3GHGA

Crystal structure of human fibrinogen
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
174
structure length
174
Chain Sequence
ACKDSDWPFCSDEDWNYKCPSGCRMKGLIDEVNQDFTNRINKLKNSLFEYQKNNKDSHSLTTNIMEILRGDFSSANNRDNTYNRVSEDLRSRIEVLKRKVIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKDLLPSRDRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen alpha chain
publication title Crystal structure of human fibrinogen.
pubmed doi rcsb
molecule tags Blood clotting
total genus 55
structure length 174
sequence length 174
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2009-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08702 Fib_alpha Fibrinogen alpha/beta chain family
A PF12160 Fibrinogen_aC Fibrinogen alpha C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3ghgA00
1FZAA 1FZGA 1RF0C 2OYHA 1JY2O 1N86A 1RF1A 1RF1B 2OYHB 1RE3A 1LWUA 2A45G 2XNXA 1LWUB 3HUSB 3HUSA 2OYIC 1FZCB 1FZCA 2FFDA 2FFDB 1JY3N 1LT9A 1JY3P 1LT9B 1M1JC 1W2EA 2Q9IA 1FZCC 2A45I 1T3UA 1LTJC 3GHGC 1FZBA 1N73C 1RF0A 1N73B 1RE4C 3H32A 2OYIA 2HODA 1FZEA 1JY2N 2HODB 1JY2P 3H32B 1FZFA 3BVHA 2HPCA 2HPCB 2OYIB 2OYHC 1RE3C 1LWUC 1RF1C 3E1IA 3HUSC 1M1JA 1M1JB 3GHGA 1JY3O 1LTJA 3GHGB 1LTJB 2A45H 2Z4EA 2FFDC 1LT9C 1RE4A 1N73A 2HLOA 2H43A
chains in the Genus database with same CATH superfamily
1FZAA 1N7SB 3RL0B 5BU5A 1CW5A 1NTZE 2KB7P 4LC1A 3CCQP 5KLIB 2E74B 2N9BA 2A45I 4OH8B 4UB8H 2QIWA 3LIEA 2WPSA 1URQD 1EXIA 3H1IE 2C0XA 1M1JB 5AW8B 3L36A 1JB0J 4ASVA 1HF9A 3Q1MA 5DJTB 2WSEJ 4IFDK 1MFTA 4O9BA 1AVYA 1PL5A 3H1IG 3U1CA 1IFIA 1ZR2A 3PRJA 2HYNA 2WPQA 1FZCC 4BRYB 2QVAA 1L0LG 3PTZA 3RK2C 2Z5IA 1KILC 1VQ6P 1HJBA 1IZNB 1JTHB 1LT9A 3BCCE 3PP5A 1YI2P 1Q81Q 1SQQJ 1WT6A 4IFMA 3RK3E 2N1TC 3G6EP 3L72E 1OWAA 3E1RA 1L4AB 4UB6E 2O1KA 4I2LC 1N7SA 1R8EA 2RMZA 3CCSP 1PV3A 1LP1B 1SQBE 5DJUB 5KLVE 3BVHA 1NTKG 3VMZA 1M1JA 4EI2A 1GW3A 1L0NG 3QWOC 4L76A 1BGYE 1NTMK 1FZCB 1LJ2A 1BSHA 1PGQA 2E76C 1JMMA 1YYCA 1H88A 2XV5A 4BRYA 1Y47A 2N1TB 2Z5HA 3B71A 1BCCD 2ZAEB 1JTHA 4IFFA 3M9BA 1EZVG 3M06A 1OIPA 1ZLLA 1VQKP 2V7QH 5CCHC 1SFCC 4XA4A 1ZW0A 3VMYA 2K88A 1L4AA 1KQSO 3HTKB 3NTNA 4W7ZA 3OA7A 1XTCC 1FDMA 1KB9E 1H0TB 1SQQD 1NTZK 1LP1A 2BCCG 1NGMB 2A06G 4ASWA 3H1HG 4H0LD 1FBMA 2E43A 2K3RA 1A02F 3AE3C 5KKZB 5TISH 3CCUP 3CCEP 1YBKA 2BEZF 3MD0A 5CMZA 4H44C 5AW5B 2WQYC 3N4XA 3H1JE 4PJ0E 4I6MC 2W6JH 1RE4C 1FZEA 3CXHE 3WUVA 3GG2A 1YQ3C 3WUTA 1L0LK 2N1TA 3BCCJ 1QVFO 1ZN5A 1XTGB 1ZRTE 3TDKA 1VQ4P 5CBNA 3L72J 3P8CE 1OZHA 1YTZT 1URQB 3V5BA 4UB8E 3C8VA 1M90Q 5KAFH 3HTKA 3KPEA 2Y9ZA 1VQLP 3F89A 5KLVJ 1H0TA 1G2CB 3CX5D 3M9HA 1Q82Q 1YQ4C 1NTKK 1EC5A 3AECC 3H32B 1OW7A 5KAIH 3S9OA 1L0NK 1FC2C 3L71G 2HG5D 3CCRP 3G3ZA 5APVA 3AE4C 1S1CX 3VTPC 1VF5D 1NWQA 1PPJG 2W27A 3CD6P 5AW7B 2AXCA 3L74G 1N8RQ 2MJZA 3B5NC 3KQGA 2FYUE 1JCDA 2QE7H 3GHGB 5CCHA 1FZGA 4N78E 1SQPG 2CK3H 3RL0g 1EDLA 3HD7C 3NMDA 1P84E 1LTSC 4YXDC 4D6TE 1URQA 1M1KQ 3LIDA 2NPSC 3WU2E 2HR3A 2WSFJ 4U3FG 2YIUC 1NAYA 4L73A 5AVZB 2PAJA 5CCGC 3K5BA 4PD4I 1G2CA 4OVNF 2E5YA 2ZYDA 5CHXA 3EFFK 3H32A 2UWJE 2WVRA 3MIWA 1VQ7P 1LTIC 1KYOH 4IOIH 2OTLP 1RE4A 1SQVG 1S5LH 4EIJA 1PGOA 3W68A 4Y99C 3PLNA 1IC2A 2V4HA 1EXJA 3H1KJ 1VQ5P 4K35A 3GHGA 4EOTA 2Y0CA 2Q5UA 1EDIA 3H1LJ 1NU1J 1J2JB 3FXDA 1PGPA 1DEEG 4PV1C 1YITP 4H0LB 3A0HE 1GW4A 1NYHA 4WBAA 1HGVA 3L70E 1JY3O 2E75D 2RN0A 3Q5PA 3BRTB 3EQ2A 4I7ZB 1YTZI 2NZ2A 5KTBA 3T97B 4L75A 5BVZA 1JY2N 1PZQA 1CZQA 1UIIA 3HRNA 2K9YA 4UB6H 3VP8A 2B88A 2KS1B 1Y9BA 3L4FA 5AVXB 3FWNA 2ZXXA 5KAFE 2R44A 1FOSF 5CJ0A 2PRRA 1SQPK 2AEFA 3V2QA 2AXTE 2YNYA 3SWYA 2FYZA 3M91A 2HFED 4JF7A 2JP3A 2WT7B 2W83C 5KAIE 4OWFA 2C0WA 2WPRA 1BCCE 3M0DC 1OW6A 1S3JA 3RK2D 1KILD 1NU1D 1VF5B 4ZMDA 2M5AB 1BCCG 3T97A 2N1TD 2IBZI 3AEGC 2IZ1A 1S9KD 5B5EH 1SQVK 3MTUE 2V7QJ 1LGHB 2KXPB 2KSEA 2WTYA 5APUA 1GZLA 2WSCH 2KS1A 1SQQG 2KSJA 4KJMA 3PH0A 3I55P 1KB9H 4NPDA 2XNDH 2IX7C 1RF0A 1OMIA 5AVWB 5C39A 1AA0A 3AEEC 3CX5I 3L73E 2KZIA 5AVRB 1FU1A 3TGUE 1KQLA 1PP9E 