3GHHA

Structural insights into the catalytic mechanism of cd38: evidence for a conformationally flexible covalent enzyme-substrate complex.
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
238
structure length
238
Chain Sequence
NRWHGAGSTADFQKIIQERCDTYTQTIRPGSRSRNCQAIRQAFMSAFISKDPCKATKEDYNSLINLAPPTVPCGQQVFWSKTKELAHEYAKRRRLMTLEDTLLGYLADGLRWCGEPGSSDLNIWSCPDWRKDCRTNYLSVFWEVLSERFAESACNTVRVVLNGSLENAFDSMSIFGRVQAPNLRPQVELEAWLVHDTGKPPSDSCSGSSIRKLKSILDGRNVKFRCMDNLSRDQFLQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into the mechanism of bovine CD38/NAD+glycohydrolase from the X-ray structures of its Michaelis complex and covalently-trapped intermediates.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
molecule keywords Ecto-NAD+ glycohydrolase (CD38 molecule)
total genus 81
structure length 238
sequence length 238
chains with identical sequence B
ec nomenclature ec 3.2.2.5: NAD(+) glycohydrolase.
pdb deposition date 2009-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02267 Rib_hydrolayse ADP-ribosyl cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.82.10 Mainly Alpha Up-down Bundle ADP Ribosyl Cyclase; Chain A, domain 1 ADP Ribosyl Cyclase; Chain A, domain 1 3ghhA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ghhA02
4E2YA 1HDRA 4QUKA 5JMPA 1RM5A 1X7GA 2P5YA 2X5OA 5HM8A 3JQBC 1GPDG 5EESA 4B4OA 4KTVE 2OXIA 3RJ5A 4L4SA 4UULA 4S3MA 4Z3DA 4PRKA 2PKQO 1T4BA 1YWGO 5EJ2A 2YJZA 2NV6A 3MEQA 1QYCA 2EXXA 2J3JA 4OHUA 3WGOA 4CQMD 3OQBA 2C0CA 1MC5A 2YW9A 4QT0A 2HUNA 5FI3A 1ZEMA 4NR0A 4DBVO 3NJ8A 1E7QA 4CQLA 4DRYA 3DMTA 4LMRA 5A4DA 3X2FA 2NVWA 5IZCA 4YWJA 4QXMA 4N5LA 2C54A 3Q3CA 1R0SA 1BG6A 5AYVA 1CQIA 5KNLA 2Q1TA 3C3XA 4MJLA 4XJTA 1EUCA 1O0SA 2X7HA 4MVJM 2IRWA 1PZGA 3H7AA 3NYWA 2YHUA 3ABIA 1EZ4A 3I3OA 3IUSA 2CDBA 2P2SA 4K6FA 5I9LA 1EUZA 4LRSB 3EC7A 3GMDA 2EP5A 1G1AA 1NWHA 4Y8VA 4UVDA 5BSHA 3WICA 5L53A 3TDKA 4JNKA 2V6FA 1H9AA 2EF1A 2IYOA 4AG3A 3ZW8A 4WECA 2CFCA 4Q3CA 2AEFA 1C1XA 1BHSA 3MJCA 1H94A 4AJJA 4CM7A 3DMTC 3I9NA 2QQ5A 3QWHA 4CM3A 3O38A 2AEJA 1J0XO 3VH4A 5F3RA 3CZRA 2PZLA 2R2GA 3U4DA 1P9LA 1NVMB 3WSVA 4IDGA 1ADCA 1UP7A 2WJPA 2E4AA 3BMCB 3PLNA 3D5QA 3FNGA 1HE2A 4N5MA 2FSSA 3PPIA 2EERA 4GGPA 2J3IA 3EGOA 1GEGA 4JCOA 2GSDA 1YDWA 3OJEA 1LSSA 3NJ4A 2DFDA 1WAMA 3F5SA 3GAFA 1HYGA 5IFLA 1PJTA 1YXMA 2VYNA 1QYWA 2J5QA 2HQ1A 4RL6A 1HZJA 4AJIA 1UH5A 1OFGA 3IKVA 2PZMA 2B83A 2F1KA 2FPGA 3PTZA 3I6QA 4MVJP 1LU9A 4PVCA 2HDHA 4G81A 4BO1A 5DCYA 4MIEA 4JK3A 1P3DA 5IXSA 2I66A 1NR1A 3WGQA 3TZCA 4BMNA 5TC4A 3JYNA 4FOOA 1GADO 4YA6A 4U6SA 3AI3A 4ZQBA 4D7AA 3D4OA 3WLFA 1XSEA 4KDEA 3I83A 3H65A 3OEWA 1CYDA 2PGDA 3VTFA 4R4JA 4C7KA 1N5DA 3VPFA 4GI2A 2HLPA 2ZB8A 3KYDA 3WX0A 4N54A 3ONEA 3COSA 4D3FA 5KIAA 3U3XA 4INAA 1DRVA 2WWRA 4DVJA 4X54A 2QZ9A 3P2YA 2HRZA 3NT2A 4ZQGA 1TA4A 3VDRA 1O6ZA 2HMSA 2FP4A 2JAPA 3PWZA 1OOEA 3FTPA 3OJ0A 4RF5A 2C2YA 1E1NA 1O94A 1V3UA 1B7GO 3C7CB 4HBGA 4WLFA 3VKUA 4E30A 3BTSA 2VTEA 3JCZA 4WLVA 1X13A 1TXGA 4RORA 1Y5MA 3VPHA 4YAKA 1O8CA 3AFNA 4IDBA 1J4AA 3LF1A 6ADHA 2FSVA 1J49A 3RU7A 3PZBA 3CSDA 3VH1A 4BGIA 4L75A 1LC3A 1EDZA 4MVJA 4BB5A 5T67A 4C7JA 5F1KA 3I1JA 4NBWA 1LRLA 5CDYA 4H16A 4J6FA 3HFGA 2VRCD 4NHEA 4N5NA 2PFGA 1MP0A 3BYZA 3H6KA 1QG6A 1JA9A 2GYYA 2NU7A 4CM9A 4CMCA 1ENPA 3GZ4A 1IUKA 1E92A 4YRDA 5JY1A 1QKIA 5TSDA 4RDHA 1H2BA 1BDMA 3FBGA 5DBGA 1A9YA 1N1GA 3OECA 2FY8A 1IY8A 4EUFA 4BNGA 5A03A 1GUYA 1Q1NA 4D0RA 4FB5A 2JHFA 1F8GA 2NTNA 7MDHA 4BB6A 4KUEA 4W6ZA 4E13A 3JQCA 1HE5A 4HY3A 3U4IA 1PWZA 1HE3A 2OL4A 3CMCO 3JQEA 3I23A 5A9SA 5MGBA 2Q4BA 1GQ2A 4WK6A 1NPDA 2DBZA 4NH4A 1YL6A 3GG2A 1R4NB 3OIFA 2B37A 2NVBA 1ZJYA 1VJ1A 1Y8RA 2Y1DA 4DMLA 3D4PA 1ENYA 3ZWCA 2HMUA 2CVOA 1F17A 2GN4A 3MJEA 1I01A 5F5NA 4CLRB 4QX6A 4BNWA 4KWIA 3OHSX 2FPPA 5JAQA 4J49A 4YT4A 1UP4A 1Z82A 1B8UA 3WIDA 3H3JA 3QSGA 2HSDA 1FDTA 3RKRA 1GTMA 3JQBA 1UXIA 3RC1A 3I4CA 3QWIA 1NXQA 5L7YA 1RYEA 3GZNB 3WR5A 3DQPA 1GYQA 3OF2A 1PX0A 2VYND 3UFXA 1WNTA 5HWSA 4EGFA 3HUDA 2VRCA 4Z9XA 2VNAA 3HFSA 4R69A 4DL9A 1EVZA 1E1MA 2XPCA 3E6AA 4NFSA 3VPXA 5I7FA 1MG0A 5CPBA 3ZN2A 4KUHA 4E21A 1I2CA 3ETEA 1E3JA 3GFBA 4UUNA 1LC0A 3JD0A 1Y6JA 4BOYA 3M1AA 1JN0A 2X9VA 3OEYA 1NX6A 2V6GA 1J5PA 3E48A 4D41A 1PR9A 4GX0A 4UUPA 4YYZA 4EYEA 4RDIA 4YB8A 3FI9A 1Y1PA 1BXGA 2JFHA 2P4QA 1I30A 4CV3A 5H82A 4NBUA 1LEHA 5DP1A 3V1TC 3FF4A 1GV0A 2ZCUA 1LJ8A 3RVDA 4AICA 3JQAB 1UZMA 2J6IA 4BNJA 3NDJA 3UUWA 1WZEA 3P7MA 3QVTA 2YDYA 1E7WA 1E6UA 2JHGA 1T2EA 3EZLA 2YUTA 5AOVA 4K9DA 5GMOA 4CM6A 3VDQA 4OO3A 2Q45A 3PWKA 5DDIP 4IXWA 2GN8A 1H0KA 3BMCA 4IGFA 3UOGA 2ET6A 3M2TA 3JTMA 3AM5A 1TT5A 2BFAA 2YDXA 1PS8A 1LBEA 3LC1O 4URFA 3TL3A 4A10A 2RH4A 3DBVO 4BNXA 4E5KA 4YR9A 3MOIA 1GQYA 3PEFA 3GY0A 1BW9B 1JWAB 4TROA 4B79A 3D3WB 3AM3A 3MJTA 4YACA 1ZZEA 1JKFA 1ZH8A 5KKAA 1EBUA 2CSUA 4FC6A 1BGVA 4M55A 3H8VA 1ZFNA 2J3KA 3IS3A 2JL1A 1XGKA 3Q6IA 3ZV3A 1KY4A 2C59A 3QHAA 1PQPA 1WZIA 3I9LA 1DRUA 2D8AA 4QFCA 2RIRA 2VUUA 2JCVA 2ZCVA 3BIOA 1C1DB 4NK5A 4RVDA 3ZNQA 2BGLA 2RAFA 4R9SA 4XB1A 4IXTA 5K6AA 1BMDA 1VSUA 2GGSA 2B36A 3DOCA 3QWFA 5B12A 4XDZA 3H2ZA 5JE8A 4CMEC 4KWHA 5F5LA 1Y9EA 2EP7A 2X0JA 4MDHA 1I36A 3K9QO 1CETA 5IDQA 