TBTB 2AEPL 4KWUA 4BZ1H 3MRHA 4HT1L 1UXWA 4QXTB 2OL3A 3GBLA 5ID0B 2I25N 2NY3B 4KK8C 1J7VR 4KJYB 3D3VE 3INUH 4X6CB 3MRQB 3LD8C 4M3KB 1XEDA 2VQUA 4PLJD 4NFDA 5DJXB 2VABA 1LNUB 4KJPD 3TEUA 3QPQC 4N1HB 5D1XB 4UV4L 5CBEB 1HHHB 4WTZA 2DMKA 1T5XA 3C60A 3ZSTA 2DAVA 1CL7I 2VAAB 4JZOA 5JW3L 3OZ9L 4XH2A 3RKDD 3RU8H 1I8KB 1WEJH 2PXYD 3VXPA 1BM3L 2IPKB 1IC5H 1Q1JL 2GY7B 3U2SB 3UJTH 4OZIB 1JRHH 4PJIA 1EGJH 1Y0LA 1IAKB 3ILPB 3F7VB 1NKRA 3IFPA 4IOIA 1UWEL 4P9HC 2G9HB 5J57B 2AK4B 3I3DA 2DIJA 5GGSA 4DQOL 5ABDE 1E0OB 5DUPL 1D5ZA 3GSOB 3AY4A 5GSVB 4L3EE 3WIFB 5CJ8A 4ZPVA 1LEKB 4ORZC 4D9LL 1W8OA 4S11A 4KHTL 1UG9A 2PYEB 5E4EB 4KJQD 5GGQH 4DGYL 5IW3A 4NT6A 3LS5H 5GGUA 1IT9L 5IW1A 4JDZB 3UDWA 4YDIH 1R3HA 3NABH 3OKOB 4AIZA 4OFKA 4MSWA 5FEBA 4YAQB 1NGWA 1SBSH 3PWLA 4N5ED 5HVWA 1VKXB 3L3OB 4NQDB 1FL6B 5CP3H 5JIKA 4QCIA 2VIRB 1VFAB 4S1QH 4U1SA 2CGRH 3VWJB 1ZLSL 4UAOB 5DEZA 2H9GA 1PGRB 4FXGA 5AG9A 3N9GH 3GM8A 4G8IA 1S9VB 4P3DB 3RUGE 4DOHB 1HINH 3IETA 1B2WH 3KPQB 2EYRA 1W8NA 1W0VB 3FO1B 3PGCA 5CZKA 15C8L 4GRLA 1CDUA 4X7DC 3U7AA 3V79C 1NCTA 5EDXA 4TSCH 3D0VA 3LEYL 3QCUH 3KPPB 2EIBA 2VDQL 4U2ZA 4TULL 1BX2B 4NRXA 5I9QB 1VFBA 1ND0B 3PWPB 4YQXH 5C0EA 3CVIL 1Z0MA 4PJ8A 3IB4A 5HY9B 5LGJB 4QYOA 4I8DA 5DLMH 3MV01 3GI9L 3QUZA 4FFWD 4NM4L 4WUUD 2VH5H 3IDIA 4AG4L 1P1ZA 4NNYB 5TE6H 1CE6A 1XF2B 3S37X 1W0YT 4GS7B 4RQQA 4CNIB 1YEKH 3SKNB 1WICA 3U79A 2UYLB 1N8ZB 1OW0A 1P5UA 1RVFH 1T66D 4GG6A 3QDMB 2NR6D 1MCSA 3UBXB 4KMTL 1N0LA 2EKSA 1MH5A 4S1DC 4H1LB 1FC2D 1PKOA 2NY1C 2VITA 3LQZB 4BKLB 1MNUL 3AMKA 4DW2H 1RURH 2IAMB 1L7IL 1JPGB 1BD2B 2R0ZH 1NBZB 2NXZC 1QBBA 3LS5L 5J13C 4KKAC 1GIGH 2ARJQ 3VDAA 3RBGA 5KVEL 1OB1B 3DHJA 5IGXL 1OPGH 4JHAH 4ELMA 1XF3B 5AZEL 4P3WA 2OM5A 1PKQE 3UTSD 2KZWA 4JRYE 4WV1A 4Z5RB 2IGFH 5IVXE 5GGVH 1IGTA 2Z8SA 5E70A 3N9GL 3H2WA 1VEPA 4PLJC 3LEVH 5DJ0B 3X14B 2D31B 5EIIA 4F37F 3WUWB 5MI0C 3C09B 4KJPC 5SWSB 1SHMA 1XGTA 3TBWB 1ITCA 4M61A 3MRKB 1FNAA 4U1HA 1NCWH 5A16A 3D9AH 3O6FA 2QR0B 1AXTL 1M6OA 4NQEB 3WS6A 5EG6C 1E4XH 3RKDC 2YPLB 1QRKA 3T65B 4HJJL 4PV8B 4P2QE 4QT5A 4YHLH 2PXYC 4OD3H 4MXQC 2V2TA 3V52L 1RFDH 5I19L 3ZTNH 2P47B 4H0IA 1J87A 5F93C 1FL3B 2FL5B 1MRFH 4K7PX 4RAVA 3RNQA 1CDIA 3TJEL 3UTPD 3V7AG 2P5ED 2VDKL 1K85A 1OP3H 3KPTA 4OF3A 4AT6B 1U8QB 2R29L 1PLGH 3D25B 1TVBA 1A3RH 1Q0YH 2VR5A 3T77A 1I7TA 2V7HB 3NPSC 4JZJC 4X6EB 2EDBA 4KJQC 2EH7L 3U83A 4LMQI 3S5LB 4RGNB 3B2UC 4LSDA 5SWZA 5JW5B 2DQTL 3U0PA 5BVJB 4F7EB 1NDMA 3E0GA 1FBIH 1YDPB 3N1MC 4J8RB 4JG1L 3BEWA 4PUBL 1AO7B 5J1TC 4KFZC 1GIGL 1MHPL 4YX2H 1NAML 4P49A 4PJDE 2NXYC 5D7LE 4JHAL 4G8GD 3SE4C 4HUUB 4LCWA 3D39A 5GGRY 1KN4L 4WJ5B 5IESL 2BZDA 4PJ7F 5GGVL 1TZGH 2DQFB 1ONQB 3QPXH 4JFXB