2W8ZA 1DEBA 2E76D 3SFDC 1A02J 3L70J 4JYBA 1IK9A 3O6QB 1W2EA 1QEXA 2WT7A 3CC7P 1N7LA 1Q90D 4PJ0H 1KYOE 1MKMA 2HPCB 2XKMA 4R4MA 3CWBJ 3TNUB 5E79E 3A3YB 4N3YB 2M5AA 5CCHD 1SFCD 1OX3A 1X0TA 3CPWO 1ZP0C 2GUVA 3CL3D 4KT0J 1NH4A 1FS0E 2DW3A 2MKVA 2M8RA 3MHVA 3M9QA 3OW2O 3ABVC 3KDPB 3QH9A 2M3EA 1BSNA 2KP8A 1SP4A 1KFMA 2YO2A 4RKUJ 1FDOA 3VOPA 1GD2E 5APQA 2FYNB 1Z56A 3V2PA 1L0LE 2E75B 3L75D 1RE3C 2CPSA 3E1IA 2OGUA 4H44D 4PD4D 1J1DC 3AE7C 3CCVP 2P67A 1JO5A 3O6QA 1HTLC 2ZVOB 3BRVB 3RBZA 2HPCA 3TNUA 3N7NA 2Y9YA 1VQ8P 3LW5H 3CLQA 2A45G 3VYIA 1NTKE 1SQXD 3CI9A 1P84H 4ZKUA 3OJAB 1NTMJ 1FOSE 3CWBD 3MUDA 1L0NE 1H89A 2OYHC 3WU2H 1N2DC 1QL2A 1SQQK 1N86A 1OW8A 4IL6E 1MUUA 3L73J 4C7RA 3MP7B 2GM4A 2QJYC 2NRGA 3RK2B 1KILB 1PP9J 1J1EC 3MGNA 2L91A 1EZVE 4HYTB 1BE3J 2ZT9C 3C9IA 1JNMA 3B5ND 2JKVA 3CC4P 2G8YA 5H2FH 5B5EE 3R4YA 2I1KA 5APSA 1LTTC 2J59M 3AEDC 1NTZJ 3D6YA 2Q6QA 3V2RA 3P8MC 3HD7D 2P2UA 2BCCE 2A06E 3H1HE 2OYHB 2BASA 2NPSD 3CXHI 5AW9B 3H1IJ 3II6A 1VDFA 1IO4A 4DOJA 2YXRB 2QG4A 3A0HH 5CCGD 2QJKC 2QJYB 2Z4EA 3CC2P 5AVVB 2E76B 2B87B 1JMBA 4H13D 4WB4A 1FZCA 2RH0A 1ZXGA 1KILA 1QLED 1ZR4A 4GDOA 5AVUB 5GTIH 4YTPC 5K5GB 1SFCB 2IBZD 2R5BA 3VMXA 3KHUA 1ZOYC 1LTJC 2IPPA 1LNQA 1Y8AA 4MN4C 1VPCA 1HBWA 3CMEP 2KI7B 1BE3D 2FFDC 1FAVA 2R3SA 4PV1D 2RKLA 1K05A 1RQUA 4GOEA 3A5TA 2OYHA 1SQBJ 1Q86Q 2JEEA 2AXTH 2IYPA 1AFOA 3L71E 4JQ0D 2WSEH 3H1KG 3UIAA 3GMAA 4H44B 1WRGA 1BGYJ 2M3BA 4HJGH 1K9MQ 4DCKA 3ZDMA 1USDA 1P84I 1NU1G 1PPJE 2B87A 4GIFA 3L74E 1M56D 1ZV8A 1CSBA 2W90A 1IJDB 1DH3A 1SQPE 1AVOA 1LWUC 2OTKE 2ZYGA 3B4SA 5KJ7C 2HLOA 1SFCA 5AW6B 1U7MA 5M1BA 4RESB 4U3FE 1SLQA 2I8DA 4RJTA 2WZ7A 1GL2C 4WY4C 2KNCB 2O01H 1QL1A 3BCCD 3CCMP 1RHZB 2FKWB 3L72D 1E5WA 2WSSH 5APXA 2E5TA 4OGQC 2B89A 1K04A 3IFMA 3ITKA 1OVRA 2IDBA 1MV8A 3BATA 1K8AQ 1SQVE 3G71P 4H13C 1VQNP 1FDIA 1JOCA 1GU5A 1SQBD 1DIPA 3H1JJ 5KLVD 3B5NB 5E79H 4DJGA 5H2FE 1JY3N 2KK7A 2LKMA 1GDTA 1N73C 1BGYD 3GF7A 3C1LA 3HD7B 4L74A 5L8RJ 2PGDA 3P7KA 4WY4B 4AUWA 3S4RA 2NPSB 3KZIE 2YIUB 5EFWB 1NVOA 1HVVA 4PD4E 1CI6B 4U7JA 2KNCA 5TJHA 3L75G 3L71J 1KV4A 4H13B 1ZMEC 3S1KA 1MFZA 1LTGC 2P10A 2Q3EA 1EDJA 2N9YB 1IFPA 2C9LY 3V4QA 1JY2P 1KB9D 5GTIE 4Y99B 3IF4A 1NU1K 1RF1C 2FXOA 1KMIZ 2A45H 4BXLA 3B5NA 4ZNCA 3V2NA 2WPVB 2O1JA 5KJ7A 1QVGO 2FYUJ 1SQXG 1D7MA 2CPBA 3LW5J 2ZJSE 1PFIA 3CWBG 1T6AA 2OTJP 3HD7A 1G1IA 3H1JD 4PV1B 4U3FJ 4WY4A 2QM8A 1KFNA 4D6TJ 3CXHD 2NPSA 4YPCA 4WVZA 3RK3C 3FXEA 1X8YA 4LGDE 4IL6H 1CI6A 2J58A 5CCGA 1YJ9P 3H1KD 1T2KC 3FGAD 3H1LD 1RF1B 3VMAA 1DD4A 1LT1A 5BU8B 3TYYA 5AW0B 1R5LA 3AE1C 2QJPC 1SQQE 1LT9C 3I56P 4QMAA 2LXBA 1KYOI 4XE5B 1DX7A 3L35A 1N7SC 3RL0C 3AEAC 1GTWA 3RK3B 1LTAC 3Q5SA 5AVTB 2E74C 1EDKA 3AE2C 5AW3B 2L5GB 2FYUD 2PFXA 1M1JC 2XZRA 2P58A 4N78D 2P1JA 4A7PA 2C9NY 2HODB 3V6IA 1P84D 4D6TD 2ZT9D 2O3JA 4XFJA 1T3JA 2IBZG 1RF1A 3AE6C 2QJPB 1VQPP 1SVFA 5APTA 1WMKA 3HUSC 1BE3G 3IR9A 3CX5E 1JUNA 1SQXK 2JDIH 2K9JB 3V4WA 5B66E 2XNXA 1QX8A 2YMKA 1L4AC 2JO1A 1NTZG 1IFNA 1FZFA 3Q2YA 2AEMA 1E79H 3HE5B 1FE6A 2PP6A 3PHLA 2FBWC 1AQ5A 3M0DA 1BCCJ 1FJKA 2KYVA 5APWA 4DZOA 2POHA 2HODA 2IFMA 1JCCA 2WMMA 1X22A 2K37A 2H43A 4LLHA 1KORA 4C46A 1KZUB 3L70D 3KYQA 3HUSB 3BASA 2VRSA 3JCUH 2D2CC 3A2AA 1EZVI 1HUCA 3AE5C 3F5HA 1KN7A 1RH5B 1RY3A 3BCCG 1NHLA 1UIXA 4JBZA 3L72G 2K9JA 4HKZH 2O01J 1VQMP 2H88C 3AEFC 1J1DB 3TGUJ 2AEJA 3SFEC 1KTMA 4I1LA 2LXCB 2YKPA 3HE5A 4KHXA 4B86A 1SQBG 1IFJA 1KB9I 1PIXA 2Y0EA 5KLVG 1PGJA 3A0BH 1OVVA 3E7KA 3SWKA 5KKZC 4R4LA 1BGYG 1NAFA 5KJ7D 2Q3IA 2JJLA 3JC22 2KIKA 1FJPA 3NFQA 2B9BA 2D2CB 2IYOA 3TK1A 1W2BO 3HUSA 4C7NB 1GL2D 4WY4D 3KZIH 4PD4H 3TF5A 4OGQD 1NO4A 2QRXA 1S72P 3MZWB 1URQC 1J1EB 5AVQB 1RE3A 2OYIC 1L0LJ 2KLVA 1NTMD 1NOHA 3CCLP 5GTHE 1FZBA 2ZT9B 1S5LX 1KC8Q 1OFCX 3RBXA 1AQTA 1IFMA 3L73D 3TGUD 3D6ZA 2H7HA 3B8EB 1PP9D 3D70A 4W80A 3FWLA 2KZJA 2XU6A 1YJWP 3H1JG 1NTKJ 2BEQD 3SSUA 1IK7A 1KYOD 3AE8C 3H1KE 3FX0A 3EFGA 3HE4B 1L0NJ 5CBOA 4C7NA 2QJKB 2M0BA 3U59A 3GHGC 2ZVNB 1KILE 3H1LE 1NU1E 1NTZD 