3GHGA

Crystal structure of human fibrinogen
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
174
structure length
174
Chain Sequence
ACKDSDWPFCSDEDWNYKCPSGCRMKGLIDEVNQDFTNRINKLKNSLFEYQKNNKDSHSLTTNIMEILRGDFSSANNRDNTYNRVSEDLRSRIEVLKRKVIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKDLLPSRDRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human fibrinogen.
pubmed doi rcsb
molecule tags Blood clotting
molecule keywords Fibrinogen alpha chain
total genus 55
structure length 174
sequence length 174
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2009-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08702 Fib_alpha Fibrinogen alpha/beta chain family
A PF12160 Fibrinogen_aC Fibrinogen alpha C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3ghgA00
2FFDA 1FZGA 2A45G 1RF1B 2A45H 1N73B 2A45I 1FZEA 1FZCA 1FZCB 1LT9B 1RF1A 1N73A 1JY2O 1RE3C 1RF0C 2OYIA 3H32B 2OYHB 1RE4C 2OYIC 2OYHA 1JY3P 3HUSB 1JY3O 2Q9IA 2FFDB 1M1JB 1RF0A 2HPCB 1LWUB 1JY2N 1RE4A 1W2EA 2XNXA 1FZCC 2HLOA 1RE3A 2OYHC 2H43A 1RF1C 3E1IA 1N73C 3H32A 2HODB 1T3UA 1FZFA 1FZAA 1LTJC 1M1JA 3GHGB 1LWUC 3GHGA 1FZBA 2OYIB 1LWUA 3HUSA 1LTJA 1JY3N 3HUSC 1LT9A 2Z4EA 2FFDC 1LT9C 1M1JC 3GHGC 3BVHA 2HPCA 1N86A 1JY2P 2HODA 1LTJB
chains in the Genus database with same CATH superfamily
2E74C 2QRXA 3GLMA 3O8ZA 3S4RA 4LGDE 4D6TD 2A06E 3T97A 3ABVC 5GTIE 5CJ0A 1PP9G 1KFNA 1URQC 1UIIA 4DZOA 5AW1B 2O3JA 1HBWA 4L76A 2H7HA 2YMKA 1AA0A 2SPZA 3AE2C 4GODA 5CCHC 3CC4P 1VQKP 1GZLA 3KZIH 4YTPC 1AQTA 2YO3A 1W5CE 2OTJP 1E79H 1L0NK 3LIDA 3W68A 1GW4A 1HUCA 3A0BE 3AE3C 5AVQB 1OVRA 1SS1A 4KT0J 3TGUJ 2FY8A 4DJGA 2WPRA 3AE9C 1EXJA 1HTLC 1NTKD 5APUA 2A06G 1NHLA 1GMJA 3CD6P 5C39A 1KQLA 1SQQD 1PPJE 3M9BA 5AW6B 3RK3B 1ZV8A 1N7SA 4DCKA 4JYCA 4TT3H 2RN0A 2OYIB 2WTYA 3NFQA 1KYOI 1OFCX 4JPZB 4ASWA 3HRNA 1SQPE 3GHGC 2KSEA 1SQVE 1SQVK 4IL6E 1G2CB 1IFNA 4WY4A 2B87A 5B5EE 3L70G 2E43A 1IK7A 1LT9B 2N1TD 1OZHA 4EIJA 1KC8Q 1RF1A 3L72J 1BGYD 3OA7A 1Y9BA 3IF4A 2YKPA 3B71A 3HD7B 4OGQD 5APTA 1K8AQ 1RH5B 3AE8C 1KILB 1M56D 1PV3A 2E75C 2K1AA 3RK3E 4Y99C 1PIXA 1U7MA 1RE4A 1VQPP 2W6AA 2KI7B 1EZVE 3O6QB 3H1HJ 3HTKA 3H1LE 3G9RA 2FYUJ 4OWFA 4ZMDA 2JWDA 3V4QA 2XV5A 3L70D 1Q90D 2KLUA 3BCCD 3H1KG 3TGUD 1VQ5P 1H88A 3JCUH 3CX5E 1DD4A 1LTJC 4B86A 1EC5A 1MZ9A 2NZ2A 1Z56A 4QMAA 5APSA 3I5CA 3L73E 4WY4D 2P58A 1LT9A 2B89A 2FFDC 1GTWA 1PZQA 1KB9D 4TLFA 3VMAA 2IFNA 3RL0D 1YHQP 1NU1G 3BVHA 2QM8A 1KQGB 2B87B 5BU5A 1X9VA 1LP1B 1SVFA 2FYNB 1RF1B 1USEA 2A45I 1EQ7A 1BGYG 1HJ0A 1SFCB 1NTZJ 3B5NC 4WVZA 4BRYB 3CCRP 1FOSF 1KFMA 2XNDH 1K73Q 3B8EB 2QJPB 1RE4C 2QJYB 1Y47A 1NTMG 3O6QA 3A0HH 4OVNF 5APWA 5AW4B 1X79B 5DJTB 3G6EP 2ZJSE 1Q81Q 2RH0A 1GL2C 1NH4A 2FFDB 2AXTE 2H8PD 2WSEH 3PP5A 3TNUB 4C7NB 1KYOD 2W27A 1A02J 5KLVG 1ZRTD 5GTHH 3PTZA 3RK2C 1HH0A 1S4XA 2CK3H 1YYCA 4CPGA 1PGOA 1J1DC 5CHXA 5AW8B 2RKLA 2WITA 1VQ4P 1AVYA 1L0NJ 1NWQA 2FFDA 1JOCA 2ZT9D 2Q6QA 3L74D 4MN4C 4D6TE 1BCCG 2AEFA 2E5TA 2H89C 3BRTB 4PD4D 2KZJA 3AEGC 1XTGB 1CI6B 1RHZB 2CPSA 2R5BA 3T97B 1JCCA 3C1LA 4AUWA 1L0NG 1YTZI 3EFGA 1FZCB 1YJ9P 3SFEC 1NTZE 1N7LA 1PP9D 2E74B 1JY3P 2WT7B 4BWNA 2WPVB 2Q9IA 1YBKA 2HR3A 4UB6E 2QG4A 1WRGA 3FX0A 3AEFC 5CCHA 1YITP 1JTHA 1L2PA 2YNYA 3E1IA 2AXCA 3L73J 1SLQA 2OQQA 3HD7D 4JQ0D 5KKZC 3FXDA 2K9JB 2WSCH 2E76B 3WMM0 1IK9A 4R4MA 5E79H 1M8OB 2E42A 2GUVA 3HUSA 1FDOA 3E1RA 5BU8B 3VYIA 1L0ND 1R8EA 4K3AA 1M90Q 3H1HE 3U59A 3V6IA 1H89A 1VDFA 5AW5B 3VP9A 1FE6A 2JJLA 1SQXK 1LTJB 3HE5B 4N6JA 1NU1J 3CXHE 3Q2YA 5TJHA 2JR8A 1EZVI 3SFDC 1NU1K 1L4AB 2MKVA 1EDLA 2OTLP 3M0DC 1DH3A 1QVGO 1IO4A 1KMIZ 5M1BA 1GU5A 1JM0A 3A0BH 3TSIA 3H1KJ 5E79E 3VMZA 2D2CB 4HKZH 3TDKA 3A5TA 1L4AD 2R44A 4WB4A 2JDIH 4U3FD 1OW6A 1NO4A 1Y8AA 1RE3A 2JKVA 3M0DA 3N4XA 3NXSA 3CMAP 1IC2A 1HVVA 1OWAA 1QEXA 3AE5C 2NPSA 3H32A 3KYQA 3L73D 3V2PA 1GL2B 2KNCA 2KSJA 3L37A 4OH8B 4D6TJ 1LTJA 3HE5A 3RBXA 1N7SC 3TGUE 1LT1A 5EFWB 1R5LA 3H1LD 3BASA 1QGKB 4L74A 3V4WA 4HYTB 2LXBA 1NU1D 4I1LA 