3GHHA

Structural insights into the catalytic mechanism of cd38: evidence for a conformationally flexible covalent enzyme-substrate complex.
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
238
structure length
238
Chain Sequence
NRWHGAGSTADFQKIIQERCDTYTQTIRPGSRSRNCQAIRQAFMSAFISKDPCKATKEDYNSLINLAPPTVPCGQQVFWSKTKELAHEYAKRRRLMTLEDTLLGYLADGLRWCGEPGSSDLNIWSCPDWRKDCRTNYLSVFWEVLSERFAESACNTVRVVLNGSLENAFDSMSIFGRVQAPNLRPQVELEAWLVHDTGKPPSDSCSGSSIRKLKSILDGRNVKFRCMDNLSRDQFLQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ecto-NAD+ glycohydrolase (CD38 molecule)
publication title Insights into the mechanism of bovine CD38/NAD+glycohydrolase from the X-ray structures of its Michaelis complex and covalently-trapped intermediates.
pubmed doi rcsb
source organism Bos taurus
total genus 81
structure length 238
sequence length 238
chains with identical sequence B
ec nomenclature ec 3.2.2.5: NAD(+) glycohydrolase.
pdb deposition date 2009-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02267 Rib_hydrolayse ADP-ribosyl cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.82.10 Mainly Alpha Up-down Bundle ADP Ribosyl Cyclase; Chain A, domain 1 ADP Ribosyl Cyclase; Chain A, domain 1 3ghhA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ghhA02
1E7WA 3N74A 3VOSA 3JTMA 3DQPA 4TVBA 1KY5A 3FWZA 1JTVA 1P1KA 3OEWA 3PK0A 1AGNA 3TOXA 4MIEA 2NVBA 4GVXA 2VOJA 1WPQA 4CMBA 3NTQA 2ZYAA 1DC6A 1DOHA 4IPTA 1EMDA 2E49A 3LT4A 1ISMA 2GN8A 2PZMA 4BKQA 4UVHA 2QG4A 1PWZA 2ZK7A 4OQYA 3FTPA 3TL3A 3Q6IA 3CKYA 2O48X 3EZLA 2GPTA 1F17A 4E2YA 4YPOA 2GUGA 3ZNOA 1Y7TA 3EVTA 1UUFA 2XPCA 5AVOA 3X2EA 4XWYA 1V9LA 4KOAA 1QLHA 1H6AA 1XYGA 3GHYA 4P4GA 5JDCA 4DLBA 3E03A 2CY0A 2QX7A 1BHSA 4R69A 1Y81A 5IDXA 2Z1NA 3VH1A 5K0ZA 1HDOA 2H6EA 4GBJA 4GX1A 5T5QA 4K6FA 1XLTA 1LRLA 4B3IA 4CMGA 4INAA 1UZMA 2BFAA 4WLEA 4J4BA 1BDBA 1I01A 4FN4A 3GC6A 3GVIA 4W9NA 3U62A 3VDQA 3JQ9C 4WCDA 3TPCA 3AI1A 3RC7A 4MVJM 1WP4A 4BNWA 3C3XA 2UYYA 4J0EA 4CMIA 4RVUA 4UULA 3KB6A 4D3DA 1ZMTA 5JAMA 2OMEA 3WMWA 3MJEA 4P22A 4JQCA 2NVWA 2G1UA 4WLVA 3FR7A 3GPIA 1ZSYA 3V2UA 4J0FA 1MUUA 4ZD6A 3VH3A 3Q9UA 3L6EA 3GHHA 3OJFA 4YJFA 5A4DA 1XELA 2F00A 4D3SA 2O7QA 2DUWA 4Z9YA 5JDIC 5BNTA 3RU9A 4BNVA 5L7WA 4RF5A 4Y98A 3GGGA 1EUDA 3ZV4A 1IB6A 2IE0A 2PH3A 3GZNA 4ALNA 4BMSA 1C0KA 2OFPA 2FSVA 4KTTE 5JYDA 4JK3A 3HJAA 3AY3A 5B4TA 3RQSA 1E92A 4QT0A 3AY6A 3H9QA 2PLAA 3O03A 5T6BA 4DTIA 1LEHA 1P77A 4R54A 1B2LA 3WG9A 2FP4A 4YT5A 5KVVA 4R16A 4BQPA 2OL4A 1ZCJA 1LSSA 3E48A 3SXPA 3HADA 4R51A 5ITVA 1UP4A 2D5CA 1OFGA 3Q9NA 4E5YA 3ZNQA 5B4VA 3DHNA 3DDNA 2Y0DA 3ZDFA 1I8TA 1IYZA 1SEPA 2Y1FA 2NVUB 2WSBA 3DWFA 3NEPX 1J0XO 4E12A 4BNUA 3WR5A 1ZW1A 4IS2A 4W7IA 3FD8A 4L75A 3K30A 2NUAA 2D5AA 4N5LA 4PCVA 1ENYA 1GZ6A 5KTKA 2X5JO 1GV1A 3QP9A 1R6DA 3QA9A 2YDXA 4J7CA 1UDBA 3KSZO 1C3VA 1ISIA 5T67A 1E5LA 1PJSA 2GASA 4AJPA 1H2HA 3NDJA 3PTZA 1H9AA 2BGMA 4G65A 3EZYA 4TRNA 3HFGA 2Q2VA 3Q2KA 5LC1A 4XD2A 1BXGB 4BL5A 3KYDA 2O3JA 4YACA 2B4TO 2P9CA 5IFLA 4PIVA 1R16A 4Q3DA 3SVTA 2WEKA 5AXCA 4Z3KA 3WFJA 1V3TA 3WQSB 2EWMA 1LC0A 4FJ1A 2F1KA 4PFJA 2DM6A 4HFRA 4I5GA 4JP2A 4OM8A 5C7IO 3WWYA 3QWAA 4FGSA 5HS6A 4A26A 2QHXA 4DIBA 3GN2A 1IUKA 1LLCA 2GF2A 1T26A 3UCXA 3I83A 3NAQA 4XB2A 2DTDA 5AQ1A 2C20A 4CLOA 1WWKA 5L95A 8LDHA 1E7QA 1E1LA 4J9UE 5FYDA 2AHRA 2HCTA 5IG2A 1O6ZA 2OGUA 3WTCA 4J7XA 3D4NA 1P31A 5T57A 5TT1A 3OHSX 4ITUA 2VHXA 3U9LA 4XGNA 1U9JA 3PDUA 1DLJA 3TZCA 2NACA 3GT0A 3F47A 2FZWA 3QV1A 1LQUA 4AJIA 1HEUA 2EKLA 1NQTA 3ZU4A 4OO3A 3PGXA 4FFPA 5CG1A 1T4BA 4A10A 2GYYA 3GGOA 3S2IA 3AUTA 5A9SA 3O4RA 5AXAA 1QYWA 1E3EA 4CUZA 2ZQZA 1U3VA 3B1FA 3RFTA 4ZQGA 4B4WA 1MXFA 3C1TA 3EK2A 1SBYA 3IOYA 1HSZA 3L4SO 4NFHA 2PR2A 3FNEA 2CZCA 1ZJZA 3H8VA 3E8XA 3AM3A 3WIDA 1C0PA 2OORA 3T7CA 3IP3A 4GKVA 5L9AA 3EMKA 4WCFA 1PGJA 3UXYA 1YL7A 5IN4A 3F4BA 3E5RA 4B4UA 3F1KA 3QVXA 1B3RA 4CM9A 2BGKA 1PS9A 4YB8A 5GMOA 3JQBC 1F12A 2JKVA 1H6BA 3HE3A 1YRLA 4IMPA 2HAEA 1DXYA 3GY0A 2Q1TA 3FPCA 1SNYA 1LDGA 5I9NA 4TSKA 4TQGA 4S1VA 1SMKA 5T8KC 3T7EA 1QORA 2RH8A 2XXBA 5I9LA 3JQ8A 2GDZA 4R3NA 1LC3A 3TDKA 3PHGA 3QLJA 4U0KA 1QV6A 1FF9A 1K3TA 2DUUA 2I99A 2NADA 2ZYDA 3GRKA 3QWFA 4C7KA 1P45A 3D5TA 4D7AA 1LRJA 3OF2A 4YRDA 1QXSA 4RPJA 1GCOA 5THKA 2ZYGA 1W4ZA 1T25A 4GX5A 1PQWA 1EVZA 1N9GA 5EL0A 4BB6A 1PL7A 3ZWAA 4EEZA 4UVEA 3GMDA 2HK9A 3COSA 4CMEA 3E9MA 3RU7A 5TT0A 1QLJA 4D41A 4PLTA 1TLTA 3IC5A 2I3AA 3GDGA 3HDHA 4I9NA 2Y68A 4RQTA 3LT2A 3EVNA 3O38A 3DBRA 5A02A 4FDAA 3RUEA 3WYEA 2BKAA 4AJ1A 3KYCB 1XWFA 2J5KA 4IQ0A 4Q3AA 4TRRA 4DBZA 3S2FA 1GZ3A 4XCVA 5GZ3A 3LU1A 1K0UA 1ISFA 3VZPA 2CVQA 1Y9EA 4LGVA 2PKQP 1YO6A 3F3SA 2CDBA 4NR0A 3AK4A 3LLSA 3C85A 1BW9B 1RM4A 3W6ZA 3PLNA 4NMHA 1GYPA 1NR7A 3Q2IA 4OYRA 2P5YA 1I2BA 2AXQA 1NAIA 3JYLA 4U5QA 5L7YA 4QSMA 4YJGA 1IPFA 1XQ1A 4DYDA 2ZCVA 4FIZA 1I0ZA 1I3LA 1FDWA 1O8CA 4R1SA 4R5HA 4A0SA 3KTDA 5ILOA 3QWIA 2R6JA 4B4VA 3VKVA 4E2ZA 5L51A 3H6KA 1E3IA 1A4IA 5JCJD 4L76A 1YL6A 4MVJE 4JJFA 1WZEA 2HMTA 3ZI0A 3DR3A 1DBVO 3I23A 3H7AA 1YJ8A 2GN6A 3W8FA 4FS3A 4CQLA 5JC1A 2E4AA 1VC2A 2BFMA 4Q3BA 3WYCA 4XGIA 5L53A 4MVJF 2LDBA 3H9JA 4DPLA 5U9CA 5L4NA 1ZO8A 1UZNA 3RBZA 1IL0A 3DO5A 1XQ6A 