3GHHA

Structural insights into the catalytic mechanism of cd38: evidence for a conformationally flexible covalent enzyme-substrate complex.
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
238
structure length
238
Chain Sequence
NRWHGAGSTADFQKIIQERCDTYTQTIRPGSRSRNCQAIRQAFMSAFISKDPCKATKEDYNSLINLAPPTVPCGQQVFWSKTKELAHEYAKRRRLMTLEDTLLGYLADGLRWCGEPGSSDLNIWSCPDWRKDCRTNYLSVFWEVLSERFAESACNTVRVVLNGSLENAFDSMSIFGRVQAPNLRPQVELEAWLVHDTGKPPSDSCSGSSIRKLKSILDGRNVKFRCMDNLSRDQFLQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ecto-NAD+ glycohydrolase (CD38 molecule)
publication title Insights into the mechanism of bovine CD38/NAD+glycohydrolase from the X-ray structures of its Michaelis complex and covalently-trapped intermediates.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 81
structure length 238
sequence length 238
chains with identical sequence B
ec nomenclature ec 3.2.2.5: NAD(+) glycohydrolase.
pdb deposition date 2009-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02267 Rib_hydrolayse ADP-ribosyl cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.82.10 Mainly Alpha Up-down Bundle ADP Ribosyl Cyclase; Chain A, domain 1 ADP Ribosyl Cyclase; Chain A, domain 1 3ghhA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ghhA02
3EK2A 1PL8A 1JKIA 4MO2A 4CUJA 4CV3A 4BNWA 3LC2O 4I5DA 2J8ZA 3RJ5A 4Q9NA 1HDXA 1I2ZA 3AUUA 5ADHA 4YAEA 4TRNA 4ALMA 3L4BA 2HJSA 3Q9NA 3JYOA 3IL2A 3KO8A 3FN4A 4HFRA 5C5IA 4TQGA 1A9ZA 2GLXA 1NYTA 3GNTA 1X0VA 2A92A 4GGOA 4K28A 2I3GA 1E6WA 5KVVA 7ADHA 2ET6A 3PHHA 5AXDA 4CQMB 1BVRA 3H9UA 4Z0HO 2BRUA 1U1IA 1ZSYA 1HE3A 1IB6A 3I52A 3LSYA 3MTJA 3KYCA 1E92A 4R9SA 1NHWA 4DUPA 3TZHA 1A27A 1Y9EA 4XCVA 1MV8A 1NX6A 3PFFA 2JFGA 4CUKA 2H1SA 