3FGAD 3MUDC 4EI2A 1KTMA 3CCQP 2O01N 3MZWB 2Y9YA 5AW7B 3GF3A 2P1JA 4H13C 1NKZB 2Q3IA 1AFOA 1BGYJ 1KILC 2NPSD 4UB8H 1BDDA 2WPSA 2YIUC 1NU1E 4XA4A 3NMDA 3ZDMA 4HB1A 1KV4A 1SQQJ 1JMMA 1NTMD 3CC2P 1L0LD 3V2QA 1N8RQ 1N73C 2AEMA 1KQSO 1SQVG 3H1HD 1HF9A 3CX5H 3H1IG 1DX7A 2I1JA 1PFIA 2BEZF 1LNQA 2W8ZA 3BCCJ 1OVUA 1M7LA 5APVA 4EOTA 3H6PA 4R4LA 2JWAA 3IN6A 2Q7CA 1QX8A 2ZYGA 1EDKA 1NTKE 3AEDC 3HD7A 2D2CC 4C46A 5AW0B 1T2KC 2OTKE 2J5UA 1L0LG 3GW6A 1IFJA 1N86A 5KJ7D 4U7JA 1IFDA 1QLED 2KP8A 3G71P 3CCJP 1HWTC 3PRJA 1EZVG 1IFMA 1LGHB 3B5NB 4C7RA 5AVUB 2IBZG 3KXDA 1FZCA 1LJ2A 2OGUA 2WSFJ 1VQOP 2P10A 1NTZD 1RQUA 4JYBA 3L70J 4L73A 1JEKA 2XZRA 2C9LY 1SQXJ 1N7SB 3IR9A 2PP6A 1NAFA 3L4FA 3P7KA 4RKUJ 1NTKG 1X22A 2K37A 1YQ4C 2HG5D 4K35A 3V2RA 1L0LK 1L0LE 5APYA 1NTME 1U7JA 1ZP0C 2IYPA 3U1AA 1KB9H 1MKMA 2KUBA 3M06A 3VP8A 1JO5A 1L0NE 1FC2C 2KK7A 1BGYE 2FXMA 2I8DA 4I7ZB 5CCGC 2V7QH 1JMBA 2IX7C 1OW8A 2LXCB 5KLVE 4PJ0E 4JF7A 3BATA 1NYHA 3L71G 2R3CA 1P84I 1YQ3C 3Q5SA 1SQPK 5KKZB 2YKQA 3EWKA 3VN0A 1VQ6P 2WSSH 3L75D 1K9MQ 2KZIA 1KN7A 2IDBA 3CCVP 4IL6X 2QJKB 3QH9A 2MJZA 3M9HA 2PGDA 3AEAC 2Q5UA 3F5HA 2W6BA 3KDPB 1BDCA 3Q1MA 4GT1A 1H0TA 1PP9J 2OARA 4RESB 1SQXD 3L71E 1JCDA 1HGVA 1SFCA 2JEEA 4PD4E 4PV1B 4U3FE 1YJWP 3L74J 3L71D 2CPBA 4OGQC 1KB9E 1LP1A 2YXRB 3SSUA 3WUVA 2H43A 2GM4A 1QL2A 1HJBA 2W6JH 2N1TB 2WSEJ 1TU3F 1FZAA 1URQA 5AVZB 2OYOA 1VQNP 4IFDK 1SQQK 4LLHA 2WT7A 4GOFA 1ZRTE 5L8RJ 3TNUA 1LTBC 1GD2E 2WQYC 3V5BA 1H0TB 1DIPA 1MFTA 1IFIA 1OVVA 3C9IA 2ZFCA 1OW7A 4ZKPA 4DT0A 2K9JA 4AQRD 3TF5A 1EXIA 5KLVD 1L4AC 1DEBA 2N9YB 3C8VA 3GG2A 5GTHE 2PFXA 3BCCG 5AW3B 1GDTA 3LW5H 1J1EB 3AE1C 1VF5C 2WMMA 2YMYA 1SQVJ 3S9OA 5B66E 1KYOE 1RF0A 1SQPG 5APQA 2V4HA 4H0LC 1FBMA 1OIPA 1JY2N 2XNXA 3R4YA 4W80A 2ITAA 2O01J 1KD1Q 1SQQG 1JUNA 3ITKA 2ZT9B 4U3FJ 1X0TA 1ZOYC 3CX5I 4H13B 2QJKC 3L71J 3KPEA 3S1KA 1SQBG 4ASVA 5H2FH 5KAIH 4A7PA 1PP9E 1AVOA 2IYOA 2PRRA 4M3LA 2G8YA 3K5BA 1FZBA 3BRVB 3BCCE 3R2PA 3HE4B 5KLIC 3RK2D 4YPCA 1M1JC 5CBOA 1EDJA 3PH0A 3V2NA 3G3ZA 2XKMA 4I7ZC 2QVAA 5AW2B 3M91A 2IZ0A 2Z5IA 2GA1A 3GMAA 1FZGA 4OGQB 2HFED 3TK1A 1JTHB 3RK3D 4ZKUA 5CCGA 1FZEA 5KAFE 1EDIA 4XFJA 3MTUE 4D6TG 4UB8E 3D6YA 3GF7A 1RF0C 4H44D 1H8AA 1OX3A 2QE7H 1XTCC 5CMZA 2OYHA 1FAVA 3EQ2A 3H1LG 3WUTA 2M3BA 3L70E 5TISH 2E76D 4LC1A 4XE5B 1LTIC 1S3JA 3CXHD 3RL0B 3WU2E 1L4AA 1L0LJ 3L72D 2BCCE 1X8YA 2WZ7A 5BVZA 1FZFA 2JP3A 1PPJD 2LKMA 4H44B 4PV1C 1OMIA 2H88C 4N3YB 3H25A 2FYZA 1N2DC 2E74D 3F89A 2W90A 1JNMA 1NOHA 1IZNB 2P7JA 3H1IJ 2Z4EA 5CJ4A 1IJDB 5KTBA 3WU2H 1URQD 3KHUA 2QEXP 5AVYB 1BE3G 2GUSA 2NRGA 3MD0A 4EDFA 4IFFA 4ZNCA 5CCHD 3P32A 1KB9I 4NPFX 4HJGH 5DJUB 4WY4B 4DOJA 1OXZA 3OJAB 2BCCG 3U1CA 2E5YA 3D71A 1ZXGA 1K05A 2YXQB 1CSBA 1LTSC 1GU4A 1VQLP 1GW3A 3CCSP 3CCEP 2IBZD 1BCCE 3L73G 1M1JB 1SFCD 2KYVA 2W83C 2YKOA 1IFPA 2M0BA 1EZVD 2QSIA 5CCGD 1MV8A 2FXOA 3L74E 1YI2P 1FDMA 3MUDA 1RY3A 2FXPA 2I1KA 4AYCA 1LWUC 1NAYA 3VMYA 1FDIA 1KZUB 2IPPA 2ZAEB 2P67A 2KS1B 1K04A 2QM7A 3CI9A 2A06D 3CWBE 3A7OA 2IFMA 2E75B 3MIWA 3H1ID 3CCLP 2VRSA 3II6A 1SQBK 2DW3A 1BCCJ 2C0WA 4I6MC 2Y0DA 3LW5J 4IL6H 1T3JA 1P84D 1T8ZA 3H1JE 1S5LH 2B9BA 1ZMEC 3FWLA 1G1JA 1WT6A 4BRYA 1FJKA 2E75D 4EYYQ 1N73A 1RE3C 1Q86Q 2OYIA 1DEEG 3NTNA 3SWKA 5AVTB 1YIJP 1JY3O 4W7ZA 3CWBG 1P84E 3AEBC 2M5AA 3H1JD 2KIKA 4GIFA 3B5NA 1NKNA 2Y0EA 4Z1MH 4L75A 1YTZT 3SWFA 3JC22 3MP7B 4RJTA 3OAKA 1RF1C 3CMEP 4KJMA 4N78E 1S1CX 1DD3A 1FJPA 2AXTH 4WY4C 1W2BO 3G4SP 1G2CA 5KAFH 3CX5D 4H0LB 5AVSB 3GHGA 3RL0g 1NTZG 1HGZA 5AW9B 2FBWC 1ZR4A 1NGMB 1JB0J 4RO0A 3RGUA 1BSHA 1BE3J 3H1KD 2A45G 1SQBE 2KOGA 1BCCD 2D2CD 2PAJA 3CL3D 3CWBJ 3VTPC 1N73B 2N1TA 4Y28J 3CC7P 3KQGA 1URQB 5B66H 5KJ7C 3D6ZA 4H0LD 1R5SA 5H2FE 1LTGC 1GL2D 1M57D 2OYHB 1MFZA 2C9NY 2WPQA 2ZVOB 4GOEA 2WVRA 2R3SA 1SQVD 3H1HG 2Z5HA 2QA4P 1NTMK 3P8MC 2HLOA 1J2JB 1D7MA 2QJPC 2QJYC 3CPWO 3Q5RA 1PPJG 3B4SA 2G3AA 3H1LJ 4PD4I 2J59M 1S2EA 3EFFK 1KORA 1SQQE 3L72G 1AV1A 3UIAA 5KLVK 3VOPA 2Y0CA 3E7KA 1RQVA 1YJNP 5KLIB 