3BTSA 3IKVA 3PLRA 2VZ9A 3AY7A 3F9IA 4QO8A 1NAHA 3MOGA 5KJ1A 4CM8B 2PTGA 1F06A 1LRKA 2SCUA 3WFIA 4H15A 5JDIA 1MG5A 3TZ6A 1O5IA 2IZZA 1LUAA 1NYTA 5KVCA 4RVGA 4Y8VA 1U28A 1DRWA 5B4UA 3OJOA 1F8FA 4K9DA 4IJKA 1VJ1A 3UHAA 2E6UX 4GI2A 4XEHA 3RD5A 1BXZA 4ZHSA 1ZEMA 3EHEA 1X14A 4NG5A 3V5NA 3MJTA 2NQTA 1CQIA 1JQBA 4IXTA 2C7VA 1YS4A 3PHHA 1D8AA 1ID1A 1SOWA 2EW8A 2I6TA 4BO2A 5TLSA 3QWHA 4IJWA 1I36A 3QVSA 1Y5RA 3PQEA 5B12A 2NNLD 4C7JA 4AVYA 1YVEI 1P3DA 1FDTA 2OBNA 1WMBA 1UAYA 4PG6A 1HZJA 1XDWA 2O2SA 3O8QB 4IJVA 3ZWXA 1YQDA 1E3WA 3C1AA 3IS3A 2AG5A 3KSDO 4D0RA 1ZUD1 3T4XA 2P68A 4R3WA 1TXGA 1SOVA 5DZSA 4BO9A 1B26A 3VH2A 3BYZA 3WNQA 3OFSA 1MA0A 1BVUA 1Z7BA 2DTXA 5L4LA 3DZFA 1VJTA 1Z73A 4I5FA 1I5RA 2PKQO 5JY6A 1C14A 2GN4A 1C1XA 2QYSA 1KOLA 3RSHA 3IJPA 3QSGA 4HFNA 4AJEA 4URFA 2XF8A 4LSMA 4EJMA 3KOUA 2FSSA 1P74A 4IMRA 4BKUA 3AOEC 1GQYA 2IYPA 3WGIA 5CFZA 1YDWA 4BB5A 1EUZA 3PIIA 5CDSA 3ZWWA 1I32A 2UUPA 5CDTA 3M1LA 4EBFA 3JQDA 4PRLA 3L07A 1LXCA 4Q3NA 4BNKA 1P1FA 3VPGA 1S6YA 4ALKA 1PJTA 5THQA 4EUHA 4E2WA 1SO8A 1C0IA 1TI7A 2ZB8A 2BLLA 4U7WA 4NFSA 1U3TA 3QVTA 3ZHBA 3H4VA 3PHLA 4MP3A 1GQ2A 2X0IA 3ULKA 3FCOA 3HB4X 2Y1CA 5G0SA 2HRBA 2YZ7A 4UEKA 4WUVA 2UUOA 4KQXA 1JN0A 4GQAA 4Z0TA 3MJ4A 2Q49A 4BNYA 4C4OA 1ADCA 3KVOA 4YVFA 3AI3A 1D7OA 1LSOA 4FW8A 2QYTA 1I33A 2OUIA 1E1KA 3E5MA 1V3UA 4ZQFA 2HUNA 3OQBA 1OC2A 1LSJA 1TVEA 4E0BA 2VWHA 3GVCA 4IDCA 3K31A 2Q1SA 4XDYA 2C82A 1A7KA 2HO5A 1PTJA 2JAHA 1K2WA 1ZH8A 2W2KB 4BKOA 3CINA 5IF3A 2NQ8A 1DC4A 4FFLA 3ABIA 4FFNA 3VTFA 2Q45A 2YV3A 2ZB3A 3A28A 3RJ9A 1YB4A 1UP7A 4BMVA 1ISHA 2ZKLA 2XAAA 4NDNE 4RJTA 1AXEA 1ENZA 4N18A 1O95A 1IZ0A 3F5SA 4K26A 4B8WA 4M49A 4QX6A 3CPSA 3CEAA 1LJ8A 2UAGA 3MJVA 4YA6A 1EBUA 4Q39A 4IDBA 3PHIA 4KZPA 3JQBA 1HDRA 4ILKA 4RZIA 3NJ8A 3W4KA 2DBZA 1GTMA 5AXBA 4UVGA 3U49A 4ZA2A 1HTBA 1LLUA 5C7OO 2YW9A 3G3EA 3W4JA 3ADPA 3OA2A 1PU2A 2DKNA 1W8DA 2TMGA 4UUNA 2VNSA 2Z5LA 3U09A 1EE9A 1DO8A 3OP4A 2Q2WA 4LVUA 4RV9A 3SBOA 3E9NA 2P2SA 2DTEA 4JBGA 4XR4A 1PWXA 1LDBA 3HG7A 2EGHA 1ZVMA 3TF5A 4UREA 5COAA 4CV3A 4J49A 2YY7A 2X7HA 4I08A 1LA2A 4AJNA 5I7FA 3V2HA 1DRVA 2I65A 1V3VA 3L9WA 3KSUA 2D0IA 1TB4A 4I9UA 3UFXA 3Q3CA 4KWHA 4GKBA 5A9TA 2W90A 2NVUA 3UAGA 4CM4B 3DZGA 1Z82A 1QYVA 4KWIA 4FB5A 1E6WA 3TWOA 1BGVA 1GPDG 1SB8A 3GEMA 1RKXA 4Z9FA 3MTJA 1Z74A 5G4LA 4MVJD 3R1IA 5F21A 3MOIA 4N5MA 2JFFA 1YXMA 3UCEA 2QW8A 2X86A 3NX4A 3FSRA 5KJFA 4TKMA 3ZGYA 1O0SA 3RUIA 1DJQA 3DAFA 3A1NA 1R15A 1Q2XA 1KIFA 2PGLA 4II2A 3GFGA 1WLYA 2C5EA 2WE7A 1DIRA 5KKAA 4E6PA 1BXGA 2CDAA 2G17A 1I2ZA 1GDHA 4XQEA 5HM8A 3WYBA 4NPCA 3LF1A 1L7DA 4FCCA 3F6YA 4AJHA 4FFOA 1G6KA 4FJ2A 4FR5A 4RVDA 3TN7A 4AJOA 4CUKA 5BSFA 4M87A 2DBQA 2V6MA 4L74A 3DBHB 1HLPA 5I9MA 1KC1A 2X9NA 4R1NA 5CG2A 1E7YA 3F5QA 3QJ5A 4M86A 3WQRA 4XYBA 3DFUA 4B3HA 1PIWA 2D8AA 4FOOA 1S7CA 1PGNA 1ZKMA 4YAIA 1GUZA 1G1AA 2NTNA 1A27A 1VL6A 4WNCA 5LDGA 1BSVA 1ADBA 2V6FA 1X7DA 1T24A 4GGOA 1Z6ZA 2DPGA 5TX7A 1TT7A 2EGGA 4PLPA 4L8VA 3H5NA 2BRUA 3I5MA 4CM1A 2P9EA 3AU9A 5EMHA 2AE1A 1U2GA 4IS3A 2PD3A 4RORA 5TJ9A 4ZICA 4XRRA 2IEBA 4IDGA 4U6SA 3R6DA 1PZEA 4XJSA 2BFOA 2JD2A 1AUPA 2DBRA 5F3RA 5TRTA 4Z6KA 1X0XA 3AU8A 1P0FA 5ICSA 3RBVA 2B69A 1ONOA 4OJNA 2W2LD 3DBLB 5CHEA 4LRSB 2VHWA 2AQHA 2Y1DA 5AOVA 4MP8A 1DHRA 5BNFA 4IZIA 3RJ5A 1ISJA 3MJSA 3WGHA 2AQ8A 2WMDA 2X1HA 2E82A 3P2YA 4GAEA 1YQGA 2FR1A 2FR8A 5K6AC 2QRLA 4JROA 4AICA 4RLHA 5KKCA 1EVJA 5JY1A 4BNXA 3H2SA 1N5DA 3AM5A 3CIFA 5A05A 4FFRA 2NU7A 3C24A 4GLOA 5KVSA 5GZ1A 1E7MA 2HLPA 3RC2A 1RM5A 2YQ5A 4E5KA 3OEYA 3TRIA 2JFGA 3INTA 4DIFA 2VZ0A 4BKPA 3RFVA 1E77A 4YT2A 4DBVO 1RM0A 3ROQA 1M66A 1PEDA 3E1KA 3F46A 2DC1A 5IZ4A 2C2YA 4ZU3A 4GSLA 4PZCA 4IGEA 3VDRA 1YOVB 1QKIA 3MCVA 4EITA 4BQRA 4QUKA 1TA4A 2YYYA 4MO2A 4H7PA 1GUYA 3GG9A 3V1UA 3WB9A 4AL4A 2D2IA 1NNUA 2FOIA 2NWQA 2X8LA 4QFDA 3VTZA 2VUTA 3JQAD 1P1HA 5DP1A 3U5TA 4CMHA 1HSOA 2ZJ1A 4YEDA 3JQAB 2UV8A 3DMTA 4R4JA 1ENPA 4CLHA 1NVTA 3SX2A 5JFOA 2AEJA 1PS8A 5AYVA 4QECA 3RIHA 5DBFA 4A73A 4E31A 2E48A 1P1IA 4E3ZA 1ZSNA 3AM4A 1YL5A 4Y67A 4KUEA 4YJDA 2EKQA 2AEFA 5DCWA 4CUJA 1R12A 1CJCA 1JA9A 1EQUA 4BO1A 5EQFA 4BO6A 2X5OA 4IQ8A 3KYCA 1HXHA 4P38A 4MJLA 1T2AA 3H2ZA 1DAOA 4GMGA 4NIMA 2VCYA 1R4NB 2H1SA 4EYEA 1ZK1A 3LC1O 1EDOA 1TT5B 2YFQA 5JYEA 3U4DA 5FI5A 1E6UA 3PP8A 1YBAA 1U3WA 3G49A 5U4QA 1BW9A 2JL1A 3ORFA 3Q1LA 3PI7A 3UH1A 3GUYA 4YQZA 1UDAA 2FRDA 1CETA 4MKRA 4D44A 1AN9A 5CPBA 4E30A 2RHRA 1H6DA 4OXYA 1P1RA 5JO0A 1LDEA 4NBWA 9LDTA 1XR3A 1PJLA 1T2DA 1GYRA 4NJMA 1ZIDA 2C07A 2GD1O 4EJ6A 2DVMA 1LBEA 4B7UA 4PZDA 2X9VA 4TZKA 2FWMX 4IQGA 3RUFA 2I66A 4B79A 4XR9A 5JCJA 1KVUA 3DOJA 2X0JA 3W1VA 3IMFA 1ZEJA 1SAYA 3WMXA 4GVLA 1R0SA 3GA0A 2FPIA 5DOZA 5JPIA 4IBOA 1KVTA 2PGDA 1TEHA 4KTVE 4CM8A 1QYXA 4HV4A 5HWSA 5EQDA 3ONFA 4TMFA 3RI3A 4BIIA 4BNHA 2VYNA 1ZJYA 1JVBA 3G79A 2GCGA 2VOEA 4HKTA 4PG7A 2NTVA 3EGOA 2I9PA 2X9GA 1VJ0A 1HE3A 2RH4A 3VHRA 3WS7A 5HS4A 4YDRA 2YDYA 4IZHA 2EJVA 3I1JA 3GOHA 2R00C 1Y9AA 1PZGA 3BZUA 3PJGA 4RCVA 3E18A 1ULUA 1QG6A 1L7EA 4XIYA 4W99A 3FPLA 1Q0HA 2VRCD 3ZHYA 4ZGWA 2WM3A 5I8ZA 3OA0A 3JD1A 4U8GA 5L3ZA 1FDSA 4GPD1 4PGFA 2EP5A 1H0KA 5I7SA 5C7LO 1AHIA 1E3JA 4FQ8A 5KNLA 4J4HA 4JJIA 3D3WB 5LCXA 3UN1A 3VH4A 1CRWG 4BO7A 