3GHGA

Crystal structure of human fibrinogen
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
174
structure length
174
Chain Sequence
ACKDSDWPFCSDEDWNYKCPSGCRMKGLIDEVNQDFTNRINKLKNSLFEYQKNNKDSHSLTTNIMEILRGDFSSANNRDNTYNRVSEDLRSRIEVLKRKVIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKDLLPSRDRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human fibrinogen.
pubmed doi rcsb
molecule tags Blood clotting
molecule keywords Fibrinogen alpha chain
total genus 55
structure length 174
sequence length 174
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2009-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08702 Fib_alpha Fibrinogen alpha/beta chain family
A PF12160 Fibrinogen_aC Fibrinogen alpha C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3ghgA00
1FZCB 2HPCB 1FZAA 1FZEA 1LT9C 1RF0A 1RE3A 1RE4A 1JY3O 2HODA 3GHGC 3HUSA 1RF1A 1LWUB 1N73C 3H32A 2A45H 2OYHB 1LTJC 1RF0C 1LTJB 1LWUA 2A45I 2OYHC 2FFDC 3GHGB 1N73B 2HPCA 2OYIA 1FZCC 1JY3N 2Z4EA 3H32B 1JY3P 1T3UA 2H43A 1FZBA 1W2EA 1FZCA 2OYHA 2XNXA 2Q9IA 1LTJA 2OYIB 2HLOA 2A45G 1FZGA 1M1JC 1N86A 2FFDB 3GHGA 1N73A 1RF1B 1LT9A 1JY2P 1RE4C 1JY2N 3E1IA 3HUSB 3HUSC 1RF1C 1M1JA 1LWUC 1M1JB 1JY2O 2HODB 1LT9B 2OYIC 1RE3C 1FZFA 2FFDA 3BVHA
chains in the Genus database with same CATH superfamily
1NU1G 4GKGA 1P84E 1RF0A 1KORA 1VQNP 3WU2E 1OW7A 2JWAA 2O1KA 3RL0D 3V2PA 4GOFA 3Q5SA 2V4HA 3T97A 3CWBJ 2WTYA 3H1KD 2Q3EA 3VYIA 1SQPD 2ITAA 4C7RA 3FXEA 1SQBE 1SFCB 3SWFA 1K8AQ 1AJYA 1SFCD 3TYYA 2E5YA 3CWBG 3CXHH 1Q86Q 3WUTA 1SQQE 2FXMA 2XNXA 2Q9IA 2E76B 4PD4I 1VPCA 1VQ5P 1H89A 2KK7A 2A45G 3H25A 3CPWO 2RKLA 2M5AB 1KYOD 1Q90D 2AEMA 1UIXA 2OTKE 1MFTA 2ZYGA 5AVRB 3D6ZA 2O1JA 3P8MC 1ZV8A 1EQ7A 5TISE 2ZXXA 3H6PA 4EDFA 5KKZB 3A5TA 2J59M 1VF5C 4B86A 5KTBA 2NPSA 1A02J 1JY2O 1NU1D 5APVA 3GF7A 3B5NA 3PH0A 3H1JE 1LTSC 3BASA 3CWBE 3L75E 4KHXA 3V2RA 3CCLP 3GMAA 1NOHA 3I56P 1S3JA 1CW5A 1YQ4C 1OX3A 5AVXB 5KLIC 1S72P 1KILC 1S9KD 1EDJA 1URQB 3L72J 3L70E 1JOCA 3BRTB 1VQLP 1IK9A 1HGZA 3L71E 2BEZF 1N2DC 2R44A 3AE6C 4C7NB 3L73D 3Q1MA 1HF9A 1FDMA 5KAIE 2CPSA 3H1JG 1IFDA 3L75G 1BGYE 4NPDA 1M1KQ 1SQVG 3B71A 2WSSH 1KQSO 3CD6P 3OAKA 1L0NE 1NO4A 1DEEG 3V4QA 1L4AA 1EDKA 2A06D 3HUSC 4IFDK 3L70G 2NPSB 1P84H 1USEA 3F89A 3GG2A 3H1IJ 1HVVA 1HJ0A 5AW3B 1PGQA 1HWTC 3H1HD 3VTPC 3LIEA 1FZCB 1RE4A 1RHZB 3V6IA 2E42A 1LNQA 2B87A 1YTZI 2BCCG 1KB9E 4U3FE 2IBZI 3A0HH 3H1LJ 5GTIH 1RH5B 3ITKA 3CCVP 1QVGO 1NTME 2FFDC 5AVVB 1NJIQ 4L76A 4BXLA 3L71D 2KS1A 3Q2YA 1H88A 1JY3N 3C1LA 1NTKK 2KUBA 1W2EA 2HR3A 1CI6B 2BCCJ 3WUVA 1VF5B 2FKWB 4H13C 5BVZA 1JEKA 1N73A 4W7YA 4OWFA 1H0TB 1JY2P 1LT9A 3AEAC 4I6MC 1BCCD 1SQBK 4H0LD 3SFDC 1NWQA 2E74C 3RBXA 4ASWA 5KLVG 1LWUC 4H0LB 4HKZH 1EZVD 2Y9ZA 3H1IG 3D71A 1S4XA 2JEEA 2H8PD 1FZFA 1Q2NA 1P84I 3VMAA 2FFDA 2KIKA 2W6BA 1NTKE 3PP5A 1IJDB 2FY8A 2GA1A 3A0BH 4IOIH 1W2BO 4ZKUA 2I1KA 2IBZE 2W8ZA 3MGNA 1PGPA 2QVAA 1LTJB 5AVUB 2ZVOB 1VQ9P 1FE6A 1AA0A 5AW0B 3VMZA 1SQPK 2WZ7A 4AUWA 1NTMD 1QX8A 4HJGH 1OIPA 3AE1C 3H1IE 2SPZA 1H8AA 1CZQA 4U3FD 3M06A 2B89A 4ZNCA 1S2EA 1NTZK 1IFNA 1OVUA 3RK3C 3RK3E 3FX0A 3RBZA 3TNUA 3I55P 2IBZG 1IZNB 1Y47A 2LR2A 4GIFA 2MKVA 3HD7B 4H13B 4YXWH 4WY4A 1N7SB 1OVRA 1K04A 1HBWA 1DEBA 3BVHA 5H2FH 5CBOA 1FBMA 3L73E 2QSIA 2P67A 3PLNA 2HPCB 2Y0DA 1OFCX 3GHGC 1H0TA 1TU3F 2HFED 3AECC 3CL3D 3CXHE 2P10A 3AE4C 3K5BA 5TJHA 3CCJP 1SFCA 2K88A 4W7ZA 1YI2P 1KN7A 1EZVE 3KZIE 3S4RA 2YMKA 1NTKJ 2JWDA 3FWNA 3G4SP 1JY3P 5L8RJ 1FDIA 2NZ2A 3G6EP 3H1LD 3L73G 4NPFX 1GU5A 2K37A 1NH4A 1SFCC 1WRGA 1ZR4A 1JM0A 3CC7P 1IFJA 2KNCA 5KLVK 1JMMA 1NU1J 1AQTA 4WWIA 3W67A 3H1HJ 5H2FE 1X9VA 4JYBA 4L74A 5AW7B 1LP1B 3TGUE 3OA7A 2R3SA 4WY4D 5AW2B 1KD1Q 1AQ5A 1FAVA 4H44C 4OVNF 4DZOA 2OYIC 2IZ0A 5APWA 4WY4C 3FXDA 2JJLA 1FZCA 1Q82Q 2HG5D 1FZAA 3D6YA 5CCGC 1RE3A 1X0TA 1SQXJ 5KLVD 1N73C 1LWUB 1BCCG 1M7LA 1OW6A 1PPJD 1RF0C 2WSCJ 3CXHI 3HE4A 3TGUG 3W68A 1URQC 1DD3A 4RO0A 3U59A 5KLIB 1SS1A 2BASA 2N9BA 4BRYB 5APUA 