1JY3N 1AJYA 5KLVJ 1Q2NA 2KXPB 3L72E 1PGJA 1E5WA 2HPCA 5AVRB 5B5EH 1FU1A 1J1DB 4H44C 3H1IE 1S5LE 1BE3D 2Q1KA 4PD4H 1ZN5A 1Q7YQ 1NTMJ 2Q3EA 3CWBD 2B88A 2RMZA 2HYNA 1WMKA 5GTIH 3I55P 3TYYA 3W67A 1NTZK 2BCCJ 3IAOA 3AE4C 1SQBJ 1U57A 4I2LC 4NPDA 2XU6A 3AE7C 1BE3E 4Y99B 3PJSK 3TGUG 3WUUA 2L5GB 2N1TC 3H1KE 2ZXEB 3P8CD 4UB6H 5APXA 1W2EA 2HPCB 2FYUD 1FS0E 3RBZA 3P8CE 2IBZE 2BASA 2NPSB 3CXHI 2BEQD 1T6AA 1T3UA 2FKWB 2YO2A 3A3YB 2XDJA 3QWOC 3I56P 1SP4A 1NJIQ 4PJ0H 1S9KE 2R5DA 3KZIE 3PLNA 2M3EA 3HUSC 3SWYA 1LTTC 1LT9C 1PGQA 1ZW0A 2FYUG 3Q3DA 1VQ8P 4HH2A 3USSA 2HODA 1SQPD 3FXEA 5K5GB 1GK4A 1LTAC 4C7NA 3CXHH 3CCMP 2K9YA 2ZYAA 3RL0C 2J58A 2R32A 2K88A 1SFCC 2IBZI 2QIWA 1S9KD 1CZQA 1JY2O 2POHA 3A0HE 2P2UA 4GDOA 1AQ5A 3LIEA 2O1JA 1KILE 3B5ND 2BCCD 1SQBD 3HE4A 1VPCA 1KILA 3L74G 4W7YA 2FYUK 2FYUE 1FZCC 2WSCJ 3H1JG 1NVOA 2C0XA 3HTKB 2OYHC 2JO1A 1CI6A 3RK2B 1VF5D 1KQFB 1ZR2A 1CW5A 2ZXXA 1N7SD 2HODB 4YXWH 5KJ7A 3L36A 1QL1A 5AVWB 5KAIE 3MGNA 4IFMA 3L75J 5CBNA 1S72P 3M0AA 3GHGB 4O9BA 1UIXA 2FYNC 5TISE 3Q5PA 1QVFO 1LWUA 1ZLLA 1J1EC 2YIUB 1VF5B 2AEJA 2K3RA 3IFMA 3M9QA 3MHVA 4N78D 4U3FG 3OW2O 3JSVC 5AVVB 2Y9ZA 1JY2P 1VQ7P 2M8RA 1MUUA 2UWJE 1S5LX 3N7NA 4H13D 4WWIA 1SQPJ 1SQXE 2A45H 2ZT9C 2O1KA 3VMXA 1BSNA 1KILD 1G1IA 1PGPA 2NPSC 3A2AA 3FWNA 3JCUE 1P84H 1GL2A 2KNCB 2L91A 1FOSE 3L75G 4JBZA 4YXDC 3H32B 2ZYDA 3RK3C 2KS1A 2OYIC 2WWWA 3L35A 3HUSB 3D70A 2N9BA 4IOIH 1M1KQ 3AEEC 1GK6A 3L75E 3H1JJ 2KB7P 1LWUB 1PL5A 2V7QJ 2LR2A 3AECC 4BXLA 2ZVNB 1VQMP 1NTKJ 3CCUP 3CLQA 1SQXG 2E76C 1T2KD 1A02F 1NTKK 4NPEA 2KLVA 1KYOH 2IZ1A 4GKGA 4KHXA 4WBAA 1USDA 1M1JA 1Q82Q 1VQ9P 2O01H 3PHLA 5AVXB 2WSFH 3HD7C 2M5AB 1VL2A 4PV1D 3AE6C
chains in the Genus database with same CATH topology
3O8ZA 4LGDE 3T97A 5CJ0A 1URQC 1KFNA 4DZOA 5AW1B 2H7HA 5CCHC 1GZLA 2YO3A 3LIDA 1L0NK 1GW4A 1HUCA 5AVQB 2WPRA 1HTLC 5APUA 1NHLA 1KQLA 5AW6B 3M9BA 3RK3B 1ZV8A 1N7SA 2OYIB 4JYCA 2WTYA 3NFQA 3HRNA 3GHGC 1SQVK 1G2CB 1IFNA 4WY4A 2E43A 1LT9B 2N1TD 4EIJA 1RF1A 3OA7A 2YKPA 5APTA 3HD7B 1KILB 4Y99C 1RE4A 2W6AA 3HTKA 3V4QA 2XV5A 1H88A 1LTJC 4B86A 1MZ9A 1Z56A 3I5CA 4WY4D 2FFDC 1LT9A 1GTWA 2IFNA 3RL0D 3BVHA 2QM8A 5BU5A 1X9VA 1SVFA 1RF1B 2A45I 1EQ7A 1SFCB 3B5NC 1FOSF 1KFMA 3B8EB 1RE4C 5APWA 5AW4B 1X79B 1GL2C 1NH4A 2H8PD 2WSEH 3PP5A 3TNUB 4C7NB 2W27A 1A02J 3RK2C 1HH0A 1YYCA 1J1DC 5CHXA 5AW8B 2WITA 1NWQA 1JOCA 3BRTB 1XTGB 1CI6B 2CPSA 2R5BA 1JCCA 4AUWA 1YTZI 3EFGA 1FZCB 1N7LA 1JY3P 2WT7B 2Q9IA 1WRGA 5CCHA 1JTHA 2YNYA 3E1IA 1SLQA 3HD7D 2WSCH 3WMM0 1IK9A 2E42A 2GUVA 3HUSA 5BU8B 3VYIA 3U59A 1H89A 1VDFA 5AW5B 3VP9A 2JJLA 1SQXK 3HE5B 1LTJB 4N6JA 1NU1K 1L4AB 3M0DC 1DH3A 1IO4A 1GU5A 3TSIA 3VMZA 3A5TA 1L4AD 4WB4A 3M0DA 1NO4A 1RE3A 3N4XA 3NXSA 1IC2A 1HVVA 1OWAA 3H32A 2NPSA 3KYQA 3V2PA 1GL2B 2KSJA 3L37A 4OH8B 1LTJA 3HE5A 1N7SC 3BASA 3V4WA 4HYTB 4I1LA 5AW7B 2P1JA 1NKZB 2Q3IA 4XA4A 1KILC 2NPSD 5APSA 2WPSA 3NMDA 1JMMA 3V2QA 1N73C 1DX7A 2I1JA 1PFIA 1M7LA 5APVA 4EOTA 3H6PA 2Q7CA 3HD7A 4C46A 5AW0B 1T2KC 1IFJA 1N86A 5KJ7D 1IFDA 1HWTC 2KP8A 1IFMA 1LGHB 3B5NB 4C7RA 5AVUB 1FZCA 4JYBA 2XZRA 2C9LY 3IR9A 1N7SB 3L4FA 2PP6A 1NAFA 3P7KA 3V2RA 2HG5D 1L0LK 5APYA 3U1AA 3M06A 1JO5A 3VP8A 2FXMA 5CCGC 2IX7C 4JF7A 3BATA 2R3CA 1SQPK 2YKQA 3VN0A 2MJZA 3M9HA 2Q5UA 3KDPB 2W6BA 4GT1A 2OARA 4RESB 1JCDA 1HGVA 1SFCA 2JEEA 2CPBA 2H43A 2GM4A 1QL2A 1HJBA 2N1TB 1FZAA 1URQA 5AVZB 1SQQK 4LLHA 2WT7A 3TNUA 1LTBC 1GD2E 3V5BA 1IFIA 3C9IA 2ZFCA 4ZKPA 4AQRD 1L4AC 1DEBA 5AW3B 3LW5H 1J1EB 2FFDB 2YMYA 1RF0A 5APQA 2HPCB 1FBMA 4W80A 1JY2N 2XNXA 1JUNA 3KPEA 4M3LA 1FZBA 3BRVB 3RK2D 3R2PA 3HE4B 1M1JC 3V2NA 3G3ZA 2XKMA 1A02F 5AW2B 3M91A 2Z5IA 2FFDA 1FZGA 5CCGA 2HFED 3TK1A 1JTHB 3RK3D 4ZKUA 1FZEA 3MTUE 1H8AA 1RF0C 5CMZA 1XTCC 2OYHA 1FAVA 3EQ2A 2M3BA 4XE5B 4LC1A 1LTIC 3RL0B 1L4AA 1X8YA 2WZ7A 5BVZA 1FZFA 1CW5A 2LKMA 4N3YB 2FYZA 1N2DC 1JNMA 1NOHA 2P7JA 2Z4EA 5CJ4A 1IJDB 5KTBA 1URQD 5AVYB 2GUSA 3MD0A 4IFFA 5CCHD 3P32A 4DOJA 4WY4B 1OXZA 3OJAB 3U1CA 1CSBA 1LTSC 1GU4A 