3O8QA 1F8GA 1UZLA 4JXKA 5EIOA 4IDDA 1M2WA 1V8BA 1O89A 5GY7A 2X23A 2WYUA 4KUGA 1N7HA 1U2DA 3MEQA 3P2OA 3WXBA 4AG3A 1NQAO 2J5RA 1BVRA 4E5MA 3WGYA 9LDBA 3WTBA 4UEJA 1YB1A 2PY6A 4Y9DA 3RC9A 4GSKA 3VPHA 1PL8A 3I52A 5IAAA 1BXKA 4ZRMA 2VQ3A 1FK8A 3DTTA 4RPLA 2Y1GA 2AE2A 2CVOA 1MC5A 4RPKA 4DXHA 3ZWYA 3JQGB 4YJHB 3LLVA 4CV2A 2JCYA 1ZNQO 2Y67A 3NGXA 4HADA 3ZHZA 2CUKA 5DN9A 3UCFA 4A5OA 2HK8A 1VL0A 1P1JA 4BO3A 4ESOA 3WBFA 2P9GA 4RZHA 4TKLA 4YQYA 1HKUA 2ZCUA 3KETA 1PL6A 5TF4A 3JQEA 3OBBA 3D64A 2YQ4A 1NFQA 1LSUA 1UXJA 3OICA 4D45A 3I9OA 3NDRA 4UVDA 2C0CA 5L45A 3AUAA 4MVJP 5A1TA 3T4EA 1HDCA 4O0LA 4OMUA 1MGOA 2AW5A 2X4GA 4XIJA 3I4FA 1QYCA 4M1QA 3PJEA 1G0NA 3GVPA 1B8VA 2QZZA 4A7PA 4Y6PA 4EJ0A 1VM6A 3L4BC 2Q1WA 1PQUA 4NFYA 2NTJA 4LRTB 1A5ZA 1X0VA 3H3JA 3MZ0A 4CV1A 4R9SA 5CDUA 3LT0A 3RUAA 1PGQA 2VHVA 5HBRA 4WKGA 2PK3A 5ADHA 2W98A 4OKIA 1D1SA 1Q1NA 4FJ0A 2Y0EA 4RVHA 5TNXA 1YQXA 5HTOA 2I5PO 4IM7A 3IKTA 1DHTA 4PLZA 5U1PA 1XSEA 3ZWVA 5L7TA 5K6AA 4FOSA 4DLLA 4MDHA 4CLDA 2HSDA 3JD4A 3JCZA 1KEWA 2W2KA 3JV7A 4YAJA 3HB5X 4EDFA 5KVQA 2GZ3A 2O3UA 5JCXA 3JYPA 4R5MA 3LT1A 1LLDA 4OXNA 4YJFB 1DFHA 3ZU5A 5KCZA 3ITDA 1EQ2A 1ZFNA 1GZ4A 2JFHA 1JAXA 4L73A 4MKXA 3PQFA 1NFFA 4MVJH 4BHTA 4HUJA 3CH6A 3NJ4A 3C1OA 3OMLA 3NDIA 1LQTA 3V1YA 1UAGA 1DFGA 3K73O 3RROA 1HWYA 3KXDA 3SC6A 1PJ4A 1Q0LA 3JD3A 2AMFA 4I9HA 5JC8A 4RVSA 4BVAA 4NK5A 3I4CA 3RFXA 3CE6A 3FBTA 3I9LA 3G1UA 1OAAA 4JN6B 3I9KA 2WDZA 3ZV3A 5KOIA 1MG0A 1ZXLA 1I30A 2J8ZA 3AWDA 2HMVA 4R01A 2ZATA 1Y6JA 2VT2A 3JQ9A 4B3JA 3N7UA 4WE3A 3D7LA 4OL9A 2VUUA 1LDMA 4XQ9A 4Q9NA 1WDMA 4EZBA 1XIVA 1WDLA 3DOOA 3FNHA 3VVBA 2VHZA 2Y0CA 2ZTLA 4E33A 3ZWNA 1SZJG 4K6CA 1GL3A 3H5AA 4ND3A 2C59A 3EAGA 4ZQBA 1E3SA 4XJTA 1FDUA 4B7XA 3ICCA 4NZ9A 2Y1OA 4CM4A 2G0TA 5G0TA 2CDCA 3OIDA 2V65A 1M67A 1MLDA 2HK7A 3F4LA 2EG9A 3ONEA 4RLSA 4ALLA 2IZ0A 4WLNA 1YGYA 3W8EA 3ZW8A 4FBGA 3H9UA 4F6LA 3VVCA 2VTDA 4U0JA 4Q3CA 2JCVA 3C7DB 1B16A 4EUFA 3VZRA 2B4RO 3PPIA 3U0BA 4DMLA 2Q1UA 3B1KA 4BGEA 1KVQA 1NASA 1EUCA 1EE2A 1MX3A 4DQVA 2Y99A 3V2GA 4UEOA 1GUFA 3AFNA 3PJFA 4R1UA 3AUUA 3JQFC 3C7CB 1Z7EA 1LDNA 2C29D 2FN7A 3PQDA 5F5NA 1CIVA 2ILTA 2V6BA 1RPNA 1XU7A 4CMCA 5JW6A 1MB4A 3IL2A 3U4CA 2Q4BA 3GK3A 1KVSA 1ZK0A 5TSDA 4Q3EA 1SPXA 1DLIA 4BNLA 4YRBA 3DBHA 4DQXA 3UVEA 5T64A 3WSWA 4LMPA 5JNLA 1MP0A 1R37A 2EXXA 4NU5A 4J6FA 5L4SA 5JDCC 3P5SA 4EGFA 3BMCB 3HDJA 1QRRA 3HWRA 3LF2A 4HNGA 1T2CA 4WLUA 4GMFA 1P44A 7MDHA 2UDPA 4RPHA 4ZQEA 5IZCC 1CDOA 1HL3A 2IYOA 1N92A 1NWHA 1LI4A 2EKPA 3GEGA 3PHJA 1M76A 4HFJA 2YUTA 1N2SA 1NX6A 2P4HX 3NUGA 3K96A 4YBZA 4IJUA 1KVRA 3STHA 4ONEA 4W9NC 4PLYA 4WGGA 5DCYA 3KBOA 3TFQA 1EDZA 3K2BA 3DBLA 4RDIA 1NHGA 2B37A 3CMCO 4M54A 3H5RA 3CXRA 2OP1A 4OH1A 2W2LA 3EC7A 4PLHA 4E21A 3ITKA 3PYXA 4MVJG 1KYQA 1ZBQA 3BMNB 8ADHA 1UR5A 3OQ6A 5A5EA 2AQIA 3GR6A 3DONA 3FI9A 3PWZA 2H63A 4QQRA 4CQMD 3A14A 4WJZA 4CM9D 1D3AA 4WASA 1EFLA 5IXSA 4CQMB 3B20A 3LK7A 4E5NA 4GLLA 3TZHA 3U3XA 1IE3A 3WLEA 1JU9A 2C7GA 4NBVA 4FFMA 3IUSA 1Y8RB 1WW8A 5FI3A 1PJBA 2A9FA 1B7GO 2WTBA 3DAPA 4ZVVA 1MV8A 4ND4A 1ORRA 2GLXA 4ID9A 3DBVO 3C7AA 3W6UA 1T1SA 3AOGA 1K6XA 3SLKA 5KJCA 4GL4A 4RPGA 1N8KA 4ZQHA 3IQDB 1NPTO 1ZMOA 3E82A 4AJ4A 3TFOA 1B0AA 3ENKA 5BT9A 3ZWCA 5IJZA 2X22A 2FMUA 3ZW9A 1GADO 2GZ1A 1EZ4A 3BTVA 4L4SA 3ZN2A 3CSDA 4DPKA 4KUHA 1OOEA 2FR0A 3DHYA 4LMRA 5BSGA 3KZVA 3GRPA 1X7HA 2J3KA 3BMQB 3LZ6A 2CD9A 5CDGA 3JQAA 1AHHA 5F1PA 4IDFA 3TZKA 3V1TC 5IDYA 4CR7A 5FWNA 3NT4A 3ST7A 4BNGA 3DBRB 4DIOA 4NJOA 1BRMA 2Q46A 3K5PA 5KJ6A 1HE2A 3GAZA 1FXSA 1V6AA 3ANNA 4CLXA 2O3TA 1JVSA 1H5QA 4IIVA 3AUSA 3ZWOA 1EBFA 1R0KA 5T8KA 2AQKA 4NNJA 2D59A 2IDZA 3MTGA 4YCAA 4IUYA 2HMUA 3NYWA 2BFPA 2HRZA 4OOFA 4HNHA 2QIOA 2H9IA 3GLQA 5JBIA 5MDHA 2G82A 3P7MA 3SEFA 4GX0A 4BGIA 3ONDA 3L4BA 3RVDA 1LX6A 4DUPA 4L4RA 4IY1A 5TGDA 1R4NA 3PIDA 4GWGA 1NTOA 4J90A 3JQ7B 3ZU2A 4J2HA 1QMGA 1JLLA 1TT5A 3CZMA 5G0VA 2NU6A 3PYLA 3ON5A 4LVCA 5I7VA 3OIFA 2IODA 2BELA 4YWJA 3HZZA 3JQCA 1ARZA 3DZHA 1XU9A 3EDMA 1E0DA 3OJLA 3QHAA 4E2XA 1KY4A 6LDHA 4HY3A 1U3UA 4OQZA 3VZSA 3NV9A 3SC4A 2PZLA 3HDQA 1P33A 2GR9A 3KV3O 2YHIB 3WGGA 2EIHA 3FWNA 4MP6A 5JLAA 1BDMA 3GGPA 1HF3A 1EK5A 3WLFA 1XHLA 3ZH2A 1EVYA 4OAQA 2YV2A 4X54A 2O4CA 3OJEA 1LDYA 2CF6A 1X7GA 3ZZNA 1JW9B 2IEDA 3A06A 2C54A 1BTOA 1A7AA 3V8BA 1LTHR 1DB3A 2PH5A 2J6IA 3KLPX 5TS3A 1LNQA 4N5NA 2O3QA 1NPYA 3WOHA 4ALJA 4F6CA 2ZIZA 2P4QA 3D3EA 2P91A 3FN4A 5DF1A 1C1DB 4K28A 1B15A 5C37A 1NQOA 1WVGA 2X58A 1YKFA 3D1LA 3ETEA 3LVFO 3WQQA 4PVCA 4WNIA 3DMYA 1XCBA 4F45A 1ULSA 1WZIA 4W6ZA 2OOSA 4W82A 3R3SA 4YAEA 5EESA 1GPJA 2PA3A 2EV9A 3N58A 2VRCA 3DAGA 4Y6RA 3HFSA 3JYQA 2NLOA 4FC7A 5I7EA 5H83A 3SJ7A 5A9RA 4CM6A 3K2EA 3D3WA 2OXIA 3FBGA 1Y8QB 3QE3A 1B3BA 3MWDB 2O4UX 1E1NA 2O2YA 4DC1A 4ZRNA 1UXHA 1E3LA 2A94A 4BNZA 1HYGA 5G4KB 4WEQA 3PXXA 4DRYA 2AG8A 4BV8A 1GQQA 5JXWA 4RO0A 1JKIA 2VNAA 4FSHA 1R66A 2B36A 5DULA 4XQCA 4WEOA 4CMEC 1K6IA 1A72A 1AXGA 3ZWMA 1PGOA 1OC4A 3GDOA 4W7HA 2J3JA 3JQFA 1ISGA 5CAEA 4BV9A 3JQGA 4YJHA 1Z75A 3S55A 3GAFA 5BQFA 1D4FA 4E32A 2WE8A 4ROSA 4HBGA 4PLFA 4QXMA 2Q2QA 1U5CA 4R1TA 4PZEA 1I3MA 2WD7B 4EW6A 1DSSG 4YTEA 1PQPA 3D4PA 4EEXA 5TIIA 4WLFA 1NM5A 1T1RA 5C3MA 3DXFA 1NP3A 4I8XA 4WOKA 4CLRB 