4IS2A 1EK5A 2I76A 5B4VA 4BO6A 1DHRA 1F0YA 4DMLA 3OA0A 3PWKA 3JQGB 4FFNA 1HZZA 4KUHA 1GV1A 2EP7A 5CDGA 3S2GA 5A02A 2BI7A 3AY3A 1YL5A 4O59O 2YV3A 1YOVA 1O0SA 2O3TA 2P9GA 9LDTA 1UAGA 4ND4A 1KVQA 1DO8A 3RBXA 4YJGA 2WE8A 4IJKA 3QLJA 4EBFA 1PJ2A 4R4JA 3IC5A 3H9QA 3RI3A 4RDHA 3NRCA 3NTRA 2D8AA 3PYLA 4PG7A 3HWRA 4KP7A 3HN7A 1DC5A 2J5RA 1UP7A 1VLLA 5HWSA 5DCYA 3IUSA 4HNHA 3E5MA 1EFLA 1YL6A 5F1OA 3CUKA 1D8AA 2FR0A 3GGPA 2D4AA 4YVFA 3AI1A 3UUWA 3WGZA 3VPHA 3PYMA 1G0NA 1T1SA 2A4KA 2DQ4A 3KYDB 3S2EA 3E18A 2Y68A 3H3JA 4CJXA 4XGIA 4QQRA 2BLLA 4J90A 5ER6A 2QX7A 3B20A 2VNSA 3H5AA 1YQDA 3FPLA 5COBA 1H9BA 4B3IA 4N7RA 1LI4A 1JWAB 1EE9A 4TSKA 2JHGA 4IDBA 4BO0A 2CF5A 2AEFA 3FNFA 9LDBA 4U5QA 1MFZA 3DTTA 4UVEA 1LEHA 1VJTA 2DVMA 3P7MA 3L77A 3TOXA 3RSHA 4CM8B 2I5PO 3OEYA 2O3SA 2B0JA 3PIDA 3SC6A 4N54A 2V6GA 3KYCB 4XD2A 3WTBA 4OSPA 2XAAA 1J0XO 1PQUA 1QRRA 3DBRB 4NI5A 3WYBA 4Y98A 5T64A 5IJZA 2YV1A 1PZHA 2O7QA 1HDCA 2VTDA 2NM0A 1EVJA 5EIOA 3PJGA 1KYQA 1U4OA 1HXHA 4I9HA 1K5HA 3HN2A 2FWMX 4BNKA 4C7JA 1EQ2A 3U09A 2ZQZA 1E1KA 5DOZA 2ZTLA 1CQIA 2GERA 3QW2A 1WZEA 3ASUA 3MZ0A 2ZYDA 3GQVA 5KKAA 1W6UA 2GD1O 1SCUA 4FSHA 3WMXA 1WVGA 4DREA 1UJMA 4NFYA 1UXKA 4HX5A 5CG1A 8ADHA 4LMPA 4IJWA 4U6QA 3WBBA 3ST7A 4PLZA 1LQTA 1ZXBA 4BQRA 4G81A 3SX2A 3PJDA 2GZ1A 5DBGA 2VOEA 5T8KA 3W8EA 4INAA 3GOHA 2HMWA 4B7CA 2VRBA 1PR9A 5DP1A 5JNLA 1HLPA 4XDYA 1JKFA 3P2YA 1NPDA 1MP0A 2IDZA 4B79A 2Y05A 2VOJA 1YB1A 1B8VA 1PIWA 4UVIA 3JCZA 3JQAD 3R0IA 1I30A 4XYMA 1OC2A 5DN9A 3GY0A 1PX0A 3SEFA 1DIGA 4OL9A 4OKIA 2ZJ0A 5GY7A 5C3MA 2YFHA 4HFJA 2Q2QA 3LLVA 1UXJA 2DBVO 4MIEA 2PD6A 2VZ8A 2PH5A 1BXKA 4LISA 1NFQA 1H2HA 4YR9A 2GUGA 1Z6ZA 1SPXA 4GX5A 4TWRA 4WEOA 3WMWA 3Q2KA 5L9AA 5A9SB 3BHMA 4DPMA 2V6MA 4IDCA 5ES3A 4XRRA 5IZCA 1PZFA 2LDXA 