3RBVA 2PKQP 2O3TA 1L1FA 3EZYA 3ORFA 1ZEJA 5G4LA 2UAGA 1GYRA 2D0IA 4HV4A 3IC5A 3HE3A 2ZK7A 2IEDA 4BGUA 3GVCA 3WWYA 5JW6A 5LDHA 1TI7A 1MA0A 4BO4A 1WP4A 2BRUA 3NGXA 3B6ZA 3ROKA 1P1IA 5ADHA 2WD7B 1NR7A 4DBZA 1T1SA 3LZ6A 4PZCA 4YJFB 1LDGA 1OC4A 3RI3A 1XWFA 1M67A 4PLZA 4A27A 5A3JA 1ENOA 4E5MA 1C0PA 3E9QA 4RPKA 1ZSYA 4YEDA 3ADPA 3ST7A 1YE3A 3JSAA 4DC1A 1LA2A 2E6UX 2RHRA 3GGOA 3K30A 1B3RA 1U9JA 3VHRA 2X1HA 1RKXA 4J7CA 3PIIA 5IJZA 2Y0DA 1IB6A 2BELA 3BTUA 4NJOA 2BD0A 3CXRA 4GVLA 4J1TA 4RF3A 2IZ1A 3TN7A 4LVUA 3CKYA 4PLWA 1TT7A 3DZFA 1LNQA 1ZK0A 2JCXA 2O48X 4RQUA 4M87A 2GUGA 1HDZA 1OI7A 1NAIA 3WFIA 1PQUA 1UJMA 2E48A 3L9WA 4DREA 3Q2IA 5F21A 4CM4B 1AXEA 4WE3A 4XJSA 3ASVA 3DTTA 3OETA 4MP6A 5KKCA 4LMPA 1LXCA 1TVEA 1YB5A 1EVYA 1PJ3A 1VKNA 4B4WA 2J5RA 2B4RO 3HDHA 5KJ1A 2O7QA 4OOFA 2I3GA 4I08A 3DZBA 3VZQA 1PSDA 2HK8A 5DP2A 3ZDFA 1Q7CA 4Y6RA 3TFQA 3TZHA 3GLQA 4YJHB 2VOEA 2C20A 3QJ5A 3QVSA 2P9CA 4RVHA 1ISHA 1P33A 3PGXA 2YFQA 4YT8A 2VCYA 4BO8A 8ADHA 1I5RA 4O63O 2VYVA 2Q2WA 4XD2A 3L6OO 5JDIA 3PYLA 4XWYA 3FN4A 3L77A 3PIDA 3PXXA 4R01A 2C7VA 3A06A 2ZTLA 1QP8A 3SX2A 4FGSA 1ULUA 1T4DA 4IIVA 3ZV5A 4BNNA 4DQUA 5CEFA 3PGJA 5EIOA 1U4SA 2GN6A 1G0NA 4NDNE 1NASA 1PL6A 4UREA 2TMGA 3H9EO 4ZN6A 1YL5A 3SVTA 1Z7EA 3R3JA 4YQZA 4OSOA 5C7LO 3ZV4A 4XGIA 2V6MA 4BGEA 1ONOA 1EMDA 4PZDA 2DC1A 4TQGA 4FOSA 3F6YA 3MWEB 4PVDA 2DUWA 5COAA 2ZTMA 5B37A 3NGLA 5KVCA 4EJ6A 1X1EA 3V2HA 4U0KA 1MUUA 1IZ9A 2IE0A 1KERA 1Y9AA 4WKGA 4BKOA 2X5JO 4IBOA 4YJGA 2AEMA 1E1LA 3INRA 4FFPA 2PTGA 4Z0TA 5G2OA 3WMWA 1KS9A 3C1OA 1K6JA 1RPNA 2J3HA 5JCXA 4MVJG 4L9RA 4ZRMA 4Z0PA 1QMGA 4CMEA 4PLPA 4OQZA 3ZH2A 3GRKA 3NTOA 3KEOA 4XYMA 2TMDA 4OKIA 2X22A 4JROA 3KSDO 4Y6SA 4M54A 1ZO8A 4TKLA 5CFZA 2UUOA 2O2YA 3A9WA 3E9MA 4YBZA 2BI7A 3E03A 1RM4A 4YJDA 4TRNA 5C7IO 5JAZA 4AL4A 4DA9A 2EGHA 4XRRA 1Z74A 4TMFA 2VWHA 2GDZA 1KEVA 4GGOA 3V2GA 3ULKA 5TS3A 2SCUA 4D0SA 1EDOA 3ZWWA 3SEFA 2PH5A 4F3YA 4PG8A 1D7OA 2X23A 4QQRA 3DAGA 3AI1A 1F8FA 4IS3A 4JLWA 5G4KB 4CUJA 3TRIA 1PZEA 2Q1WA 2VHVA 1XIVA 4HWKA 3BZUA 4IZIA 3DAFA 3MJVA 4H7PA 4MKRA 3KB6A 4Q3BA 4CMGA 1GDHA 3BA1A 3JQ7A 3FCOA 5I9MA 3PJEA 4FR5A 4XB2A 1XEAA 5BR7A 4UEJA 3KYDB 3FPCA 1LSUA 4OAQA 5IDWA 3AUUA 4FJ0A 3K5PA 1WDMA 4LW8A 3PJGA 2QHXA 3D3EA 5TIIA 2NU9A 3JQGA 3EW7A 3H5NA 4K28A 4FFRA 2I5PO 2O3RA 3KO8A 2P5UA 3ZW9A 3D7LA 2YHIA 1O89A 2E49A 1WWKA 3DL2A 4G2NA 1QYDA 4H3VA 4L4XA 4D43A 2G0TA 3HNPA 3ONDA 1MC4A 4E12A 4ZU3A 3TL2A 4PZEA 4E5YA 3GZNA 1DFHA 4MIOA 5L4SA 3DFUA 2O2SA 3HJAA 5AQ1A 2ZKLA 3KLPX 3Q9UA 2E37A 3G1UA 4IDCA 1ADBA 2QRJA 3DBRB 4TVOA 3L4SO 3SJ7A 5A1TA 1KEWA 5LCXA 1H9BA 2CD9A 4CUKA 3GN1A 1K5HA 3IAHA 3OH8A 3ZGYA 1NVTA 3RASA 5I9NA 4TZKA 3TOXA 4DYDA 1YQGA 1HEUA 3GC6A 4DPLA 4M86A 3VVBA 4AJ1A 3UHAA 3OSUA 4BNLA 1BXGB 1Q0QA 4BIIA 1HWYA 1Q7GA 4B7CA 4ND4A 1DIHA 4GBJA 4J7UA 3O8QA 1F0YA 5EQDA 1JVSA 4WNCA 5CDSA 1UP6A 2VRBA 3TFOA 4E33A 3OFSA 1EE2A 1SB9A 4UUOA 1EUDA 4GVXA 1KOLA 1PL8A 3K92A 3LT0A 1B16A 1N2SA 4CMBA 3PHGA 3PHHA 1HDCA 2YV2A 4L76A 1K2WA 4B8ZA 2V65A 3V1UA 5JS6A 2W2KB 4W7HA 4CQMB 1ZK4A 3DWFA 3UCXA 5TJHA 1X0XA 1WPQA 3PI7A 2H63A 2H6EA 1BTOA 1ULSA 4YJFA 4D79A 2IXAA 3DEYX 1GFSA 1T24A 1RM3A 4GSLA 4ALIA 1DXYA 3WIEA 1E3EA 2PZKA 1CIVA 3A1NA 2ZYDA 3S2GA 5AVOA 4MIYA 3RWBA 3K6JA 3RCBA 3H9UA 2WSBA 1ZIDA 4R16A 1PGNA 1ISJA 1OMOA 3AUTA 2EGGA 4JGBA 1AN9A 3V5NA 1GZ3A 3WBFA 5B4TA 1LLQA 3UICA 3FTNA 4R54A 4NFYA 4AJKA 3NUGA 3QLJA 4D45A 5EPOA 5L3ZA 5A3VA 5C7OO 4OSPA 1SZJG 2HJSA 5AXDA 5JPIA 1M66A 4ESOA 2X0NA 1E7YA 1YH3A 4BO2A 2FMUA 3RFTA 4ZQHA 1SBYA 3B1FA 4PFJA 1ZKMA 3U4CA 2ZQYA 1YRLA 2Z5LA 3WGHA 4PLFA 4CLEA 1I2BA 2EHDA 3E9NA 4H15A 2ZYGA 4BGVA 3PQEA 1GPJA 3RUAA 1J6UA 3FHLA 3VVCA 2Q4EA 2O50A 3WNVA 3VOSA 4CODB 1BSVA 1W0CA 3NRCA 5TLSA 4TVBA 5G0WA 1DFIA 1DHRA 1KEUA 2Q2VA 3QA9A 2I99A 4IUYA 4CPDA 3Q2KA 2I65A 1U28A 4IM7A 4EITA 2HO5A 2CMDA 5U9CA 4PIVA 5I7SA 1R12A 4DMMA 1GEEA 3R1IA 3OQ1A 2DTEA 4BV8A 5T8KA 2ZJ0A 5ICMA 3BMNA 3K8ZA 2ZJ1A 3F47A 4P8RA 3OA2A 4OXKA 2VQ3A 5JY6A 2CZCA 1A5ZA 3CINA 5IZ4A 2CNBA 4JXKA 1VRWA 4NIMA 4YAEA 1Y8RB 2OMEA 1A4UA 4P4NA 5DOVA 3R6DA 3SC4A 4CL3A 3W8DA 3IMFA 3KYCA 4YT2A 5L51A 1NPYA 4KZPA 4NFHA 1GD1O 1B8VA 1PQWA 3B1JA 3EMKA 2NSDA 5DCWA 1Q0HA 1T1RA 1MFZA 1MX3A 3JD4A 2D5AA 1R6DA 2DU8A 3FPLA 2YV1A 3DR3A 3ON5A 2OHXA 2R00C 2RBEA 2OBNA 2VUSA 2W98A 4J0EA 4ZICA 3RFVA 1I3LA 3PP8A 2WE7A 5IN5A 2O3QA 4LN1A 1JLLA 1JVBA 5DZSA 3KSZO 1E1KA 4IZHA 4FFMA 2OGUA 2BFMA 4LISA 1E7SA 2DLDA 4RVGA 5HS4A 3D5TA 1JAXA 1CWUA 1ZNQO 3DZIA 1BVRA 1EEHA 1V8BA 4QO7A 1YBAA 3UAGA 4CM4A 2VZ9A 4MP8A 4JBHA 4YVFA 3QY9A 1WW8A 3ZHYA 2LDBA 7ADHA 4P38A 2UYYA 1P44A 5ER9A 5C37A 3STHA 3NV9A 2Y1FA 4BL5A 2C7GA 1GUFA 4GX1A 3AM4A 4PRLA 1AHHA 3WDSA 4EZBA 6LDHA 4ZHSA 4XEHA 1PIWA 3DMYA 1DOHA 4ALMA 1CRWG 4Z3KA 4R1NA 4D44A 3E82A 1QSGA 3M2PA 1A72A 2VT2A 1N1EA 1RYDA 2CVQA 2WE8A 1VJ0A 3JQAA 1E77A 3RUHA 4FPXA 5GZ6A 5CEEA 1HE4A 5GZ1A 3JQ9A 5U4QA 5BNFA 1H93A 1R0KA 2ILTA 3R0IA 5GZ3A 3U0BA 4EW6A 4OMUA 4CM8A 5CDTA 1ZVMA 2NU6A 1H6BA 1LDMA 2WTBA 2X4GA 2IDZA 4EUHA 4IMRA 2GD1O 4RZHA 5G0TA 3C85A 2VZ8A 1U1IA 1T25A 2BGKA 1KEPA 3JQ9C 3HB4X 4TSKA 3HDJA 2H1SA 3VH2A 1Q0LA 3UH1A 2PGJA 5IAAA 4U6QA 3A28A 1YDEA 3OA0A 1MGOA 3DBRA 4XQEA 2OUIA 4BKQA 4CLHA 