2IZ1A 1HDGO 3D0OA 3IDSA 1NHWA 3O26A 4BOYA 4J3FA 3DL2A 3IAHA 2VN8A 5J23A 1KBZA 4UUOA 3LC2O 4U6QA 2HKIA 5IZCA 1R4MB 3BXXA 2J5QA 3UW3A 5A5FA 3AOEA 3QW2A 3HNPA 1EVIA 1JAYA 5DOVA 5B1YA 2JCXA 5DBGA 3RC1A 1HZZA 1SC6A 3H65A 4Z9XA 1NPDA 5KIAA 5BR7A 1IPEA 4OSPA 4BGUA 4CJXA 4DA9A 5JS6A 4A27A 1IHXA 4G2NA 4JJGA 5A06A 2BI8A 4YAGA 4BO4A 2B5VA 2DPHA 3OIGA 4J1SA 4II3A 3JD2A 3PVZA 3RUHA 5F1KA 1N1GA 3KM0A 4ALMA 2JHGA 4NI5A 2EP7A 5FF9A 3QRWA 2HDHA 4JBIA 1U7HA 1J6UA 1NBOA 3LDHA 5I8WA 3RBXA 5EN4A 1GEGA 2CMDA 1GYQA 3RUDA 4IXWA 1ONNA 2O7SA 3KUXA 3IP1A 3PJDA 3BAZA 3O9ZA 4BNJA 5IDWA 1CQJA 2EW2A 4IDAA 2JD0A 2G76A 4YRAA 2BF7A 1JDJA 2VZ8A 4FPXA 4QO7A 3IIEA 3ROKA 3EY4A 3K9QO 3PYMA 2VYVD 1WDKA 1DIHA 5JMPA 4BUCA 4HWKA 1KETA 4B8ZA 2X0NA 3I6IA 1VKNA 3M6IA 2H5LA 4RF4A 5BSEA 1EEHA 2Z95A 4R41A 3OH8A 4UAGA 5ILGA 1LLQA 1CWUA 4AJKA 3UF0A 2PKRA 4A03A 1DIBA 4DPMA 4CLEA 5IDQA 3PGJA 4QFCA 3K8ZA 3I6QA 2BMAA 4CMAA 1I3NA 2PZJA 1X13A 1DJNA 3PZBA 1PJ2A 4N7RA 2DT5A 4OGWA 5LDHA 1RWBA 1GD1O 3S2EA 3H3FA 2RCYA 1UXGA 3HDYA 5CPFA 3B6ZA 3BMOB 3WNVA 3BIOA 4J1NA 2D3TA 5TQVA 3FF4A 3VKUA 3EUWA 2PFGA 4D79A 3WWZA 5MGBA 3RWBA 4PLCA 4AJ2A 2W4QA 3CZRA 2BGLA 3GNTA 1SEVA 1DC3A 4F46A 2NM0A 3KO8A 3L0DA 1XGKA 1KC3A 4RF3A 3ZHXA 1RYEA 1Q7CA 2B4QA 3RKRA 1G0OA 4Y6SA 2GZ2A 4AFNA 4O59O 2YFHA 5A04A 2Y05A 3S8MA 4PVDA 1E7SA 3BHMA 4UUPA 3BA1A 3DC2A 3GUCA 3K92A 1O94A 2ZTMA 4IINA 4XX0A 3WGZA 3MJCA 3UOGA 4DLAA 1ZSVA 1XKQA 1A9YA 3VPXA 3WDSA 3UGKA 4GWKA 4E5PA 3ZNPA 1HRDA 3OM9A 2CSUA 4MKZA 4RVFA 5DCUA 1IHYA 1T2FA 4CM3A 1J49A 4WOJA 4BMNA 4L0QA 1H93A 1SB9A 2Y66A 1VSUA 2I3GA 2NSDA 2Q4EA 3FHLA 3Q0EA 1KEVA 4J43A 4YT4A 2CFCA 6ADHA 1DFIA 1U4SA 1W73A 2DFVA 1M6HA 2Q50A 1AE1A 1QYDA 2UVDA 3GEDA 1GCUA 3ZV6A 4BO5A 1UDCA 2IRWA 3ANMA 1Z45A 5DBIA 4HX5A 1UXIA 3ZV5A 1KS9A 4DC0A 3GN1A 4FC6A 5AXDA 1VRWA 3GNQA 3IUPA 4TRMA 4MIOA 3M2TA 1I3KA 5ENDA 2RBEA 4HFMA 4XYGA 3KEOA 3BMCA 1IULA 3R0IA 3KYBA 1DPGA 3ANLA 5HA5A 4MPDA 4NBTA 4XA8A 2JAPA 1JKJA 2Z1MA 1FDVA 3MWEB 5DP2A 1RM3A 2AEMA 2PNFA 2EHDA 1LU9A 3LSYA 3ZNNA 1F14A 4K1LA 1R0LA 2ZTVA 4L4XA 2ZQYA 2ZJ0A 3TSCA 3UKOA 1NWCA 4CMKA 3HN7A 3NTRA 4PLGA 3TZQA 2YJZA 1UP6A 3SLGA 3WICA 4DREA 4XZ3A 3WJ7A 4NHEA 4F3YA 3IJRA 5G0UA 3S2GA 2JD1A 1WMAA 3DHEA 2Q99A 2VT3A 3RUCA 4P8RA 3BTOA 3BMNA 3DEYX 1DIGA 4BKRA 4DQUA 4EI2A 1IY8A 4RGBA 2BHLA 3ADOA 2NU9A 4MOWA 4CPDA 2FHSA 2GO1A 1KERA 2Y1EA 3BTUA 4CQMA 3FTNA 3RKUA 3ASVA 3DTYA 4NBUA 2B0JA 4TWRA 4D42A 5TJHA 4Z0PA 3A9WA 5H81A 2D1YA 3KHUA 1HE4A 2V7PA 5HRUA 1GFSA 1X1TA 4OXKA 1Y8RA 1Q7GA 1H6CA 3ZWBA 2J3HA 4DGSA 1PSDA 3FR8A 2B5WA 3QY9A 4XGKA 3HSKA 2R2GA 3ETDA 2QRJA 3GZ4A 1A71A 2BD0A 5EINA 4XQGA 1YJQA 3FNFA 1A4UA 4LSWA 5H82A 1J5PA 4BNFA 3HHPA 4CMIB 4HP8A 3GH3A 2VUSA 3WX0A 1ML3A 3OSUA 4PG8A 1YDEA 2GRAA 5TC4A 4BO0A 5F5LA 4D0SA 1PGPA 4AJJA 3HQ4O 2VWGA 3KRTA 5JO9A 1ENOA 1K89A 1H2BA 4KP7A 3D4OA 4L9RA 1HYHA 4YXFA 1PJ3A 1ADFA 3P19A 3JYOA 2DLDA 4J2OA 1EK6A 1PZHA 4Z3DA 4NBRA 5ITWA 1U8XX 3JD0A 4FGWA 5F1OA 1E6EA 1PR3A 2O3SA 2O50A 3BMQA 3HN2A 3G17A 4ZN6A 3PFWO 2CVZA 2POQX 4H3VA 4OSOA 3LQFA 2CNBA 2B35A 3GZNB 4NH4A 3CMMA 3DOCA 1GR0A 1JWBB 1PS0A 1FMCA 5GZ6A 4O6VA 1C0LA 2HJSA 2FZEA 2X6TA 3Q11A 4J1TA 1HETA 3ROPA 4M8SA 1OI7A 3GPDG 3F1LA 1W0CA 5FFFA 5G2OA 1T2EA 4MVJI 5EPOA 1BMDA 1QSGA 3G1TA 3CTMA 4AJLA 4TROA 3VPFA 1OBFO 4NU6A 4D43A 1DAPA 2J3IA 2W8ZA 1E5QA 3A4VA 4BNIA 4G81A 4DVJA 2I67A 4LN1A 3NRCA 4PN3A 3JQ7A 1YBVA 4IDEA 3G0OA 3TL2A 4J91A 4J9VA 1QR6A 1YONA 3C8MA 4PG4A 4J7UA 3NTOA 1IOLA 4XYMA 1W6UA 4NJMB 4JP3A 4CV0A 1UXKA 5EJ2A 1I10A 2HQ1A 3QVOA 4OHUA 5B37A 1HDXA 1RJWA 5ES3A 3U4IA 5IN5A 4PLVA 1JKFA 1X1EA 4QTZA 3M1AA 3WGOA 5DNAA 5ENVA 4WPGA 3QWBA 4TRJA 2YHUA 1PJQA 4RF2A 1PJCA 2PWZA 5JE8A 3GQVA 4MVJA 3DB2A 3KYDB 2GNAA 2YHIA 3JSAA 1VSVA 1OMOA 4HXYA 2VYND 3FRJA 1JWAB 1GAEO 1ZXBA 1ZK3A 3B70A 4PLWA 5CEJA 3VC7A 4J16A 3PWSA 2EJWA 4MINA 3WIEA 2ET6A 1K6JA 4GGPA 4CLOB 3WSVA 3B1JA 3S1LA 1DRUA 1YBMA 5L40A 1VE9A 1J4AA 2DU8A 1ZK4A 4ND1A 4JCOA 1B14A 3M2PA 4S3MA 1DC5A 4CL3A 2QRKA 4LK3A 4YR9A 1PR9A 3PZRA 2OHXA 2E37A 5JAQA 1U4OA 2EERA 2I76A 1C1DA 1FJHA 3OECA 1A9ZA 4I5EA 4ALIA 4YAKA 1HE5A 1OZAA 3AW9A 2YV1A 3WGTA 1U5AA 3ZCXA 4B7CA 5CEEA 5JSFA 2C2XA 5JMWA 4OKNA 1NR1A 5IXYA 2HMSA 1KEPA 2PGJA 3SJUA 4O1MA 4ND5A 3QVWA 5KJEA 4WK6A 4O63O 3AI2A 2WWRA 4DYVA 1CERA 4A2CA 5A9SB 2PV7A 3OJ0A 1EFKA 3GG2A 4JIGA 2DFDA 5A3VA 1Y8QA 1MXHA 2A4KA 2B83A 2GN9A 4YT8A 4CM5A 1T4DA 3GNSA 4LCEA 1VI2A 4WLOA 4E13A 3ROMA 5G4KA 2X0RA 3K6JA 3E9QA 5ER6A 3DMTC 5C5IA 4WCFB 2WYWA 3PRJA 2R00A 3PFFA 3RASA 4EUEA 4KDEA 1YB5A 3U4HA 3DZKA 1YE3A 4D3FA 4RL6A 3VZQA 3X2FA 2A92A 1NVGA 2XXJA 1HDYA 3VPSA 3W4IA 3ASUA 4QEDA 3I9MA 1NQ5A 3UICA 5ICMA 4KDFA 4E4YA 2P5UA 1I2CA 1O9BA 2VTEA 3JQ8B 3EYWA 1M75A 1GEEA 4TZTA 3EW7A 5A3JA 5KWEA 1NVMB 2O23A 2WD7A 2NV6A 2PZKA 2Y93A 3DZIA 3DZJA 2RAFA 3OQ1A 1YOVA 3PEFA 2ZB7A 4KQWA 1IZ9A 5G0WA 1HYEA 4Z0HO 1ZK2A 4G5HA 2A35A 1N9GB 4CLRA 3AJRA 2G5CA 4BO8A 3L6DA 1KEUA 2ZB4A 4UUMA 3OETA 2OZPA 1R4MA 3ICPA 2DQ4A 2OBYA 3PDJA 3GF4A 4KMSA 3I9NA 3GVHA 2FPGA 1Q7BA 1UJMA 2O3RA 3H9EO 1SCUA 1NFRA 1MFPA 2IXBA 4LISA 2EEZA 2FPPA 3TJRA 1U1IA 1F0YA 3H9GA 3RAJA 4CMJA 1DEHA 1GY8A 1VPDA 2JJYA 1K5HA 2HU2A 2HJRA 1VL8A 4LW8A 4P4LA 3DFZA 1YH3A 