1NHLA 1J1DC 2Z4EA 3V2QA 4ZMDA 1GZLA 2WVRA 3A3YB 3KZIH 1VQ7P 5APSA 3P7KA 1U57A 2KP8A 1BSHA 2YXRB 2QJKC 2FYUG 1XTCC 2OQQA 1PFIA 1JUNA 3IAOA 2KSEA 3GW6A 5KKZC 1BCCE 1RE4C 2ZT9B 2R5BA 2O01N 1NAFA 1L0NJ 1JMBA 3G9RA 3JSVC 2G8YA 2H7HA 5BU5A 1K05A 3L37A 4WBAA 3CMAP 4CPGA 4D6TD 3A0BE 2FYZA 2IYOA 3SWYA 1RY3A 1FC2C 1T8ZA 2C0WA 2K1AA 1QEXA 1EDIA 3H1ID 3HUSA 1IFPA 4HB1A 5C39A 4WVZA 2V7QH 2CPBA 2WSCH 2Z5HA 3LIDA 1LP1A 2N1TC 2WPVB 3MUDC 1ZXGA 5AW8B 4AYCA 4YXDC 4PV1D 4WB4A 5CCGA 3CCUP 2OYHC 2N9YB 4YTPC 1VQ8P 2ZAEB 4PV1B 1N8RQ 3H1JD 1S5LX 1GMJA 2OYIA 3KDPB 3JCUE 2W27A 3Q5RA 4N6JA 1FZBA 1Z56A 3QH9A 2N1TD 2ZYAA 1X8YA 3T97B 2QA4P 1M57D 2P7JA 1M1JC 4C46A 1HH0A 3MHVA 4ZKPA 2JR8A 3ZDMA 3R4YA 2WSFJ 3M9BA 1KILB 2JO1A 2ZVNB 1SQQJ 3CMEP 1ZOYC 2JKVA 4XFJA 2K3RA 2PAJA 1L0LJ 1ZP0C 2GM4A 2G3AA 2YO2A 1SQBJ 2HODA 2YMYA 1SQQD 1BE3G 1JB0J 1DD4A 4PD4E 1J1EB 2OTLP 2KOGA 1OZHA 2L91A 2IDBA 2RN0A 3II6A 4TLFA 1X22A 1PL5A 1LTTC 3BATA 4KT0J 1RQUA 4PD4H 1VL2A 3USSA 5B5EH 1WMKA 4I1LA 3CX5I 1M8OB 3KQGA 1URQD 1S5LH 2OYHA 2H43A 4I7ZB 2YIUB 1SQPJ 3HD7D 3QWOC 1JTHB 2RMZA 4OGQB 1KB9D 1L0LK 1GL2C 3SFEC 5KAFE 2KZIA 2R32A 2OYOA 2LXBA 1NKZB 1NTMJ 1QL1A 3AEEC 3BCCG 1W5CE 3JCUH 4LLHA 3B5ND 1S9KE 3L74J 1DH3A 2FXOA 3KYQA 1G2CB 2NPSD 4K3AA 4L75A 3WU2H 1G1IA 1A02F 1ZLLA 2ZJSE 1NTZJ 4ASVA 4D6TG 1XTGB 3PHLA 4DCKA 1KZUB 5GTHE 3O6QA 4N3YB 3L71G 1JY3O 5AVZB 4EOTA 2D2CC 4XA4A 3S1KA 1YJNP 3BCCE 3G3ZA 3TDKA 5APTA 1MZ9A 1PP9E 3IR9A 1PZQA 5GTHH 1NAYA 2A06E 1SQVE 2FYUD 2PGDA 2WPQA 3N4XA 4N78D 1N73B 2QG4A 3U1AA 2AXTE 1KQGB 2R5DA 3L74E 1M56D 2IFMA 2B87B 3RL0C 4KJMA 2E75B 2HYNA 2R3CA 4HYTB 3CI9A 3RGUA 4PD4D 3GLMA 1S5LE 2DW3A 4PV1C 4H44B 3L71J 4IFFA 4K35A 3VMXA 1KYOI 2O01H 5KJ7C 2AXCA 1OMIA 1RF1B 4D6TJ 1PP9G 3MUDA 2IPPA 1VDFA 2Q3IA 2WT7B 2A06G 2IX7C 2PRRA 3AEFC 3B4SA 3L72E 2BCCE 4U3FG 1SQXE 1GL2B 2QJPC 2QM7A 2W6AA 2O3JA 2YKPA 3CCMP 3RK2B 3L74G 3H1KJ 1FU1A 5CJ0A 5APQA 4O9BA 1L0NK 1NTMG 3F5HA 1FZEA 4Y99B 2VRSA 3C8VA 4JYCA 1FDOA 3BRVB 2M3EA 4IL6E 3HD7A 1VQOP 4QMAA 1ZN5A 1NTZD 4JPZB 1WT6A 2W6JH 3O8ZA 3MP7B 3VOPA 1SQVD 2QJKB 3IN6A 3R2PA 1SQBD 1SLQA 2P1JA 3E1RA 2OARA 4LGDE 1QLED 2PFXA 2XU6A 2ZT9D 3H32B 3L74D 4IL6X 4UB8E 3CC2P 1R8EA 4UB6E 1NGMB 1BE3J 1BDCA 2YO3A 1JCDA 1SQBG 2P58A 1N7LA 1NTKD 1PP9D 2Q5UA 2QIWA 3B8EB 2W90A 3GHGA 3NXSA 1KQFB 5B5EE 1LJ2A 3SSUA 1HUCA 1SQQG 2WPRA 5CCHC 1IFIA 3L72D 1BGYJ 1LT9B 3P8CD 1ZR2A 5AVYB 2KI7B 3CWBD 5AW6B 3L35A 1KTMA 2OTJP 3L36A 4GT1A 3CCRP 1YITP 1KFNA 1KILA 2IBZD 2N1TA 2YKQA 5KJ7A 1L0LD 1LTJC 2ZXEB 4R4LA 2N1TB 2POHA 3L70D 2LKMA 2BCCD 3AE2C 2L5GB 1OVVA 4NPEA 4JBZA 3M0DA 4DOJA 5K5GB 1GW4A 2HPCA 2H88C 1CI6A 2WSEH 4IL6H 4I7ZC 1Y8AA 2K9YA 2KLVA 3E7KA 1K73Q 3HTKA 3AE7C 3RK2C 1KILD 1EXIA 1OWAA 1MV8A 2KS1B 2OGUA 1J2JB 1G1JA 2IYPA 2WQYC 3JC22 3M0AA 3NFQA 4H0LC 2YXQB 5AVTB 5B66E 3CCEP 1U7JA 2YKOA 5EFWB 2XV5A 1X79B 3E1IA 1RF1C 1D7MA 3BCCD 1J1EC 1L2PA 4AQRD 1GU4A 2AEJA 3KHUA 1BGYG 4UB6H 2C0XA 4W80A 3EFGA 1EZVI 3C9IA 1U7MA 1L0NG 1KC8Q 1FOSE 1T3JA 2AEFA 2B88A 3TNUB 1AV1A 2WSEJ 1P84D 1J1DB 1EZVG 1L4AD 1N7SC 3L4FA 1LT9C 3AE3C 2K9JB 3NMDA 1OXZA 2I1JA 3TSIA 3V4WA 1YYCA 1Q7YQ 3CC4P 3OW2O 2CK3H 3AE9C 1YTZT 2AXTH 1KYOE 3AEGC 3H1KE 1ZMEC 2FYNB 2YNYA 2ZYDA 1NYHA 5CJ4A 3AE5C 2GUVA 4M3LA 4D6TE 1YJ9P 1LTAC 1IK7A 1FZCC 1JTHA 3TF5A 3TGUJ 1SVFA 3MD0A 3PJSK 1GW3A 1DIPA 2J58A 2Q6QA 1T2KC 4C7NA 2M0BA 2PP6A 1IFMA 3Q5PA 2WSFH 2NPSC 2O01J 1ZRTD 5CMZA 3H1KG 5E79E 2KB7P 2M5AA 4L73A 2C9LY 2ZFCA 4U3FJ 1Q81Q 2J5UA 4Y99C 3VP9A 2Q7CA 1JCCA 3EFFK 1PP9J 2KNCB 2M3BA 2FXPA 2QM8A 2WMMA 1AVOA 3FWLA 3H1HG 2QE7H 3L75D 5M1BA 2H89C 2E43A 2JDIH 5KLVE 2BEQD 2UWJE 3HE5B 1GTWA 2WWWA 2Y0CA 3L73J 1NTZE 2P2UA 2E75D 1FJKA 1LTIC 3CX5H 4DT0A 5B66H 1FS0E 1KB9H 1NTKG 3CLQA 4HH2A 5AW9B 1RQVA 3CX5E 1T3UA 3RL0B 3WMM0 3P32A 1BDDA 3H1HE 4A7PA 1VF5D 3IFMA 2Q1KA 4GDOA 1YHQP 1E79H 1L0ND 1PGJA 4MN4C 1E5WA 1N86A 3UIAA 2FBWC 3RK2D 2M8RA 5AW4B 2FYNC 3I5CA 1JY2N 4U7JA 1NTZG 1ZRTE 1GDTA 1MUUA 1YBKA 1M1JB 2E76D 2KXPB 3VP8A 1EXJA 