1GW3A 1M1JB 1SFCD 2KYVA 2YKOA 5CCGD 1MV8A 1FDMA 3MUDA 1RY3A 2I1KA 4AYCA 1LWUC 3VMYA 3CI9A 1KZUB 2IPPA 2P67A 3MIWA 2QM7A 3A7OA 2IFMA 2VRSA 3II6A 1SQBK 2C0WA 4I6MC 1T3JA 1T8ZA 1G1JA 1WT6A 1FJKA 1N73A 1RE3C 2OYIA 3NTNA 5AVTB 1JY3O 4W7ZA 1HBWA 4GIFA 4IFDK 3B5NA 1NKNA 1YTZT 3SWFA 3OAKA 1RF1C 4N78E 1FJPA 4WY4C 1G2CA 5AVSB 3GHGA 1HGZA 5AW9B 1ZR4A 2A45G 2KOGA 1N73B 2PAJA 3CL3D 3VTPC 2N1TA 3KQGA 1URQB 5KJ7C 1LTGC 1GL2D 2OYHB 1MFZA 2C9NY 2WPQA 2Z5HA 1NTMK 3P8MC 2HLOA 1J2JB 2J59M 3UIAA 5KLVK 3VOPA 1JY3N 1E5WA 2HPCA 5AVRB 1FU1A 1J1DB 1ZN5A 2HYNA 3TYYA 1NTZK 4I2LC 2XU6A 4Y99B 2L5GB 2N1TC 3P8CD 2ZXEB 5APXA 1W2EA 3P8CE 2BASA 2NPSB 2FKWB 2YO2A 1T3UA 3A3YB 2XDJA 1SP4A 1S9KE 2R5DA 3HUSC 3SWYA 1LTTC 1LT9C 4HH2A 2HODA 1GK4A 1LTAC 4C7NA 3RL0C 2J58A 2R32A 1SFCC 1S9KD 1CZQA 1JY2O 2POHA 2P2UA 1AQ5A 3LIEA 2O1JA 3B5ND 3HE4A 1VPCA 1KILA 4W7YA 2FYUK 1FZCC 2C0XA 2OYHC 3HTKB 1ZR2A 1CI6A 3RK2B 1N7SD 2HODB 5KJ7A 3L36A 1QL1A 5AVWB 1GDTA 3MGNA 4IFMA 3M0AA 3GHGB 4O9BA 1LWUA 1ZLLA 1J1EC 3IFMA 3M9QA 1AFOA 4N78D 5AVVB 1JY2P 2M8RA 1MUUA 3N7NA 2A45H 2O1KA 3VMXA 1KILD 1G1IA 2NPSC 3A2AA 1GL2A 1FOSE 3H32B 3RK3C 2OYIC 2WWWA 3L35A 3HUSB 2N9BA 1GK6A 2KB7P 1LWUB 3CLQA 1T2KD 1NTKK 4WBAA 2KLVA 4KHXA 4GKGA 1M1JA 2O01H 5AVXB 2WSFH 3HD7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FFD A;  1FZG A;  2A45 G;  1RF1 B;  2A45 H;  1N73 B;  2A45 I;  1FZE A;  1FZC A;  1FZC B;  1LT9 B;  1RF1 A;  1N73 A;  1JY2 O;  1RE3 C;  1RF0 C;  2OYI A;  3H32 B;  2OYH B;  1RE4 C;  2OYI C;  2OYH A;  1JY3 P;  3HUS B;  1JY3 O;  2Q9I A;  2FFD B;  1M1J B;  1RF0 A;  2HPC B;  1LWU B;  1JY2 N;  1RE4 A;  1W2E A;  2XNX A;  1FZC C;  2HLO A;  1RE3 A;  2OYH C;  2H43 A;  1RF1 C;  3E1I A;  1N73 C;  3H32 A;  2HOD B;  1T3U A;  1FZF A;  1FZA A;  1LTJ C;  1M1J A;  3GHG B;  1LWU C;  3GHG A;  1FZB A;  2OYI B;  1LWU A;  3HUS A;  1LTJ A;  1JY3 N;  3HUS C;  1LT9 A;  2Z4E A;  2FFD C;  1LT9 C;  1M1J C;  3GHG C;  3BVH A;  2HPC A;  1N86 A;  1JY2 P;  2HOD A;  1LTJ B; 
#chains in the Genus database with same CATH topology
 2E74 C;  2QRX A;  3GLM A;  3O8Z A;  3S4R A;  4LGD E;  4D6T D;  2A06 E;  3T97 A;  3ABV C;  5GTI E;  5CJ0 A;  1PP9 G;  1KFN A;  1URQ C;  1UII A;  4DZO A;  5AW1 B;  2O3J A;  1HBW A;  4L76 A;  2H7H A;  2YMK A;  1AA0 A;  2SPZ A;  3AE2 C;  4GOD A;  5CCH C;  3CC4 P;  1VQK P;  1GZL A;  3KZI H;  4YTP C;  1AQT A;  2YO3 A;  1W5C E;  2OTJ P;  1E79 H;  1L0N K;  3LID A;  3W68 A;  1GW4 A;  1HUC A;  3A0B E;  3AE3 C;  5AVQ B;  1OVR A;  1SS1 A;  4KT0 J;  3TGU J;  2FY8 A;  4DJG A;  2WPR A;  3AE9 C;  1EXJ A;  1HTL C;  1NTK D;  5APU A;  2A06 G;  1NHL A;  1GMJ A;  3CD6 P;  5C39 A;  1KQL A;  1SQQ D;  1PPJ E;  3M9B A;  5AW6 B;  3RK3 B;  1ZV8 A;  1N7S A;  4DCK A;  4JYC A;  4TT3 H;  2RN0 A;  2OYI B;  2WTY A;  3NFQ A;  1KYO I;  1OFC X;  4JPZ B;  4ASW A;  3HRN A;  1SQP E;  3GHG C;  2KSE A;  1SQV E;  1SQV K;  4IL6 E;  1G2C B;  1IFN A;  4WY4 A;  2B87 A;  5B5E E;  3L70 G;  2E43 A;  1IK7 A;  1LT9 B;  2N1T D;  1OZH A;  4EIJ A;  1KC8 Q;  1RF1 A;  3L72 J;  1BGY D;  3OA7 A;  1Y9B A;  3IF4 A;  2YKP A;  3B71 A;  3HD7 B;  4OGQ D;  5APT A;  1K8A Q;  1RH5 B;  3AE8 C;  1KIL B;  1M56 D;  1PV3 A;  2E75 C;  2K1A A;  3RK3 E;  4Y99 C;  1PIX A;  1U7M A;  1RE4 A;  1VQP P;  2W6A A;  2KI7 B;  1EZV E;  3O6Q B;  3H1H J;  3HTK A;  3H1L E;  3G9R A;  2FYU J;  4OWF A;  4ZMD A;  2JWD A;  3V4Q A;  2XV5 A;  3L70 D;  1Q90 D;  2KLU A;  3BCC D;  3H1K G;  3TGU D;  1VQ5 P;  1H88 A;  3JCU H;  3CX5 E;  1DD4 A;  1LTJ C;  4B86 A;  1EC5 A;  1MZ9 A;  2NZ2 A;  1Z56 A;  4QMA A;  5APS A;  3I5C A;  3L73 E;  4WY4 D;  2P58 A;  1LT9 A;  2B89 A;  2FFD C;  1GTW A;  1PZQ A;  1KB9 D;  4TLF A;  3VMA A;  2IFN A;  3RL0 D;  1YHQ P;  1NU1 G;  3BVH A;  2QM8 A;  1KQG B;  2B87 B;  5BU5 A;  1X9V A;  1LP1 B;  1SVF A;  2FYN B;  1RF1 B;  1USE A;  2A45 I;  1EQ7 A;  1BGY G;  1HJ0 A;  1SFC B;  1NTZ J;  3B5N C;  4WVZ A;  4BRY B;  3CCR P;  1FOS F;  1KFM A;  2XND H;  1K73 Q;  3B8E B;  