3WTCA 3HDJA 3OICA 3KVOA 2EJVA 1ISMA 3LF2A 3TZQA 1I8TA 3JQEA 2CF6A 3TNLA 4N5MA 2PGLA 4QT0A 5EMHA 4MP8A 3P19A 1R12A 2IE0A 1U3UA 2UYYA 1RM5A 1Q7CA 3WWZA 3OQ6A 1X1TA 1A4UA 1AXEA 1KVUA 3JQCA 1N2SA 2R00C 2ZB4A 1CWUA 4MVJE 3ZWWA 5AVOA 1HLDA 2BGKA 3DL2A 3VVBA 2HMUA 1ORRA 3V2UA 1E1MA 3WNVA 3U3XA 1I0ZA 4NG5A 1JVBA 4D42A 2C5AA 5DCWA 3K31A 5TJ9A 4FR5A 2EXXA 4URFA 5HS6A 1GU7A 1C0IA 2XOXA 1TT7A 1OFGA 1J49A 1HYHA 3DBHB 3Q3CA 3HDQA 3FRJA 3IP3A 4JK3A 3V1YA 2OFPA 3GNSA 3EVNA 5K6AC 4KWIA 3L9WA 4B4UA 4GWGA 2NTNA 1F8GA 2W2LA 3ZWVA 2WYUA 1U2GA 2GO1A 1A71A 1T26A 2G82A 1C0PA 3JD3A 2P68A 4X54A 3PFWO 3H8VA 2O4CA 3GEGA 4WLNA 4BV8A 2ZTVA 5KNLA 1C1XA 2D1YA 3A9WA 1UZNA 3DOOA 1BSVA 1UP4A 2JAPA 2WMDA 4D44A 2PK3A 4TROA 2PR2A 2DUUA 4R1TA 5L4SA 1GYRA 1VRWA 3GAZA 3GGGA 4ID9A 1V8BA 3JD2A 3BTOA 4J7XA 5H82A 3UGKA 5JCJD 2FZEA 3GDOA 3MCVA 3JYPA 5L7TA 3WGYA 3I9MA 3IIEA 1M2WA 1X7HA 5JDIC 1NQOA 3WQSB 4FC6A 3IUPA 2NU7A 3S1LA 2EV9A 3HFSA 4BNNA 4PRKA 3UCXA 1BGVA 4DYVA 3ZH2A 4DLAA 1ONOA 1PEDA 4WJZA 2QG4A 3WYEA 2XXJA 4J2OA 1F8FA 3ZWYA 3WIEA 1G6KA 1P1KA 4JROA 3LDHA 4M55A 3H4VA 3PZBA 3WOHA 3MJSA 1DJQA 4R16A 3H2SA 4NNJA 4GI2A 2IYPA 4I5EA 5TT1A 4D45A 2Y0DA 2EKQA 5HA5A 1HDOA 4PG8A 5JMWA 2YZ7A 3NT5A 2AEJA 4ZICA 3TZKA 4YYZA 3NJ4A 3E82A 5H81A 3VZRA 1SEVA 3F9IA 2B4QA 3CZRA 3ZWBA 4WCFA 4IM7A 1T4BA 3DTYA 2ZTMA 1B26A 4L9RA 3ROKA 4S1VA 3DAPA 2X22A 4GX2A 2ZCUA 4CM3A 1LDNA 5F3RA 3HZZA 3GC6A 3V2GA 1EBUA 4K1LA 4AVYA 2C0CA 3NDIA 4OSOA 5JW6A 1QORA 3AI3A 3MEQA 4OOEA 1PJQA 1V9LA 4HFMA 1T1RA 5C7OO 2WEKA 4LK3A 5FFFA 5IG2A 2Q1SA 4UEJA 4KQXA 3WGIA 1ISHA 3AOEA 1HE2A 4AJJA 1CEQA 5CDYA 4Y8VA 5A06A 4RCVA 5LDGA 4CR7A 5KVSA 2D5CA 4CMEA 3JQAB 3E8XA 1E3WA 4M8SA 1ZK0A 2PD3A 2O3RA 3C3XA 2YUTA 2VCYA 3GDGA 4DPKA 4E2ZA 5G2OA 4UVHA 2D0IA 2E6UX 2HDHA 