2IFNA 3P8CE 2QEXP 3LW5H 3FGAD 3O6QB 2XNDH 3G71P 3M91A 1ZW0A 3PRJA 1AVYA 1MFZA 3S9OA 3BCCJ 1YQ3C 1EC5A 3IF4A 4BWNA 2XZRA 2OYHB 1L0LE 1KFMA 5AVWB 1SQPG 3U1CA 1LGHB 3HRNA 4BRYA 3CXHD 1URQA 2RH0A 1LT1A 1LWUA 4R4MA 5AW5B 4N78E 1VQ4P 3A2AA 2WPSA 2YIUC 3LW5J 2Y0EA 1KILE 1KYOH 2XKMA 3AEBC 3OJAB 1LTJA 4GOEA 1JO5A 1T6AA 1FZGA 1KQLA 2WITA 1N7SD 1FOSF 3A7OA 1GK4A 2JP3A 3AE8C 1L0LG 1LTGC 4H13D 1SQPE 1GL2A 2ZT9C 2Z5IA 5KAIH 3TGUD 3KPEA 1JNMA 1IO4A 4IFMA 1BSNA 1QGKB 1BE3E 4OGQD 5CCHA 1PV3A 1R5LA 2GUSA 2KLUA 4Y28J 1SQXD 2XDJA 5KLVJ 2E75C 3H1LE 1VQPP 1AFOA 3B5NB 3SWKA 5E79H 5GTIE 3M9QA 3PTZA 5CHXA 1RF1A 4OH8B 1NVOA 2WT7A 1T2KD 1VQKP 3EWKA 1QL2A 3RK3D 4EI2A 1M90Q 3MZWB 4EYYQ 4XE5B 3D70A 3ABVC 1KV4A 1HJBA 1FJPA 4JQ0D 3RK3B 2D2CB 3V2NA 3V5BA 5DJTB 5AVSB 2D2CD 2Y9YA 1S1CX 1SQXK 3H1LG 3WUUA 5CCGD 5TISH 3A0HE 3AEDC 1Y9BA 3HE5A 4WY4B 5KJ7D 1YIJP 1QVFO 2OYIB 1GK6A 1BGYD 1DX7A 2HLOA 4RKUJ 2LXCB 2E5TA 2QJYB 5BU8B 4EIJA 4H44D 1UIIA 1L4AC 5AVQB 2V7QJ 1L4AB 3HUSB 4LC1A 5DJUB 1VQ6P 2QJYC 1HTLC 1MKMA 4DJGA 5CCHD 1LTBC 1BE3D 1CSBA 1NU1K 2FYUE 3NTNA 4OGQC 4PJ0E 3L70J 2W83C 1GL2D 4RJTA 2IZ1A 1GD2E 4I2LC 3Q3DA 1N7SA 1USDA 1PIXA 2E74D 2FYUJ 2QJPB 1SQVJ 3EQ2A 1G2CA 3H32A 2A45H 3L75J 2E74B 3H1JJ 2KSJA 4TT3H 5APYA 3RL0g 3VN0A 2KYVA 3MTUE 1PPJG 2I8DA 4GODA 2A45I 5AW1B 4Z1MH 5CBNA 1SP4A 3GHGB 4YPCA 3VMYA 5KAFH 1K9MQ 3CX5D 2C9NY 3B5NC 2KZJA 1PGOA 3M9HA 1NU1E 2FYUK 1IC2A 3GF3A 2QRXA 4JF7A 2B9BA 1BCCJ 3L72G 3HE4B 3MIWA 1KB9I 3KXDA 1SQXG 1EDLA 4PJ0H 4UB8H 2FFDB 3CCQP 3HD7C 3TK1A 1SQVK 1NKNA 5APXA 1VQMP 1OW8A 1M1JA 3M0DC 4RESB 3CCSP 1PPJE 2NRGA 1YJWP 1R5SA 1KMIZ 2E76C 2HODB 2MJZA 1NTMK 1RE3C 1SQQK 2K9JA 3HTKB 3N7NA 1HGVA
chains in the Genus database with same CATH topology
4GKGA 1RF0A 3V2PA 2O1KA 3RL0D 3T97A 2WTYA 3VYIA 4C7RA 1SFCB 3SWFA 1SFCD 3TYYA 2FXMA 2XNXA 2Q9IA 1VPCA 1H89A 2A45G 5BVZA 5AVRB 2O1JA 3P8MC 1ZV8A 1EQ7A 3H6PA 3A5TA 2J59M 4B86A 5KTBA 2NPSA 1A02J 1JY2O 5APVA 3B5NA 4KHXA 3V2RA 1LTSC 3BASA 1NOHA 5AVXB 1KILC 1S9KD 1URQB 1JOCA 3BRTB 1IK9A 1HGZA 4C7NB 1N2DC 1FDMA 2CPSA 1IFDA 3OAKA 1NO4A 3V4QA 1L4AA 3HUSC 4IFDK 2NPSB 1HVVA 5AW3B 1HWTC 3VTPC 3LIEA 1FZCB 1RE4A 2E42A 1YTZI 2FFDC 5AVVB 1H88A 1JY3N 1NTKK 1W2EA 1CI6B 2FKWB 1N73A 4W7YA 1JY2P 1LT9A 4I6MC 1SQBK 1LWUC 2JEEA 1FZFA 2H8PD 2FFDA 2W6BA 3PP5A 1IJDB 4ZKUA 2I1KA 1CW5A 3MGNA 5AVUB 1LTJB 3VMZA 5AW0B 1SQPK 2WZ7A 4AUWA 1H8AA 1CZQA 3M06A 1NTZK 1IFNA 3RK3C 3TNUA 4GIFA 3HD7B 4WY4A 1N7SB 1HBWA 1DEBA 3BVHA 1FBMA 2HPCB 2P67A 3GHGC 3CL3D 2HFED 1SFCA 4W7ZA 1JY3P 1GU5A 1NH4A 1SFCC 1WRGA 1ZR4A 1IFJA 5KLVK 1JMMA 1X9VA 4JYBA 5AW7B 3OA7A 4WY4D 5AW2B 1FAVA 4DZOA 2OYIC 5APWA 4WY4C 2JJLA 1FZCA 2HG5D 1FZAA 5CCGC 1RE3A 1N73C 1LWUB 1M7LA 1RF0C 3HE4A 1URQC 3U59A 2BASA 2N9BA 5APUA 1NHLA 1J1DC 2Z4EA 3V2QA 1GZLA 3A3YB 5APSA 3P7KA 2KP8A 1XTCC 1PFIA 1JUNA 1RE4C 2R5BA 1NAFA 2H7HA 5BU5A 3L37A 4WBAA 2FYZA 3SWYA 1RY3A 2C0WA 1T8ZA 3HUSA 2CPBA 3LIDA 2WSCH 2Z5HA 2N1TC 4AYCA 5CCGA 5AW8B 4WB4A 2OYHC 2OYIA 3KDPB 2W27A 4N6JA 1FZBA 1Z56A 2N1TD 1X8YA 2P7JA 1M1JC 4C46A 1HH0A 4ZKPA 3M9BA 1KILB 2PAJA 2GM4A 2YMYA 2YO2A 2HODA 1J1EB 2KOGA 3II6A 1LTTC 3BATA 4I1LA 3KQGA 1URQD 2OYHA 2H43A 3HD7D 1JTHB 1L0LK 1GL2C 2R32A 1NKZB 1QL1A 4LLHA 1S9KE 3B5ND 1DH3A 3KYQA 1G2CB 2NPSD 1A02F 1G1IA 1ZLLA 1XTGB 1KZUB 4N3YB 5AVZB 1JY3O 4EOTA 4XA4A 3G3ZA 5APTA 1MZ9A 3IR9A 2WPQA 3N4XA 4N78D 1N73B 3U1AA 2R5DA 2IFMA 3RL0C 2HYNA 2R3CA 4HYTB 3CI9A 3VMXA 4IFFA 2O01H 5KJ7C 1RF1B 3MUDA 2IPPA 1VDFA 2Q3IA 2IX7C 1GL2B 2QM7A 2W6AA 2YKPA 3RK2B 1FU1A 5CJ0A 5APQA 4O9BA 1L0NK 4Y99B 1FZEA 2VRSA 4JYCA 3BRVB 3HD7A 1ZN5A 1WT6A 3O8ZA 3VOPA 5CHXA 1SLQA 2P1JA 4LGDE 2OARA 1AQ5A 2XU6A 3H32B 2YO3A 1JCDA 3R2PA 1N7LA 2Q5UA 3GHGA 3B8EB 3NXSA 1HUCA 2WPRA 5CCHC 1IFIA 1LT9B 3P8CD 1ZR2A 5AVYB 5AW6B 3L35A 3L36A 4GT1A 1KFNA 1KILA 2YKQA 2N1TA 5KJ7A 1LTJC 2ZXEB 2N1TB 2POHA 2LKMA 2WT7B 2L5GB 4DOJA 3M0DA 1GW4A 2HPCA 1CI6A 2WSEH 2KLVA 3HTKA 3RK2C 1KILD 1OWAA 1MV8A 3M0AA 3NFQA 1J2JB 1G1JA 5AVTB 2YKOA 