2OYIB 5CJ4A 1OXZA 3CMAP 3PJSK 3H1LG 2ZYAA 3GW6A 2J5UA 2R32A 1HH0A 1S9KE 1HJ0A 3H1ID 3G9RA 1BDCA 2QSIA 3H25A 1T3UA 1SS1A 2ITAA 2XDJA 1YJNP 1SQBK 3O8ZA 2Q7CA 1KQGB 5KLVK 2H89C 3OAKA 4Y28J 2KOGA 3USSA 1LTJB 2IFNA 1VQ9P 3GF3A 4GT1A 1L0LD 2O01N 1BDDA 2W6AA 3JCUE 1AV1A 2GA1A 2KLUA 3IAOA 1DD3A 2FFDB 1HGZA 2Q9IA 5AW1B 2BCCJ 3EWKA 2JR8A 2WSCJ 3H1HJ 3WMM0 3WUUA 4K3AA 4IL6X 3RK3D 1USEA 2Q1KA 2W6BA 2YO3A 4GODA 2FYUG 3HE4A 1T2KD 3VN0A 3SWFA 3KXDA 2OYIA 1NTKD 1S2EA 2YKQA 4NPEA 2YMYA 4D6TG 4H0LC 1G1JA 1JEKA 1L0ND 1AJYA 5AVSB 2ZFCA 2K1AA 3JSVC 1LWUB 3A0BE 3CCJP 1JY3P 2IZ0A 2G3AA 2H8PD 4I7ZC 5AW4B 4GKGA 4NPFX 1QGKB 1NKNA 4RO0A 1L2PA 1GK4A 1LTJA 2Y0DA 4CPGA 1GL2B 3CX5H 2QEXP 1EZVD 1N7SD 3RL0D 1M8OB 4HB1A 2FFDA 3L75E 5B66H 1VL2A 2E74D 4OGQB 2FY8A 1M7LA 3RGUA 1K73Q 5AVYB 3M0AA 1U7JA 1LTBC 1RF0C 3VP9A 1GU4A 2BCCD 4M3LA 1GMJA 2A06D 3H1HD 2GUSA 4GOFA 5TISE 1Q2NA 3L74J 1X79B 1SQXE 1N73B 4DT0A 3CWBE 1LWUA 3L70G 1SQPJ 3AEBC 2SPZA 1S4XA 4AQRD 3W67A 1VF5C 1X9VA 1YIJP 4EYYQ 1NJIQ 5AW2B 3Q5RA 4AYCA 1W5CE 4Z1MH 4JYCA 1GL2A 2P7JA 4HH2A 1L4AD 3GLMA 2OYOA 3A7OA 1GK6A 1TU3F 1KD1Q 3NXSA 4TLFA 1OVUA 3AE9C 1ZRTD 3P32A 3P8CD 4WWIA 4N6JA 1M57D 1IFDA 2KUBA 2FYUK 4EDFA 3IN6A 3G4SP 1RQVA 1NKZB 2JWDA 2E42A 1YHQP 1EQ7A 1SQVJ 1JY2O 3H6PA 2OARA 2YKOA 2QA4P 4YXWH 1HWTC 3TSIA 1KQFB 2R3CA 3L71D 3Q3DA 1JM0A 1N73A 1T8ZA 2R5DA 2D2CD 1H8AA 4JPZB 1PPJD 4W7YA 2QM7A 3L74D 1R5SA 1U57A 5KLIC 1VQOP 3L75J 1NTME 1SQPD 4TT3H 2OQQA 2LR2A 3MUDC 4BWNA 2ZXEB 2WSFH 1NTMG 2WWWA 2FXPA 3L37A 2IBZE 5GTHH 3U1AA 4U3FD 1MZ9A 2FYNC 2WITA 3L73G 4ZKPA 3I5CA 2I1JA 2E75C 2JWAA 3TGUG 2YXQB 1LT9B 3R2PA 3D71A 1Q7YQ 1SQXJ 1BE3E 1PP9G 2FXMA 5APYA 3CXHH 1S5LE 1SQVD
chains in the Genus database with same CATH topology
1FZAA 1N7SB 5AW6B 3RL0B 5BU5A 3TK1A 3VP8A 1CW5A 2KB7P 4RESB 3HUSA 4LC1A 4C7NB 1GL2D 4WY4D 3L4FA 5AVXB 2N9BA 1SLQA 2A45I 2WZ7A 4OH8B 1GL2C 4WY4C 1FOSF 5CJ0A 3LIEA 2WPSA 1URQD 2O01H 1SQPK 1QL1A 2C0XA 1M1JB 5AW8B 3L36A 3V2QA 1NO4A 2FKWB 4IFDK 1URQC 1E5WA 2YNYA 5APXA 3SWYA 1J1EB 5AVQB 1RE3A 4O9BA 2OYIC 2FYZA 3IFMA 2KLVA 3M91A 2HFED 3U1CA 1NOHA 4JF7A 1MV8A 2WT7B 3BATA 1FZBA 1IFIA 1ZR2A 2HYNA 2C0WA 2WPRA 2WPQA 3M0DC 1JOCA 3RK2D 1GU5A 1KILD 1FZCC 1IFMA 3B5NB 3RK2C 2Z5IA 1KILC 1HJBA 1JTHB 3T97A 2N1TD 2H7HA 1JY3N 1LT9A 2LKMA 3B8EB 3PP5A 1GDTA 1N73C 4W80A 1S9KD 1WT6A 4IFMA 2N1TC 2XU6A 3HD7B 1OWAA 1SQVK 3MTUE 1L4AB 2O1KA 3P7KA 4I2LC 4WY4B 1LGHB 4AUWA 1N7SA 2NPSB 2WTYA 5APUA 3EFGA 3HE4B 1GZLA 4C7NA 2WSCH 1HVVA 3U59A 2KSJA 3GHGC 2IX7C 1CI6B 1RF0A 5AVWB 2OYIB 3BVHA 5CJ4A 3VMZA 1OXZA 5AVRB 1FU1A 1M1JA 1GW3A 1KQLA 2R32A 1HH0A 1MFZA 1NTMK 1S9KE 1DEBA 1LTGC 1FZCB 1A02J 4JYBA 1IK9A 1W2EA 2WT7A 1T3UA 1N7LA 2C9LY 1JMMA 1YYCA 3V4QA 2XDJA 1JY2P 2HPCB 4Y99B 1H88A 1NU1K 1SQBK 3O8ZA 2Q7CA 2XKMA 1RF1C 2XV5A 5KLVK 3OAKA 2KOGA 1LTJB 2A45H 3TNUB 2IFNA 3A3YB 2N1TB 4GT1A 4N3YB 2Z5HA 3B5NA 3V2NA 2W6AA 1JTHA 4IFFA 5CCHD 2O1JA 1SFCD 3M9BA 5KJ7A 3M06A 2FFDB 1HGZA 2GUVA 2Q9IA 3CL3D 1ZLLA 2CPBA 1NH4A 5CCHC 1SFCC 4XA4A 1PFIA 2M8RA 5AW1B 3M9QA 3VMYA 3HD7A 3KDPB 1G1IA 3WMM0 1L4AA 2KP8A 1SP4A 1KFMA 2YO2A 3HTKB 4WY4A 2QM8A 1KFNA 3NTNA 2NPSA 3RK3D 4W7ZA 2YO3A 2W6BA 3OA7A 3VOPA 1XTCC 3HE4A 1FDMA 1T2KD 1GD2E 3RK3C 1NTZK 3VN0A 1X8YA 4LGDE 3SWFA 1CI6A 2J58A 5APQA 5CCGA 1Z56A 1T2KC 3V2PA 2OYIA 1FBMA 2E43A 2YKQA 1RE3C 2CPSA 3E1IA 2YMYA 1A02F 1G1JA 1J1DC 2P67A 5AVSB 1JO5A 2ZFCA 3MD0A 1RF1B 5CMZA 1LWUB 5AW5B 3N4XA 5BU8B 3TYYA 5AW0B 1JY3P 1HTLC 2H8PD 4I6MC 5AW4B 1RE4C 4GKGA 3BRVB 1FZEA 1NKNA 2HPCA 1L0LK 1GK4A 1LTJA 3TNUA 3N7NA 1LT9C 2N1TA 1GL2B 1ZN5A 3LW5H 1XTGB 3CLQA 2A45G 3VYIA 3P8CE 1N7SD 3RL0D 2FFDA 4XE5B 1YTZT 3CI9A 1DX7A 1URQB 3OJAB 4ZKUA 3V5BA 1FOSE 3L35A 1N7SC 3MUDA 3RL0C 1GTWA 1H89A 3RK3B 2OYHC 1LTAC 1M7LA 5AVTB 3HTKA 1N2DC 3KPEA 1QL2A 5AVYB 3M0AA 5AW3B 1LTBC 1RF0C 2L5GB 1SQQK 1N86A 3VP9A 1MUUA 1G2CB 3M9HA 4C7RA 1GU4A 4M3LA 1M1JC 2XZRA 4N78D 1NTKK 2GM4A 2P1JA 2GUSA 3RK2B 2C9NY 1KILB 3H32B 2HODB 1J1EC 3MGNA 1L0NK 1X79B 