2NNLD 3DBLB 4I5DA 2NUAA 2UDPA 1NYTA 2B5VA 3JQ8A 1C0KA 4BO5A 4BO7A 4Q3AA 4LRTB 1B0AA 2AQKA 1NWCA 4L8VA 3KUXA 2AMFA 1YL7A 1V3VA 5LDGA 4DIOA 4GL4A 4HXYA 3GVXA 3EK2A 3Q11A 3AU9A 2A4KA 3Q0EA 3ICCA 1FJHA 1C1DA 2HMVA 2Y1GA 4YCAA 5G4KA 4LSMA 3C1AA 5TGDA 4BMSA 3KVOA 1D3AA 3EHEA 3OJFA 5I8WA 4BKRA 2BFPA 3FNEA 1UDCA 1WMAA 1YB4A 3WXBA 4Z0HO 3LLSA 1U2DA 2JFGA 3GUCA 4WLOA 2FPIA 3GDFA 3CUKA 3DFZA 3DB2A 3L6DA 1R66A 1MG5A 4KOAA 4XDYA 4P4GA 5TX7A 1KVRA 3CE6A 5KWEA 3RUEA 4I5FA 4BO3A 1PZHA 4J7XA 2A35A 1U5CA 2PKRA 4IQGA 4MPDA 3CMMA 2VHXA 3U62A 3KM0A 3WG9A 3HWRA 3GEDA 3LU1A 4HUJA 5I8ZA 2NWQA 2ZB3A 3OICA 1H6CA 3LT2A 4HFMA 2HAEA 3PJFA 3ZWVA 3B20A 4XGNA 2AQHA 3S2EA 1YB1A 1U4OA 3AI2A 1ORRA 4RPGA 4E31A 2PD3A 1K0UA 3ROQA 3UGKA 9LDTA 1U7TA 3HG7A 5A05A 3WQSB 4DLAA 4XCVA 3P2OA 2FR0A 1YBVA 5EERA 2CF5A 4I5GA 3PFFA 4Y98A 4AFNA 4DUPA 4FFNA 1R0LA 3ADOA 1HDGO 1XQ6A 5K0ZA 2Q50A 1BRMA 1T2CA 1U8FO 1SC6A 1YS4A 5BNTA 2CF6A 4HKTA 2I6TA 3HDQA 5CHEA 5HBRA 1B8PA 3EYWA 4DWVA 1DC4A 3ZWNA 2Y0CA 3TJRA 4DXHA 4FCCA 4UVIA 1HSOA 3IKTA 4FDAA 5KJCA 2QW8A 3PQFA 1GUZA 1PR3A 1LLCA 4DLLA 4W99A 5JFOA 2DTXA 1DDOA 2HK7A 2WYVA 2GR9A 3HZZA 2PLAA 1HETA 3I52A 1M6WA 1XA0A 2XF8A 4O5OA 4JJIA 4A7PA 5KJ6A 3BAZA 3G49A 4WUVA 3EVTA 5A9RA 1IE3A 1TB4A 4MP3A 3ZU3A 4E5NA 1FDUA 5COQA 1P1HA 1PGOA 3NTRA 4BNVA 3V8BA 1C0LA 1I8TA 1PGJA 4FS3A 4RPJA 5BQFA 4XR9A 5KVVA 3ENNA 1XKQA 5DCUA 4BNTA 1VJTA 4W9NA 3C8MA 5DF1A 4BO9A 1NBOA 3DONA 1KC1A 1F14A 1X7HA 3RUCA 1VE9A 4GLOA 1IOLA 3NAQA 3O8QB 5BSEA 2HK9A 1E7MA 5CPFA 1XLTA 2GO1A 4UAGA 3H3FA 4BKUA 4UUMA 3RAJA 2B4QA 2DBRA 5COBA 3E5RA 4CLXA 1G6KA 1WDKA 4DIBA 3MOGA 3I9MA 4TRJA 4J1QA 4GKBA 1XR3A 1VM6A 2X9NA 3JQDA 3WTBA 3ZWOA 4M8SA 1VSVA 3QRWA 3GQVA 2X58A 3GG9A 2I3AA 3WGYA 4NBVA 4PLGA 4YAIA 5CAEA 1DLJA 1MXFA 3U9LA 1B3BA 1GAEO 2GRAA 3U09A 2P9GA 2W2LD 4BNUA 1K6XA 3L6EA 4OH1A 5ILGA 2DAPA 3TQHA 3HB5X 4R3NA 3LYLA 1C1XB 2WMDA 1CQJA 3GF4A 4KDFA 5CEJA 4IDEA 3VH3A 1BXZA 3MTJA 4FD3A 4WNIA 3L9XA 2DFVA 5BT9A 3D4NA 3JYOA 2Q2QA 2Y1CA 1M76A 3BTOA 1HTBA 1HF3A 2UV8A 5EL0A 3ZHBA 4RGBA 4KQWA 4OIMA 3RJ9A 3W4IA 4QEDA 1UZLA 1Y81A 3C7AA 4PCVA 1OBFO 3KETA 1PS9A 4WCFA 1W4ZA 4ONEA 3DOOA 1HSZA 4MVJE 3PHJA 4DTIA 4KP7A 1Y8QB 4NNJA 1DC5A 3JQFC 2GZ1A 3PDJA 5A02A 3TSCA 3OP4A 3W1VA 5TQVA 4HX5A 4WCFB 1OZAA 1EK6A 1ZK2A 2VUTA 2Y05A 4Z9YA 3QVOA 5AXAA 3ZNOA 3BMNB 4E32A 3QP9A 3JQ8B 4GQAA 2EEZA 3PYXA 3PYMA 1IZ0A 5CG1A 3T4XA 2IYPA 3HADA 1SMKA 2Y99A 1S7CA 4JP3A 4YDRA 3KRTA 3GEMA 4D3SA 3JQ6A 5A9SB 1IULA 2YQ5A 4AVYA 4QTZA 1MB4A 4ALKA 3RSHA 1E6WA 3RUIA 2LDXA 3VC7A 1N7HA 1BXKA 3WTCA 5FI5A 5KVQA 4J4HA 4K1LA 5DOZA 3SC6A 3AOEC 2B4TO 3KHUA 4AJ2A 4ALLA 4YPOA 2E82A 2ZYAA 3JD3A 2RCYA 5U1PA 3GA0A 4I8XA 3NDRA 4TWRA 2NU8A 5MDHA 3QVWA 2Y68A 5LC1A 1DPGA 2WYWA 2OO5A 4TRRA 3PVZA 2IZ0A 1EBFA 2VYVD 3W4JA 5KCZA 4Q9NA 1T26A 2NM0A 3AFMA 1R16A 5JLAA 3W4KA 1ZMTA 4RLHA 4OQYA 2ZIZA 3AW9A 5A04A 4J0FA 4J43A 1IHYA 3GVHA 1DBVO 2GZ2A 3K96A 4K26A 3BXXA 2D4AA 1DIBA 3MCVA 2VWQA 4J2HA 1DIAA 5T64A 1SEPA 2HKIA 2VNSA 1A7AA 1KBZA 1YKFA 4NBRA 1DC3A 1VPDA 4L73A 4M1QA 2EKPA 1D4FA 5JDIC 2C5EA 3PHIA 2QYSA 2ZTUA 3H5RA 3PK0A 4HFRA 2J5KA 5CDGA 3INTA 3DBHB 3OIGA 1JWBB 1XG5A 4GKVA 3KTDA 2HRBA 1IPFA 4RCVA 4ILKA 2BLLA 1I0ZA 1N92A 3WFJA 4NK4A 4B7XA 3I9OA 1HYEA 4N18A 4NU6A 3JQAD 1P1JA 3ASUA 1DSSG 4UEKA 4ZQFA 1IYZA 3VTZA 1YJ8A 3AY7A 2EKQA 3GEGA 1GR0A 4QSMA 4R5MA 1Y7TA 2WM3A 4GMGA 3NT5A 1WLYA 3VPSA 4QFDA 1WMBA 5KOIA 4B3HA 3OM9A 4FC7A 2GZ3A 1XELA 1YVEI 4MVJH 4E3ZA 4YXFA 1PS0A 2FRDA 2VTDA 3F1LA 2UVDA 4AJEA 1ISIA 2AA3A 4NZ9A 1Z7BA 3B70A 1D8AA 4E6PA 3W6UA 4KQXA 1QYVA 4CLOA 5L4NA 4RF2A 4A0SA 4XKJA 4WOJA 3SLKA 4XYLA 4JJFA 1T2AA 4E5PA 3JYPA 4KTTE 4ZRNA 1KVTA 1KC3A 4W7IA 3B1KA 4CUZA 1JTVA 1K6IA 1Q2XA 2IODA 2A9FA 1A7KA 4EI2A 3GNTA 3IJPA 2G1UA 4CJXA 1U3UA 1F12A 1QYXA 4R51A 3L0DA 3UCFA 1E3WA 3KXDA 3LK7A 1UDBA 4DGSA 5HRUA 4YRBA 4IMPA 2PV7A 5G0VA 2EJWA 3WJ7A 4IINA 1M2WA 3JQFA 1RJWA 4WEQA 3PQDA 5CDUA 1X1TA 1AXGA 3KYCB 2EKLA 4Z9FA 3VPGA 2D59A 2HU2A 4NU5A 4R1TA 4B4VA 4FQ8A 1HDOA 4HFJA 1BVUA 5DULA 3IOYA 2ZATA 5JYDA 4RVFA 1AGNA 4CV2A 3G17A 4CMAA 3ZNPA 1FXSA 2C5AA 3EY4A 3DZHA 2EW2A 1HDXA 3WOHA 5KJEA 2YHIB 4L4RA 1QRRA 3DHYA 4XYGA 2W8ZA 1JKJA 4N7RA 5JAMA 2DBQA 1ZK3A 3ENKA 1E3LA 4IPTA 3KYBA 4Q3EA 4FGWA 4JIGA 4XR4A 1GZ4A 3INGA 3QIVA 5K6AC 1O9BA 3MZ0A 5K9ZA 2WDZA 2Y66A 2IXBA 1NAHA 3K2BA 2B0JA 1EQ2A 1MLDA 3LSYA 4GH5A 3A14A 1RM0A 2RH8A 4XQCA 4IS2A 2X0IA 4JBGA 4PLYA 1DEHA 4F6CA 2X0RA 1XU9A 4ROSA 5JC1A 4WPGA 1UR5A 1YOVB 2A94A 3VZSA 2H5LA 3WQQA 4A26A 4CMKA 4HP8A 1DJNA 2R6JA 3GVIA 4GPD1 1HL3A 2ZB4A 1X0VA 4CMIB 5FWNA 2O4CA 3C24A 4BQRA 1HXHA 4IIUA 2GASA 1U3VA 3IIEA 4I5EA 1U5AA 4LVCA 4LK3A 3G79A 3EUWA 3ZWMA 1SB8A 2GN9A 3WSWA 4FFLA 5DNAA 5TJ9A 3S2IA 1L7DA 4ZGWA 1DC6A 1BW9A 5DBIA 4I1IA 4AJOA 1C14A 4I9HA 3AJRA 3AU8A 1MFPA 3L4BA 2NVUB 4XYEA 1Z45A 1RWBA 3WYBA 2IEBA 3OJLA 5L4LA 1I32A 2BHLA 2VOJA 5DBFA 3T7EA 1PGQA 3ZHZA 3U5TA 2GCGA 3R3SA 4IJWA 3BMQB 5GY7A 4OJNA 5FFFA 1W73A 3M6IA 5J23A 1SOVA 4L0QA 2X86A 4W82A 3FWZA 4G5HA 1H5QA 4XZ3A 2DM6A 1HZZA 3IL2A 1QV7A 1FDSA 2JD2A 4Q3DA 1IL0A 1ZSNA 1LQTA 1YO6A 4ND5A 5TT1A 1PJSA 2C2XA 4BNHA 5JC8A 1PTJA 2Z95A 4OGWA 3AY3A 3I4FA 1EE9A 1P0FA 4R68A 4BQPA 1JKIA 1MV8A 