1BWSA 1I24A 3RCBA 2VWQA 3VAZA 3KLMX 1P0CA 3INRA 2FY8A 1ADGA 2NU8A 1Y1PA 3QQPA 3CUKA 2DAPA 4XKJA 1Y5MA 3TOZA 3NT5A 5FEUA 4M55A 4FD3A 4BGVA 1N7GA 2IXAA 1MC4A 3TNLA 1WAMA 1VLLA 3PWKA 3W8DA 3NKLA 3ZU3A 3UUWA 3L9XA 4TVOA 3L77A 1VKOA 4WECA 4YJGB 1CEQA 3DZBA 1XG5A 3ENNA 1HDZA 4XDZA 1YWGO 5CEFA 4RQUA 2TMDA 2WD8A 3JYNA 5DDIP 4CR6A 2PD6A 1WNTA 4R68A 4OOEA 2OO5A 4O5OA 1P9LA 2X5KO 4JGBA 4JX8A 2VYVA 1M6WA 3NGLA 5DT9A 1PX0A 3GVXA 2WYVA 3AFMA 2JHFA 4N54A 1L1FA 3FNGA 4XRGA 2VHYA 4CQLB 7ADHA 1RYDA 2OP0A 4DL9A 1PZFA 1NXQA 2GGSA 4IGFA 2D4AA 2V6GA 5K9ZA 4R9RA 4PRKA 3NT2A 1GV0A 4XYLA 3KEQA 4NQZA 4YYZA 4JLWA 4BNNA 3BMOA 1H94A 1WXDA 3ETGA 3GFBA 1B8PA 3I3OA 3GMSA 1CYDA 1X15A 4BNMA 1UH5A 3QIVA 2VWPA 5JAZA 1QP8A 2PD4A 3INGA 4PG5A 3R3JA 4NK4A 3WGQA 1ZZEA 5ER9A 4CL8A 4GH5A 4J4TA 3LYLA 4I5DA 3D5QA 4XB1A 4CODB 4BS9A 1Q0QA 1ONPA 1U8FO 3TQHA 1U7TA 1CF2O 1H9BA 4LCJA 4OIMA 2EF1A 4CM7A 4JNKA 4D46A 2BI7A 4W4TA 1HLDA 3WJAA 4DMMA 1V35A 4UVIA 2Q3EA 3LC7O 5COQA 4CR8A 3WBBA 2QQ5A 4ND2A 1BG6A 5BSHA 1E1MA 3I9JA 4J1QA 3ZWPA 4MIYA 1B8UA 4H16A 4WCFC 4BNTA 1D1TA 2RHCA 2WJPA 3L6OO 3E6AA 4GX2A 4P4NA 4IIUA 3JQ6A 2ZTUA 1QV7A 1V0JA 3BHJA 1E3WB 4B4OA 2CF5A 5BNIA 2VRBA 2BH9A 2GSDA 2HMWA 3HUDA 5CP8A 2QZ9A 3BHIA 1GU7A 1N1EA 4I1IA 2GERA 4XYEA 1MFZA 4M89A 5CDYA 2AA3A 5EERA 5JAIA 5A03A 1XA0A 1DDOA 1XEAA 1E7RA 1C1XB 4RDHA 2C5AA 1DIAA 2DBVO 4ZJUA 4JBHA 4DWVA 3GDFA 2XOXA 5COBA 2RIRA 1HT0A 2LDXA
chains in the Genus database with same CATH superfamily
3VOSA 2CYAA 5AKGA 4OHPA 1LBTA 2XJ4A 3IJ5A 5DGDA 1E4EB 1YAHA 4CKWB 2J3LA 1KY5A 2GPYA 4JCCA 5KYVA 2PQ2A 2XUOA 3A3PA 3N0VA 3OEWA 1A2KC 2NVBA 2GPSA 1Q0TA 2IH2A 1WPQA 3U3MA 3K8OE 1QFMA 3QLUC 4IPTA 4YGXB 3EJWA 3WQBA 1HQCA 5IJ0B 1E6LA 2OWDA 4RD4A 4S1OA 4P34A 2PZMA 2QPTA 3NZEA 4BKQA 4GP9A 2ZK7A 3FTPA 3TL3A 3Q6IA 3CCBA 3CKYA 2O48X 4HGZA 5A4KA 3KR0A 3PIRA 3ZU6A 3PUJA 4OSEA 5CB6A 1F17A 4E2YA 4YPOA 2GJAA 3WRWA 5BNZA 1ODIA 1Y7TA 2A9OA 3EVTA 1K4MA 1UUFA 2SKDA 3OE5A 4XWYA 2FKAA 4I5IA 5F35A 4KOAA 3T0IA 3W5JA 3ZJTA 3I62A 2ZYRA 5F9FA 1CHDA 2QVZX 1UBCA 3H5OA 3SR4A 2HU8A 2QQFA 4LOHA 3IQEA 1S4QA 3D6VA 2RHOA 1C4WA 2IQ5A 1BHSA 2VUHB 3L1VA 3I3SR 2GARA 4YCNA 4TL9A 3C3DA 1Y81A 5GTDA 3IUNA 3H1EA 3LO8A 5F2NA 4P7FA 4QYSA 1RU3A 2Z1NA 3HCOA 5CMLA 1MW9X 3VH1A 2ACKA 4RW0A 1HDOA 2PO7A 3BD7A 3LUGA 2ECPA 4UKDA 2J09A 2BFNA 2WC1A 2JAXA 3IBYA 5CT8A 1N0IA 4RV5A 4EZEA 2X2EA 1N0UA 4J4BA 1BDBA 5ALRA 4ZEVA 4JOSA 5F77A 4K9SA 4W9NA 4PR0A 4QJ5A 1JHPA 3AEUA 3V34A 1KK0A 4OHFA 3TPCA 2QYOA 2O19A 1XMOB 3OUTA 4PCUA 1K66A 3C3XA 4X1KB 2UYYA 1ICIA 4J0EA 5EIBD 4RVUA 1O95D 4CMIA 4D3ZA 2WQ7A 1ZMTA 1CU1A 2G83A 4PC7A 3V8VA 4C5CA 5JCZA 1T15A 1U6IA 5FL7D 5BV1A 2O2DA 4E08A 3TR6A 4JXXA 1R0BA 1NJ5A 3P52A 1BDIA 1XEXA 4P7JA 1MUUA 4UTZA 1YQUA 3AKEA 2OO3A 3HB1A 3L6EA 3IHTA 2DPMA 3E3OA 1AKMA 1RXIA 4H4DA 1U1DA 4F2HA 4A36A 2HT6A 5DW0A 5FLYA 1BOFA 1H8HA 4DR2B 3KFVA 4RF5A 4UFNA 2H18A 4Y98A 3MT8A 4NESA 1LF5A 2VJKA 4NBSA 2O8EB 3RFCA 1BC5A 2QOEA 2GCEA 4JIMA 3TW8A 5ELXA 3ZS8A 5CH5A 2D6FA 5FPPA 4KTTE 4R2IA 2OA0A 4IRUB 4MV3A 2FXVA 2QDKA 2RHBA 3LE8A 5T4BA 4KR6A 1N8TA 4DLTA 3H9QA 4DTIA 2H1FA 1ZIXA 5KYXB 4JOBA 2Z43A 4DNOA 2C5SA 4R54A 5LXTB 3EPJA 4PSKA 1CUAA 1DKRA 1NUPA 3O8RA 3C8DA 5KVVA 2QRPA 3EB9A 4R16A 1NJ1A 1E3DA 5FO1A 1LSSA 2PUTA 2Y1XA 3AI7A 2FGJA 3E48A 3UAOA 2AJDA 1MB3A 3DJYA 3HADA 3TNJA 1OZ0A 2QPLA 4L9AA 3ZGXA 4F12A 1ZVQA 1M8GA 2X9QA 5ITVA 2AYYA 3MWGA 1YBHA 3Q9NA 5ED0A 4E5YA 4YH1A 3DHNA 3ZLVA 1U7XA 3UFXB 4DQ0A 1I8TA 4DV0B 2WSBA 4ENPA 1L5GB 2QRHA 1TO2E 3HBAA 4BNUA 4MUAA 1KKUA 4IS2A 4ZVUA 4PGAA 3K30A 2X0EA 4B48A 1VKRA 2E7ZA 4Q7JB 1ENYA 4JI6B 3OE7A 3RR2A 5HR5A 2VJCA 3RWMB 5EJMA 4X1YA 4DY6A 4YROA 1XL0A 3RKSA 1RYBA 1QB7A 3DWIA 3AF1A 3ZIDA 1N2XA 3U3ZA 5K09A 2YDXA 2BGJA 4I55A 3G2PA 2ORIA 3D2BA 5FULA 4AKHA 1MNQA 4FGKA 1UDRA 3WK6A 5EJ7A 1TVCA 4NNOA 1CX9B 1KDOA 1AHNA 3DS8A 1ISIA 1MR3F 4HQOA 5T67A 2QW1A 4IRMA 4MPTA 4ZOLA 4K0KB 2BL4A 2JVIA 3ABQB 1C1YA 1H2HA 1RI4A 2GOYA 1E0KA 2BGMA 3AV3A 3KLBA 4IDQA 3EZYA 3ZVLA 1QNFA 2WMYA 2XDAA 1HT1E 2WYIA 3QU9A 4KIUA 4HVCA 1LZKA 1II8B 3P2EA 5LC1A 5K3BA 1QWSA 1THTA 1VIVA 5LUBA 2YOHA 3T8YA 4BL5A 2G09A 2O3JA 3TVYA 2OBMA 5IFLA 3AR8A 3QKSA 1R16A 3SDSA 4Q02A 4Q3DA 2IYXA 2UVQA 4PSCA 3RLFA 1QQ6A 4Z7JA 4KFRA 3FWKA 3WFJA 4FJ1A 4PXYA 4KE8A 4M0EA 3SFTA 4Z49A 4JBLA 4PAOA 4HFRA 1V8PA 2V4MA 2IV7A 5C7IO 3LC0A 1RKQA 1QK3A 1UK7A 3GN2A 2W48A 2VCHA 1AUOA 2VPYA 2Z09A 3MRSA 2GF2A 1DT3A 3UCXA 2YJGA 2RJ3A 4XB2A 2C20A 4LQ4A 4CKCA 3ZE8A 2WV9A 3FYDA 2QL5A 3OT1A 2Q4TA 2OCYC 3KKZA 4JNCA 3B78A 5DYWA 1JYFA 2L69A 4RMJA 1J5EB 1E1LA 1AKVA 4KN5A 3PITA 5SY6A 3RSCA 5FTLA 2HCTA 1K6EA 2GX6A 5IG2A 5M04A 1RLJA 2OGUA 2J9XB 2CB0A 4J7XA 4QREA 5TT1A 3TW4A 2AR0A 2DPYA 2KS6A 2VHXA 4IDPA 4OFXA 2GI4A 5JWRA 5I3ZA 3GT0A 4TTIA 2Y1WA 3QF7A 4OHKA 2O7NA 1LQUA 1VPLA 4YRFA 3W2HA 1MNAA 1X77A 1BX3A 2H06A 1WULS 4P92A 2AUNA 1AKUA 4FEYA 4KRGA 4QD3A 1TD1A 2I8LA 1QOQB 3HABA 1FYWA 4EI8A 3AEQB 4PYIA 4HX9A 5A9SA 3AESA 4B1FA 1AQ6A 5AXAA 4B73A 4OHYA 2ZQZA 3B1FA 5JSHA 2A9RA 3IEXA 1MCZA 1M5UA 4ES6A 3C1TA 3HKDA 1C7ZA 4CTNA 4HNTA 1HSZA 1YQQA 2HA7A 1XZ8A 3L4SO 2Z5GA 4KX3A 3FNEA 4NFHA 3PEUA 4P80A 2EYUA 4A6EA 1W6RA 3LSTA 2IX3A 1NBIA 2G1AA 4NYJR 4A9AA 3TTUA 