2HG5D 4HYTB 3G3ZA 1N73B 1T3JA 5APVA 1RF1A 3VTPC 1LWUA 3C9IA 1JNMA 3B5ND 1NWQA 2W27A 4AQRD 1SVFA 5AW7B 2I1KA 1X9VA 2MJZA 1LTTC 3B5NC 5APSA 5APTA 2J59M 5AW2B 3KQGA 4AYCA 1JCDA 3HUSC 3V2RA 3P8MC 3GHGB 5CCHA 3IR9A 3HD7D 2P2UA 4JYCA 1FZGA 1GL2A 2P7JA 4N78E 4HH2A 1L4AD 1JUNA 1SQXK 3V4WA 3A7OA 2OYHB 2XNXA 2BASA 3HD7C 3NMDA 1GK6A 1LTSC 2NPSD 5AW9B 1L4AC 3NXSA 1URQA 3II6A 1VDFA 3LIDA 1IO4A 4DOJA 2NPSC 3P32A 1IFNA 1FZFA 3P8CD 4N6JA 5CCGD 1IFDA 3HE5B 2FYUK 2Z4EA 5AVVB 5AVZB 2PP6A 1NKZB 2PAJA 5CCGC 2E42A 1EQ7A 1JY2O 1AQ5A 3M0DA 3H6PA 2OARA 1FJKA 2KYVA 2YKOA 1G2CA 4WB4A 1FZCA 5APWA 4DZOA 5CHXA 1HWTC 1KILA 3H32A 2POHA 2HODA 1ZR4A 3TSIA 2IFMA 1JCCA 2R3CA 5AVUB 3MIWA 1LTIC 1N73A 1RE4A 2H43A 1SFCB 4LLHA 1T8ZA 2R5BA 4EIJA 4C46A 1KZUB 2R5DA 3KYQA 3VMXA 3HUSB 4Y99C 1H8AA 3BASA 2VRSA 1IC2A 4W7YA 1LTJC 2IPPA 2QM7A 3A2AA 1HUCA 1VPCA 1HBWA 1RY3A 3GHGA 1NHLA 2FFDC 4EOTA 1FAVA 2Q5UA 3A5TA 2OYHA 1J2JB 2JEEA 2ZXEB 1AFOA 2WSFH 2WWWA 1J1DB 2WSEH 3L37A 1GW4A 3UIAA 4I1LA 4WBAA 2YKPA 3U1AA 1WRGA 1HGVA 2M3BA 3HE5A 4KHXA 1JY3O 4B86A 1IFJA 3BRTB 3EQ2A 1MZ9A 1YTZI 2WITA 4GIFA 4ZKPA 3I5CA 2I1JA 1ZV8A 5KTBA 1CSBA 1LT9B 3R2PA 1IJDB 1DH3A 5BVZA 2FXMA 1NAFA 1JY2N 5KJ7D 2Q3IA 2JJLA 5APYA 1FJPA 3NFQA 1CZQA 1LWUC 3HRNA 5KJ7C 2HLOA 1SFCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZA A;  1FZG A;  1RF0 C;  2OYH A;  1JY2 O;  1N86 A;  1RF1 A;  1RF1 B;  2OYH B;  1RE3 A;  1LWU A;  2A45 G;  2XNX A;  1LWU B;  3HUS B;  3HUS A;  2OYI C;  1FZC B;  1FZC A;  2FFD A;  2FFD B;  1JY3 N;  1LT9 A;  1JY3 P;  1LT9 B;  1M1J C;  1W2E A;  2Q9I A;  1FZC C;  2A45 I;  1T3U A;  1LTJ C;  3GHG C;  1FZB A;  1N73 C;  1RF0 A;  1N73 B;  1RE4 C;  3H32 A;  2OYI A;  2HOD A;  1FZE A;  1JY2 N;  2HOD B;  1JY2 P;  3H32 B;  1FZF A;  3BVH A;  2HPC A;  2HPC B;  2OYI B;  2OYH C;  1RE3 C;  1LWU C;  1RF1 C;  3E1I A;  3HUS C;  1M1J A;  1M1J B;  3GHG A;  1JY3 O;  1LTJ A;  3GHG B;  1LTJ B;  2A45 H;  2Z4E A;  2FFD C;  1LT9 C;  1RE4 A;  1N73 A;  2HLO A;  2H43 A; 
#chains in the Genus database with same CATH topology
 1FZA A;  1N7S B;  3RL0 B;  5BU5 A;  1CW5 A;  1NTZ E;  2KB7 P;  4LC1 A;  3CCQ P;  5KLI B;  2E74 B;  2N9B A;  2A45 I;  4OH8 B;  4UB8 H;  2QIW A;  3LIE A;  2WPS A;  1URQ D;  1EXI A;  3H1I E;  2C0X A;  1M1J B;  5AW8 B;  3L36 A;  1JB0 J;  4ASV A;  1HF9 A;  3Q1M A;  5DJT B;  2WSE J;  4IFD K;  1MFT A;  4O9B A;  1AVY A;  1PL5 A;  3H1I G;  3U1C A;  1IFI A;  1ZR2 A;  3PRJ A;  2HYN A;  2WPQ A;  1FZC C;  4BRY B;  2QVA A;  1L0L G;  3PTZ A;  3RK2 C;  2Z5I A;  1KIL C;  1VQ6 P;  1HJB A;  1IZN B;  1JTH B;  1LT9 A;  3BCC E;  3PP5 A;  1YI2 P;  1Q81 Q;  1SQQ J;  1WT6 A;  4IFM A;  3RK3 E;  2N1T C;  3G6E P;  3L72 E;  1OWA A;  3E1R A;  1L4A B;  4UB6 E;  2O1K A;  4I2L C;  1N7S A;  1R8E A;  2RMZ A;  3CCS P;  1PV3 A;  1LP1 B;  1SQB E;  5DJU B;  5KLV E;  3BVH A;  1NTK G;  3VMZ A;  1M1J A;  4EI2 A;  1GW3 A;  1L0N G;  3QWO C;  4L76 A;  1BGY E;  1NTM K;  1FZC B;  1LJ2 A;  1BSH A;  1PGQ A;  2E76 C;  1JMM A;  1YYC A;  1H88 A;  2XV5 A;  4BRY A;  1Y47 A;  2N1T B;  2Z5H A;  3B71 A;  1BCC D;  2ZAE B;  1JTH A;  4IFF A;  3M9B A;  1EZV G;  3M06 A;  1OIP A;  1ZLL A;  1VQK P;  2V7Q H;  5CCH C;  1SFC C;  4XA4 A;  1ZW0 A;  3VMY A;  2K88 A;  1L4A A;  1KQS O;  3HTK B;  3NTN A;  4W7Z A;  3OA7 A;  1XTC C;  1FDM A;  1KB9 E;  1H0T B;  1SQQ D;  1NTZ K;  1LP1 A;  2BCC G;  1NGM B;  2A06 G;  4ASW A;  3H1H G;  4H0L D;  1FBM A;  2E43 A;  2K3R A;  1A02 F;  3AE3 C;  5KKZ B;  5TIS H;  3CCU P;  3CCE P;  1YBK A;  2BEZ F;  3MD0 A;  5CMZ A;  4H44 C;  5AW5 B;  2WQY C;  3N4X A;  3H1J E;  4PJ0 E;  4I6M C;  2W6J H;  1RE4 C;  1FZE A;  3CXH E;  3WUV A;  3GG2 A;  1YQ3 C;  3WUT A;  1L0L K;  2N1T A;  3BCC J;  1QVF O;  1ZN5 A;  1XTG B;  1ZRT E;  3TDK A;  1VQ4 P;  5CBN A;  3L72 J;  3P8C E;  1OZH A;  1YTZ T;  1URQ B;  3V5B A;  4UB8 E;  3C8V A;  1M90 Q;  5KAF H;  3HTK A;  3KPE A;  2Y9Z A;  1VQL P;  3F89 A;  5KLV J;  1H0T A;  1G2C B;  3CX5 D;  3M9H A;  