2EV9A 2Q46A 1VI2A 2YQ4A 4J9VA 4R41A 1XYGA 1AUPA 2VT3A 5FEUA 2XXBA 4PLVA 3I6IA 3ZWYA 4EJMA 1GL3A 4IY1A 4CLDA 4M89A 5ER6A 3P5SA 5JXWA 4RV9A 5THQA 1V0JA 3V2UA 4PN3A 1O95A 4CM1A 2NQ8A 3UCEA 4PLCA 5EMHA 3ZU4A 4XQGA 2EWMA 2AE1A 2QRLA 5I7EA 2XXJA 5KVSA 4E0BA 3NDIA 4J16A 1KIFA 2PY6A 4C4OA 4U7WA 4B8WA 1B14A 3GHHA 4IJUA 4A73A 2Q1UA 4NQZA 1P0CA 4ZQEA 3KZVA 1ONNA 3JYLA 3DBHA 4BO0A 1LSJA 3Q9NA 1R15A 1I2ZA 4OOEA 2GLXA 4U8GA 4NG5A 4RF4A 1YGYA 1HRDA 1C3VA 2W90A 1FK8A 4IDDA 3U4HA 3FNFA 5HS6A 3KBOA 1DAPA 1CJCA 2H9IA 5T5QA 2FN7A 4PLHA 3JYQA 1U2GA 5BSGA 5L9AA 2OORA 4W4TA 1NQAO 1DLIA 4ND2A 2G5CA 1QLJA 1SNYA 2IZZA 3ANMA 2FHSA 4HADA 4UEOA 3BMOB 3PWSA 4O59O 1SAYA 3E1KA 3CZMA 2ZB7A 3HN7A 2W4QA 4M49A 4O6VA 3ANLA 4IDFA 4PGFA 4CV0A 5JDCC 5CP8A 1P1KA 1HDYA 8LDHA 1JQBA 1XHLA 2D5CA 2A92A 3VZRA 3MTGA 4WLNA 1D1TA 1VKOA 3H9GA 1C0IA 3DHEA 3KLMX 1A4IA 5L40A 2PH3A 2GPTA 3OIDA 4J2OA 4I9UA 4EJ0A 1LTHR 1TT5B 1PU2A 1ZXLA 2HJRA 4JJGA 4MVJD 2O7SA 4JBIA 5L45A 3CEAA 4R1UA 4AJLA 4EDFA 3F1KA 3BMOA 3DHNA 2XAAA 3OBBA 2PZJA 3H2SA 1EQUA 2JJYA 4WJZA 3F5QA 5G0UA 3RBXA 1PJ4A 5JO9A 4CM9D 2PD6A 3VKVA 1QXSA 4IGEA 3PHLA 1DJQA 3QVXA 3KSUA 1DFGA 4CV1A 2Z1NA 5JYEA 2X9GA 3GN2A 1PJQA 1H6DA 1NTOA 4EUEA 4JX8A 1S6YA 4ZJUA 4OXYA 4EEXA 3Q1LA 4XYBA 5CG2A 2P9EA 4GX2A 2AE2A 4XA8A 5IF3A 3TWOA 1UUFA 1UXHA 3D0OA 4CR6A 1U8XX 4MKXA 4YJGB 5JCJA 3NT4A 4ZVVA 1MXHA 1VL8A 5JBIA 4YTEA 4WEOA 1AHIA 3PFWO 1KVSA 3U49A 2FOIA 4E2XA 1DIGA 1V6AA 3AUAA 1I24A 5B4UA 3NEPX 4XIJA 3E8XA 3ZZNA 4FSHA 1CDOA 4NJMB 3WGZA 4BNMA 4E2WA 2GF2A 4RZIA 3TZQA 1CF2O 5HTOA 3TPCA 2NACA 3F4BA 3DZKA 3W8EA 4GX5A 3WJAA 4O0LA 1ZUD1 4Y6PA 5T8KC 3DAPA 3O4RA 1ZXBA 1UXGA 4CQLB 4JQCA 1GU7A 4F46A 1QLHA 1GQQA 1VC2A 4RVSA 3K73O 1AE1A 1NVGA 2FWMX 3H9QA 4BVAA 1PL7A 4S1VA 5TRTA 2XOXA 4CLOB 1N8KA 2NVUA 3I5MA 3ONFA 1P1RA 1XQ1A 3E18A 3EVNA 4NJMA 4NMHA 4YQYA 5TF4A 3TZKA 2JAHA 4J1NA 3LQFA 4WCFC 4NPCA 5BNIA 3G3EA 2BFOA 1NFFA 4TRMA 4DC0A 1EFLA 4G65A 3ZWAA 4BNFA 1NHWA 1PJLA 2QYTA 2FZWA 4WCDA 4BMVA 5A5FA 1X14A 1P31A 3ICPA 4AJHA 2HCTA 3CH6A 1B15A 1SPXA 3WYEA 4RO0A 3LT4A 4HNHA 3A4VA 3RUDA 1OC2A 1Z75A 3F9IA 2OZPA 5T57A 5JO0A 2QRKA 4RVUA 4AJPA 4MOWA 2VHZA 5ILOA 2HMTA 4I9NA 1K89A 5JAIA 1LDYA 4ALJA 4GAEA 1R37A 3RROA 3N74A 3JQ7B 1KVUA 2YV3A 3LC7O 1V9LA 3JD2A 4NI5A 5IZCC 4E4YA 3LLVA 3ROMA 1Z73A 2PA3A 3QWAA 1XU7A 5T6BA 5ITVA 1Y5RA 2Q99A 1P45A 3HSKA 1LUAA 3GUYA 3OQ6A 1W6UA 3OJOA 5DN9A 1VL6A 1PJCA 2V7PA 2AW5A 4WLEA 3UVEA 3T7CA 3BMQA 1A71A 1IPEA 1E5LA 3LC2O 4O1MA 1LRJA 4PLTA 3S8MA 4B3JA 1ISGA 3QQPA 3FNHA 1ZK1A 2BI8A 3FRJA 3SJUA 4DLBA 5THKA 3KEQA 3GK3A 4D42A 5JNLA 3WNQA 2AQIA 3FD8A 2VWGA 3DDNA 1QV6A 3WQRA 1KY5A 4J1SA 2AG8A 2AHRA 2VN8A 2JKVA 4Z6KA 5I7VA 2BF7A 1JW9B 3NX4A 1UAYA 4Y67A 4CM8B 1UZNA 1N9GA 1DIRA 2Q1SA 2B5WA 3C7DB 3GRPA 4F45A 5JMWA 3DZGA 3WWZA 2JCYA 1GCOA 1Z6ZA 1KYQA 3WYCA 3LT1A 4LCEA 1JU9A 5IG2A 3RD5A 1DO8A 1X15A 1E3WB 5FYDA 3O26A 3MJ4A 1EVIA 3GMSA 3BHIA 4BKPA 4GWGA 3WGTA 1LRKA 4BS9A 2EW8A 1ISMA 4XX0A 1FDWA 3GDGA 3N58A 2Q3EA 4UVEA 2WEKA 2OBYA 3TNLA 4PG7A 4U0JA 3PDUA 2ZQZA 1YBMA 2O3UA 3GPDG 2CVZA 1GCUA 3N7UA 4QO8A 3AUSA 1EVJA 3F4LA 4ND1A 1UAGA 3ITKA 3GVPA 5F1OA 2YFHA 3WB9A 4YJHA 4UVGA 3WBBA 3RBZA 4IQ0A 1FF9A 3FWNA 1HLPA 3L4BC 2B35A 3M1LA 5AXCA 2P68A 5C5IA 1GV1A 1NQOA 3PRJA 5IDYA 3ZWBA 3IJRA 2W2KA 2C82A 5H83A 3UKOA 2O3JA 4GMFA 4CQMA 2BH9A 3IQDB 9LDBA 4OM8A 2NQTA 4Q3NA 3ROPA 3NTQA 1DAOA 4JN6B 1GYPA 1ML3A 3DTYA 4J9UE 2VZ0A 3W8FA 2F00A 1E3IA 1A9ZA 3K2EA 4K6CA 4A2CA 4II3A 2P91A 2DBVO 1ADFA 4AJ4A 2Y93A 4R5HA 2DTDA 1UXJA 3V1YA 3IUPA 2P4HX 1ARZA 4HFNA 3TF5A 1PZFA 3P19A 2WYUA 1P74A 3DXFA 2X5KO 3S2FA 1HLDA 4PG6A 4FFOA 5TT0A 2R00A 2O4UX 1G0OA 1DRWA 2JFFA 1CEQA 3BHJA 4CMJA 2I9PA 4R1SA 5B1YA 3S1LA 4J3FA 1B2LA 1CERA 3I9KA 5EQFA 3E5MA 1ONPA 1TLTA 1V35A 4IJKA 2DQ4A 3MJSA 4Y9DA 2GNAA 4R9RA 1SEVA 2DVMA 1UDAA 2Z1MA 5BSFA 1X7DA 2RHCA 3PJDA 1I3NA 1N9GB 2NTJA 4GSKA 3GAZA 5ES3A 4MVJF 1NNUA 2CUKA 4WASA 3FR7A 1YJQA 1VLLA 3I9JA 1NP3A 3W6ZA 1EFKA 4FN4A 1YOVA 2FR8A 2PK3A 4CL8A 3ZV6A 5G0SA 2GERA 4D3DA 1LX6A 2PNFA 4CLRA 1JAYA 1KETA 4JP2A 2DUUA 3WS7A 3IDSA 4P22A 2QX7A 5JCJD 4A5OA 3HDYA 1HT0A 5KJFA 2JD1A 4MO2A 3ZWXA 1I3MA 3BHMA 3RQSA 2POQX 3AOEA 4LCJA 5KTKA 3SBOA 3LF2A 3MWDB 2QIOA 1ZW1A 2QG4A 1OAAA 1P77A 4BNYA 3JV7A 4BNKA 2Y1EA 2CDAA 5C3MA 2G17A 3QV1A 4D46A 1W8DA 1SO8A 1YQDA 4E2ZA 2YZ7A 5F1PA 3SXPA 1YONA 4WGGA 3ZI0A 5EN4A 1I10A 2CY0A 4J4TA 4AJNA 3BTVA 1U3TA 4EEZA 4RLSA 1Y8QA 1M6HA 1T2FA 2C29D 4WLUA 4LGVA 4P4LA 1F06A 3F3SA 1UXKA 4DPKA 1K3TA 5IXYA 2PR2A 4RJTA 3D3WA 4BNZA 5JSFA 4A03A 1QORA 3GH3A 1Q7BA 3K31A 3LVFO 4OXNA 4BV9A 1NFRA 2FZEA 1U3WA 3GGGA 1R4NA 3TOZA 1NFQA 4J91A 3UW3A 3JD1A 1NM5A 2EJVA 1LLUA 3T4EA 4FBGA 3ZU2A 3L07A 3HQ4O 1QR6A 1LDBA 1PJBA 1SCUA 3FSRA 3RIHA 3ZU5A 2BMAA 3AY6A 4HNGA 2YY7A 2VHWA 4CMIA 4YRAA 3OMLA 4U5QA 4TZTA 5L7WA 3EAGA 3ZWPA 3GNQA 1ZBQA 4YT5A 4XRGA 3H9JA 3GDOA 5A06A 1ADGA 1HYHA 4OKNA 3FR8A 5A9TA 4BNIA 3EDMA 1LLDA 5ENDA 3G0OA 1R4MB 5ITWA 4RPLA 1ISFA 1GY8A 1NQTA 2V6BA 3KV3O 2NLOA 4BO6A 5DT9A 4FJ2A 2EG9A 3H5AA 5B4VA 3WGIA 4PG4A 1O5IA 5ICSA 4IQ8A 3HN2A 4FJ1A 2B69A 1A27A 4YAGA 1LSOA 3CIFA 1R4MA 2X6TA 3FBTA 3QW2A 3KOUA 1IHXA 4RPHA 4F6LA 2OOSA 1E6EA 1EK5A 2I67A 2DT5A 