2XV5A 1X79B 3E1IA 1RF1C 1J1EC 4AQRD 1GU4A 4W80A 2C0XA 3EFGA 3C9IA 1FOSE 1T3JA 3TNUB 1J1DB 1L4AD 1N7SC 3L4FA 1LT9C 3V4WA 2E43A 3NMDA 1OXZA 2I1JA 3TSIA 1YYCA 1YTZT 2YNYA 5CJ4A 2GUVA 4M3LA 1LTAC 1FZCC 1JTHA 1SVFA 3MD0A 1GW3A 2J58A 1T2KC 4C7NA 2PP6A 1IFMA 2WSFH 2NPSC 5CMZA 2KB7P 2C9LY 2ZFCA 4Y99C 3VP9A 2Q7CA 1JCCA 2M3BA 2QM8A 3HE5B 1GTWA 2WWWA 2P2UA 1FJKA 1LTIC 3CLQA 4HH2A 5AW9B 3WMM0 1T3UA 3RL0B 3P32A 3IFMA 1E5WA 1N86A 3UIAA 3RK2D 2M8RA 5AW4B 3I5CA 1JY2N 1GDTA 1MUUA 1M1JB 3VP8A 2IFNA 3P8CE 3LW5H 3M91A 1MFZA 2XZRA 2OYHB 3U1CA 1KFMA 5AVWB 1LGHB 3HRNA 1URQA 1LWUA 5AW5B 4N78E 3A2AA 2WPSA 2XKMA 3OJAB 1LTJA 1JO5A 1FZGA 1KQLA 2WITA 1N7SD 1FOSF 3A7OA 1GK4A 1LTGC 1GL2A 1JNMA 2Z5IA 1IO4A 3KPEA 4IFMA 5CCHA 2GUSA 2XDJA 1AFOA 3B5NB 3M9QA 1RF1A 4OH8B 2WT7A 1T2KD 1QL2A 3RK3D 4XE5B 1HJBA 1FJPA 3RK3B 3V2NA 3V5BA 5AVSB 1SQXK 5CCGD 3HE5A 4WY4B 5KJ7D 1DX7A 2OYIB 1GK6A 2HLOA 5BU8B 4EIJA 1L4AC 5AVQB 4LC1A 1L4AB 3HUSB 1HTLC 5CCHD 1LTBC 1CSBA 1NU1K 3NTNA 1GD2E 1GL2D 4I2LC 1N7SA 3EQ2A 1G2CA 3H32A 2A45H 2KSJA 5APYA 3VN0A 2KYVA 3MTUE 2A45I 5AW1B 1SP4A 3GHGB 3VMYA 2C9NY 3B5NC 3M9HA 2FYUK 1IC2A 4JF7A 3MIWA 3HE4B 2FFDB 3HD7C 3TK1A 1SQVK 1NKNA 5APXA 1M1JA 3M0DC 4RESB 2HODB 2MJZA 3HTKB 1NTMK 1RE3C 1SQQK 1NWQA 3N7NA 1HGVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZC B;  2HPC B;  1FZA A;  1FZE A;  1LT9 C;  1RF0 A;  1RE3 A;  1RE4 A;  1JY3 O;  2HOD A;  3GHG C;  3HUS A;  1RF1 A;  1LWU B;  1N73 C;  3H32 A;  2A45 H;  2OYH B;  1LTJ C;  1RF0 C;  1LTJ B;  1LWU A;  2A45 I;  2OYH C;  2FFD C;  3GHG B;  1N73 B;  2HPC A;  2OYI A;  1FZC C;  1JY3 N;  2Z4E A;  3H32 B;  1JY3 P;  1T3U A;  2H43 A;  1FZB A;  1W2E A;  1FZC A;  2OYH A;  2XNX A;  2Q9I A;  1LTJ A;  2OYI B;  2HLO A;  2A45 G;  1FZG A;  1M1J C;  1N86 A;  2FFD B;  3GHG A;  1N73 A;  1RF1 B;  1LT9 A;  1JY2 P;  1RE4 C;  1JY2 N;  3E1I A;  3HUS B;  3HUS C;  1RF1 C;  1M1J A;  1LWU C;  1M1J B;  1JY2 O;  2HOD B;  1LT9 B;  2OYI C;  1RE3 C;  1FZF A;  2FFD A;  3BVH A; 
#chains in the Genus database with same CATH topology
 1NU1 G;  4GKG A;  1P84 E;  1RF0 A;  1KOR A;  1VQN P;  3WU2 E;  1OW7 A;  2JWA A;  2O1K A;  3RL0 D;  3V2P A;  4GOF A;  3Q5S A;  2V4H A;  3T97 A;  3CWB J;  2WTY A;  3H1K D;  2Q3E A;  3VYI A;  1SQP D;  2ITA A;  4C7R A;  3FXE A;  1SQB E;  1SFC B;  3SWF A;  1K8A Q;  1AJY A;  1SFC D;  3TYY A;  2E5Y A;  3CWB G;  3CXH H;  1Q86 Q;  3WUT A;  1SQQ E;  2FXM A;  2XNX A;  2Q9I A;  2E76 B;  4PD4 I;  1VPC A;  1VQ5 P;  1H89 A;  2KK7 A;  2A45 G;  3H25 A;  3CPW O;  2RKL A;  2M5A B;  1KYO D;  1Q90 D;  2AEM A;  1UIX A;  2OTK E;  1MFT A;  2ZYG A;  5AVR B;  3D6Z A;  2O1J A;  3P8M C;  1ZV8 A;  1EQ7 A;  5TIS E;  2ZXX A;  3H6P A;  4EDF A;  5KKZ B;  3A5T A;  2J59 M;  1VF5 C;  4B86 A;  5KTB A;  2NPS A;  1A02 J;  1JY2 O;  1NU1 D;  5APV A;  3GF7 A;  3B5N A;  3PH0 A;  3H1J E;  1LTS C;  3BAS A;  3CWB E;  3L75 E;  4KHX A;  3V2R A;  3CCL P;  3GMA A;  1NOH A;  3I56 P;  1S3J A;  1CW5 A;  1YQ4 C;  1OX3 A;  5AVX B;  5KLI C;  1S72 P;  1KIL C;  1S9K D;  1EDJ A;  1URQ B;  3L72 J;  3L70 E;  1JOC A;  3BRT B;  1VQL P;  1IK9 A;  1HGZ A;  3L71 E;  2BEZ F;  1N2D C;  2R44 A;  3AE6 C;  4C7N B;  3L73 D;  3Q1M A;  1HF9 A;  1FDM A;  5KAI E;  2CPS A;  3H1J G;  1IFD A;  3L75 G;  1BGY E;  4NPD A;  1M1K Q;  1SQV G;  3B71 A;  2WSS H;  1KQS O;  3CD6 P;  3OAK A;  1L0N E;  1NO4 A;  1DEE G;  3V4Q A;  1L4A A;  1EDK A;  2A06 D;  3HUS C;  4IFD K;  3L70 G;  2NPS B;  1P84 H;  1USE A;  3F89 A;  3GG2 A;  3H1I J;  1HVV A;  1HJ0 A;  5AW3 B;  1PGQ A;  1HWT C;  3H1H D;  3VTP C;  3LIE A;  1FZC B;  1RE4 A;  1RHZ B;  3V6I A;  2E42 A;  1LNQ A;  2B87 A;  1YTZ I;  2BCC G;  1KB9 E;  4U3F E;  2IBZ I;  3A0H H;  3H1L J;  5GTI H;  1RH5 B;  3ITK A;  3CCV P;  1QVG O;  1NTM E;  2FFD C;  5AVV B;  1NJI Q;  4L76 A;  4BXL A;  3L71 D;  2KS1 A;  3Q2Y A;  1H88 A;  1JY3 N;  3C1L A;  1NTK K;  2KUB A;  1W2E A;  2HR3 A;  1CI6 B;  2BCC J;  3WUV A;  1VF5 B;  2FKW B;  4H13 C;  5BVZ A;  