4D96A 3E8XA 2BF4A 4EAAA 5AW2A 1KNQA 4WAUA 2O1WA 1OX4B 1IWPB 4LBVA 3IP3A 5L9AA 3EMKA 1M1NB 3HP4A 3QI2A 4DMRA 2OV3A 3MSCA 3VVLA 2CLDX 4AUNA 3OJWA 1XVAA 3F1KA 2VPZA 1B3RA 1L6RA 1OIVA 3QVXA 5K2MA 2BGKA 4CM9A 5JSUA 4FGLA 1BS9A 1O96A 3JQBC 5FUYA 2H1RA 1CUYA 1AGPA 2WJ6A 1PSWA 3L1JA 4FINA 4IMPA 4JYCA 4B6GA 2WIAA 3EAFA 1P5ZB 4QGHA 2FRVA 5KU1A 4TQGA 4BKMA 4S1VA 4D4GA 1OI3A 2RKBA 3M6AA 4PR3A 4XPIA 5I9LA 2RG7A 5G41A 3PTLA 3MUNA 1M1XB 3JW8A 2GDZA 3KXKA 3EIUA 4HB0A 3FFBA 1ZH4A 3IDZA 4UQLA 1JFFB 3TMYA 1JFRA 2WVJA 1NBWB 1IAVA 2WPDD 2ZYDA 2ZVDA 4H1HA 1CLUA 4HNSA 1A77A 5K3EA 1XPJA 3M3HA 3D5TA 3SQWA 2IS4A 4NYIR 4D9KA 4QFMA 3VJRA 1UBMS 1GCOA 4RPJA 5LZ7A 4G4IA 2ZDQA 4N40A 3FAKA 1MENA 5HJEA 1EVZA 5CBPB 1IIRA 1RWVA 3ZWAA 3I53A 1HV8A 1NYLA 5D87A 2NO1A 1U90A 4NONA 4DV6B 1R5NA 1DJOA 2EJUA 2HK9A 3COSA 3V4SA 1GUDA 3WHIA 2AUTA 3KSRA 3C5CA 4F7DA 4A8PA 2DHDA 2OHGA 3FX2A 5DVZA 4D9NA 1OLSA 3GMTA 3LUBA 1QLJA 4K6HA 4KBGA 5TT0A 4D41A 3TNYA 4UTOA 1WMFA 1TLTA 4WT7A 3V9PA 1P1CA 4DWWA 1NF3A 4I9NA 4RQTA 1L5KA 5JQWA 4ZZ3A 3EEIA 1T9BA 3KR2A 3RUEA 4B6JA 5EXPA 4REMA 2QTCA 3WYEA 3WZLA 1FS5A 5BUZA 3WQHA 4DCMA 1UKZA 2L0XA 1I7PA 1XWFA 3MAAC 4IQ0A 4F85A 4KQ9A 3S2FA 3RS9A 2QJFA 3C6QA 3U44A 1YUBA 3C98A 3ZE6A 5BSRA 1I2DA 4FXPA 4Q1BA 3UTDA 1BFDA 5BWMA 1OXTA 2IXFA 3IULA 1T0IA 3OPYB 4IXNA 1HMPA 4C4RA 2ROQA 1YO6A 3GGCA 4JB2A 3RU3A 3C85A 3SXUB 5JI3E 3EEBA 3KZ1E 2R5NA 1NR7A 2QRVB 3PE4A 3D7RA 2Y4OA 3DDOA 1C9JA 5AI4A 5I7OA 1NAIA 3JYLA 5EHNA 4OB7A 4JOCA 5L7YA 4XOIA 3S29A 5E1MA 1EK0A 1XQ1A 1UMKA 3LGAA 4FGUA 4D81A 1UJ6A 3HKEB 4YUXA 5ICGA 3EN0A 4MKHA 2QRMA 1FDWA 2N42A 4MZDA 4YCDA 1BX0A 2GVZC 3QWIA 2F1IA 4E2ZA 1REQB 1IN7A 1OY1A 3H6KA 2NUPB 5IEJA 1XTBA 621PA 3N76A 2WMOB 4L76A 1YL6A 2PAAA 2EG5A 1LTKA 1SG6A 3IDQA 3KD2A 4H59A 4JJFA 2C58A 3N8NA 3MHPA 4ZYZA 3AGPA 4NZZA 5LOVF 5E2IA 1OWLA 4FS3A 4CQLA 1L7BA 1MZVA 4Q3LA 4CVNA 2PGAA 3MJDA 3HXKA 2NZVG 3WYCA 4ARAA 1AV7A 2DWOA 2FH5B 2G36A 4CE6A 1JSCA 1CRPA 3M5PA 4DPLA 1RPTA 1GU1A 1T9KA 1UZNA 2PVCA 3RBZA 2D1TA 1GDDA 2BH2A 2EYQA 3PLRA 2XQKA 5FEMA 3T5MA 3UFBA 1NAHA 1HR0B 4CM8B 2QUBA 4YJ3F 2EKZA 1KZHA 3GRZA 2ICAA 4V1CI 2IOHA 1TJ5A 1MG5A 2ZRMA 5FIUA 3C87A 4ZT5A 1LUAA 2HY7A 2PKWA 2VVTA 3AZQA 4M1MA 4Y8VA 1PFQA 2R8ZA 5AUPB 1KAQA 3T7SA 1JEQA 2ODAA 3MD9A 4Q16A 1XTTA 4JVSB 2P9FA 4HR7A 5ALDA 1VJ1A 3WRYC 2E6UX 4ZHSA 1CIPA 1CRLA 3BCRA 2P6UA 3C74A 4NG5A 2E3JA 2QRUA 5HIMA 3UIEA 4CF3A 1CQIA 1JXMA 1JQBA 1XV5A 2C7VA 1HYQA 2Z08A 1GZ7A 3CLTC 4Q21A 2AH5A 3K0FA 2EW8A 4BO2A 1QO7A 5AW3A 4ZI7B 5TLSA 1IIBA 2C9BA 1I36A 1TAHA 1Y5RA 3NUZA 3X1MA 2HSEA 3R0VA 4LDJA 2IYNA 3V32A 3CCCA 4AVYA 4EY3A 1P3DA 5FLXA 1WMBA 2H1CA 1SK8A 2VC2B 4MVWA 1XDWA 2XT9A 3N0TA 3O8QB 3ZWXA 1YQDA 2W2QA 3IS3A 1ECJA 1R8JA 1V37A 3PWTA 4G4GA 4LE2A 4YCBA 5C8ZA 5KOHA 2VSFA 1FU8A 5AIBA 3BPSA 4R3WA 3EF3A 1RCUA 1NM5C 4H6XA 3BYZA 4ZTUB 5JRDS 2X77A 4MV8A 4B3TB 4RD0A 1RXCA 4PRZA 5ESRA 3M89A 1FP4B 2WFMA 2YMPA 2PKQO 3OIUA 4Q4JA 3B3QA 4QVKA 3WNBA 4WBNB 3EXIA 3HJBA 3I04M 1BDJA 2XHEA 3FHOA 1RI3A 4HFNA 3EDOA 5AVJA 3KOUA 2FSSA 4IMRA 4QBGB 2ZAYA 4MDFA 1YBFA 2I7VA 1JIKA 1AKTA 4BB5A 4YLYA 5KQRA 4ZO6A 1K27A 3ZWWA 1I32A 1E4EA 1UEXC 1WF6A 2QE6A 1K88A 2JAOA 4EBFA 4CKWA 3RYFB 4K9MA 2GK6A 3G23A 4PRLA 5KDOA 2LE0A 1WXWA 4BCDA 5DTJA 1CXZA 4BFYA 3P96A 5HIKA 3ZD6A 5F7JA 3TFWA 3U2QA 1E2IA 1NF9A 4IIEA 2QI9C 1TI7A 3R3HA 5IJ0A 1LBSA 1SZCA 3E7DA 2IV2X 4F4UA 3AERB 1U3TA 2IYWA 2WVAA 1FVXA 1QGYA 4MP3A 2E85A 3PHLA 1NRJB 1XALA 1GQ2A 2X0IA 1TUEA 3FCOA 3ULKA 1V4NA 4I14A 3R9IA 3HB4X 1O03A 4IAOA 4W5HA 2B9EA 2PX2A 3VMFA 3PQ4A 5A2GA 4WXEA 1TIPA 1GITA 2YZ7A 3AIKA 2LPMA 2DSNA 2PVPA 1VDMA 3CO5A 4HL6A 2IHZA 2UUOA 4KQXA 3NKFA 2LR0A 4H31A 4AZWA 3BXEA 4J0KA 4C4OA 4LHZA 2BTQB 4WX2B 3T9DA 4NICA 5KTYA 2F43B 4JKIA 5CCDA 3B7PA 1EH5A 4YVFA 3EQ9A 1E4YA 2GEVA 2UZ0A 2VDUE 8GPBA 1RXEA 2CFIA 1I33A 1Z33A 4QUGA 3HXOA 1TMOA 3OLCX 4ATNA 4G5RA 3TIIA 1ORWA 1KHTA 3T3HA 3Q40A 1GFZA 3DUWA 2J9FB 1JDZA 2OXTA 3K70B 3ZBUA 2HJHA 4KPUB 4LIPD 1NNEA 4FYKA 2ZSUA 2GKOA 3K31A 4HN2A 1NNI1 2WKQA 1A7KA 1H2XA 1XRMA 1K2WA 3UMGA 4QM7A 1B8NA 3CINA 3SM3A 2HA5A 4M9SA 4LKOA 1GKUB 4FFLA 5EE1A 3VTFA 2PJDA 1UAAA 3RJ9A 4X1KA 2XA9A 1PX2A 2JS7A 2WG0A 2XAAA 5D8DA 3TJMA 1CDEA 5C8DA 1IBLB 1AXEA 2GZSA 3IVCA 1O95A 5IFKA 3O4JA 1P91A 3CPJB 1USIA 4B8WA 3HLYA 4NOKA 4DWOA 1IY9A 1VJ5A 3CEAA 4AIRA 1DEAA 1WB4A 4YA6A 4FUQA 5EMMA 3PHIA 3H8WA 4KZPA 5MFZA 4N6GA 4E6EA 1HDRA 2IUFA 3OKCA 4RKQA 3LPCA 2BZSA 4ILKA 3IVRA 3NJ8A 4KI7A 4C14A 5FO0A 4OU5A 3JAKB 1CUDA 2F64A 4F4IA 2AKEA 2F59A 1LLUA 5C7OO 2YW9A 2O8EA 1O4VA 2GHIA 2ZBPA 3H2YA 4MQ4A 2CLFB 2YVLA 1KH3A 4JEHA 4AY4A 2UUAB 2DKNA 3DXYA 5AM0A 4LJRA 3STXA 2PUFA 3VNUA 1BO6A 4DRZA 2TMGA 4ZTZB 4WL0A 3M9XA 5ARDA 1QP0A 3K0SA 2D2XA 1GN8A 5A7GA 1DO8A 2Q2WA 2HZBA 3OQJA 5KYXA 4RV9A 5LXTA 1TJPB 2P2SA 3FZQA 2R11A 4URVR 1PYDA 1PWXA 3IERA 4BUJA 2QX8A 2VUIB 2X1LA 1LWNA 2E0IA 4PWZA 1LVHA 1ZVMA 2BMDA 2CLIB 2Q5OA 4NBLA 1N1DA 2H0QA 3TF5A 2X7HA 1LA2A 2Q8NA 3EF1A 1DRVA 1O6GA 2JGIA 2I65A 3L9WA 3OWHA 1TB4A 3N6VA 3PKZA 3QHPA 3Q3CA 4KWHA 5A9TA 3EG5A 2W90A 2WHXA 3UFXA 4E5SA 3NANA 3MNFA 4GLFA 5I9BA 4GR4A 4RTMA 3TECE 4DSZA 2ZRQA 5JLJA 1FDIA 1SB8A 5EE9A 1LPMA 2ADFA 3R7AA 3TX6A 5IBQA 4Z9FA 1VXRA 1U2QA 