2QZZA 1N7GA 3ZCXA 2X8LA 4ZD6A 2Q49A 4OYRA 1PEDA 3ITDA 4EBFA 3ETDA 2DKNA 4B7UA 3VZPA 5H81A 4DQXA 4XIYA 4NBTA 2UUPA 3ZHXA 4BHTA 1FDVA 1B26A 4Q39A 4BUCA 3RC2A 5JDCA 1WVGA 1LI4A 2ZTVA 4GWKA 2HMWA 3ZNNA 5A5EA 5IN4A 1SOWA 3GHYA 1ZCJA 1XCBA 1BWSA 1LQUA 4CMHA 1PGPA 2J8ZA 1WXDA 5AXBA 1LDEA 3AWDA 3GT0A 3D64A 2I76A 2OFPA 1PJ2A 3NKLA 3DC2A 3O9ZA 3RC9A 5EINA 4MINA 3UXYA 4ZA2A 1I3KA 3S55A 3UF0A 4R3WA 4QECA 4TKMA 3WGGA 2OP1A 3D1LA 1NQ5A 3GOHA 3PZRA 3QE3A 1E7RA 1L7EA 1P1FA 4B3IA 1V3TA 1ID1A 3SLGA 3GPIA 1PWXA 1NHGA 2Y1OA 3X2EA 2Y67A 5IDXA 2W2LA 1BDBA 4CR7A 2G82A 3F46A 2OP0A 1XDWA 3PLRA 2DPGA 4ND3A 4ALNA 2EIHA 4MVJI 2BKAA 1ZMOA 3GR6A 3WLEA 4CR8A 4IDAA 3GNSA 3LDHA 3C1TA 4UVHA 2D3TA 1I33A 2C07A 3AK4A 1H6AA 2D1YA 3CPSA 3HHPA 3RFXA 1GZ6A 4DIFA 4ID9A 4DQVA 1H2HA 1VL0A 2O23A 4II2A 1DHTA 1TEHA 2O3SA 1ZJZA 2VWPA 4CM5A 3DO5A 2AQ8A 3GGPA 4FW8A 3JQGB 2AXQA 4MKZA 1DB3A 4ITUA 3RU9A 4IJVA 2Y0EA 4J4BA 2G76A 5L7TA 4B4UA 3RC7A 2BGMA 3IP1A 3CTMA 2WD7A 4L74A 4PG5A 3H4VA 3G1TA 1KVQA 3WMXA 1NPTO 3O03A 1U7HA 4YAJA 4DYVA 1E5QA 2FR1A 2PGLA 5HA5A 4LSWA 3DOJA 1ENZA 1T2DA 4RQTA 3AOGA 1LDNA 3UN1A 1JDJA 4FIZA 2PD4A 4J90A 2YYYA 5ENVA 4DPMA 1M75A 1D1SA 2WD8A 3VAZA 4KMSA 1E0DA 3DBLA 1FMCA 4OL9A 2NADA 3RKUA 3GFGA 3DZJA 5L95A 4XGKA 2VHYA 5TNXA 2DPHA 1YQXA 4WOKA 3RUFA 3TZ6A 3ANNA 4KUGA 4XQ9A 1HKUA 3IP3A 2JD0A 1E3SA 2CDCA 3ETGA 1WDLA 2AG5A 3QWBA 5FF9A 1ZSVA 4W9NC 2PWZA 2D2IA 4GLLA 2NTVA
chains in the Genus database with same CATH superfamily
1HDRA 2I2CA 2PMKA 1CJBA 1X7GA 4QUKA 5JMPA 3A9RA 1HTWA 4MQBA 3TKYA 4B47A 1QO0D 2XWSA 1R10A 3JQBC 4P92A 2J41A 4ER6A 3CYFA 4TWIA 4B4OA 2DOKA 2XLBA 1VTKA 1NMSA 1P6QA 4MWTA 3DXYA 1DEKA 4G5XA 4NZYA 5CAEB 2VDUE 3BWCA 4S3MA 5AQEA 1YWGO 2BY4A 1QPZA 3NATA 1F4LA 3OQVA 5CVTA 5KDDA 4DUZB 2C03A 2NV6A 3NORA 4Q3LA 4XIIA 4F71A 2EXXA 2ADOA 1FYEA 1Y1TA 4UARA 3TGWA 2QZJA 3JVVA 1JJAA 1NSFA 1ZEMA 4LF9B 3EWNA 4LXGA 1JG6A 1XMJA 4RMJA 1APBA 1ODLA 4XGQA 4DBVO 2H2IA 1E7QA 1Q44A 3GJQA 3IPYA 2F1OA 4PC6A 3TLAA 1Y6QA 4B9AA 1BFDA 3KZ1E 3X2FA 5ALUA 3VZDA 3NI2A 4E70A 2DFTA 2HLHA 4C89A 5IZCA 1R50A 3PC4A 2I9KA 2QE7D 1E2LA 2RGRA 4QXMA 5JYCA 5B55A 2C54A 3Q3CA 1R0SA 1BG6A 1YDMA 1SZCA 2B4AA 3MGKA 4KYTA 3C3XA 4P7BA 4MJLA 4B2YA 3G2KA 2C9DA 3OPYI 4BPBA 5FUWA 1O0SA 2X7HA 4I6GA 5F7OA 1BWQA 3OOSA 2W11A 1VE1A 4HO1X 4MVJM 2FF5A 2QVZX 3H7AA 3NYWA 3RLFA 1EZ4A 4RKFA 3TZEA 2P2SA 4WWHA 4PNPA 3EC7A 1YUNA 2H4ZA 1JZSA 1O4VA 2QV0A 3OTWA 2EZUA 3DBOB 1NWHA 1TVKB 1A2QA 1G55A 2HV9A 1XOIA 2ECOA 2VH2A 4MJXA 4Y8VA 2PEZA 4X85A 1YQQA 3DMGA 1LTQA 1N2CB 3WICA 5L53A 1H8HA 2QW0X 2C9MA 4I99A 5BW5A 1H9AA 1WE2A 2EF1A 2BOVA 3E84A 4QRIA 4XIGS 4AG3A 5HUHA 1WX1A 3OJXA 1STOA 4I19A 1PR6A 4XSVA 5CK4A 4ENRA 3DOFA 5G3YA 4AJJA 1GGHA 2DQZA 2R3SA 1B6SA 3I9NA 3DMTC 4HWRA 1Q0SA 4LI3X 2FPOA 2QWXA 2PHZA 4NOJA 2YOFA 1UODA 4TKUA 5IJ9B 4V0OA 3ZE2B 2Z2KA 4JOSA 4LJ9A 2BFCA 5C1IA 4CFZA 2XKKA 3T06B 4LJRA 2CKDA 1CU1A 1U2PA 1P9LA 4YP6A 5F7JA 4AQYB 1OYWA 1UP7A 4E11A 1G9XA 2XTNA 1POXA 3BMCB 3LW8A 4A2QA 3PLNA 3SX4A 1DQRA 1FC0A 3FNGA 2GD6A 1PX2A 3JAKA 1M73E 2OQ2A 3PPIA 4GGPA 2J3IA 3EGOA 3DCIA 4IMJB 4JCOA 2WB4A 1OCEA 4MEAA 3HKEB 4L51A 2DFDA 3GAFA 3H1GA 1JYEA 1EDEA 1I6WA 4G26A 1QYWA 5EIBD 5HEKA 3QTBA 4ZU1X 4AJIA 3DCNA 2PYIA 2ERYA 1ISSA 1UH5A 3AF2A 3EUAA 4LYAA 4HEQA 5H16A 3TLGA 1C9NA 1Z5PA 1BDIA 3BH6A 3IKVA 1CNMA 2B83A 2FHPA 3L0PA 1P2VA 4MW9A 2FPGA 1LU9A 1CS0B 2R6ZA 4G81A 1LKZA 4OHBA 4BO1A 3ZS8A 1ILWA 2HXGA 3GFOA 4ZVRA 1RKBA 1P3DA 2ZVQX 2VPXA 1SQFA 3H6HA 5IXSA 1NSTA 1NR1A 3H04A 1E1CB 5DM4A 4BMNA 5TC4A 5CYFA 2FW8A 4NYIQ 3VU9B 4D7AA 1OXXK 3FTDA 4H1UA 5ESRA 3H65A 4TTTS 4Z7NB 4A3SA 1XLUA 1CEXA 3RSOA 1ABBA 2PGDA 4C7KA 5JH7A 1GL7A 2C5BA 3ZW7A 1K9VF 3TTWA 1FTYA 5ALKA 3RDPA 5LP6A 1T4MA 3FCSB 3WX0A 1JS1X 3DA8A 3ONEA 3P2EA 3COSA 4D3FA 4YRPA 5KIAA 4PHFA 2WT9A 3AHFA 2QZ9A 4UZEA 1NG1A 2HRZA 3NT2A 4KSBA 5ECGC 1N4AA 3WK7A 1R27A 1ZGJA 3VDRA 3QFHA 2FP4A 4HLQB 1XTTA 4M83A 4EYKA 1VJGA 3TM5A 1KJQA 5CW2A 4BMOB 4WLFA 1V3UA 2GJSA 2J32A 2PAAA 4H0CA 4H60A 5ALMA 4FX2A 2QTTA 4RMGA 2ISSD 3JCZA 3L7CA 1Z4JA 2RAPA 4GZ3A 4WLVA 1FX0A 1H1TA 3UHJA 1SUWA 4YAKA 2HA2A 1O8CA 2W4MA 1RAIA 3EGVA 3PFNA 2F3SA 3E27A 4LWOA 5ALDA 3HWWA 2FSVA 1J49A 2NP7A 3CSDA 3NNDA 1RC0A 1T34A 1V4NA 3HR7A 2G70A 4Q7EA 3A7DA 3CZCA 2O8DA 4NBWA 3G0BA 3RVLA 1RMYA 4KE9A 4LQ4A 4H16A 5IMBA 5B2ZA 2VRCD 1KYWA 2FMFA 4Y2JA 3H6KA 1MP0A 2FPKA 1G98A 2QE6A 4FYHA 4MI1A 4RXMA 1VECA 3F7MA 3QNUA 1X80B 3RVRA 3HXOA 2YHSA 4CMCA 3RQIA 4BEWA 3SM9A 5TSDA 1OSNA 4TXHA 3V48A 1P61B 1TYCA 2WTNA 1YZFA 5E8RA 4CMKA 3ZLTA 2FZ4A 4S1WA 4BFXA 1NXWA 2VT6A 1UANA 1U98A 4G5RA 1OX4B 1R2QA 3R7SA 3OECA 3WK4A 1KI6A 4MHTA 3FZEA 4B84A 4DSTA 4EUFA 4BNGA 5BN3A 4N5IX 1W5BA 4F21A 1K8QA 1GUYA 3DQQA 4QXAA 4YP9A 2ZCJA 1ZCBA 2R97A 7MDHA 1S2GA 1E66A 2YWCA 4RTLA 2FZLA 2W2NA 4E13A 4IJQA 4RMNA 3RS7A 2BKLA 4W9MC 3PBKA 2REBA 1KO4A 2Y0PA 3MYYA 4GQBA 4D56A 4KGVA 4NS1A 5TPZA 3OLWA 4EJ2A 1T8WA 3EE6A 3D6NB 2JI7A 1U0RA 3OIFA 4F91B 3PEWA 2ZUCA 2WOOA 5CR9A 2GM3A 5FADA 3ZUPA 1WTCA 1CUZA 1XJWA 4MQFA 4EFKA 1QIIA 5IANA 1N34B 4B85A 3MJEA 4URZR 4MXDA 1UPFA 4QX6A 3OCCA 4JT9A 4E3WA 1T3GA 2FPPA 3KZNA 3PR1A 4FDUA 2H1IA 5JAQA 4Q1FA 1YFJA 1Z82A 4M1EA 1PT5A 1B8UA 1NVVR 5AW2A 