3V1TC 4RVHA 1E1NA 1ONNA 3B1JA 1OOEA 3KSUA 4BOYA 3FBGA 3FNGA 4A26A 2VQ3A 4MOWA 4DLLA 1HDYA 2I66A 1XQ1A 1PZGA 1HF3A 1S7CA 5G4LA 3ADPA 3MOGA 1IOLA 2W2KB 2Y1CA 2X9NA 1UAYA 2Y93A 2ZYGA 4W99A 4JQCA 2JD1A 3D4PA 3IKVA 3VHRA 3WG9A 3GEDA 1J4AA 3PDUA 3S8MA 2J3KA 3GN2A 3OJLA 1ZCJA 1P77A 4BKRA 3LVFO 4P4NA 1HYEA 2NLOA 4Z0PA 4OO3A 4YA6A 1FDSA 1WLYA 3D64A 1FDWA 3VH1A 2H5LA 3CIFA 5A9TA 2Q49A 2D5AA 1M6WA 5CEFA 4GWKA 1N1EA 2AG8A 3WGTA 1P1IA 1E7WA 1YBVA 4IIUA 4GPD1 1P1FA 2HRBA 2O2YA 1AXGA 3NGXA 4WCFB 5CP8A 3MWDB 1VSVA 3RUEA 2FY8A 1UZMA 4D41A 1R4MA 3GPDG 1LNQA 3TJRA 3G0OA 2D2IA 3BMCB 4IZHA 1DLIA 1HWYA 4BGUA 1ARZA 4L73A 1OZAA 1LX6A 3L4BC 3WFJA 3QVSA 3AJRA 4QXMA 2ZKLA 3K9QO 3NAQA 1RYEA 4PLYA 2EP5A 4RQTA 1HDZA 3B1FA 1RKXA 5CG2A 1K3TA 4NBWA 3JD0A 2AQ8A 5JMPA 3ZU3A 3L9XA 2PLAA 3WLEA 5F21A 1LTHR 1LLQA 5BT9A 4TMFA 4EEXA 3UHAA 3JYQA 5CFZA 5I9NA 3I9KA 3ZHXA 5BSEA 4FC7A 2GN6A 2CVOA 3ZI0A 2PFGA 1ISGA 3LT4A 3QWAA 3RUFA 6LDHA 4OGWA 3AM4A 1C14A 2ILTA 2RCYA 4XQ9A 2QHXA 3EAGA 4F46A 1LLUA 5B12A 4A03A 1H5QA 4H16A 4TRJA 4KTVE 1JTVA 1MB4A 4CV2A 3D5TA 2HMTA 1IYZA 2C20A 2PTGA 3GR6A 4LSWA 1W73A 3VAZA 4PZDA 5B4TA 3HHPA 4QSMA 3QE3A 1LSSA 3KB6A 1GEEA 1P0CA 1SOWA 3EZYA 1PS0A 3OJEA 4GL4A 5AXAA 1HSZA 4B7UA 4E5MA 5I7EA 3CMMA 2YQ4A 5AOVA 4A7PA 2A9FA 1ID1A 2HMSA 5A03A 5THKA 3BMOB 2HQ1A 1IHYA 4UVDA 3U9LA 3WDSA 4YEDA 4IXWA 2Z95A 5TT0A 5BSFA 4K6FA 3ROPA 1RWBA 1TXGA 1IPFA 4E5NA 5EQFA 5JCXA 1R4MB 3RC9A 2DU8A 1UDAA 4MKZA 1CETA 4BO2A 1YQXA 3H3FA 4JJGA 2WSBA 3PHGA 1ZJZA 3C7AA 2OMEA 1WPQA 3UCEA 3ZW9A 5J23A 3FPCA 4GGPA 3SLGA 4R68A 3QP9A 4FD3A 5JSFA 1ZEJA 5L95A 5JYEA 5B4UA 1PQPA 3JQFA 3D4NA 4ZJUA 3KOUA 4IGEA 2TMGA 1GCUA 3RFVA 2ZATA 4MPDA 1M6HA 1NFRA 4XWYA 4CMCA 1ADBA 3OBBA 1MG5A 5CAEA 5CHEA 1IHXA 5A4DA 3DZHA 2C54A 4AJLA 