1JEK A;  1N73 A;  4W7Y A;  4OWF A;  1H0T B;  1JY2 P;  1LT9 A;  3AEA C;  4I6M C;  1BCC D;  1SQB K;  4H0L D;  3SFD C;  1NWQ A;  2E74 C;  3RBX A;  4ASW A;  5KLV G;  1LWU C;  4H0L B;  4HKZ H;  1EZV D;  2Y9Z A;  3H1I G;  3D71 A;  1S4X A;  2JEE A;  2H8P D;  1FZF A;  1Q2N A;  1P84 I;  3VMA A;  2FFD A;  2KIK A;  2W6B A;  1NTK E;  3PP5 A;  1IJD B;  2FY8 A;  2GA1 A;  3A0B H;  4IOI H;  1W2B O;  4ZKU A;  2I1K A;  2IBZ E;  2W8Z A;  3MGN A;  1PGP A;  2QVA A;  1LTJ B;  5AVU B;  2ZVO B;  1VQ9 P;  1FE6 A;  1AA0 A;  5AW0 B;  3VMZ A;  1SQP K;  2WZ7 A;  4AUW A;  1NTM D;  1QX8 A;  4HJG H;  1OIP A;  3AE1 C;  3H1I E;  2SPZ A;  1H8A A;  1CZQ A;  4U3F D;  3M06 A;  2B89 A;  4ZNC A;  1S2E A;  1NTZ K;  1IFN A;  1OVU A;  3RK3 C;  3RK3 E;  3FX0 A;  3RBZ A;  3TNU A;  3I55 P;  2IBZ G;  1IZN B;  1Y47 A;  2LR2 A;  4GIF A;  2MKV A;  3HD7 B;  4H13 B;  4YXW H;  4WY4 A;  1N7S B;  1OVR A;  1K04 A;  1HBW A;  1DEB A;  3BVH A;  5H2F H;  5CBO A;  1FBM A;  3L73 E;  2QSI A;  2P67 A;  3PLN A;  2HPC B;  2Y0D A;  1OFC X;  3GHG C;  1H0T A;  1TU3 F;  2HFE D;  3AEC C;  3CL3 D;  3CXH E;  2P10 A;  3AE4 C;  3K5B A;  5TJH A;  3CCJ P;  1SFC A;  2K88 A;  4W7Z A;  1YI2 P;  1KN7 A;  1EZV E;  3KZI E;  3S4R A;  2YMK A;  1NTK J;  2JWD A;  3FWN A;  3G4S P;  1JY3 P;  5L8R J;  1FDI A;  2NZ2 A;  3G6E P;  3H1L D;  3L73 G;  4NPF X;  1GU5 A;  2K37 A;  1NH4 A;  1SFC C;  1WRG A;  1ZR4 A;  1JM0 A;  3CC7 P;  1IFJ A;  2KNC A;  5KLV K;  1JMM A;  1NU1 J;  1AQT A;  4WWI A;  3W67 A;  3H1H J;  5H2F E;  1X9V A;  4JYB A;  4L74 A;  5AW7 B;  1LP1 B;  3TGU E;  3OA7 A;  2R3S A;  4WY4 D;  5AW2 B;  1KD1 Q;  1AQ5 A;  1FAV A;  4H44 C;  4OVN F;  4DZO A;  2OYI C;  2IZ0 A;  5APW A;  4WY4 C;  3FXD A;  2JJL A;  1FZC A;  1Q82 Q;  2HG5 D;  1FZA A;  3D6Y A;  5CCG C;  1RE3 A;  1X0T A;  1SQX J;  5KLV D;  1N73 C;  1LWU B;  1BCC G;  1M7L A;  1OW6 A;  1PPJ D;  1RF0 C;  2WSC J;  3CXH I;  3HE4 A;  3TGU G;  3W68 A;  1URQ C;  1DD3 A;  4RO0 A;  3U59 A;  5KLI B;  1SS1 A;  2BAS A;  2N9B A;  4BRY B;  5APU A;  1NHL A;  1J1D C;  2Z4E A;  3V2Q A;  4ZMD A;  1GZL A;  2WVR A;  3A3Y B;  3KZI H;  1VQ7 P;  5APS A;  3P7K A;  1U57 A;  2KP8 A;  1BSH A;  2YXR B;  2QJK C;  2FYU G;  1XTC C;  2OQQ A;  1PFI A;  1JUN A;  3IAO A;  2KSE A;  3GW6 A;  5KKZ C;  1BCC E;  1RE4 C;  2ZT9 B;  2R5B A;  2O01 N;  1NAF A;  1L0N J;  1JMB A;  3G9R A;  3JSV C;  2G8Y A;  2H7H A;  5BU5 A;  1K05 A;  3L37 A;  4WBA A;  3CMA P;  4CPG A;  4D6T D;  3A0B E;  2FYZ A;  2IYO A;  3SWY A;  1RY3 A;  1FC2 C;  1T8Z A;  2C0W A;  2K1A A;  1QEX A;  1EDI A;  3H1I D;  3HUS A;  1IFP A;  4HB1 A;  5C39 A;  4WVZ A;  2V7Q H;  2CPB A;  2WSC H;  2Z5H A;  3LID A;  1LP1 A;  2N1T C;  2WPV B;  3MUD C;  1ZXG A;  5AW8 B;  4AYC A;  4YXD C;  4PV1 D;  4WB4 A;  5CCG A;  3CCU P;  2OYH C;  2N9Y B;  4YTP C;  1VQ8 P;  2ZAE B;  4PV1 B;  1N8R Q;  3H1J D;  1S5L X;  1GMJ A;  2OYI A;  3KDP B;  3JCU E;  2W27 A;  3Q5R A;  4N6J A;  1FZB A;  1Z56 A;  3QH9 A;  2N1T D;  2ZYA A;  1X8Y A;  3T97 B;  2QA4 P;  1M57 D;  2P7J A;  1M1J C;  4C46 A;  1HH0 A;  3MHV A;  4ZKP A;  2JR8 A;  3ZDM A;  3R4Y A;  2WSF J;  3M9B A;  1KIL B;  2JO1 A;  2ZVN B;  1SQQ J;  3CME P;  1ZOY C;  2JKV A;  4XFJ A;  2K3R A;  2PAJ A;  1L0L J;  1ZP0 C;  2GM4 A;  2G3A A;  2YO2 A;  1SQB J;  2HOD A;  2YMY A;  1SQQ D;  1BE3 G;  1JB0 J;  1DD4 A;  4PD4 E;  1J1E B;  2OTL P;  2KOG A;  1OZH A;  2L91 A;  2IDB A;  2RN0 A;  3II6 A;  4TLF A;  1X22 A;  1PL5 A;  1LTT C;  3BAT A;  4KT0 J;  1RQU A;  4PD4 H;  1VL2 A;  3USS A;  5B5E H;  1WMK A;  4I1L A;  3CX5 I;  1M8O B;  3KQG A;  1URQ D;  1S5L H;  2OYH A;  2H43 A;  4I7Z B;  2YIU B;  1SQP J;  3HD7 D;  3QWO C;  1JTH B;  2RMZ A;  4OGQ B;  1KB9 D;  1L0L K;  1GL2 C;  3SFE C;  5KAF E;  2KZI A;  2R32 A;  2OYO A;  2LXB A;  1NKZ B;  1NTM J;  1QL1 A;  3AEE C;  3BCC G;  1W5C E;  3JCU H;  4LLH A;  3B5N D;  1S9K E;  3L74 J;  1DH3 A;  2FXO A;  3KYQ A;  1G2C B;  2NPS D;  4K3A A;  4L75 A;  3WU2 H;  1G1I A;  1A02 F;  