2QJP B;  1RE4 C;  2QJY B;  1Y47 A;  1NTM G;  3O6Q A;  3A0H H;  4OVN F;  5APW A;  5AW4 B;  1X79 B;  5DJT B;  3G6E P;  2ZJS E;  1Q81 Q;  2RH0 A;  1GL2 C;  1NH4 A;  2FFD B;  2AXT E;  2H8P D;  2WSE H;  3PP5 A;  3TNU B;  4C7N B;  1KYO D;  2W27 A;  1A02 J;  5KLV G;  1ZRT D;  5GTH H;  3PTZ A;  3RK2 C;  1HH0 A;  1S4X A;  2CK3 H;  1YYC A;  4CPG A;  1PGO A;  1J1D C;  5CHX A;  5AW8 B;  2RKL A;  2WIT A;  1VQ4 P;  1AVY A;  1L0N J;  1NWQ A;  2FFD A;  1JOC A;  2ZT9 D;  2Q6Q A;  3L74 D;  4MN4 C;  4D6T E;  1BCC G;  2AEF A;  2E5T A;  2H89 C;  3BRT B;  4PD4 D;  2KZJ A;  3AEG C;  1XTG B;  1CI6 B;  1RHZ B;  2CPS A;  2R5B A;  3T97 B;  1JCC A;  3C1L A;  4AUW A;  1L0N G;  1YTZ I;  3EFG A;  1FZC B;  1YJ9 P;  3SFE C;  1NTZ E;  1N7L A;  1PP9 D;  2E74 B;  1JY3 P;  2WT7 B;  4BWN A;  2WPV B;  2Q9I A;  1YBK A;  2HR3 A;  4UB6 E;  2QG4 A;  1WRG A;  3FX0 A;  3AEF C;  5CCH A;  1YIT P;  1JTH A;  1L2P A;  2YNY A;  3E1I A;  2AXC A;  3L73 J;  1SLQ A;  2OQQ A;  3HD7 D;  4JQ0 D;  5KKZ C;  3FXD A;  2K9J B;  2WSC H;  2E76 B;  3WMM 0;  1IK9 A;  4R4M A;  5E79 H;  1M8O B;  2E42 A;  2GUV A;  3HUS A;  1FDO A;  3E1R A;  5BU8 B;  3VYI A;  1L0N D;  1R8E A;  4K3A A;  1M90 Q;  3H1H E;  3U59 A;  3V6I A;  1H89 A;  1VDF A;  5AW5 B;  3VP9 A;  1FE6 A;  2JJL A;  1SQX K;  1LTJ B;  3HE5 B;  4N6J A;  1NU1 J;  3CXH E;  3Q2Y A;  5TJH A;  2JR8 A;  1EZV I;  3SFD C;  1NU1 K;  1L4A B;  2MKV A;  1EDL A;  2OTL P;  3M0D C;  1DH3 A;  1QVG O;  1IO4 A;  1KMI Z;  5M1B A;  1GU5 A;  1JM0 A;  3A0B H;  3TSI A;  3H1K J;  5E79 E;  3VMZ A;  2D2C B;  4HKZ H;  3TDK A;  3A5T A;  1L4A D;  2R44 A;  4WB4 A;  2JDI H;  4U3F D;  1OW6 A;  1NO4 A;  1Y8A A;  1RE3 A;  2JKV A;  3M0D A;  3N4X A;  3NXS A;  3CMA P;  1IC2 A;  1HVV A;  1OWA A;  1QEX A;  3AE5 C;  2NPS A;  3H32 A;  3KYQ A;  3L73 D;  3V2P A;  1GL2 B;  2KNC A;  2KSJ A;  3L37 A;  4OH8 B;  4D6T J;  1LTJ A;  3HE5 A;  3RBX A;  1N7S C;  3TGU E;  1LT1 A;  5EFW B;  1R5L A;  3H1L D;  3BAS A;  1QGK B;  4L74 A;  3V4W A;  4HYT B;  2LXB A;  1NU1 D;  4I1L A;  3FGA D;  3MUD C;  4EI2 A;  1KTM A;  3CCQ P;  2O01 N;  3MZW B;  2Y9Y A;  5AW7 B;  3GF3 A;  2P1J A;  4H13 C;  1NKZ B;  2Q3I A;  1AFO A;  1BGY J;  1KIL C;  2NPS D;  4UB8 H;  1BDD A;  2WPS A;  2YIU C;  1NU1 E;  4XA4 A;  3NMD A;  3ZDM A;  4HB1 A;  1KV4 A;  1SQQ J;  1JMM A;  1NTM D;  3CC2 P;  1L0L D;  3V2Q A;  1N8R Q;  1N73 C;  2AEM A;  1KQS O;  1SQV G;  3H1H D;  1HF9 A;  3CX5 H;  3H1I G;  1DX7 A;  2I1J A;  1PFI A;  2BEZ F;  1LNQ A;  2W8Z A;  3BCC J;  1OVU A;  1M7L A;  5APV A;  4EOT A;  3H6P A;  4R4L A;  2JWA A;  3IN6 A;  2Q7C A;  1QX8 A;  2ZYG A;  1EDK A;  1NTK E;  3AED C;  3HD7 A;  2D2C C;  4C46 A;  5AW0 B;  1T2K C;  2OTK E;  2J5U A;  1L0L G;  3GW6 A;  1IFJ A;  1N86 A;  5KJ7 D;  4U7J A;  1IFD A;  1QLE D;  2KP8 A;  3G71 P;  3CCJ P;  1HWT C;  3PRJ A;  1EZV G;  1IFM A;  1LGH B;  3B5N B;  4C7R A;  5AVU B;  2IBZ G;  3KXD A;  1FZC A;  1LJ2 A;  2OGU A;  2WSF J;  1VQO P;  2P10 A;  1NTZ D;  1RQU A;  4JYB A;  3L70 J;  4L73 A;  1JEK A;  2XZR A;  2C9L Y;  1SQX J;  1N7S B;  3IR9 A;  2PP6 A;  1NAF A;  3L4F A;  3P7K A;  4RKU J;  1NTK G;  1X22 A;  2K37 A;  1YQ4 C;  2HG5 D;  4K35 A;  3V2R A;  1L0L K;  1L0L E;  5APY A;  1NTM E;  1U7J A;  1ZP0 C;  2IYP A;  3U1A A;  1KB9 H;  1MKM A;  2KUB A;  3M06 A;  3VP8 A;  1JO5 A;  1L0N E;  1FC2 C;  2KK7 A;  1BGY E;  2FXM A;  2I8D A;  4I7Z B;  5CCG C;  2V7Q H;  1JMB A;  2IX7 C;  1OW8 A;  2LXC B;  5KLV E;  4PJ0 E;  4JF7 A;  3BAT A;  1NYH A;  3L71 G;  2R3C A;  1P84 I;  1YQ3 C;  3Q5S A;  1SQP K;  5KKZ B;  2YKQ A;  3EWK A;  3VN0 A;  1VQ6 P;  2WSS H;  3L75 D;  1K9M Q;  2KZI A;  1KN7 A;  2IDB A;  3CCV P;  4IL6 X;  2QJK B;  3QH9 A;  2MJZ A;  3M9H A;  2PGD A;  3AEA C;  2Q5U A;  3F5H A;  2W6B A;  3KDP B;  1BDC A;  3Q1M A;  4GT1 A;  1H0T A;  1PP9 J;  2OAR A;  4RES B;  1SQX D;  3L71 E;  1JCD A;  1HGV A;  1SFC A;  2JEE A;  4PD4 E;  4PV1 B;  4U3F E;  1YJW P;  3L74 J;  3L71 D;  2CPB A;  4OGQ C;  