3I5YA 2DLCX 2X0FA 1X39A 3FOWA 3UZUA 1H2YA 3RV3A 3ND7A 1R6AA 3R1IA 5HTKA 1UOEA 2FZ5A 2XQIA 4GP6A 4N5MA 5C4MA 3T06B 1QP7A 3VU0A 4TKMA 13PKA 1O0SA 2PUHA 1GKYA 4PHHA 1VGRA 3KUDA 4K87A 1M6EX 3LVQE 3R5HA 2V7XA 1Q2XA 1X70A 2XUHA 3S68A 1KIFA 1Q92A 3QTLA 3WRXC 3T4PA 1WLYA 1EX1A 2F4NA 4M0MA 1II8A 2WE7A 5C5CA 3OEHD 5K0CA 3ESCA 2DG2A 4CETA 4L0DA 4XQEA 3WYBA 2PQ6A 1HDIA 3DQQA 4OFWA 1G6KA 4YAOA 2BGTA 3AFOA 1NY6A 4FR5A 2IP4A 4RVDA 4RDXA 3BIXA 4EHIA 3CVUA 1XMPA 2IOFA 1Y42X 3DBHB 3OQNA 4MCHA 5ALYA 2X9NA 4MWSA 1M74A 3WLOA 3O3NB 1XYYA 2GBIA 3N8DA 4YAFA 3NIBA 1PIWA 1JKXA 2YWDA 5FTWA 2JANA 3EA4A 3N3BC 4NOMA 1S7CA 1PGNA 5JCPA 3GJZA 3OZRA 1G38A 1GUZA 4GNRA 5IVDA 2W2NA 3L7YA 1U1EA 2D13A 1RYMA 4HNRA 1BSVA 4HYYA 5BV2P 1E2MA 3QEKA 4K40A 5EUMA 2A9KA 2AG0A 2BDTA 3V7UA 2CFRA 1I4EB 4GGOA 2VT6A 4QYXA 3E9ZA 2D3WA 3AJ8A 3LQKA 3BRWD 3H5NA 4CF5A 1X1RA 1KXZA 2DR3A 4CM1A 2HMAA 4IS3A 1L6IA 1AZTA 4C87A 1NUTA 4XRRA 4IDGA 4I3HA 3GJSA 3R6DA 3LLCA 2BFOA 4MUBA 4MRVA 4U9UA 4A3SA 5TRTA 4AM8A 2IXTA 2GB4A 4Z6KA 1IHPA 4KG7A 3BD8A 5ICSA 2JFBA 2Q9UA 2BUAA 3ECCA 2WU1A 1JKMA 3LQ2A 3UHOA 1XROA 1QO0D 4PTYA 5FOUA 5I01A 3ONNA 4ZT2A 5BNFA 3AEQA 4AZSA 3MJSA 3CC8A 2RH9B 1T5SA 1RW4A 2GD0A 4M88A 3CUWA 4NCKA 3DMHA 3Q7IA 1W96A 4XAQA 4JROA 3SE0A 1Q19A 4RLHA 2RB4A 3L0IB 5KKCA 4MLCA 4EPTA 4MLDA 1D2HA 4MRMB 4FFRA 3JR3A 2GHTA 1PUXA 3RRNA 1VRVA 4YI5A 1VG1A 1A69A 1RSZA 3CLSD 1KJ9A 3FYUC 3T3OA 4R8SA 1OX4A 2N0SA 3P5BA 4TXMA 4RVOA 3OEYA 1U99A 4I3FA 1M1NA 3TRIA 2JFGA 3A2MA 3OVMA 4LJ6A 4CTOA 4PQYA 2Q0HA 2DE0X 1CUWA 1QONA 4YHHB 1Z2PX 1XJ5A 4A1OA 9ABPA 1M66A 1QHNA 2Z0MA 2DT8A 4MUIA 3D6AA 3U81A 1TW2A 1QKKA 1PEDA 3I6BA 4OI4A 3AUFA 3F46A 2ZE5A 5M5BA 1J24A 4G01B 3CPHA 3T3EA 4N76A 1JBQA 1AQUA 4K88A 4GSLA 1L8XA 3F7NA 3CSSA 2H2IA 5K3CA 2PN1A 1S1MA 2WV7A 2JW5A 1KRWA 4TQ9A 1ESDA 4NQRA 5CD1A 1WRBA 3LLMA 5JSZA 5EUBA 4NCBA 1JFFA 3BK2A 3V1UA 4YLGA 4QT4A 4K7JA 1EESA 2V7GA 2ZUVA 1BWQA 2ZWMA 3G0BA 4KQFA 1WBBA 5AHRA 1TDJA 3KAPA 4GPZA 4BQSA 1VB5A 2ZJ1A 4ZOQI 2WPDA 1E2BA 5TVKA 2PSEA 2GEFA 5JMOA 4HEHA 1JDUA 1S0UA 3DMTA 1ENPA 4RTSA 3WYAA 4BRUA 2CJFA 2GZRA 4CLHA 1NVTA 1MC1A 4MV7A 1OGJA 3W2FA 2I1WA 2ANCA 1TCBA 4D8WA 1KMQA 5CBPA 5JFOA 3RK0A 1NONA 2GSWA 2Q21A 4A73A 5HOQA 1Z5ZA 2E48A 2EP8A 5IULC 1SH7A 3BKXA 5DB4A 5IAOA 4JXZA 3UPTA 1ZSNA 1V5IA 3BXZA 4Z7OB 4QUBA 3B2EA 3BUSA 2EKQA 2GD2A 2AEFA 1AOXA 1ELOA 3LDFA 3AFGA 3KQSA 4ZI2A 1W4RA 1R12A 2C0QA 2FSUA 3EOZA 1LLFA 3FCUB 2FZ4A 3F3KA 1P75A 2X5OA 3ADKA 1U6JA 3JU3A 3L40A 4IG4A 4TLLB 4MJLA 1TE2A 1H1LA 1D0SA 3PC8C 2NO6A 4TVSA 3TLEA 1W85B 4GMGA 2AJCA 3BH7A 4QG3A 2D54A 2PU7A 2VCYA 1R4NB 1FUYB 3LA6A 3TTVA 3HR4A 3VYSB 1DRJA 3OPYA 4FZ5A 1R6UA 1N77A 1ZK1A 3LC1O 4FHGA 5INTA 1FUEA 1EDOA 2ZR7A 3DT8A 4EHDA 3U4DA 5FI5A 1G7SA 2VAMA 3PP8A 3VDQA 1NLMA 1SXHA 5U4QA 4R40A 3SXUA 1Z17A 3V4OA 1P3JA 5BSWA 2XUZA 4AQYB 2HRRA 2QRVA 4IJ5A 1XJCA 2SKEA 1T9CA 3IXMA 3ZQJA 2FRDA 2IYRA 5KHOC 4S0ZA 2P6OA 1L7QA 4N6NA 1E5TA 3M6WA 4WXPA 5CPBA 4EHJA 3SVLA 1CULC 1ZMBA 4X8HA 3V97A 3PPYA 3DHWC 1P1RA 4UMVA 3PEWA 1QRTA 3A6JA 4IWXA 3WMRA 1JE1A 1JIVA 1V1MB 3HKEA 3PFKA 3V4RA 2O8VA 1FUUA 3HC7A 2YJ5A 2IUYA 3JASB 3PD7A 2O0JA 1V2HE 7ABPA 3VNSA 1FNCA 2GUWA 2GD1O 2IGTA 3U09A 4ILEA 3WZ2A 4PZDA 1REQA 5K0TA 2NUPA 1QCCA 1V9CA 3SVZA 3A1DA 1M33A 4QOSA 4RD2A 2X14A 1IXKA 2W6JD 4ZVQA 5D7BA 1COZA 2BGGA 4B79A 3LWNA 3DOJA 3V3TA 2PGNA 5C7YA 3IMFA 4BYMA 1X1BA 3OC6A 2QMUA 4FMDF 3EQ2A 4GVLA 3ZOKA 3HLKA 3H9BA 2AGVA 1UMCB 3NQ41 4D8YA 1KVTA 4FEAA 1U11A 4YQFA 2I2BA 4M8IA 4CM8A 1KI7A 2HA4A 3KC2A 1PQYA 5E9JA 5HWSA 4Z4GA 4QARA 4GIBA 5EQDA 2B8TA 2ZIAA 5MN5A 1TW3A 3TBKA 4BIIA 1IU9A 2VYNA 2FPUA 3RJTA 1ZJYA 2Q3BA 2GCGA 1JJBA 3GLTA 4HKTA 4RZUA 1V2GA 2DHRA 4AF8A 2NTVA 1RWNA 1GGFA 2X9GA 1VJ0A 1HE3A 1Z0SA 4I7EA 4LI0A 4R7ZA 4YDRA 2YDYA 5HS4A 5B3LA 3GOHA 2V7VA 3EGWA 1LW6E 3D6TB 1PZGA 5ALOA 5HZKA 3SK0A 3I9V6 4PFSA 2RDMA 5KQPA 3AHGA 4FBLA 5IAEA 2V7QD 4W99A 1XVIA 3ZTYA 5IPFA 2F8MA 2OHVA 2PSHA 4ZI7A 3S70A 2ZZKA 1FFAA 4KE6A 3OZSA 1HE1C 4U8GA 5L3ZA 4WACA 1FDSA 1PJRA 4GPD1 1W2HA 2P9HA 4ZYUA 3USZA 5C7LO 4ZT6A 2A86A 2A58A 1UT6A 4C5BA 4CDGA 4FX5A 3QG5A 3D3WB 3GT3A 1CRWG 1JQJC 4NOLA 1U3CA 3O8QA 3P9CA 4JXKA 3TNDA 4BCCA 1TEXA 4KYTA 3EOAI 4D6YA 3FNQA 4IDDA 2R8PA 3G9ZA 4F5EA 1V8BA 2XUQA 4GKJB 1VBMA 2BM0A 2WYUA 4LZWA 2MYPA 3TMKA 3QJYA 2PXXA 1JT2A 3P2OA 4AYTA 2O5EA 2EOAA 2XRYA 5J58A 1M0SA 4RY8A 2O1XA 2M1XA 1FP4A 2OFXA 5DX0A 9LDBA 1S2OA 1EAMA 3MILA 4WBNA 1HO3A 2OSVA 2VQEB 1N6RA 2O2IA 5IAAA 3CF0A 5BVGB 1LK7A 2HSJA 2YXDA 1ZW6A 1Q91A 3V7YA 5KDDA 5B1EA 5I9TA 1Z37A 3M8KA 4CV2A 2J33A 4TL7A 3T1OA 4UARA 5AQEA 4EPVA 1BEZA 3O8CA 2HK8A 4C4TA 2GVDC 1KMNA 4C0SA 1P1JA 4KACA 4BO3A 4EKIA 4IX1A 4QGFA 3PGA1 1GUAA 3FW1A 5KNDH 1XNGA 2JFOA 2Q27A 3JQEA 5LZ9A 2FMFA 3UUGA 3QFTA 1Y3FE 4JLNA 2VFAA 2GM3A 4UVDA 3W5CA 3AERA 3IODA 2D2VA 3DLAA 4OMUA 3VQTA 1MGOA 2XWBF 4BDSA 2AW5A 4TWJA 4Y18A 1D2EA 4CNQA 3CF2A 4S1WA 2NUBA 3GVPA 4C01A 2W00A 1QHSA 2PKEA 5D85A 1L4KA 3L4BC 4ISCA 3T38A 2QXTA 2FPRA 2C0PA 4AECA 1YE8A 1EIWA 4KNVA 1G8KA 4OXQA 1FJGB 1K6MA 1VCIA 3O21A 1X0VA 3H3JA 1GRVA 4YXWA 5A3SA 10MHA 4HB2A 1NT2A 2BMJA 4BYGA 4I81A 4R9SA 3LT0A 1HFWA 5CDUA 1PGQA 1Q15A 1M34B 2BTQA 3H1PA 5HBRA 2F43A 1X42A 1QTQA 4RJIA 