1Q82 Q;  1YQ4 C;  1NTK K;  1EC5 A;  3AEC C;  3H32 B;  1OW7 A;  5KAI H;  3S9O A;  1L0N K;  1FC2 C;  3L71 G;  2HG5 D;  3CCR P;  3G3Z A;  5APV A;  3AE4 C;  1S1C X;  3VTP C;  1VF5 D;  1NWQ A;  1PPJ G;  2W27 A;  3CD6 P;  5AW7 B;  2AXC A;  3L74 G;  1N8R Q;  2MJZ A;  3B5N C;  3KQG A;  2FYU E;  1JCD A;  2QE7 H;  3GHG B;  5CCH A;  1FZG A;  4N78 E;  1SQP G;  2CK3 H;  3RL0 g;  1EDL A;  3HD7 C;  3NMD A;  1P84 E;  1LTS C;  4YXD C;  4D6T E;  1URQ A;  1M1K Q;  3LID A;  2NPS C;  3WU2 E;  2HR3 A;  2WSF J;  4U3F G;  2YIU C;  1NAY A;  4L73 A;  5AVZ B;  2PAJ A;  5CCG C;  3K5B A;  4PD4 I;  1G2C A;  4OVN F;  2E5Y A;  2ZYD A;  5CHX A;  3EFF K;  3H32 A;  2UWJ E;  2WVR A;  3MIW A;  1VQ7 P;  1LTI C;  1KYO H;  4IOI H;  2OTL P;  1RE4 A;  1SQV G;  1S5L H;  4EIJ A;  1PGO A;  3W68 A;  4Y99 C;  3PLN A;  1IC2 A;  2V4H A;  1EXJ A;  3H1K J;  1VQ5 P;  4K35 A;  3GHG A;  4EOT A;  2Y0C A;  2Q5U A;  1EDI A;  3H1L J;  1NU1 J;  1J2J B;  3FXD A;  1PGP A;  1DEE G;  4PV1 C;  1YIT P;  4H0L B;  3A0H E;  1GW4 A;  1NYH A;  4WBA A;  1HGV A;  3L70 E;  1JY3 O;  2E75 D;  2RN0 A;  3Q5P A;  3BRT B;  3EQ2 A;  4I7Z B;  1YTZ I;  2NZ2 A;  5KTB A;  3T97 B;  4L75 A;  5BVZ A;  1JY2 N;  1PZQ A;  1CZQ A;  1UII A;  3HRN A;  2K9Y A;  4UB6 H;  3VP8 A;  2B88 A;  2KS1 B;  1Y9B A;  3L4F A;  5AVX B;  3FWN A;  2ZXX A;  5KAF E;  2R44 A;  1FOS F;  5CJ0 A;  2PRR A;  1SQP K;  2AEF A;  3V2Q A;  2AXT E;  2YNY A;  3SWY A;  2FYZ A;  3M91 A;  2HFE D;  4JF7 A;  2JP3 A;  2WT7 B;  2W83 C;  5KAI E;  4OWF A;  2C0W A;  2WPR A;  1BCC E;  3M0D C;  1OW6 A;  1S3J A;  3RK2 D;  1KIL D;  1NU1 D;  1VF5 B;  4ZMD A;  2M5A B;  1BCC G;  3T97 A;  2N1T D;  2IBZ I;  3AEG C;  2IZ1 A;  1S9K D;  5B5E H;  1SQV K;  3MTU E;  2V7Q J;  1LGH B;  2KXP B;  2KSE A;  2WTY A;  5APU A;  1GZL A;  2WSC H;  2KS1 A;  1SQQ G;  2KSJ A;  4KJM A;  3PH0 A;  3I55 P;  1KB9 H;  4NPD A;  2XND H;  2IX7 C;  1RF0 A;  1OMI A;  5AVW B;  5C39 A;  1AA0 A;  3AEE C;  3CX5 I;  3L73 E;  2KZI A;  5AVR B;  1FU1 A;  3TGU E;  1KQL A;  1PP9 E;  2W8Z A;  1DEB A;  2E76 D;  3SFD C;  1A02 J;  3L70 J;  4JYB A;  1IK9 A;  3O6Q B;  1W2E A;  1QEX A;  2WT7 A;  3CC7 P;  1N7L A;  1Q90 D;  4PJ0 H;  1KYO E;  1MKM A;  2HPC B;  2XKM A;  4R4M A;  3CWB J;  3TNU B;  5E79 E;  3A3Y B;  4N3Y B;  2M5A A;  5CCH D;  1SFC D;  1OX3 A;  1X0T A;  3CPW O;  1ZP0 C;  2GUV A;  3CL3 D;  4KT0 J;  1NH4 A;  1FS0 E;  2DW3 A;  2MKV A;  2M8R A;  3MHV A;  3M9Q A;  3OW2 O;  3ABV C;  3KDP B;  3QH9 A;  2M3E A;  1BSN A;  2KP8 A;  1SP4 A;  1KFM A;  2YO2 A;  4RKU J;  1FDO A;  3VOP A;  1GD2 E;  5APQ A;  2FYN B;  1Z56 A;  3V2P A;  1L0L E;  2E75 B;  3L75 D;  1RE3 C;  2CPS A;  3E1I A;  2OGU A;  4H44 D;  4PD4 D;  1J1D C;  3AE7 C;  3CCV P;  2P67 A;  1JO5 A;  3O6Q A;  1HTL C;  2ZVO B;  3BRV B;  3RBZ A;  2HPC A;  3TNU A;  3N7N A;  2Y9Y A;  1VQ8 P;  3LW5 H;  3CLQ A;  2A45 G;  3VYI A;  1NTK E;  1SQX D;  3CI9 A;  1P84 H;  4ZKU A;  3OJA B;  1NTM J;  1FOS E;  3CWB D;  3MUD A;  1L0N E;  1H89 A;  2OYH C;  3WU2 H;  1N2D C;  1QL2 A;  1SQQ K;  1N86 A;  1OW8 A;  4IL6 E;  1MUU A;  3L73 J;  4C7R A;  3MP7 B;  2GM4 A;  2QJY C;  2NRG A;  3RK2 B;  1KIL B;  1PP9 J;  1J1E C;  3MGN A;  2L91 A;  1EZV E;  4HYT B;  1BE3 J;  2ZT9 C;  3C9I A;  1JNM A;  3B5N D;  2JKV A;  3CC4 P;  2G8Y A;  5H2F H;  5B5E E;  3R4Y A;  2I1K A;  5APS A;  1LTT C;  2J59 M;  3AED C;  1NTZ J;  3D6Y A;  2Q6Q A;  3V2R A;  3P8M C;  3HD7 D;  2P2U A;  2BCC E;  2A06 E;  3H1H E;  2OYH B;  2BAS A;  2NPS D;  3CXH I;  5AW9 B;  3H1I J;  3II6 A;  1VDF A;  1IO4 A;  4DOJ A;  2YXR B;  2QG4 A;  3A0H H;  5CCG D;  2QJK C;  2QJY B;  2Z4E A;  3CC2 P;  5AVV B;  2E76 B;  2B87 B;  1JMB A;  4H13 D;  4WB4 A;  1FZC A;  2RH0 A;  1ZXG A;  1KIL A;  1QLE D;  1ZR4 A;  4GDO A;  5AVU B;  5GTI H;  4YTP C;  5K5G B;  1SFC B;  2IBZ D;  2R5B A;  3VMX A;  3KHU A;  1ZOY C;  1LTJ C;  2IPP A;  1LNQ A;  1Y8A A;  4MN4 C;  1VPC A;  1HBW A;  3CME P;  2KI7 B;  1BE3 D;  2FFD C;  1FAV A;  2R3S A;  4PV1 