1KB9 E;  1LP1 A;  2YXR B;  3SSU A;  3WUV A;  2H43 A;  2GM4 A;  1QL2 A;  1HJB A;  2W6J H;  2N1T B;  2WSE J;  1TU3 F;  1FZA A;  1URQ A;  5AVZ B;  2OYO A;  1VQN P;  4IFD K;  1SQQ K;  4LLH A;  2WT7 A;  4GOF A;  1ZRT E;  5L8R J;  3TNU A;  1LTB C;  1GD2 E;  2WQY C;  3V5B A;  1H0T B;  1DIP A;  1MFT A;  1IFI A;  1OVV A;  3C9I A;  2ZFC A;  1OW7 A;  4ZKP A;  4DT0 A;  2K9J A;  4AQR D;  3TF5 A;  1EXI A;  5KLV D;  1L4A C;  1DEB A;  2N9Y B;  3C8V A;  3GG2 A;  5GTH E;  2PFX A;  3BCC G;  5AW3 B;  1GDT A;  3LW5 H;  1J1E B;  3AE1 C;  1VF5 C;  2WMM A;  2YMY A;  1SQV J;  3S9O A;  5B66 E;  1KYO E;  1RF0 A;  1SQP G;  5APQ A;  2V4H A;  4H0L C;  1FBM A;  1OIP A;  1JY2 N;  2XNX A;  3R4Y A;  4W80 A;  2ITA A;  2O01 J;  1KD1 Q;  1SQQ G;  1JUN A;  3ITK A;  2ZT9 B;  4U3F J;  1X0T A;  1ZOY C;  3CX5 I;  4H13 B;  2QJK C;  3L71 J;  3KPE A;  3S1K A;  1SQB G;  4ASV A;  5H2F H;  5KAI H;  4A7P A;  1PP9 E;  1AVO A;  2IYO A;  2PRR A;  4M3L A;  2G8Y A;  3K5B A;  1FZB A;  3BRV B;  3BCC E;  3R2P A;  3HE4 B;  5KLI C;  3RK2 D;  4YPC A;  1M1J C;  5CBO A;  1EDJ A;  3PH0 A;  3V2N A;  3G3Z A;  2XKM A;  4I7Z C;  2QVA A;  5AW2 B;  3M91 A;  2IZ0 A;  2Z5I A;  2GA1 A;  3GMA A;  1FZG A;  4OGQ B;  2HFE D;  3TK1 A;  1JTH B;  3RK3 D;  4ZKU A;  5CCG A;  1FZE A;  5KAF E;  1EDI A;  4XFJ A;  3MTU E;  4D6T G;  4UB8 E;  3D6Y A;  3GF7 A;  1RF0 C;  4H44 D;  1H8A A;  1OX3 A;  2QE7 H;  1XTC C;  5CMZ A;  2OYH A;  1FAV A;  3EQ2 A;  3H1L G;  3WUT A;  2M3B A;  3L70 E;  5TIS H;  2E76 D;  4LC1 A;  4XE5 B;  1LTI C;  1S3J A;  3CXH D;  3RL0 B;  3WU2 E;  1L4A A;  1L0L J;  3L72 D;  2BCC E;  1X8Y A;  2WZ7 A;  5BVZ A;  1FZF A;  2JP3 A;  1PPJ D;  2LKM A;  4H44 B;  4PV1 C;  1OMI A;  2H88 C;  4N3Y B;  3H25 A;  2FYZ A;  1N2D C;  2E74 D;  3F89 A;  2W90 A;  1JNM A;  1NOH A;  1IZN B;  2P7J A;  3H1I J;  2Z4E A;  5CJ4 A;  1IJD B;  5KTB A;  3WU2 H;  1URQ D;  3KHU A;  2QEX P;  5AVY B;  1BE3 G;  2GUS A;  2NRG A;  3MD0 A;  4EDF A;  4IFF A;  4ZNC A;  5CCH D;  3P32 A;  1KB9 I;  4NPF X;  4HJG H;  5DJU B;  4WY4 B;  4DOJ A;  1OXZ A;  3OJA B;  2BCC G;  3U1C A;  2E5Y A;  3D71 A;  1ZXG A;  1K05 A;  2YXQ B;  1CSB A;  1LTS C;  1GU4 A;  1VQL P;  1GW3 A;  3CCS P;  3CCE P;  2IBZ D;  1BCC E;  3L73 G;  1M1J B;  1SFC D;  2KYV A;  2W83 C;  2YKO A;  1IFP A;  2M0B A;  1EZV D;  2QSI A;  5CCG D;  1MV8 A;  2FXO A;  3L74 E;  1YI2 P;  1FDM A;  3MUD A;  1RY3 A;  2FXP A;  2I1K A;  4AYC A;  1LWU C;  1NAY A;  3VMY A;  1FDI A;  1KZU B;  2IPP A;  2ZAE B;  2P67 A;  2KS1 B;  1K04 A;  2QM7 A;  3CI9 A;  2A06 D;  3CWB E;  3A7O A;  2IFM A;  2E75 B;  3MIW A;  3H1I D;  3CCL P;  2VRS A;  3II6 A;  1SQB K;  2DW3 A;  1BCC J;  2C0W A;  4I6M C;  2Y0D A;  3LW5 J;  4IL6 H;  1T3J A;  1P84 D;  1T8Z A;  3H1J E;  1S5L H;  2B9B A;  1ZME C;  3FWL A;  1G1J A;  1WT6 A;  4BRY A;  1FJK A;  2E75 D;  4EYY Q;  1N73 A;  1RE3 C;  1Q86 Q;  2OYI A;  1DEE G;  3NTN A;  3SWK A;  5AVT B;  1YIJ P;  1JY3 O;  4W7Z A;  3CWB G;  1P84 E;  3AEB C;  2M5A A;  3H1J D;  2KIK A;  4GIF A;  3B5N A;  1NKN A;  2Y0E A;  4Z1M H;  4L75 A;  1YTZ T;  3SWF A;  3JC2 2;  3MP7 B;  4RJT A;  3OAK A;  1RF1 C;  3CME P;  4KJM A;  4N78 E;  1S1C X;  1DD3 A;  1FJP A;  2AXT H;  4WY4 C;  1W2B O;  3G4S P;  1G2C A;  5KAF H;  3CX5 D;  4H0L B;  5AVS B;  3GHG A;  3RL0 g;  1NTZ G;  1HGZ A;  5AW9 B;  2FBW C;  1ZR4 A;  1NGM B;  1JB0 J;  4RO0 A;  3RGU A;  1BSH A;  1BE3 J;  3H1K D;  2A45 G;  1SQB E;  2KOG A;  1BCC D;  2D2C D;  2PAJ A;  3CL3 D;  3CWB J;  3VTP C;  1N73 B;  2N1T A;  4Y28 J;  3CC7 P;  3KQG A;  1URQ B;  5B66 H;  5KJ7 C;  3D6Z A;  4H0L D;  1R5S A;  5H2F E;  1LTG C;  1GL2 D;  1M57 D;  2OYH B;  1MFZ A;  2C9N Y;  2WPQ A;  2ZVO B;  4GOE A;  2WVR A;  2R3S A;  1SQV D;  3H1H G;  2Z5H A;  2QA4 P;  1NTM K;  3P8M C;  2HLO A;  1J2J B;  1D7M A;  2QJP C;  2QJY C;  3CPW O;  3Q5R A;  1PPJ G;  3B4S A;  2G3A A;  3H1L J;  4PD4 I;  2J59 M;  1S2E A;  3EFF K;  1KOR A;  1SQQ E;  3L72 G;  1AV1 A;  3UIA A;  5KLV K;  3VOP