3WIDA 3H3JA 1II8B 1FDTA 1MVOA 1EXVA 4A36A 1TYDE 4QYIA 3U9SA 2H5JA 3JQBA 1UXIA 3F2VA 3H11A 3DF7A 1UT8A 2B94A 1CUEA 4OFWA 3DVLA 3RC1A 3CLSD 1RYEA 4PQYA 5AHWA 1KJ8A 2XJ4A 1S3IA 2L69A 2R5NA 1DX9A 2VP6A 3F90A 3Q88A 1NUHA 1T2NA 3HRKA 3S4YA 2IA5A 1WNTA 2C2WA 1XZPA 2K7ZA 3CEPB 5HWSA 3HUDA 3EIWA 2VRCA 3EXHC 4G1FA 4OQFA 3HFSA 4YMGA 1A2KC 2XPCA 3E6AA 4WMLA 2WP0A 4MI9A 5HQTA 1C3LA 1J25A 4E21A 2IYQA 4OXXA 3ETEA 4HTAA 5HFAA 3ME5A 1TVKA 2FE1A 2ID8A 5I9BA 1IMOA 1Y6JA 1MJFA 3M1AA 1Q11A 3Q8WA 2EX4A 1JN0A 3ELWA 1UDXA 1A98A 2X9VA 3OEYA 4I55F 2BDTA 4GX0A 4PHGA 1WBJB 2OHGA 4KKXB 4WK2B 3VA7A 3ZJUA 3I6YA 3UMVA 1FNSA 3AW8A 5BXQC 3L5KA 1JA1A 1I30A 3V1TC 1LEHA 3R40A 1I6MA 3FF4A 2D1TA 4B3FX 2VBIA 3RVDA 4FD2A 4DEVA 3I39X 4CCAA 5KX5B 3HUTA 1MU0A 2PT9A 3NDJA 3B52X 4HX9A 5KSZA 1T8PA 1E7WA 5HYVA 3TX2A 3LKBA 2I33A 2JHGA 3PF8A 1T2EA 1IU9A 4ENSA 1T13A 2WJJA 1O8BA 2ZJZA 4CM6A 4UTXA 1DKRA 2NP6A 2ZSBA 1EQAA 1YZKA 4ZCIA 1Q0ZA 4IXWA 2GN8A 3BMCA 3D7SA 3IE0A 4IGFA 3UOGA 4BC0A 1WSDA 2JJQA 2UKDA 3SQMA 2FCRA 4DRXB 4EKYA 3JTMA 5C0OE 4IG9A 2QB5A 4XB6B 1O9GA 3MCZA 1PS8A 2F1RA 3FVVA 2AL7A 3LC1O 4URFA 1FRVA 1LY1A 5FOTA 4A10A 4AT1A 5AKYA 4YR9A 2XB2A 2YR0A 4X8HA 3FBWA 1BW9B 3GY0A 4FZ5A 4ZYLA 2IDKA 4TROA 4Z8YA 1GR1A 2JW5A 2XD4A 1FU8A 1DXQA 2EF0A 5B7QA 3S5JA 1ZDMA 2CMKA 2PO7A 1MT0A 1JKFA 5EKUA 3U3RA 1O5TA 3D8UA 4A0RA 3FSEA 3QKRB 1HQDA 3EXEB 4M55A 4YO7A 5L3SB 1D09A 1UPXA 1CDZA 2JL1A 2YJ3A 3DE4X 3Q6IA 3TX6A 1SR8A 3CRNA 3GLRA 1EKXA 1PQPA 2IQIA 2QU8A 4NG4A 1BCSB 1DRUA 1FTWA 3UXHA 3VR4A 1J1UA 4QFCA 3RYHA 4EX6A 4NK5A 1C1DB 2VHQA 4JLDA 3S28A 2BGLA 3ZPXA 4BLWA 3MMSA 3QI7A 1KJWA 1QGED 2X13A 1KS2A 1C4KA 2AKAB 5E4JA 2HTEA 1VSUA 3QWFA 2B36A 5IKMA 3EVBA 3OIVA 4DNFA 2B61A 3IEIA 4CMEC 2LR0A 1SY7A 3HB7A 1X87A 4JXXA 1BMFD 2BJVA 3EZYA 3ORFA 1GNQA 1PNOA 1TYEB 4Q37A 4I66A 5BOVA 1ZEJA 4CKYA 2UAGA 1A95A 1GYRA 4AU1A 3KU1A 3FHOA 2QTVA 4QULA 4IMIB 4F9GA 5CVCA 4BGUA 5AIBA 1IHUA 1X2EA 3GVCA 4UOQA 4C07A 2YFKA 1NDHA 1IJFA 1UC4B 2BRUA 3EB9A 5TPZD 3NGXA 3B6ZA 2M6RA 3B78A 2WD7B 4XOUA 5D3QA 4DBZA 5ADHA 1I6LA 1P3JA 4AWBA 3I9V6 3HWSA 2Q3FA 4F2PA 1XWFA 2BEKA 1RCUA 2R8RA 4AS3A 4EUSA 4HB2A 1M67A 3L7OA 2QF7A 2XDYA 4LXQA 1DZ3A 4WN3A 1ZSYA 3MTIA 1NLMA 1W5AA 2ZJ5A 4UBLA 1PQ4A 3D8RA 4DC9A 2TMYA 4DCOA 4AURA 2OV8A 5K2MA 1PKEA 2E6UX 2RHRA 2RHBA 3GGOA 4ZHQA 5IC4A 5GONF 4QQ8A 1B3RA 2ID4A 1JLSA 1MB2A 1MAAA 2PQ2A 2QAIA 3VHRA 5CYOA 1W5FA 1YR1A 1IRXA 4DR2B 4J7CA 3W2GA 5IJZA 1UJ6A 2XVZA 3QW4B 1Y4ZA 2TECE 2SICE 2BFDB 4U6NA 5CDFA 4FYJA 4W8OA 3MCUA 2LIVA 2G3YA 3OKAA 3GYBA 4NJOA 4B48A 1TAGA 5TMPA 2C9BA 1R3DA 2ZSAA 1QG0A 2A14A 3TN7A 4BATA 3ANXA 1TT7A 1XK7A 2MR5A 3G0GA 4PLWA 3U81A 2JCXA 4Y9TA 2Q5IA 4L3OA 4E4RA 1BX1A 2GUGA 1HDZA 3KPYA 3FM9A 3MJDA 4HSGA 4HB4A 3GRRA 5MFZA 2G1KA 2YW2A 3LLCA 4JVOA 2DMRA 5CB4F 4PC2A 2JGRA 3NFRA 5E0KB 2XOKA 4FDTA 1X7WB 4P36A 3WB2A 4L72A 5MHTA 3RK1A 5EZSA 1BHJA 3OT4A 3D8NA 4PRZA 1KE2A 1RXEA 5HGJA 3ZXSA 4B4WA 1ODFA 2B4RO 3HDHA 5HG0A 4JUAA 1U7DA 1TJNA 2H1CA 3FPJA 4D74A 2GK7A 1R00A 1C30B 4EQ6A 3TFQA 1KDOA 4RANA 5GOTA 3UV3A 1JLLB 2C20A 4YDHB 3IVGA 3QJ5A 4J1TC 1VPTA 1VMIA 4EJSB 4RVHA 1C8BA 3PGXA 2YFQA 3IX7A 5BWLA 2ZVPX 4X3PA 2CZQA 3V4ZA 2RE8A 4MUIA 4CI0B 2Q2WA 4XD2A 5JDIA 2Y0BA 1JQAA 4XWYA 3B7GA 5CU7A 2WQ6A 2GKGA 3IFSA 1D2EA 3T99A 2C7VA 3T8YA 1TZCA 2I6FA 3A06A 3P2KA 3QELB 1ULUA 4IIVA 2PXXA 4K6OA 1PDOA 3HNOA 3PGJA 3ROTA 1U4SA 1BJKA 2YVAA 4YLEA 4OA5A 3RV3A 4DMCA 3DZCA 1PL6A 3DXZA 5A7FA 4N8EA 3H9EO 1U7PA 3SPXA 3SVTA 3GJZA 1E8MA 4J3NA 4Q4HA 1A77A 1LGYA 2JIZA 4JI8B 5JZVA 2W8BB 3ZJYA 3P96A 5EZYF 3RABA 1UEXC 3CGGA 4MS3A 2V6MA 4XGIA 2WV9A 3BWEA 4N1AA 1ESZA 4G84A 3CLKA 3KJEA 3WSTA 2J3DA 4RV5A 4B6JA 1YC2A 3LPCA 3F6YA 4FOSA 4MYTA 2ZRNA 4RXUA 5DTJA 3R9KA 1W25A 5K0JA 4KRYA 5I45A 3R9IA 2ZTMA 4AM8A 1X1EA 1TO2E 4U0KA 4V38A 4DQ0A 1CY0A 4XPIA 3KB8A 4OQXA 5EEHA 3DF9A 4YJGA 1JMKC 3ZD6A 1FB5A 2FQ1A 1B1AA 1GXSB 4FFPA 1FW8A 2JATA 2HU5A 5HILA 1RPNA 2ZYWX 5M04A 1SXPA 1XTUA 1L5QA 3MMZA 2ZJYA 4Q9AA 2HTFA 3P9SA 4ZRMA 4JA0A 4DJAA 1BZYA 1J97A 3ECSA 2FK8A 2HA5A 4AROA 3STUA 3GRKA 4JJZA 4OK3A 4XYMA 1EXMA 1ZN8A 4OKIA 2H29A 2JKYA 4PXAA 1NC3A 3C16C 3R0ZA 2E4WA 4M54A 3PCXA 4E94A 5LYJB 2OCKA 5TQ2A 2O2YA 3A9WA 3DNPA 2BI7A 2I7TA 5C1PA 1ZIPA 3QVJA 3G8BA 4X97A 1THTA 2F55A 1R9JA 4G5FA 4YQFA 4NEHB 4MIKA 2EGHA 4DA9A 3OSZA 2AG0A 2RHGB 3HXPA 1UC5B 2JK1A 4U2CA 3AUYA 2JVKA 1ZNYA 2GF0A 2IPOA 2ZS8A 1YQTA 3RYFA 3ZWWA 4WZBA 3JALA 3RIEA 5BV8A 3H16A 4QWWA 1C81A 2Z2JA 3K6KA 4DQLA 4C14A 4MWCA 4DZRA 2QK4A 3AKDA 4UJ3A 3GJTA 1T0UA 3THXB 3GD7A 2BFBA 3ZEIA 3U7FB 1E6KA 2G6TA 4HWKA 4QARA 4KBGA 2ZS7A 2DQKA 3JPYA 1V7CA 2JIZD 3MJVA 4Q3BA 2P90A 5A3RA 1E8NA 4E46A 1GDHA 1GTJ1 3CLUD 3FCOA 3UY4A 4I1SA 2VDJA 4FR5A 3KYIB 3HDGA 1U1GA 2NZVG 4UEJA 5DLYA 2RJ3A 3I09A 5LJLA 3OPNA 3QY0A 4P3NA 1H85A 3GLKA 3K5PA 1ZUNA 3LIPA 4GOKA 1TJ5A 4JHXA 5KNBH 1GNVA 3IEXA 4TYQA 3L7YA 4RIEA 2NPOA 5BP7A 1GT6A 2YMQA 2XGSA 3N2IA 3RARA 4JJ6A 3TZBA 1E79D 1FX1A 2KQUA 3GGDA 3U48A 1IONA 2HO4A 2Y27A 4EQ6B 1KWGA 2I4NA 3W6NA 1P18A 4R8SA 1O89A 1JWLA 1WWKA 3U7JA 5I6DA 4G5QA 5JTUA 3BCRA 5M2QA 3HNPA 2R8EA 1MC4A 5EMNA 4DEXA 4DBLC 1Q3TA 2XOKD 3DMRA 3RPEA 1S89A 2G9NA 2W0SA 4RS3A 1RHUA 4A6DA 2O2SA 3HJAA 1Z4OA 4BN4A 