D;  2RKL A;  1K05 A;  1RQU A;  4GOE A;  3A5T A;  2OYH A;  1SQB J;  1Q86 Q;  2JEE A;  2AXT H;  2IYP A;  1AFO A;  3L71 E;  4JQ0 D;  2WSE H;  3H1K G;  3UIA A;  3GMA A;  4H44 B;  1WRG A;  1BGY J;  2M3B A;  4HJG H;  1K9M Q;  4DCK A;  3ZDM A;  1USD A;  1P84 I;  1NU1 G;  1PPJ E;  2B87 A;  4GIF A;  3L74 E;  1M56 D;  1ZV8 A;  1CSB A;  2W90 A;  1IJD B;  1DH3 A;  1SQP E;  1AVO A;  1LWU C;  2OTK E;  2ZYG A;  3B4S A;  5KJ7 C;  2HLO A;  1SFC A;  5AW6 B;  1U7M A;  5M1B A;  4RES B;  4U3F E;  1SLQ A;  2I8D A;  4RJT A;  2WZ7 A;  1GL2 C;  4WY4 C;  2KNC B;  2O01 H;  1QL1 A;  3BCC D;  3CCM P;  1RHZ B;  2FKW B;  3L72 D;  1E5W A;  2WSS H;  5APX A;  2E5T A;  4OGQ C;  2B89 A;  1K04 A;  3IFM A;  3ITK A;  1OVR A;  2IDB A;  1MV8 A;  3BAT A;  1K8A Q;  1SQV E;  3G71 P;  4H13 C;  1VQN P;  1FDI A;  1JOC A;  1GU5 A;  1SQB D;  1DIP A;  3H1J J;  5KLV D;  3B5N B;  5E79 H;  4DJG A;  5H2F E;  1JY3 N;  2KK7 A;  2LKM A;  1GDT A;  1N73 C;  1BGY D;  3GF7 A;  3C1L A;  3HD7 B;  4L74 A;  5L8R J;  2PGD A;  3P7K A;  4WY4 B;  4AUW A;  3S4R A;  2NPS B;  3KZI E;  2YIU B;  5EFW B;  1NVO A;  1HVV A;  4PD4 E;  1CI6 B;  4U7J A;  2KNC A;  5TJH A;  3L75 G;  3L71 J;  1KV4 A;  4H13 B;  1ZME C;  3S1K A;  1MFZ A;  1LTG C;  2P10 A;  2Q3E A;  1EDJ A;  2N9Y B;  1IFP A;  2C9L Y;  3V4Q A;  1JY2 P;  1KB9 D;  5GTI E;  4Y99 B;  3IF4 A;  1NU1 K;  1RF1 C;  2FXO A;  1KMI Z;  2A45 H;  4BXL A;  3B5N A;  4ZNC A;  3V2N A;  2WPV B;  2O1J A;  5KJ7 A;  1QVG O;  2FYU J;  1SQX G;  1D7M A;  2CPB A;  3LW5 J;  2ZJS E;  1PFI A;  3CWB G;  1T6A A;  2OTJ P;  3HD7 A;  1G1I A;  3H1J D;  4PV1 B;  4U3F J;  4WY4 A;  2QM8 A;  1KFN A;  4D6T J;  3CXH D;  2NPS A;  4YPC A;  4WVZ A;  3RK3 C;  3FXE A;  1X8Y A;  4LGD E;  4IL6 H;  1CI6 A;  2J58 A;  5CCG A;  1YJ9 P;  3H1K D;  1T2K C;  3FGA D;  3H1L D;  1RF1 B;  3VMA A;  1DD4 A;  1LT1 A;  5BU8 B;  3TYY A;  5AW0 B;  1R5L A;  3AE1 C;  2QJP C;  1SQQ E;  1LT9 C;  3I56 P;  4QMA A;  2LXB A;  1KYO I;  4XE5 B;  1DX7 A;  3L35 A;  1N7S C;  3RL0 C;  3AEA C;  1GTW A;  3RK3 B;  1LTA C;  3Q5S A;  5AVT B;  2E74 C;  1EDK A;  3AE2 C;  5AW3 B;  2L5G B;  2FYU D;  2PFX A;  1M1J C;  2XZR A;  2P58 A;  4N78 D;  2P1J A;  4A7P A;  2C9N Y;  2HOD B;  3V6I A;  1P84 D;  4D6T D;  2ZT9 D;  2O3J A;  4XFJ A;  1T3J A;  2IBZ G;  1RF1 A;  3AE6 C;  2QJP B;  1VQP P;  1SVF A;  5APT A;  1WMK A;  3HUS C;  1BE3 G;  3IR9 A;  3CX5 E;  1JUN A;  1SQX K;  2JDI H;  2K9J B;  3V4W A;  5B66 E;  2XNX A;  1QX8 A;  2YMK A;  1L4A C;  2JO1 A;  1NTZ G;  1IFN A;  1FZF A;  3Q2Y A;  2AEM A;  1E79 H;  3HE5 B;  1FE6 A;  2PP6 A;  3PHL A;  2FBW C;  1AQ5 A;  3M0D A;  1BCC J;  1FJK A;  2KYV A;  5APW A;  4DZO A;  2POH A;  2HOD A;  2IFM A;  1JCC A;  2WMM A;  1X22 A;  2K37 A;  2H43 A;  4LLH A;  1KOR A;  4C46 A;  1KZU B;  3L70 D;  3KYQ A;  3HUS B;  3BAS A;  2VRS A;  3JCU H;  2D2C C;  3A2A A;  1EZV I;  1HUC A;  3AE5 C;  3F5H A;  1KN7 A;  1RH5 B;  1RY3 A;  3BCC G;  1NHL A;  1UIX A;  4JBZ A;  3L72 G;  2K9J A;  4HKZ H;  2O01 J;  1VQM P;  2H88 C;  3AEF C;  1J1D B;  3TGU J;  2AEJ A;  3SFE C;  1KTM A;  4I1L A;  2LXC B;  2YKP A;  3HE5 A;  4KHX A;  4B86 A;  1SQB G;  1IFJ A;  1KB9 I;  1PIX A;  2Y0E A;  5KLV G;  1PGJ A;  3A0B H;  1OVV A;  3E7K A;  3SWK A;  5KKZ C;  4R4L A;  1BGY G;  1NAF A;  5KJ7 D;  2Q3I A;  2JJL A;  3JC2 2;  2KIK A;  1FJP A;  3NFQ A;  2B9B A;  2D2C B;  2IYO A;  3TK1 A;  1W2B O;  3HUS A;  4C7N B;  1GL2 D;  4WY4 D;  3KZI H;  4PD4 H;  3TF5 A;  4OGQ D;  1NO4 A;  2QRX A;  1S72 P;  3MZW B;  1URQ C;  1J1E B;  5AVQ B;  1RE3 A;  2OYI C;  1L0L J;  2KLV A;  1NTM D;  1NOH A;  3CCL P;  5GTH E;  1FZB A;  2ZT9 B;  1S5L X;  1KC8 Q;  1OFC X;  3RBX A;  1AQT A;  1IFM A;  3L73 D;  3TGU D;  3D6Z A;  2H7H A;  3B8E B;  1PP9 D;  3D70 A;  4W80 A;  3FWL A;  2KZJ A;  2XU6 A;  1YJW P;  3H1J G;  1NTK J;  2BEQ D;  3SSU A;  1IK7 A;  1KYO D;  3AE8 C;  3H1K E;  3FX0 A;  3EFG A;  3HE4 B;  1L0N J;  5CBO A;  4C7N A;  2QJK B;  2M0B A;  3U59 A;  3GHG C;  