1ZLL A;  2ZJS E;  1NTZ J;  4ASV A;  4D6T G;  1XTG B;  3PHL A;  4DCK A;  1KZU B;  5GTH E;  3O6Q A;  4N3Y B;  3L71 G;  1JY3 O;  5AVZ B;  4EOT A;  2D2C C;  4XA4 A;  3S1K A;  1YJN P;  3BCC E;  3G3Z A;  3TDK A;  5APT A;  1MZ9 A;  1PP9 E;  3IR9 A;  1PZQ A;  5GTH H;  1NAY A;  2A06 E;  1SQV E;  2FYU D;  2PGD A;  2WPQ A;  3N4X A;  4N78 D;  1N73 B;  2QG4 A;  3U1A A;  2AXT E;  1KQG B;  2R5D A;  3L74 E;  1M56 D;  2IFM A;  2B87 B;  3RL0 C;  4KJM A;  2E75 B;  2HYN A;  2R3C A;  4HYT B;  3CI9 A;  3RGU A;  4PD4 D;  3GLM A;  1S5L E;  2DW3 A;  4PV1 C;  4H44 B;  3L71 J;  4IFF A;  4K35 A;  3VMX A;  1KYO I;  2O01 H;  5KJ7 C;  2AXC A;  1OMI A;  1RF1 B;  4D6T J;  1PP9 G;  3MUD A;  2IPP A;  1VDF A;  2Q3I A;  2WT7 B;  2A06 G;  2IX7 C;  2PRR A;  3AEF C;  3B4S A;  3L72 E;  2BCC E;  4U3F G;  1SQX E;  1GL2 B;  2QJP C;  2QM7 A;  2W6A A;  2O3J A;  2YKP A;  3CCM P;  3RK2 B;  3L74 G;  3H1K J;  1FU1 A;  5CJ0 A;  5APQ A;  4O9B A;  1L0N K;  1NTM G;  3F5H A;  1FZE A;  4Y99 B;  2VRS A;  3C8V A;  4JYC A;  1FDO A;  3BRV B;  2M3E A;  4IL6 E;  3HD7 A;  1VQO P;  4QMA A;  1ZN5 A;  1NTZ D;  4JPZ B;  1WT6 A;  2W6J H;  3O8Z A;  3MP7 B;  3VOP A;  1SQV D;  2QJK B;  3IN6 A;  3R2P A;  1SQB D;  1SLQ A;  2P1J A;  3E1R A;  2OAR A;  4LGD E;  1QLE D;  2PFX A;  2XU6 A;  2ZT9 D;  3H32 B;  3L74 D;  4IL6 X;  4UB8 E;  3CC2 P;  1R8E A;  4UB6 E;  1NGM B;  1BE3 J;  1BDC A;  2YO3 A;  1JCD A;  1SQB G;  2P58 A;  1N7L A;  1NTK D;  1PP9 D;  2Q5U A;  2QIW A;  3B8E B;  2W90 A;  3GHG A;  3NXS A;  1KQF B;  5B5E E;  1LJ2 A;  3SSU A;  1HUC A;  1SQQ G;  2WPR A;  5CCH C;  1IFI A;  3L72 D;  1BGY J;  1LT9 B;  3P8C D;  1ZR2 A;  5AVY B;  2KI7 B;  3CWB D;  5AW6 B;  3L35 A;  1KTM A;  2OTJ P;  3L36 A;  4GT1 A;  3CCR P;  1YIT P;  1KFN A;  1KIL A;  2IBZ D;  2N1T A;  2YKQ A;  5KJ7 A;  1L0L D;  1LTJ C;  2ZXE B;  4R4L A;  2N1T B;  2POH A;  3L70 D;  2LKM A;  2BCC D;  3AE2 C;  2L5G B;  1OVV A;  4NPE A;  4JBZ A;  3M0D A;  4DOJ A;  5K5G B;  1GW4 A;  2HPC A;  2H88 C;  1CI6 A;  2WSE H;  4IL6 H;  4I7Z C;  1Y8A A;  2K9Y A;  2KLV A;  3E7K A;  1K73 Q;  3HTK A;  3AE7 C;  3RK2 C;  1KIL D;  1EXI A;  1OWA A;  1MV8 A;  2KS1 B;  2OGU A;  1J2J B;  1G1J A;  2IYP A;  2WQY C;  3JC2 2;  3M0A A;  3NFQ A;  4H0L C;  2YXQ B;  5AVT B;  5B66 E;  3CCE P;  1U7J A;  2YKO A;  5EFW B;  2XV5 A;  1X79 B;  3E1I A;  1RF1 C;  1D7M A;  3BCC D;  1J1E C;  1L2P A;  4AQR D;  1GU4 A;  2AEJ A;  3KHU A;  1BGY G;  4UB6 H;  2C0X A;  4W80 A;  3EFG A;  1EZV I;  3C9I A;  1U7M A;  1L0N G;  1KC8 Q;  1FOS E;  1T3J A;  2AEF A;  2B88 A;  3TNU B;  1AV1 A;  2WSE J;  1P84 D;  1J1D B;  1EZV G;  1L4A D;  1N7S C;  3L4F A;  1LT9 C;  3AE3 C;  2K9J B;  3NMD A;  1OXZ A;  2I1J A;  3TSI A;  3V4W A;  1YYC A;  1Q7Y Q;  3CC4 P;  3OW2 O;  2CK3 H;  3AE9 C;  1YTZ T;  2AXT H;  1KYO E;  3AEG C;  3H1K E;  1ZME C;  2FYN B;  2YNY A;  2ZYD A;  1NYH A;  5CJ4 A;  3AE5 C;  2GUV A;  4M3L A;  4D6T E;  1YJ9 P;  1LTA C;  1IK7 A;  1FZC C;  1JTH A;  3TF5 A;  3TGU J;  1SVF A;  3MD0 A;  3PJS K;  1GW3 A;  1DIP A;  2J58 A;  2Q6Q A;  1T2K C;  4C7N A;  2M0B A;  2PP6 A;  1IFM A;  3Q5P A;  2WSF H;  2NPS C;  2O01 J;  1ZRT D;  5CMZ A;  3H1K G;  5E79 E;  2KB7 P;  2M5A A;  4L73 A;  2C9L Y;  2ZFC A;  4U3F J;  1Q81 Q;  2J5U A;  4Y99 C;  3VP9 A;  2Q7C A;  1JCC A;  3EFF K;  1PP9 J;  2KNC B;  2M3B A;  2FXP A;  2QM8 A;  2WMM A;  1AVO A;  3FWL A;  3H1H G;  2QE7 H;  3L75 D;  5M1B A;  2H89 C;  2E43 A;  2JDI H;  5KLV E;  2BEQ D;  2UWJ E;  3HE5 B;  1GTW A;  2WWW A;  2Y0C A;  3L73 J;  1NTZ E;  2P2U A;  2E75 D;  1FJK A;  1LTI C;  3CX5 H;  4DT0 A;  5B66 H;  1FS0 E;  1KB9 H;  1NTK G;  3CLQ A;  4HH2 A;  5AW9 B;  1RQV A;  3CX5 E;  1T3U A;  3RL0 B;  3WMM 0;  3P32 A;  1BDD A;  3H1H E;  4A7P A;  1VF5 D;  3IFM A;  2Q1K A;  4GDO A;  1YHQ P;  1E79 H;  1L0N D;  1PGJ A;  4MN4 C;  1E5W A;  1N86 A;  3UIA A;  2FBW C;  3RK2 D;  2M8R A;  5AW4 B;  2FYN C;  3I5C A;  1JY2 N;  4U7J A;  1NTZ G;  1ZRT E;  1GDT A;  1MUU A;  1YBK