1PWYE 1MN6A 4RCYA 3TUJC 4F3KA 2PV0A 3OU6A 2FMKA 4OKIA 1HNNA 1QGUB 4JDPA 3HKCB 2Y0EA 3SP1A 2QQGA 2PCLA 3EIOA 5TMBA 2A9PA 1YQXA 2JVKA 1SOMA 2JGKA 2XZLA 4CF6A 3GD7A 2P41A 1WQ1R 3O3OB 4KPUA 1N4DA 3F4KA 1KDZA 4BJ5A 2BZ1A 3FPHA 5U1PA 3QVLA 2AF4C 5L7TA 2NV2B 5K6AA 4QEKA 1FMJA 4DLLA 1W44A 4MDHA 2L19A 5K8IA 1SVSA 2HSDA 2O1EA 2XYRA 3JCZA 4GW3A 5AMXA 3JV7A 3LDAA 1FVOA 5KNBD 2GEKA 1M2JA 5JCXA 3TDMA 3JYPA 4KWCA 4KXLA 3AVWA 4YONB 4KIWA 1WM1A 3G59A 1CQJB 1P2DA 1JR3E 4FMBB 4RMGA 5IDVA 1ZFNA 4RH1A 5JJBA 1JAXA 2DMRA 1O9HA 2IOQA 4W8OA 1DMRA 1NFFA 3CH6A 4RHXA 3VR3D 3PCTA 3AKYA 1LQTA 3V1YA 3B7GA 1DFGA 4K3UA 3AVXA 1PJ8A 3RO7A 1LB1B 3HYLA 4G8JA 5BV8A 1XDDA 2FEWB 3QZUA 1RMTA 1N1MA 4AMVA 3JAKA 3I76A 4BVAA 1D6MA 3I4CA 3BK7A 3L18A 3LP6A 3JZMA 2P65A 1I30A 2J8ZA 3LUPA 3VR6A 1ZI8A 3QPDA 1QRSA 2HMVA 3L4JA 1AA6A 2V6IA 1Y6JA 2CNOA 3D59A 3D8HA 2P3SA 2H59A 3JQ9A 1P19A 4H1TA 4MA4A 4OQ4A 4TLMB 4QGBA 4OUDB 2NW6A 2QTHA 3VC2A 1VLQA 3OCCA 3ZEAA 3K5IA 5BRJA 1X92A 1XIVA 4K05A 3DOOA 3FNHA 1BZYA 1XP8A 2Y0CA 4PGMA 1Z0FA 4JUAA 4XVHA 3VVBA 2ZR8A 3ASYA 3TUZC 4E33A 5FR2A 1SZJG 3MQ4A 1E79D 1RR6A 3DZ8A 5FL3A 2C59A 3RTDA 1E3SA 1ZJ6A 2GZMA 3ICCA 3BBLA 2X6RA 1L8OA 1TK2A 2Z8XA 4CIAA 4ND6A 1AKNA 1RHKA 2V7EA 1FSPA 2R6FA 3WKDA 1US8B 1O94D 2V6JA 4ALLA 3ZW8A 2I7DA 5C5EA 1RXWA 3TIFA 5JNTA 2D0OB 1FFWA 3KELA 2JCVA 1JHDA 1UL1X 1U81A 2VBFA 2ZQ5A 3C7DB 1GNPA 1PNRA 3D6MA 2CMKA 2Q1UA 3B1KA 1WEKA 4REOA 3ZXYA 4MUMA 2IELA 4Q47A 5EZQA 1MX3A 4TUYF 4JI3B 3BKWA 4DQVA 1QWOA 1B73A 5BN5A 4YV7A 2P35A 3AUUA 3JVVA 4KMMA 4LTNA 1M2GA 4NF2A 4GL2A 3CRZA 1Z7EA 1N2EA 2COKA 5F5NA 1AKYA 1H9CA 3WP0A 1ISPA 1RPNA 5EIHA 3OEHA 3NCHA 3WAGA 1MB4A 2AG6A 3U4CA 2DYKA 1G3RA 1MOZA 2PSJA 2Q4BA 3GK3A 1ZK0A 4MSUA 4Q3EA 1SPXA 2JA2A 4BNLA 2JNWA 1EGVB 4LJAA 1UPXA 1Q7RA 3TZEA 4KXVA 3DBHA 2WF9A 4UBJA 4ARZB 5LQRA 3RTCA 5B30A 5AI8A 1ZH6A 1YC5A 3FY4A 1U0GA 4EVIA 2HQOA 2WG2A 5DYNA 4GF5A 1XT6A 3P9NA 3H6GA 3P5SA 3IBCA 5KTPA 1DDIA 2IEGA 1KA9H 4BZXA 1JFTA 1RQLA 4HNGA 4UW9A 2R8XA 1EHYA 1P44A 2UDPA 4HB4A 1NXSA 3M5CA 2WU8A 4KQIA 4GE0A 4RPHA 5IZCC 2P6RA 3HSSA 1CDOA 1DKUA 3G0GA 1NWHA 3LDUA 3UKDA 4ZZ0A 1EWVA 4G0XA 1MRZA 3G5LA 2EKPA 3H0EA 1NX6A 4UNSA 3SNHA 3WI7A 4TTPA 4JELA 1EM6A 3BRWA 1YZLA 1CPYA 3NUGA 4YBZA 4EM6A 5A5GA 3FHCB 1J8VA 4BFZA 4NMLA 4U2FA 4JEIA 2XEXA 2CYBA 4JVMA 4TV9B 2QU8A 1JH8A 3W9BA 3GA7A 1LPPA 4W9NC 1TQ6A 4PLYA 4QNRA 3ENZA 5B3JA 2VPIA 3CS3A 2E9SA 3KBOA 4FILA 3AJEA 4UDNA 1E0AA 1NHGA 4IOJA 4ZPXA 5ECWA 3PGLA 2H07A 5JZ9A 1UBNA 4OH1A 1I4LD 1DC7A 3EC7A 3WC4A 1JDBC 1ABFA 4E21A 1QO0A 1VYTA 3BDAA 3LUJA 1YZNA 2VDQB 3BMNB 3FGOA 5CVTA 2XNDD 2IYVA 5A5EA 3NDPA 2AQIA 3GR6A 4MGHA 1UC8A 5G02A 4QQRA 4CQMD 3TLAA 1OYWA 1TEZA 4WJZA 4WASA 3WBJA 5I4BA 4PHFA 3QPUA 4CQMB 4D02A 3R8CA 3FNRA 3LK7A 1QDUA 4MRMA 3IURA 1YI0A 2FCRA 2MWMA 1CG6A 1D04A 3RS8A 3RYIB 5I8PA 2GM4A 2IYAA 5KTTA 1JU9A 2QD5A 1AGXA 2PWPA 5DV9A 4FFMA 3T35A 1CUJA 1H2FA 1WW8A 4UNQA 3HXMA 2ZI6A 1IEWA 2A9FA 1B7GO 1OLOA 2WTBA 4ZVVA 1DOAA 2LNDA 1QUEA 4EO9A 2GYUA 3O93A 3WGUA 3HXTA 4UBLA 2MSEB 3A9UA 1T1SA 3SC2B 3SLKA 3VAYA 1OFIA 4ZO9A 1UF9A 1W9HA 1ZGCA 4LJ4A 2XEDA 3M0EA 4FDMA 4AJ4A 3ED1A 2QT0A 1Z8HA 1VPEA 5LL6P 1USKA 3U1BA 1LK0A 1FTWA 2FMUA 3ZW9A 1GAQA 4TXLA 4D4IA 4L4SA 5EP1A 3Q3EA 3K4QA 5YASA 1SC4A 1KSFX 2J0SA 2FR0A 2VCEA 3A9VA 3CE9A 2WSYB 5EJ5A 2FV8A 2FF5A 4JAVC 1H1TA 2J3KA 3BMQB 1HOTA 3CR8A 1FMTA 1IZYA 1DBQA 1H4TA 1T9GS 3KJZA 3M33A 4LZPA 4TSFA 1YVPA 4C6HA 4IDFA 5GJCA 1HLGA 4QU0A 1IMOA 3NCTA 2VJLA 3DLPX 3NOXA 3PPWA 2Q3JA 4CR7A 4GQIA 1YB7A 4BNGA 3B6JA 3N7TA 1OI4A 2QTAA 1FQWA 4NJOA 1IONA 3A6DA 4MH0R 2BFFB 2D00A 4CCWA 3K5PA 4YMVA 5KJ6A 1LI5A 5JADA 2ECQA 1HE2A 3GAZA 3QQ5A 5A4MS 3ANNA 2O3TA 2R2AA 1TFUA 1AXRA 1JVSA 3DDCA 3H4MA 4JVLA 4OXRA 5A7HA 1KS2A 2OQ2A 3ETNA 4NNJA 4DSOA 1PUIA 2DCUA 1E2DA 2IDMA 3TD6A 4EMUA 4OOFA 3U31A 2QIOA 2GPBA 5EAIA 1GA6A 1X8XA 5HZHA 4G9GA 2JH8A 2A9VA 2G82A 3AB7A 2VXBA 5JJCA 3NG1A 3DB1A 4DUPA 2H8GA 1UFOA 3O82A 2EQAA 1W85A 3Q5EA 1RBMA 3A6FA 4FMCB 5IP5A 1AN0A 2O2XA 1R4NA 3KXPA 2VIIA 1ORIA 3AMVA 4IFIA 5E95A 1NTOA 4ISBA 4J90A 3ZU2A 1UMDB 2QNRA 2FK7A 4QM6A 2IUUA 1DELA 3M6VA 4TMTA 4Y2QA 3FRHA 1PVDA 3CH5A 1H42A 1NLUA 2R8YA 4FI3F 1NVWQ 4N7BA 4LF5B 3PHBE 5LIPA 2BELA 3NNNA 2J9YB 3W7BA 1RRFA 4JLBA 3QX9A 4HDNB 4PXSA 2H17A 2CWDA 1T8PA 3KAQA 5KC8A 1UOOA 2NZXA 4JSRA 4ACBA 1TJ4A 3OCYA 3NTUA 1E5DA 1V1MA 2RGCA 1XU9A 3AKCA 3U60B 1NMSA 2IBMA 4E2XA 2NOAA 3JASA 3JQQA 4HY3A 4MI9A 5LLTA 4JV5B 4OQZA 2JIRA 5EZYF 4Z4CA 3MWKA 3OX1A 4G85A 3AKZA 4Q9IA 2PZLA 1T9GR 3C41J 2GR9A 5IKPA 4HLQB 5K6RA 1OU4A 1Q84A 3Q12A 4FP9A 4HOYA 2EIHA 3DVRX 1KRHA 4W7SA 1UKYA 4PNHA 4RTRA 5KYGA 2W6JA 3R5SA 2HT1A 1MPXA 4KEAA 2QX4A 4FBMA 1OE0A 4EI9A 5BQOA 3MN1A 2WWYA 1JW9B 2VJPA 4BVLA 5KTRA 1UMCA 2IEDA 2WHEA 1IQUA 3A06A 3PNKA 4G5GA 4X5OA 4XUCA 3V7WA 4CDRA 2C54A 1BTOA 3V8BA 1JG6A 1AS2A 3K2IA 1LTHR 4WKOA 3VAAA 4ARSA 4WXHA 1YZHA 2J6IA 3KLPX 3CR7A 4PPYA 2DHQA 5F5XA 4JLKA 1FVFA 2PUCA 4N5NA 1QUFA 5CM2Z 3WKEA 4H1VA 2YVUA 3WOHA 5F4BA 3EIWA 4G25A 4F04A 2QT1A 4IH1A 3LTEA 1XNJA 3D3EA 3FN4A 3GLHE 4KWTA 4N65A 1C1DB 2OM2A 4KLRA 4K28A 3KU4A 1SXPA 3U3OA 4OP2A 2AFIB 4DLKA 1NQOA 1WVGA 4GXTA 4R8LA 2NO4A 2NP6A 1WKBA 3LVFO 5DM4A 5AUOB 2JLBA 2WKRA