2ZVN B;  1KIL E;  3H1L E;  1NU1 E;  1NTZ D;  2OYI B;  5CJ4 A;  1OXZ A;  3CMA P;  3PJS K;  3H1L G;  2ZYA A;  3GW6 A;  2J5U A;  2R32 A;  1HH0 A;  1S9K E;  1HJ0 A;  3H1I D;  3G9R A;  1BDC A;  2QSI A;  3H25 A;  1T3U A;  1SS1 A;  2ITA A;  2XDJ A;  1YJN P;  1SQB K;  3O8Z A;  2Q7C A;  1KQG B;  5KLV K;  2H89 C;  3OAK A;  4Y28 J;  2KOG A;  3USS A;  1LTJ B;  2IFN A;  1VQ9 P;  3GF3 A;  4GT1 A;  1L0L D;  2O01 N;  1BDD A;  2W6A A;  3JCU E;  1AV1 A;  2GA1 A;  2KLU A;  3IAO A;  1DD3 A;  2FFD B;  1HGZ A;  2Q9I A;  5AW1 B;  2BCC J;  3EWK A;  2JR8 A;  2WSC J;  3H1H J;  3WMM 0;  3WUU A;  4K3A A;  4IL6 X;  3RK3 D;  1USE A;  2Q1K A;  2W6B A;  2YO3 A;  4GOD A;  2FYU G;  3HE4 A;  1T2K D;  3VN0 A;  3SWF A;  3KXD A;  2OYI A;  1NTK D;  1S2E A;  2YKQ A;  4NPE A;  2YMY A;  4D6T G;  4H0L C;  1G1J A;  1JEK A;  1L0N D;  1AJY A;  5AVS B;  2ZFC A;  2K1A A;  3JSV C;  1LWU B;  3A0B E;  3CCJ P;  1JY3 P;  2IZ0 A;  2G3A A;  2H8P D;  4I7Z C;  5AW4 B;  4GKG A;  4NPF X;  1QGK B;  1NKN A;  4RO0 A;  1L2P A;  1GK4 A;  1LTJ A;  2Y0D A;  4CPG A;  1GL2 B;  3CX5 H;  2QEX P;  1EZV D;  1N7S D;  3RL0 D;  1M8O B;  4HB1 A;  2FFD A;  3L75 E;  5B66 H;  1VL2 A;  2E74 D;  4OGQ B;  2FY8 A;  1M7L A;  3RGU A;  1K73 Q;  5AVY B;  3M0A A;  1U7J A;  1LTB C;  1RF0 C;  3VP9 A;  1GU4 A;  2BCC D;  4M3L A;  1GMJ A;  2A06 D;  3H1H D;  2GUS A;  4GOF A;  5TIS E;  1Q2N A;  3L74 J;  1X79 B;  1SQX E;  1N73 B;  4DT0 A;  3CWB E;  1LWU A;  3L70 G;  1SQP J;  3AEB C;  2SPZ A;  1S4X A;  4AQR D;  3W67 A;  1VF5 C;  1X9V A;  1YIJ P;  4EYY Q;  1NJI Q;  5AW2 B;  3Q5R A;  4AYC A;  1W5C E;  4Z1M H;  4JYC A;  1GL2 A;  2P7J A;  4HH2 A;  1L4A D;  3GLM A;  2OYO A;  3A7O A;  1GK6 A;  1TU3 F;  1KD1 Q;  3NXS A;  4TLF A;  1OVU A;  3AE9 C;  1ZRT D;  3P32 A;  3P8C D;  4WWI A;  4N6J A;  1M57 D;  1IFD A;  2KUB A;  2FYU K;  4EDF A;  3IN6 A;  3G4S P;  1RQV A;  1NKZ B;  2JWD A;  2E42 A;  1YHQ P;  1EQ7 A;  1SQV J;  1JY2 O;  3H6P A;  2OAR A;  2YKO A;  2QA4 P;  4YXW H;  1HWT C;  3TSI A;  1KQF B;  2R3C A;  3L71 D;  3Q3D A;  1JM0 A;  1N73 A;  1T8Z A;  2R5D A;  2D2C D;  1H8A A;  4JPZ B;  1PPJ D;  4W7Y A;  2QM7 A;  3L74 D;  1R5S A;  1U57 A;  5KLI C;  1VQO P;  3L75 J;  1NTM E;  1SQP D;  4TT3 H;  2OQQ A;  2LR2 A;  3MUD C;  4BWN A;  2ZXE B;  2WSF H;  1NTM G;  2WWW A;  2FXP A;  3L37 A;  2IBZ E;  5GTH H;  3U1A A;  4U3F D;  1MZ9 A;  2FYN C;  2WIT A;  3L73 G;  4ZKP A;  3I5C A;  2I1J A;  2E75 C;  2JWA A;  3TGU G;  2YXQ B;  1LT9 B;  3R2P A;  3D71 A;  1Q7Y Q;  1SQX J;  1BE3 E;  1PP9 G;  2FXM A;  5APY A;  3CXH H;  1S5L E;  1SQV D; 
#chains in the Genus database with same CATH homology
 1FZA A;  1N7S B;  5AW6 B;  3RL0 B;  5BU5 A;  3TK1 A;  3VP8 A;  1CW5 A;  2KB7 P;  4RES B;  3HUS A;  4LC1 A;  4C7N B;  1GL2 D;  4WY4 D;  3L4F A;  5AVX B;  2N9B A;  1SLQ A;  2A45 I;  2WZ7 A;  4OH8 B;  1GL2 C;  4WY4 C;  1FOS F;  5CJ0 A;  3LIE A;  2WPS A;  1URQ D;  2O01 H;  1SQP K;  1QL1 A;  2C0X A;  1M1J B;  5AW8 B;  3L36 A;  3V2Q A;  1NO4 A;  2FKW B;  4IFD K;  1URQ C;  1E5W A;  2YNY A;  5APX A;  3SWY A;  1J1E B;  5AVQ B;  1RE3 A;  4O9B A;  2OYI C;  2FYZ A;  3IFM A;  2KLV A;  3M91 A;  2HFE D;  3U1C A;  1NOH A;  4JF7 A;  1MV8 A;  2WT7 B;  3BAT A;  1FZB A;  1IFI A;  1ZR2 A;  2HYN A;  2C0W A;  2WPR A;  2WPQ A;  3M0D C;  1JOC A;  3RK2 D;  1GU5 A;  1KIL D;  1FZC C;  1IFM A;  3B5N B;  3RK2 C;  2Z5I A;  1KIL C;  1HJB A;  1JTH B;  3T97 A;  2N1T D;  2H7H A;  1JY3 N;  1LT9 A;  2LKM A;  3B8E B;  3PP5 A;  1GDT A;  1N73 C;  4W80 A;  1S9K D;  1WT6 A;  4IFM A;  2N1T C;  2XU6 A;  3HD7 B;  1OWA A;  1SQV K;  3MTU E;  1L4A B;  2O1K A;  3P7K A;  4I2L C;  4WY4 B;  1LGH B;  4AUW A;  1N7S A;  2NPS B;  2WTY A;  5APU A;  3EFG A;  3HE4 B;  1GZL A;  4C7N A;  2WSC H;  1HVV A;  3U59 A;  2KSJ A;  3GHG C;  2IX7 C;  1CI6 B;  1RF0 A;  5AVW B;  2OYI B;  3BVH A;  5CJ4 A;  3VMZ A;  1OXZ A;  5AVR B;  1FU1 A;  1M1J A;  1GW3 A;  1KQL A;  2R32 A;  1HH0 A;  1MFZ A;  1NTM K;  1S9K E;  