A;  1M1J B;  2E76 D;  2KXP B;  3VP8 A;  1EXJ A;  2IFN A;  3P8C E;  2QEX P;  3LW5 H;  3FGA D;  3O6Q B;  2XND H;  3G71 P;  3M91 A;  1ZW0 A;  3PRJ A;  1AVY A;  1MFZ A;  3S9O A;  3BCC J;  1YQ3 C;  1EC5 A;  3IF4 A;  4BWN A;  2XZR A;  2OYH B;  1L0L E;  1KFM A;  5AVW B;  1SQP G;  3U1C A;  1LGH B;  3HRN A;  4BRY A;  3CXH D;  1URQ A;  2RH0 A;  1LT1 A;  1LWU A;  4R4M A;  5AW5 B;  4N78 E;  1VQ4 P;  3A2A A;  2WPS A;  2YIU C;  3LW5 J;  2Y0E A;  1KIL E;  1KYO H;  2XKM A;  3AEB C;  3OJA B;  1LTJ A;  4GOE A;  1JO5 A;  1T6A A;  1FZG A;  1KQL A;  2WIT A;  1N7S D;  1FOS F;  3A7O A;  1GK4 A;  2JP3 A;  3AE8 C;  1L0L G;  1LTG C;  4H13 D;  1SQP E;  1GL2 A;  2ZT9 C;  2Z5I A;  5KAI H;  3TGU D;  3KPE A;  1JNM A;  1IO4 A;  4IFM A;  1BSN A;  1QGK B;  1BE3 E;  4OGQ D;  5CCH A;  1PV3 A;  1R5L A;  2GUS A;  2KLU A;  4Y28 J;  1SQX D;  2XDJ A;  5KLV J;  2E75 C;  3H1L E;  1VQP P;  1AFO A;  3B5N B;  3SWK A;  5E79 H;  5GTI E;  3M9Q A;  3PTZ A;  5CHX A;  1RF1 A;  4OH8 B;  1NVO A;  2WT7 A;  1T2K D;  1VQK P;  3EWK A;  1QL2 A;  3RK3 D;  4EI2 A;  1M90 Q;  3MZW B;  4EYY Q;  4XE5 B;  3D70 A;  3ABV C;  1KV4 A;  1HJB A;  1FJP A;  4JQ0 D;  3RK3 B;  2D2C B;  3V2N A;  3V5B A;  5DJT B;  5AVS B;  2D2C D;  2Y9Y A;  1S1C X;  1SQX K;  3H1L G;  3WUU A;  5CCG D;  5TIS H;  3A0H E;  3AED C;  1Y9B A;  3HE5 A;  4WY4 B;  5KJ7 D;  1YIJ P;  1QVF O;  2OYI B;  1GK6 A;  1BGY D;  1DX7 A;  2HLO A;  4RKU J;  2LXC B;  2E5T A;  2QJY B;  5BU8 B;  4EIJ A;  4H44 D;  1UII A;  1L4A C;  5AVQ B;  2V7Q J;  1L4A B;  3HUS B;  4LC1 A;  5DJU B;  1VQ6 P;  2QJY C;  1HTL C;  1MKM A;  4DJG A;  5CCH D;  1LTB C;  1BE3 D;  1CSB A;  1NU1 K;  2FYU E;  3NTN A;  4OGQ C;  4PJ0 E;  3L70 J;  2W83 C;  1GL2 D;  4RJT A;  2IZ1 A;  1GD2 E;  4I2L C;  3Q3D A;  1N7S A;  1USD A;  1PIX A;  2E74 D;  2FYU J;  2QJP B;  1SQV J;  3EQ2 A;  1G2C A;  3H32 A;  2A45 H;  3L75 J;  2E74 B;  3H1J J;  2KSJ A;  4TT3 H;  5APY A;  3RL0 g;  3VN0 A;  2KYV A;  3MTU E;  1PPJ G;  2I8D A;  4GOD A;  2A45 I;  5AW1 B;  4Z1M H;  5CBN A;  1SP4 A;  3GHG B;  4YPC A;  3VMY A;  5KAF H;  1K9M Q;  3CX5 D;  2C9N Y;  3B5N C;  2KZJ A;  1PGO A;  3M9H A;  1NU1 E;  2FYU K;  1IC2 A;  3GF3 A;  2QRX A;  4JF7 A;  2B9B A;  1BCC J;  3L72 G;  3HE4 B;  3MIW A;  1KB9 I;  3KXD A;  1SQX G;  1EDL A;  4PJ0 H;  4UB8 H;  2FFD B;  3CCQ P;  3HD7 C;  3TK1 A;  1SQV K;  1NKN A;  5APX A;  1VQM P;  1OW8 A;  1M1J A;  3M0D C;  4RES B;  3CCS P;  1PPJ E;  2NRG A;  1YJW P;  1R5S A;  1KMI Z;  2E76 C;  2HOD B;  2MJZ A;  1NTM K;  1RE3 C;  1SQQ K;  2K9J A;  3HTK B;  3N7N A;  1HGV A; 
#chains in the Genus database with same CATH homology
 4GKG A;  1RF0 A;  3V2P A;  2O1K A;  3RL0 D;  3T97 A;  2WTY A;  3VYI A;  4C7R A;  1SFC B;  3SWF A;  1SFC D;  3TYY A;  2FXM A;  2XNX A;  2Q9I A;  1VPC A;  1H89 A;  2A45 G;  5BVZ A;  5AVR B;  2O1J A;  3P8M C;  1ZV8 A;  1EQ7 A;  3H6P A;  3A5T A;  2J59 M;  4B86 A;  5KTB A;  2NPS A;  1A02 J;  1JY2 O;  5APV A;  3B5N A;  4KHX A;  3V2R A;  1LTS C;  3BAS A;  1NOH A;  5AVX B;  1KIL C;  1S9K D;  1URQ B;  1JOC A;  3BRT B;  1IK9 A;  1HGZ A;  4C7N B;  1N2D C;  1FDM A;  2CPS A;  1IFD A;  3OAK A;  1NO4 A;  3V4Q A;  1L4A A;  3HUS C;  4IFD K;  2NPS B;  1HVV A;  5AW3 B;  1HWT C;  3VTP C;  3LIE A;  1FZC B;  1RE4 A;  2E42 A;  1YTZ I;  2FFD C;  5AVV B;  1H88 A;  1JY3 N;  1NTK K;  1W2E A;  1CI6 B;  2FKW B;  1N73 A;  4W7Y A;  1JY2 P;  1LT9 A;  4I6M C;  1SQB K;  1LWU C;  2JEE A;  1FZF A;  2H8P D;  2FFD A;  2W6B A;  3PP5 A;  1IJD B;  4ZKU A;  2I1K A;  1CW5 A;  3MGN A;  5AVU B;  1LTJ B;  3VMZ A;  5AW0 B;  1SQP K;  2WZ7 A;  4AUW A;  1H8A A;  1CZQ A;  3M06 A;  1NTZ K;  1IFN A;  3RK3 C;  3TNU A;  4GIF A;  3HD7 B;  4WY4 A;  1N7S B;  1HBW A;  1DEB A;  3BVH A;  1FBM A;  2HPC B;  2P67 A;  3GHG C;  3CL3 D;  2HFE D;  1SFC A;  4W7Z A;  1JY3 P;  1GU5 A;  1NH4 A;  1SFC C;  1WRG A;  1ZR4 A;  1IFJ A;  5KLV K;  1JMM A;  1X9V A;  4JYB A;  5AW7 B;  3OA7 A;  4WY4 D;  5AW2 B;  1FAV A;  4DZO