4EDHA 3IXQA 3Q9UA 2E37A 3G1UA 4Y1FA 1W47A 3HYTA 3SJ7A 4D99A 4WK4B 2YZ2A 2GWRA 4WKBA 1J06A 1HEYA 2HU7A 4QUDA 4CUKA 4ZEMA 4N3BA 3QNMA 4Q21A 2XCTB 4JLAA 3K0KA 4URYR 4JL5A 2HNAA 1NLZA 4N65A 1K5HA 1K5DA 3REQA 1JXMA 5SZIA 1XZHA 2Z83A 16PKA 1T1GA 2J5BA 4FMDB 4UDXX 1C7IA 4TWJA 1TCUA 5AUPB 1FBNA 1RZRA 1JDTA 4EZEA 2H2WA 2OKCA 4M86A 2ZE8A 4X9XA 3DBIA 5JBNA 4RJIA 4BNLA 2WIBA 3GLIA 2YNMD 1SU4A 4BIIA 1Q1BA 3WLLA 1AKUA 4M8IA 3GLTA 1DIHA 3N0XA 4GBJA 3O8QA 4XUCA 1OXSC 4XXHA 3A4MA 5FUVA 1JVSA 3BGIA 4WDQA 3C3MA 1EZ1A 4P82A 4WNCA 4HT3B 3LY5A 5PGMA 3ZBUA 4E5DA 4QU8A 1UP6A 3DUFA 5CDSA 5L3QB 3OFSA 1K86A 5ICFA 1M2VA 2FUEA 3SF8A 2BEJA 3A05A 2JH9A 1N2SA 4CMBA 3PHGA 1NGSA 1HDCA 2OHFA 3F74A 4NICA 1GITA 5FUYA 5KQSA 2P62A 5DTMA 1UC9A 1Y3IA 4Q47A 3VOBA 2ZE5A 2V65A 2WKQA 3ZCPA 4IHQA 5TY0A 1FA9A 3CJQA 4L5BA 1FP2A 4CYMA 4R2WA 4E7OA 3IHWA 1KJIA 2NUBA 3L8EA 2KI5A 3PI7A 4DJEC 2H6EA 2KLHA 1QIEA 1KP9A 2NU7B 2ZWMA 3EIUA 4P3OA 3HFRA 4YJFA 4D79A 5ADVA 5EWJA 1T24A 4NCXA 1BAPA 4YS6A 1G20A 2AFVA 2X3UA 4HTFB 3AHEA 4IKOA 2HEGA 1V3QE 3WIEA 4UTVA 4M9CA 1GPBA 1T0JB 4OLJA 3L0IB 3D8BA 3QPAA 3UG6A 2XT9A 3S2GA 5AVOA 4YUVA 4DLKA 1ZVVA 2HIAA 3R2JA 2DSTA 2FN3A 2YRFA 5JOQA 3K6JA 2D13A 4X1KA 4TSFA 4N0EA 1Q1EA 2IYXA 3F9CA 1WVMA 3H9UA 4KWEA 2QN1A 3C3AA 3FHTA 2YXPX 3AUTA 4WZAA 1AN9A 4G56A 2EVWX 1XKLA 2DWPA 4FZ3A 3AVOA 5H4HA 1I3CA 5KTPA 1R6XA 2ZKIA 4LJKA 2O2HA 2OECA 3W2TA 3MK31 2GHQA 4K9PA 1FUYB 2GA8A 5EPOA 4DLZA 5L3ZA 1AM4D 1X7ZA 5A3VA 3UMMA 2PE5A 1Y3DE 2XDQB 3FRHA 3NHYA 4OSPA 5HFJA 4FP9A 3KQTA 1M66A 5AXDA 5JPIA 2QUZA 2R87A 4UHEA 5JS1A 1MZPA 1E7YA 3LWNA 4JSRA 2FMUA 2C2GA 1OWLA 2BV3A 1CLUA 2B0CA 2FQXA 2OG1A 3LKZA 4M1YA 3RS8A 3CLVA 3K0SA 3ABZA 3FKQA 1ZKMA 1B0UA 2I2XB 1C29B 1G19A 1NVDA 3IT0A 1RXVA 3UHOA 4CT0A 1Z07A 5LQRA 3WLPA 1RJ9A 1R0XA 4KQCA 3AEQB 2VJPA 4H15A 4P4TA 3D1VA 4J0GA 4HS4A 2OHIA 3EWSA 3PQEA 3JTEA 3FHLA 1DPFA 3QE2A 1X80A 4M0UA 4P5DA 1CZKA 3RUAA 3KL2A 3E7WA 4DCCA 3Q9LA 4R7TA 5IEJA 5G0WA 3VNBA 4PAWA 1DHRA 3THWA 1KKMA 1E1RD 1T10A 2I99A 4DANA 3BFVA 2EFGA 3CZ9A 5JCPA 2IL1A 4MTCA 4NMXB 2J33A 1D2RA 1IQ0A 1QO0A 4PIVA 3Q15C 4UHJA 2O54A 1V5WA 2XGGA 3E9DA 1C4OA 1XHEA 4B6RA 3BK1A 5E1BA 3MHTA 3R1IA 5ETJA 2ZI9A 2NUPA 3N07A 4BV8A 5CYPA 5J2UF 1GG8A 3CLUC 3GJYA 3PGMA 1OAKA 2PBLA 1CY7A 1HMYA 4K0RA 4NDZA 3KJFA 4HLUA 3TB6A 2C42A 2NZWA 2ZJ1A 3F47A 5LXTA 2DPLA 3PB3A 3QENA 2DF8A 4MVWA 4LZAA 5JY6A 3IBYA 1NJGA 1PTKA 4YMHA 5AUOB 1T4CA 1ZGGA 2CNBA 4JXKA 1SBCA 4NIMA 3ER8A 3B6KA 3OU6A 2O06A 4H9GA 1BJRE 2YWBA 4P4NA 1UAAA 4PBTA 3GLHB 2DKFA 4Q9JA 3WWEA 3BK2A 3TBFA 1XTVA 1T5SA 3O2QB 4ZYVA 2OTCA 5LQUA 2MOKA 2P1ZA 3B1JA 3G23A 3ORHA 5DCWA 1OWMA 1XXHE 5GAJA 3W6PA 4KAXA 4J75A 3TOCA 3CT4A 1T1RA 1QRSA 3JD4A 3WKBA 1NMXA 2D06A 2DU8A 2OBXA 2NYVA 1Z3CA 3OMXA 1VPEA 4FVTA 4YP7A 3TTTA 4M9UA 2OHXA 4YRLA 4ZICA 2VUSA 3V3TA 2C0QA 1QHYA 1IHOA 1NE2A 4RBNA 3RFVA 5FI0B 1H1LB 2WE7A 1NVWQ 2ZJ4A 4U7FA 5IN5A 4NCIA 1JLLA 1LBTA 1YK1A 5DZSA 4EPXA 4N76A 1QNFA 1AKVA 1SKYE 3VJRA 4UTOA 1Z5OA 1OLXA 2P6UA 2Q62A 1E7SA 3EIHA 2DLDA 4PC1A 4RVGA 4WNYA 3D5TA 1JIXA 2NT3A 1BD4A 3PFCA 5KTMA 1E1QD 1TQHA 3DZIA 1BVRA 2HQRA 3IQHX 3KCNA 1UJNA 1YBAA 4LIPD 4KQ2A 4CM4A 4BGDA 2PR7A 3BCUA 3I2YX 4KQGA 1C3OB 3O9MA 3K2QA 2B34A 1WW8A 1SVNA 5A4JA 1JR3A 4P38A 4DV0B 5JAOA 1P44A 5C37A 2ZIAA 4BL5A 5CFRA 2CGEA 3VDNB 4GX1A 1QDLB 1CVLA 4D9NA 6LDHA 1K9SA 1KAEA 2FG6C 1PIWA 2A1TS 3WB0A 3CHYA 4ALMA 1OXUA 1IXYA 4D44A 4MW2A 1SQ6A 3TGPA 2QUHA 1BROA 2VT2A 1RYDA 2YRWA 5BN3B 1N0VC 4KE7A 1UZUA 3U3OA 3LDGA 3WIBA 1Q20A 4LOLA 1HE4A 1UOQA 1A3CA 2QVXX 4CIBA 5GJVC 4M0LA 4DSZA 3U0BA 5J4HA 2C99A 3KZXA 1GPLA 3A4TA 3JATB 4L5AA 1P4HA 1C8VB 2WKWA 4FBMA 4OHPA 4PYIA 3V3KA 5EWMA 3X1JA 2VNHA 3T1VA 1LDMA 2X4GA 3V1KA 3QTTA 4GOJA 3U4QA 3Q3HA 1H4SA 4B75A 3P9PA 1ECCA 4GYKA 1ZI9A 3CKKA 3QBTA 3EIQA 4EMSA 1GRVA 1KEPA 1YKGA 3OO1A 3HB4X 3GJ8A 2RK3A 4R7ZA 3VH2A 4GECA 1Q0LA 3UH1A 2PGJA 5IAAA 1JE0A 3DKPA 4U6QA 2EZ9A 3C43A 1ZC4A 1FU7A 3OA0A 1NKTA 1YE5A 2GXUA 3DBRA 4EBBA 1EUYA 3EFEA 3EH1A 3PPXA 3R3YA 2YJGA 1F2DA 4ENPA 2GJKA 2Z3WA 3N28A 3RB8A 3UWDA 3EXIA 5HZMA 4BP9A 4DA8A 3K1YA 4LRTB 1XN4A 3ZY4A 1YDGA 3S44A 1NWCA 2VK8A 5CNKA 3KUXA 3PGVA 3K70B 2FG5A 3RYFB 4DIOA 1V5GA 2R6DA 4OXIA 3E3LA 4RHFA 3EK2A 3OZBA 6REQB 1Q92A 3Q0EA 1RCTE 3D8HA 1UQTA 4V2UA 4YIHA 2X6QA 1C1DA 3IP5A 3QF4B 4LA4A 4KPEC 3KD2A 2HXYA 5TGDA 2ZQ5A 1P0QA 1W0KA 3JASB 4ZAVA 1WD7A 1D3AA 3EHEA 3MRTA 4PGAA 4BKRA 3CJRA 3FNEA 1IWBB 1NKSA 3HVHA 5DHAA 3JS5A 1VG8A 2L18A 3GUCA 2H1RA 4C22A 3P71T 3MWKA 1CRPA 3DFZA 3LSTA 2F3PA 4J2TA 3ZY2A 4UTNA 3RF6A 3CW8X 5EHGA 1LVGA 4KOAA 1DG9A 4LF4B 2GM9A 3H1AA 3NIWA 1IQUA 1KVRA 4FFBB 3GB9A 1IN8A 2O0MA 3V4FA 2X40A 4AIRA 3BXEA 1SU8A 4AZ3B 5FBVB 3FCXA 4BO3A 2EJBA 1ESNA 1U5CA 4FEYA 2PKRA 1AZTA 4IQGA 1HQKA 1V5IA 1JIVA 3MT9A 4QYXA 3U62A 1QK4A 2IZ7A 2F43A 4HQLA 5CRIA 3VFDA 2J0SA 1SKQA 1H6CA 3TXAA 4Y9SA 3X1YA 2HAEA 3PJFA 2FRDC 3FTEA 2NU6B 4XGNA 5JADA 4TTRA 2R7LA 3AI2A 4MUBA 1ORRA 4Q7QA 2PD3A 3EFBA 3QXXA 5F2EA 1NMEA 2DECA 4YY3B 1VSQA 2FFJA 2YICA 1GFIA 3VX3A 3ZC3A 1T91A 3WQSB 1W9MA 2IVFA 3BWXA 1UKVY 1AGPA 3R6GA 4G0ZA 4QEZA 5DNEA 1WY5A 3IVXA 4RY0A 5HIJA 2CF5A 4JEHA 1YA8A 4QG7A 3HJNA 4P81A 3ZQKA 4FFNA 1R0LA 3IVRA 5K0ZA 1G6OA 4HDNA 2AV6A 