1DEB A;  1LTG C;  1FZC B;  1A02 J;  4JYB A;  1IK9 A;  1W2E A;  2WT7 A;  1T3U A;  1N7L A;  2C9L Y;  1JMM A;  1YYC A;  3V4Q A;  2XDJ A;  1JY2 P;  2HPC B;  4Y99 B;  1H88 A;  1NU1 K;  1SQB K;  3O8Z A;  2Q7C A;  2XKM A;  1RF1 C;  2XV5 A;  5KLV K;  3OAK A;  2KOG A;  1LTJ B;  2A45 H;  3TNU B;  2IFN A;  3A3Y B;  2N1T B;  4GT1 A;  4N3Y B;  2Z5H A;  3B5N A;  3V2N A;  2W6A A;  1JTH A;  4IFF A;  5CCH D;  2O1J A;  1SFC D;  3M9B A;  5KJ7 A;  3M06 A;  2FFD B;  1HGZ A;  2GUV A;  2Q9I A;  3CL3 D;  1ZLL A;  2CPB A;  1NH4 A;  5CCH C;  1SFC C;  4XA4 A;  1PFI A;  2M8R A;  5AW1 B;  3M9Q A;  3VMY A;  3HD7 A;  3KDP B;  1G1I A;  3WMM 0;  1L4A A;  2KP8 A;  1SP4 A;  1KFM A;  2YO2 A;  3HTK B;  4WY4 A;  2QM8 A;  1KFN A;  3NTN A;  2NPS A;  3RK3 D;  4W7Z A;  2YO3 A;  2W6B A;  3OA7 A;  3VOP A;  1XTC C;  3HE4 A;  1FDM A;  1T2K D;  1GD2 E;  3RK3 C;  1NTZ K;  3VN0 A;  1X8Y A;  4LGD E;  3SWF A;  1CI6 A;  2J58 A;  5APQ A;  5CCG A;  1Z56 A;  1T2K C;  3V2P A;  2OYI A;  1FBM A;  2E43 A;  2YKQ A;  1RE3 C;  2CPS A;  3E1I A;  2YMY A;  1A02 F;  1G1J A;  1J1D C;  2P67 A;  5AVS B;  1JO5 A;  2ZFC A;  3MD0 A;  1RF1 B;  5CMZ A;  1LWU B;  5AW5 B;  3N4X A;  5BU8 B;  3TYY A;  5AW0 B;  1JY3 P;  1HTL C;  2H8P D;  4I6M C;  5AW4 B;  1RE4 C;  4GKG A;  3BRV B;  1FZE A;  1NKN A;  2HPC A;  1L0L K;  1GK4 A;  1LTJ A;  3TNU A;  3N7N A;  1LT9 C;  2N1T A;  1GL2 B;  1ZN5 A;  3LW5 H;  1XTG B;  3CLQ A;  2A45 G;  3VYI A;  3P8C E;  1N7S D;  3RL0 D;  2FFD A;  4XE5 B;  1YTZ T;  3CI9 A;  1DX7 A;  1URQ B;  3OJA B;  4ZKU A;  3V5B A;  1FOS E;  3L35 A;  1N7S C;  3MUD A;  3RL0 C;  1GTW A;  1H89 A;  3RK3 B;  2OYH C;  1LTA C;  1M7L A;  5AVT B;  3HTK A;  1N2D C;  3KPE A;  1QL2 A;  5AVY B;  3M0A A;  5AW3 B;  1LTB C;  1RF0 C;  2L5G B;  1SQQ K;  1N86 A;  3VP9 A;  1MUU A;  1G2C B;  3M9H A;  4C7R A;  1GU4 A;  4M3L A;  1M1J C;  2XZR A;  4N78 D;  1NTK K;  2GM4 A;  2P1J A;  2GUS A;  3RK2 B;  2C9N Y;  1KIL B;  3H32 B;  2HOD B;  1J1E C;  3MGN A;  1L0N K;  1X79 B;  2HG5 D;  4HYT B;  3G3Z A;  1N73 B;  1T3J A;  5APV A;  1RF1 A;  3VTP C;  1LWU A;  3C9I A;  1JNM A;  3B5N D;  1NWQ A;  2W27 A;  4AQR D;  1SVF A;  5AW7 B;  2I1K A;  1X9V A;  2MJZ A;  1LTT C;  3B5N C;  5APS A;  5APT A;  2J59 M;  5AW2 B;  3KQG A;  4AYC A;  1JCD A;  3HUS C;  3V2R A;  3P8M C;  3GHG B;  5CCH A;  3IR9 A;  3HD7 D;  2P2U A;  4JYC A;  1FZG A;  1GL2 A;  2P7J A;  4N78 E;  4HH2 A;  1L4A D;  1JUN A;  1SQX K;  3V4W A;  3A7O A;  2OYH B;  2XNX A;  2BAS A;  3HD7 C;  3NMD A;  1GK6 A;  1LTS C;  2NPS D;  5AW9 B;  1L4A C;  3NXS A;  1URQ A;  3II6 A;  1VDF A;  3LID A;  1IO4 A;  4DOJ A;  2NPS C;  3P32 A;  1IFN A;  1FZF A;  3P8C D;  4N6J A;  5CCG D;  1IFD A;  3HE5 B;  2FYU K;  2Z4E A;  5AVV B;  5AVZ B;  2PP6 A;  1NKZ B;  2PAJ A;  5CCG C;  2E42 A;  1EQ7 A;  1JY2 O;  1AQ5 A;  3M0D A;  3H6P A;  2OAR A;  1FJK A;  2KYV A;  2YKO A;  1G2C A;  4WB4 A;  1FZC A;  5APW A;  4DZO A;  5CHX A;  1HWT C;  1KIL A;  3H32 A;  2POH A;  2HOD A;  1ZR4 A;  3TSI A;  2IFM A;  1JCC A;  2R3C A;  5AVU B;  3MIW A;  1LTI C;  1N73 A;  1RE4 A;  2H43 A;  1SFC B;  4LLH A;  1T8Z A;  2R5B A;  4EIJ A;  4C46 A;  1KZU B;  2R5D A;  3KYQ A;  3VMX A;  3HUS B;  4Y99 C;  1H8A A;  3BAS A;  2VRS A;  1IC2 A;  4W7Y A;  1LTJ C;  2IPP A;  2QM7 A;  3A2A A;  1HUC A;  1VPC A;  1HBW A;  1RY3 A;  3GHG A;  1NHL A;  2FFD C;  4EOT A;  1FAV A;  2Q5U A;  3A5T A;  2OYH A;  1J2J B;  2JEE A;  2ZXE B;  1AFO A;  2WSF H;  2WWW A;  1J1D B;  2WSE H;  3L37 A;  1GW4 A;  3UIA A;  4I1L A;  4WBA A;  2YKP A;  3U1A A;  1WRG A;  1HGV A;  2M3B A;  3HE5 A;  4KHX A;  1JY3 O;  4B86 A;  1IFJ A;  3BRT B;  3EQ2 A;  1MZ9 A;  1YTZ I;  2WIT A;  4GIF A;  4ZKP A;  3I5C A;  2I1J A;  1ZV8 A;  5KTB A;  1CSB A;  1LT9 B;  3R2P A;  1IJD B;  1DH3 A;  5BVZ A;  2FXM A;  1NAF A;  1JY2 N;  5KJ7 D;  2Q3I A;  2JJL A;  5APY A;  1FJP A;  3NFQ A;  1CZQ A;  1LWU C;  3HRN A;  5KJ7 C;  2HLO A;  1SFC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...