A;  2OYI C;  5APW A;  4WY4 C;  2JJL A;  1FZC A;  2HG5 D;  1FZA A;  5CCG C;  1RE3 A;  1N73 C;  1LWU B;  1M7L A;  1RF0 C;  3HE4 A;  1URQ C;  3U59 A;  2BAS A;  2N9B A;  5APU A;  1NHL A;  1J1D C;  2Z4E A;  3V2Q A;  1GZL A;  3A3Y B;  5APS A;  3P7K A;  2KP8 A;  1XTC C;  1PFI A;  1JUN A;  1RE4 C;  2R5B A;  1NAF A;  2H7H A;  5BU5 A;  3L37 A;  4WBA A;  2FYZ A;  3SWY A;  1RY3 A;  2C0W A;  1T8Z A;  3HUS A;  2CPB A;  3LID A;  2WSC H;  2Z5H A;  2N1T C;  4AYC A;  5CCG A;  5AW8 B;  4WB4 A;  2OYH C;  2OYI A;  3KDP B;  2W27 A;  4N6J A;  1FZB A;  1Z56 A;  2N1T D;  1X8Y A;  2P7J A;  1M1J C;  4C46 A;  1HH0 A;  4ZKP A;  3M9B A;  1KIL B;  2PAJ A;  2GM4 A;  2YMY A;  2YO2 A;  2HOD A;  1J1E B;  2KOG A;  3II6 A;  1LTT C;  3BAT A;  4I1L A;  3KQG A;  1URQ D;  2OYH A;  2H43 A;  3HD7 D;  1JTH B;  1L0L K;  1GL2 C;  2R32 A;  1NKZ B;  1QL1 A;  4LLH A;  1S9K E;  3B5N D;  1DH3 A;  3KYQ A;  1G2C B;  2NPS D;  1A02 F;  1G1I A;  1ZLL A;  1XTG B;  1KZU B;  4N3Y B;  5AVZ B;  1JY3 O;  4EOT A;  4XA4 A;  3G3Z A;  5APT A;  1MZ9 A;  3IR9 A;  2WPQ A;  3N4X A;  4N78 D;  1N73 B;  3U1A A;  2R5D A;  2IFM A;  3RL0 C;  2HYN A;  2R3C A;  4HYT B;  3CI9 A;  3VMX A;  4IFF A;  2O01 H;  5KJ7 C;  1RF1 B;  3MUD A;  2IPP A;  1VDF A;  2Q3I A;  2IX7 C;  1GL2 B;  2QM7 A;  2W6A A;  2YKP A;  3RK2 B;  1FU1 A;  5CJ0 A;  5APQ A;  4O9B A;  1L0N K;  4Y99 B;  1FZE A;  2VRS A;  4JYC A;  3BRV B;  3HD7 A;  1ZN5 A;  1WT6 A;  3O8Z A;  3VOP A;  5CHX A;  1SLQ A;  2P1J A;  4LGD E;  2OAR A;  1AQ5 A;  2XU6 A;  3H32 B;  2YO3 A;  1JCD A;  3R2P A;  1N7L A;  2Q5U A;  3GHG A;  3B8E B;  3NXS A;  1HUC A;  2WPR A;  5CCH C;  1IFI A;  1LT9 B;  3P8C D;  1ZR2 A;  5AVY B;  5AW6 B;  3L35 A;  3L36 A;  4GT1 A;  1KFN A;  1KIL A;  2YKQ A;  2N1T A;  5KJ7 A;  1LTJ C;  2ZXE B;  2N1T B;  2POH A;  2LKM A;  2WT7 B;  2L5G B;  4DOJ A;  3M0D A;  1GW4 A;  2HPC A;  1CI6 A;  2WSE H;  2KLV A;  3HTK A;  3RK2 C;  1KIL D;  1OWA A;  1MV8 A;  3M0A A;  3NFQ A;  1J2J B;  1G1J A;  5AVT B;  2YKO A;  2XV5 A;  1X79 B;  3E1I A;  1RF1 C;  1J1E C;  4AQR D;  1GU4 A;  4W80 A;  2C0X A;  3EFG A;  3C9I A;  1FOS E;  1T3J A;  3TNU B;  1J1D B;  1L4A D;  1N7S C;  3L4F A;  1LT9 C;  3V4W A;  2E43 A;  3NMD A;  1OXZ A;  2I1J A;  3TSI A;  1YYC A;  1YTZ T;  2YNY A;  5CJ4 A;  2GUV A;  4M3L A;  1LTA C;  1FZC C;  1JTH A;  1SVF A;  3MD0 A;  1GW3 A;  2J58 A;  1T2K C;  4C7N A;  2PP6 A;  1IFM A;  2WSF H;  2NPS C;  5CMZ A;  2KB7 P;  2C9L Y;  2ZFC A;  4Y99 C;  3VP9 A;  2Q7C A;  1JCC A;  2M3B A;  2QM8 A;  3HE5 B;  1GTW A;  2WWW A;  2P2U A;  1FJK A;  1LTI C;  3CLQ A;  4HH2 A;  5AW9 B;  3WMM 0;  1T3U A;  3RL0 B;  3P32 A;  3IFM A;  1E5W A;  1N86 A;  3UIA A;  3RK2 D;  2M8R A;  5AW4 B;  3I5C A;  1JY2 N;  1GDT A;  1MUU A;  1M1J B;  3VP8 A;  2IFN A;  3P8C E;  3LW5 H;  3M91 A;  1MFZ A;  2XZR A;  2OYH B;  3U1C A;  1KFM A;  5AVW B;  1LGH B;  3HRN A;  1URQ A;  1LWU A;  5AW5 B;  4N78 E;  3A2A A;  2WPS A;  2XKM A;  3OJA B;  1LTJ A;  1JO5 A;  1FZG A;  1KQL A;  2WIT A;  1N7S D;  1FOS F;  3A7O A;  1GK4 A;  1LTG C;  1GL2 A;  1JNM A;  2Z5I A;  1IO4 A;  3KPE A;  4IFM A;  5CCH A;  2GUS A;  2XDJ A;  1AFO A;  3B5N B;  3M9Q A;  1RF1 A;  4OH8 B;  2WT7 A;  1T2K D;  1QL2 A;  3RK3 D;  4XE5 B;  1HJB A;  1FJP A;  3RK3 B;  3V2N A;  3V5B A;  5AVS B;  1SQX K;  5CCG D;  3HE5 A;  4WY4 B;  5KJ7 D;  1DX7 A;  2OYI B;  1GK6 A;  2HLO A;  5BU8 B;  4EIJ A;  1L4A C;  5AVQ B;  4LC1 A;  1L4A B;  3HUS B;  1HTL C;  5CCH D;  1LTB C;  1CSB A;  1NU1 K;  3NTN A;  1GD2 E;  1GL2 D;  4I2L C;  1N7S A;  3EQ2 A;  1G2C A;  3H32 A;  2A45 H;  2KSJ A;  5APY A;  3VN0 A;  2KYV A;  3MTU E;  2A45 I;  5AW1 B;  1SP4 A;  3GHG B;  3VMY A;  2C9N Y;  3B5N C;  3M9H A;  2FYU K;  1IC2 A;  4JF7 A;  3MIW A;  3HE4 B;  2FFD B;  3HD7 C;  3TK1 A;  1SQV K;  1NKN A;  5APX A;  1M1J A;  3M0D C;  4RES B;  2HOD B;  2MJZ A;  3HTK B;  1NTM K;  1RE3 C;  1SQQ K;  1NWQ A;  3N7N A;  1HGV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...