A;  2Y0C A;  3E7K A;  1RQV A;  1YJN P;  5KLI B;  1JY3 N;  1AJY A;  5KLV J;  1Q2N A;  2KXP B;  3L72 E;  1PGJ A;  1E5W A;  2HPC A;  5AVR B;  5B5E H;  1FU1 A;  1J1D B;  4H44 C;  3H1I E;  1S5L E;  1BE3 D;  2Q1K A;  4PD4 H;  1ZN5 A;  1Q7Y Q;  1NTM J;  2Q3E A;  3CWB D;  2B88 A;  2RMZ A;  2HYN A;  1WMK A;  5GTI H;  3I55 P;  3TYY A;  3W67 A;  1NTZ K;  2BCC J;  3IAO A;  3AE4 C;  1SQB J;  1U57 A;  4I2L C;  4NPD A;  2XU6 A;  3AE7 C;  1BE3 E;  4Y99 B;  3PJS K;  3TGU G;  3WUU A;  2L5G B;  2N1T C;  3H1K E;  2ZXE B;  3P8C D;  4UB6 H;  5APX A;  1W2E A;  2HPC B;  2FYU D;  1FS0 E;  3RBZ A;  3P8C E;  2IBZ E;  2BAS A;  2NPS B;  3CXH I;  2BEQ D;  1T6A A;  1T3U A;  2FKW B;  2YO2 A;  3A3Y B;  2XDJ A;  3QWO C;  3I56 P;  1SP4 A;  1NJI Q;  4PJ0 H;  1S9K E;  2R5D A;  3KZI E;  3PLN A;  2M3E A;  3HUS C;  3SWY A;  1LTT C;  1LT9 C;  1PGQ A;  1ZW0 A;  2FYU G;  3Q3D A;  1VQ8 P;  4HH2 A;  3USS A;  2HOD A;  1SQP D;  3FXE A;  5K5G B;  1GK4 A;  1LTA C;  4C7N A;  3CXH H;  3CCM P;  2K9Y A;  2ZYA A;  3RL0 C;  2J58 A;  2R32 A;  2K88 A;  1SFC C;  2IBZ I;  2QIW A;  1S9K D;  1CZQ A;  1JY2 O;  2POH A;  3A0H E;  2P2U A;  4GDO A;  1AQ5 A;  3LIE A;  2O1J A;  1KIL E;  3B5N D;  2BCC D;  1SQB D;  3HE4 A;  1VPC A;  1KIL A;  3L74 G;  4W7Y A;  2FYU K;  2FYU E;  1FZC C;  2WSC J;  3H1J G;  1NVO A;  2C0X A;  3HTK B;  2OYH C;  2JO1 A;  1CI6 A;  3RK2 B;  1VF5 D;  1KQF B;  1ZR2 A;  1CW5 A;  2ZXX A;  1N7S D;  2HOD B;  4YXW H;  5KJ7 A;  3L36 A;  1QL1 A;  5AVW B;  5KAI E;  3MGN A;  4IFM A;  3L75 J;  5CBN A;  1S72 P;  3M0A A;  3GHG B;  4O9B A;  1UIX A;  2FYN C;  5TIS E;  3Q5P A;  1QVF O;  1LWU A;  1ZLL A;  1J1E C;  2YIU B;  1VF5 B;  2AEJ A;  2K3R A;  3IFM A;  3M9Q A;  3MHV A;  4N78 D;  4U3F G;  3OW2 O;  3JSV C;  5AVV B;  2Y9Z A;  1JY2 P;  1VQ7 P;  2M8R A;  1MUU A;  2UWJ E;  1S5L X;  3N7N A;  4H13 D;  4WWI A;  1SQP J;  1SQX E;  2A45 H;  2ZT9 C;  2O1K A;  3VMX A;  1BSN A;  1KIL D;  1G1I A;  1PGP A;  2NPS C;  3A2A A;  3FWN A;  3JCU E;  1P84 H;  1GL2 A;  2KNC B;  2L91 A;  1FOS E;  3L75 G;  4JBZ A;  4YXD C;  3H32 B;  2ZYD A;  3RK3 C;  2KS1 A;  2OYI C;  2WWW A;  3L35 A;  3HUS B;  3D70 A;  2N9B A;  4IOI H;  1M1K Q;  3AEE C;  1GK6 A;  3L75 E;  3H1J J;  2KB7 P;  1LWU B;  1PL5 A;  2V7Q J;  2LR2 A;  3AEC C;  4BXL A;  2ZVN B;  1VQM P;  1NTK J;  3CCU P;  3CLQ A;  1SQX G;  2E76 C;  1T2K D;  1A02 F;  1NTK K;  4NPE A;  2KLV A;  1KYO H;  2IZ1 A;  4GKG A;  4KHX A;  4WBA A;  1USD A;  1M1J A;  1Q82 Q;  1VQ9 P;  2O01 H;  3PHL A;  5AVX B;  2WSF H;  3HD7 C;  2M5A B;  1VL2 A;  4PV1 D;  3AE6 C; 
#chains in the Genus database with same CATH homology
 3O8Z A;  4LGD E;  3T97 A;  5CJ0 A;  1URQ C;  1KFN A;  4DZO A;  5AW1 B;  2H7H A;  5CCH C;  1GZL A;  2YO3 A;  3LID A;  1L0N K;  1GW4 A;  1HUC A;  5AVQ B;  2WPR A;  1HTL C;  5APU A;  1NHL A;  1KQL A;  5AW6 B;  3M9B A;  3RK3 B;  1ZV8 A;  1N7S A;  2OYI B;  4JYC A;  2WTY A;  3NFQ A;  3HRN A;  3GHG C;  1SQV K;  1G2C B;  1IFN A;  4WY4 A;  2E43 A;  1LT9 B;  2N1T D;  4EIJ A;  1RF1 A;  3OA7 A;  2YKP A;  5APT A;  3HD7 B;  1KIL B;  4Y99 C;  1RE4 A;  2W6A A;  3HTK A;  3V4Q A;  2XV5 A;  1H88 A;  1LTJ C;  4B86 A;  1MZ9 A;  1Z56 A;  3I5C A;  4WY4 D;  2FFD C;  1LT9 A;  1GTW A;  2IFN A;  3RL0 D;  3BVH A;  2QM8 A;  5BU5 A;  1X9V A;  1SVF A;  1RF1 B;  2A45 I;  1EQ7 A;  1SFC B;  3B5N C;  1FOS F;  1KFM A;  3B8E B;  1RE4 C;  5APW A;  5AW4 B;  1X79 B;  1GL2 C;  1NH4 A;  2H8P D;  2WSE H;  3PP5 A;  3TNU B;  4C7N B;  2W27 A;  1A02 J;  3RK2 C;  1HH0 A;  1YYC A;  1J1D C;  5CHX A;  5AW8 B;  2WIT A;  1NWQ A;  1JOC A;  3BRT B;  1XTG B;  1CI6 B;  2CPS A;  2R5B A;  1JCC A;  4AUW A;  1YTZ I;  3EFG A;  1FZC B;  1N7L A;  1JY3 P;  2WT7 B;  2Q9I A;  1WRG A;  5CCH A;  1JTH A;  2YNY A;  3E1I A;  1SLQ A;  3HD7 D;  2WSC H;  3WMM 0;  1IK9 A;  2E42 A;  2GUV A;  3HUS A;  5BU8 B;  3VYI A;  3U59 A;  1H89 A;  1VDF A;  5AW5 B;  3VP9 A;  2JJL A;  1SQX K;  3HE5 B;  1LTJ B;  4N6J A;  1NU1 K;  1L4A