4UUAA 3BG5A 2I7DA 1T2CA 2QMHA 1U8FO 1SC6A 1YS4A 1MD9A 1PFQA 2I80A 3E7PA 3URKA 4HQNA 1F51E 2QSZA 5FOUA 2IYYA 4HKTA 4C03A 1GM5A 3H5WA 4ER7A 5HBRA 1G17A 4IIJA 3A3KA 3OQNA 4DXHA 4Y2PA 4FCCA 3EIOA 1MNAA 4HUQB 4UVIA 1W36C 2HXSA 4IIBA 2ID7A 3PQFA 1Y82A 2VEDA 4W5HA 2DEUA 5C80A 1E9AA 5CGZA 3R7WA 1X94A 1PR3A 3GUZA 3M9LA 2DH6A 3O3OB 1H4VB 1LLCA 1ORHA 3QE0A 1L9XA 1ZN2A 2E1PA 5C1OA 1U5BA 5LLTA 3EEBA 2IEYA 2H08A 4GPTA 2AHOA 1HT3A 1HETA 3SAJA 1G21A 1F9EA 2HA7A 4AD8A 2QKYA 1QHIA 4B87A 4D8XA 4QTXA 4NHOA 2E21A 4HGNA 5AVZA 3M33A 5KYXB 1NJ6A 4A7PA 3LUFA 2C2OA 3COVA 3EVTA 4UW9A 5DGXA 1IE3A 5BN5B 3ZU3A 4N82A 5DHUA 2M32A 4LGCA 1EFRD 1FMJA 2CCKA 2K87A 1PGOA 5E3JA 4H6XA 1C0LA 4U5XA 3ZTWA 2D6FA 4FS3A 4XR9A 5KVVA 1E0SA 4BNTA 3B5EA 2H1HA 5AUNB 1RWWA 2ZBPA 2ISQA 1L7AA 2GTPA 3KIPA 1XCOA 3CEJA 4MPRA 1K1EA 3LHDA 3NVDA 5KWJA 3N9IA 1NBOA 3DONA 3G2LA 4BO9A 5B57C 1M10A 1GVNB 2HJHA 2P35A 1J21A 3AERA 5H3HA 3ZX4A 5AHXA 1OTHA 4KR0A 3B2NA 2DZDA 1X7HA 2IJGX 4V03A 1QLWA 2BJWA 1VE9A 3EUEA 3O82A 4GLOA 4QU0A 3VR4D 3NAQA 1TO6A 3H99A 5BSEA 2HK9A 1FXWA 4IVRA 2ZYRA 4UAGA 1NOKA 3QOWA 5EJEA 3H3FA 1ZR4A 4UUMA 3RAJA 2B4QA 2CNWD 2DBRA 2HI0A 3WWPA 1S1CA 1P0PA 1XRQA 2Y9PB 4MR8B 4NMLA 1J2JA 2QN2A 3ZTTA 3HU3A 4Q4HB 1FIUA 3GA5A 1Q19A 3O47A 3RTCA 1DZIA 1RLIA 1NR5A 2LV8A 3X1KA 2AVDA 3OZEA 4PQRA 4AY6A 4RK6A 4M8SA 2HUPA 1EVQA 3JXEA 4RMIA 4LRYA 4IYRA 4NBVA 4YAIA 1MXFA 2O2IA 3NHBA 4RZ2A 2GRAA 2QI9F 1MQSA 4QA9A 2HHJA 1IM5A 2QL5A 4NPHA 4WK0B 1HQCA 1JLHA 1K6XA 4D81A 1W36D 5TQ0B 1W48A 2HF8A 3VR6A 4HGOA 1IFXA 5C4IA 3AR2A 5KTTA 3UHFA 3KHSA 1BS9A 2MSCB 2JLRA 3G2JA 2O1WA 4UMVA 5CEJA 4IEEA 3VH3A 4AW9A 3NDBB 3FDZA 4EO9A 3L9XA 4IV0A 3OOWA 1O94D 2J30A 1ZQ9A 2Q2QA 2X8WA 4LDZA 3UMJA 3M3HA 2IV2X 4BBAA 3RHSA 4AYTA 1NP7A 2UV8A 1OGJA 3ASZA 4ECAA 3I6BA 5H0IA 1VCHA 2C92A 1NBEA 4OIMA 2VXOA 3RJ9A 4CTOA 2NTEA 1D5WA 3UJCA 2GPAA 3IEKA 2VDKB 3PNMA 1RXIA 4ONEA 4PYNA 3AJAA 4UPEA 5BNWA 1NDUA 3TM4A 2BTOA 4YECA 4NNJA 2XA2A 2OCPA 1UBCA 3CO5A 4WIAA 2R5FA 4O4JF 4ZT3A 4JGIA 4JJKA 2GCNA 3CKMA 4K9LA 4WCFB 4WZBB 1XZCA 2VUTA 1V9CA 5AXAA 3ZNOA 5F2NA 4KODA 1YJXA 2A0YA 4YCDA 1F7UA 1HG1A 3UOWA 1VFPA 1Q1GA 5K0GA 1GSHA 5EKSA 2NO1A 4QDTA 1UXOA 1VL2A 2IYPA 2YVLA 1PBNA 1JQKA 1V8ZA 2AS0A 4K9KA 5EHIA 1G8HA 3CR7A 3QU5A 1IULA 1JBQA 4AVYA 1IBKB 4X1YB 4MSUA 1SKYB 1X8XA 2ZBGA 2MWMA 1L5HA 2JG3A 1CEYA 1UOEA 1WLSA 2HDOA 3W3AD 5JEEA 4IQFA 3RUIA 3VHXB 1KMCA 3NJRA 3ZU6A 1BXKA 5FI5A 3UWOA 1E5TA 3ONNA 4PE5B 5EP1A 4EFLA 3AVXA 1QU2A 5JI2E 1EM8A 3QPCA 1BGXT 5BSVA 4C2TA 4QNMA 3W5IA 4AJ2A 4XCQA 3KR0A 1H4QA 1KAMA 4DV6B 1ZGHA 2RCYA 1MOZA 3VVMA 1RS0A 1XUOA 3NB0A 3T7DA 2CJFA 1E58A 2QL9A 5LC1A 5FBKA 3GRAA 3VR6D 2ZUSA 2FEAA 2XH8A 2XWPA 1RHKA 3EA0A 1GNTA 4JJEA 4MCIA 4TRRA 3PVZA 5JFTA 4WNAB 4HD8A 1EBFA 5DEOA 2XIQA 4GLFA 4AZTA 1SHZA 1T26A 3GARA 1C8KA 1WDTA 3G2HA 2NM0A 4ND7A 2IPMA 1UPBA 4G8DA 2GAAA 3ILSA 2QXYA 1WOYA 4X92A 5JLAA 3W4KA 3WGKA 1ZMTA 3OZVA 3TECE 1O6BA 4IH4A 3AW9A 5A04A 4J0FA 5KHOC 1GGEA 3OHPA 3FZQA 5CLQA 2BUBA 3ICVA 4RK0A 1P73A 3EBOA 2XNSA 2WW8A 1XPOA 1DIAA 2ZYTX 5T64A 3U0VA 1BEZA 2O8CA 1JFSA 1FTSA 1W5SA 2NXWA 2OUKA 1N3YA 2RKBA 4L4UA 5FPTA 1YZNA 2V74B 4TXMA 4ZMRA 2ZROA 4UBIA 5D85A 3OPYB 3L01A 5DGIA 1D4FA 1JL3A 1HI9A 1JG4A 3LNCA 2QYSA 4HFRA 1WUKS 3H5RA 4FILA 4UASA 4JI1B 5C2JB 5DHPA 2ZIXA 1RE0A 2F8TA 5CDGA 1WCXA 3H13A 4X3CA 5DM1A 4O4JA 4TLCA 2QT1A 3CZAA 2H1FA 2VG8A 2XXAA 3N6VA 4LMAA 2ZSFA 4CG1A 1LF0A 1I0ZA 3NBFA 3BN3A 2ZDGA 3ELDA 4QGFA 4LX0A 4UHKA 5FPSA 1N92A 4ZVOA 1LCIA 3I9OA 3V1LA 2JLUA 1TAQA 1R0WA 4DZTA 1M1UA 3NV7A 4HI0E 5DVZA 2ATCA 3CB2A 3A10A 4FKMA 1NRIA 3EGCA 1NJ5A 3ANSA 1AQIA 1CUVA 4MV4A 1CHDA 4Q7KA 5CD1A 3NOOA 4R5MA 2UYHA 4WUTA 1TL7C 3NT5A 5E6SA 5LOVF 4X5OA 2WU8A 4WA7A 4W63A 1TU0A 3UC5A 3VPSA 4RSGA 5KOIA 3OM9A 1BMQA 3F4KA 3LX8A 4FC7A 4E3ZA 2C7RA 1E2MA 2XYQA 2QOEA 4TN1A 1VKHA 3UW1A 3FWPA 4HDKA 1ZUNB 3VO8A 4EA7A 1MH9A 3NNNA 2ZB2A 4R6XA 4E6PA 2IYWA 3WLOA 1Z22A 2MJLA 3TTXA 2I3DA 4KQXA 1K6EA 5CFNA 4S04A 5L4NA 3FUWA 3D3NA 4RF2A 1AF4A 1DO2A 4A0SA 3CU5A 2AEEA 4XKJA 4C6TB 2DB3A 2XDWA 3FJYA 3ZBQA 3FNIA 4CU5A 4K0KB 4TS9A 3JYPA 5TMDA 3BA6A 2HNBA 4ZRNA 1ECGA 3EQ9A 4LHEA 4W7IA 3ZQ6A 3K8YA 4YIKA 4EG7A 3FUVA 2F17A 4DLPA 1K6IA 3BIXA 1BEEA 2BAGA 2PX8A 1Q2XA 2PQ6A 2F7SA 1A7KA 1NXXA 4EVSA 1ZD2P 5JVDB 1MRZA 1C7EA 1FJ2A 2CJXA 1M8JA 1ZUWA 2AIRA 2VTKA 3KCQA 4R51A 1E3WA 1ZPDA 3GZTB 1UDBA 5JSQA 1VB5A 1ZN7A 5BMVF 3SBEA 1V7QA 4H7FA 1TM3E 1EUQA 1L9KA 2PV7A 2E5FA 3L1VA 3YASA 3ANTA 4K8RB 2JGJA 1OXTA 4JYCA 3PUXA 4YRCA 5LM3A 3QG1A 1ZESA 2GZSA 2PX6A 4KWTA 4ASUA 1X1TA 3KYCB 1X2BA 1UIMA 3IKMB 3L0ZA 4FFBA 4FEEA 4NU5A 3QVVA 1EXNA 3I6MA 1MDFA 1CUHA 4HAUA 4MCAA 2B1QA 4WXEA 3KQNA 3R0VA 5E3HA 2VS1A 1W94A 1AGNA 4MW5A 4CMAA 1XX6A 2BGUA 5T3YA 2QRVA 1B6TA 1FXSA 1DUIA 1MGPA 4BC1A 5IJ0A 5DM70 2EW2A 1CJKC 3FPHA 3OP1A 4TYWA 3K9NA 4IIXA 4QREA 3CNOA 4NC9A 2FSIA 4BFUA 2ZM5A 4I1PA 1P4RA 1R0ZA 1BA2A 5JAMA 1RBMA 4OHRA 4XOIA 3ENKA 4LOIA 2BTQB 1SM4A 3VC3A 5KPJA 3KYBA 4Q3EA 2CNKA 4FYXA 5CITA 1RLUA 2AKEA 4KNVA 1YDFA 3MZ0A 3WGNA 1S2MA 3UM9A 3QBDA 2CD7A 2OWDA 1JDBC 3ELYA 2IHJA 4Y1GA 3K2BA 2D3WA 4DDKA 1I7SB 3BGOS 3IIJA 3W7AA 2W2MA 3I0NA 2ZOSA 4QBTA 3KQPA 5EP2A 2AMVA 2MYPA 2RH8A 2FZKA 4RSRA 5FH9A