B;  3M0D C;  1DH3 A;  1IO4 A;  1GU5 A;  3TSI A;  3VMZ A;  3A5T A;  1L4A D;  4WB4 A;  3M0D A;  1NO4 A;  1RE3 A;  3N4X A;  3NXS A;  1IC2 A;  1HVV A;  1OWA A;  3H32 A;  2NPS A;  3KYQ A;  3V2P A;  1GL2 B;  2KSJ A;  3L37 A;  4OH8 B;  1LTJ A;  3HE5 A;  1N7S C;  3BAS A;  3V4W A;  4HYT B;  4I1L A;  5AW7 B;  2P1J A;  1NKZ B;  2Q3I A;  4XA4 A;  1KIL C;  2NPS D;  5APS A;  2WPS A;  3NMD A;  1JMM A;  3V2Q A;  1N73 C;  1DX7 A;  2I1J A;  1PFI A;  1M7L A;  5APV A;  4EOT A;  3H6P A;  2Q7C A;  3HD7 A;  4C46 A;  5AW0 B;  1T2K C;  1IFJ A;  1N86 A;  5KJ7 D;  1IFD A;  1HWT C;  2KP8 A;  1IFM A;  1LGH B;  3B5N B;  4C7R A;  5AVU B;  1FZC A;  4JYB A;  2XZR A;  2C9L Y;  3IR9 A;  1N7S B;  3L4F A;  2PP6 A;  1NAF A;  3P7K A;  3V2R A;  2HG5 D;  1L0L K;  5APY A;  3U1A A;  3M06 A;  1JO5 A;  3VP8 A;  2FXM A;  5CCG C;  2IX7 C;  4JF7 A;  3BAT A;  2R3C A;  1SQP K;  2YKQ A;  3VN0 A;  2MJZ A;  3M9H A;  2Q5U A;  3KDP B;  2W6B A;  4GT1 A;  2OAR A;  4RES B;  1JCD A;  1HGV A;  1SFC A;  2JEE A;  2CPB A;  2H43 A;  2GM4 A;  1QL2 A;  1HJB A;  2N1T B;  1FZA A;  1URQ A;  5AVZ B;  1SQQ K;  4LLH A;  2WT7 A;  3TNU A;  1LTB C;  1GD2 E;  3V5B A;  1IFI A;  3C9I A;  2ZFC A;  4ZKP A;  4AQR D;  1L4A C;  1DEB A;  5AW3 B;  3LW5 H;  1J1E B;  2FFD B;  2YMY A;  1RF0 A;  5APQ A;  2HPC B;  1FBM A;  4W80 A;  1JY2 N;  2XNX A;  1JUN A;  3KPE A;  4M3L A;  1FZB A;  3BRV B;  3RK2 D;  3R2P A;  3HE4 B;  1M1J C;  3V2N A;  3G3Z A;  2XKM A;  1A02 F;  5AW2 B;  3M91 A;  2Z5I A;  2FFD A;  1FZG A;  5CCG A;  2HFE D;  3TK1 A;  1JTH B;  3RK3 D;  4ZKU A;  1FZE A;  3MTU E;  1H8A A;  1RF0 C;  5CMZ A;  1XTC C;  2OYH A;  1FAV A;  3EQ2 A;  2M3B A;  4XE5 B;  4LC1 A;  1LTI C;  3RL0 B;  1L4A A;  1X8Y A;  2WZ7 A;  5BVZ A;  1FZF A;  1CW5 A;  2LKM A;  4N3Y B;  2FYZ A;  1N2D C;  1JNM A;  1NOH A;  2P7J A;  2Z4E A;  5CJ4 A;  1IJD B;  5KTB A;  1URQ D;  5AVY B;  2GUS A;  3MD0 A;  4IFF A;  5CCH D;  3P32 A;  4DOJ A;  4WY4 B;  1OXZ A;  3OJA B;  3U1C A;  1CSB A;  1LTS C;  1GU4 A;  1GW3 A;  1M1J B;  1SFC D;  2KYV A;  2YKO A;  5CCG D;  1MV8 A;  1FDM A;  3MUD A;  1RY3 A;  2I1K A;  4AYC A;  1LWU C;  3VMY A;  3CI9 A;  1KZU B;  2IPP A;  2P67 A;  3MIW A;  2QM7 A;  3A7O A;  2IFM A;  2VRS A;  3II6 A;  1SQB K;  2C0W A;  4I6M C;  1T3J A;  1T8Z A;  1G1J A;  1WT6 A;  1FJK A;  1N73 A;  1RE3 C;  2OYI A;  3NTN A;  5AVT B;  1JY3 O;  4W7Z A;  1HBW A;  4GIF A;  4IFD K;  3B5N A;  1NKN A;  1YTZ T;  3SWF A;  3OAK A;  1RF1 C;  4N78 E;  1FJP A;  4WY4 C;  1G2C A;  5AVS B;  3GHG A;  1HGZ A;  5AW9 B;  1ZR4 A;  2A45 G;  2KOG A;  1N73 B;  2PAJ A;  3CL3 D;  3VTP C;  2N1T A;  3KQG A;  1URQ B;  5KJ7 C;  1LTG C;  1GL2 D;  2OYH B;  1MFZ A;  2C9N Y;  2WPQ A;  2Z5H A;  1NTM K;  3P8M C;  2HLO A;  1J2J B;  2J59 M;  3UIA A;  5KLV K;  3VOP A;  1JY3 N;  1E5W A;  2HPC A;  5AVR B;  1FU1 A;  1J1D B;  1ZN5 A;  2HYN A;  3TYY A;  1NTZ K;  4I2L C;  2XU6 A;  4Y99 B;  2L5G B;  2N1T C;  3P8C D;  2ZXE B;  5APX A;  1W2E A;  3P8C E;  2BAS A;  2NPS B;  2FKW B;  2YO2 A;  1T3U A;  3A3Y B;  2XDJ A;  1SP4 A;  1S9K E;  2R5D A;  3HUS C;  3SWY A;  1LTT C;  1LT9 C;  4HH2 A;  2HOD A;  1GK4 A;  1LTA C;  4C7N A;  3RL0 C;  2J58 A;  2R32 A;  1SFC C;  1S9K D;  1CZQ A;  1JY2 O;  2POH A;  2P2U A;  1AQ5 A;  3LIE A;  2O1J A;  3B5N D;  3HE4 A;  1VPC A;  1KIL A;  4W7Y A;  2FYU K;  1FZC C;  2C0X A;  2OYH C;  3HTK B;  1ZR2 A;  1CI6 A;  3RK2 B;  1N7S D;  2HOD B;  5KJ7 A;  3L36 A;  1QL1 A;  5AVW B;  1GDT A;  3MGN A;  4IFM A;  3M0A A;  3GHG B;  4O9B A;  1LWU A;  1ZLL A;  1J1E C;  3IFM A;  3M9Q A;  1AFO A;  4N78 D;  5AVV B;  1JY2 P;  2M8R A;  1MUU A;  3N7N A;  2A45 H;  2O1K A;  3VMX A;  1KIL D;  1G1I A;  2NPS C;  3A2A A;  1GL2 A;  1FOS E;  3H32 B;  3RK3 C;  2OYI C;  2WWW A;  3L35 A;  3HUS B;  2N9B A;  1GK6 A;  2KB7 P;  1LWU B;  3CLQ A;  1T2K D;  1NTK K;  4WBA A;  2KLV A;  4KHX A;  4GKG A;  1M1J A;  2O01 H;  5AVX B;  2WSF H;  3HD7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...