5ER9A 1O6ZA 1ZSVA 1Y7TA 3FCOA 4JP3A 4L4RA 4Q3DA 4IIVA 4CLXA 5JDCA 3AFMA 1D1SA 3EY4A 2V7PA 3LYLA 4R1UA 2CDBA 1P31A 3JQDA 4M89A 4WASA 3ZU5A 3S2FA 4KWHA 3VKVA 3E9MA 1H6BA 4EW6A 2WD7B 3L0DA 4E13A 5KJ1A 1SEPA 4YTEA 4YRDA 2HO5A 5IXYA 2FSVA 1LBEA 3I4CA 4AJNA 4FFMA 2GR9A 4PLHA 4BNTA 2HAEA 5COAA 5TGDA 1B15A 4IXTA 2JD2A 3M1LA 4RV9A 5DZSA 3N74A 4CQLA 1ENOA 1EVYA 1NR1A 2DKNA 3BMQA 4EGFA 1YO6A 1LDEA 1T25A 3BTUA 1XKQA 2P5UA 3WYCA 4BMSA 2TMDA 2DPGA 3FWZA 4OYRA 4A27A 5T8KC 3OMLA 3AK4A 5U4QA 1PWXA 2DLDA 4DC0A 4E21A 4E3ZA 4YDRA 1XEAA 2CD9A 2PD4A 3ZZNA 1UP6A 1MC4A 1BW9A 3ADOA 3CXRA 4J6FA 4OQZA 4UUPA 1WDKA 4JP2A 3ZGYA 4A10A 1PSDA 4JN6B 4WLUA 1ZK1A 4IPTA 1M67A 4YCAA 2X7HA 1OAAA 1N9GB 1EUDA 3NUGA 3B6ZA 4MINA 4A2CA 1X7GA 2RBEA 1I2BA 2IZ0A 4J1QA 4IJUA 4ALKA 1Z45A 2OP0A 4FPXA 4CV1A 4E12A 2VNAA 4E31A 4BQPA 3NEPX 3INRA 3QSGA 2B5VA 1EK6A 1S6YA 2WYVA 4U7WA 5U9CA 1T2CA 3D4OA 2WD8A 4GLLA 5DCUA 4EUEA 1JN0A 2BMAA 2UDPA 1WAMA 4PLVA 4IUYA 3VH2A 1GUZA 1X13A 5IZCC 3ZU4A 4BNLA 1VSUA 3U4HA 4IDAA 1O89A 1WDLA 4AJ2A 1P1JA 3KM0A 4MP6A 4J9UE 5BR7A 2HK9A 3B70A 4QUKA 5I7FA 3VOSA 4RVUA 4E5KA 4NU6A 5FEUA 3I9JA 1B3BA 4XZ3A 3QWBA 1PWZA 4RDIA 4RF2A 2C7VA 3TOZA 1E5LA 1ZK3A 3WQRA 1NWHA 1LU9A 1Y8RB 3ZWNA 4K6CA 1HDGO 3WR5A 3A06A 4JBGA 3EGOA 2PV7A 3H65A 1DRVA 1GZ3A 3AFNA 4CLOA 4RLSA 3O8QA 3PTZA 3VTFA 1V3VA 4DXHA 4MVJH 2JCVA 1L1FA 4MVJF 4IS3A 3PWZA 2C82A 1ZO8A 4AICA 3I4FA 4R54A 3W1VA 3WFIA 4G65A 1PS9A 3EDMA 4EI2A 3SC4A 4LVUA 3RFXA 1DC3A 1MC5A 5L53A 4YJFA 3F5SA 4YBZA 3DBLA 4GVLA 4DTIA 4OXKA 3UXYA 1BTOA 4AJPA 1PGOA 3BMNB 1WMBA 1OBFO 3G79A 4TKLA 2HU2A 1KVTA 1GQQA 1BDBA 1ADGA 3KRTA 2YFQA 3LT2A 5KJ6A 3DZKA 1NXQA 1VKOA 5A1TA 5TJHA 5BNIA 2VUTA 3TDKA 3GG2A 4Q3CA 1YB5A 4ZQHA 5L4NA 4OMUA 1LRLA 1R16A 3STHA 5L45A 1T2EA 4NZ9A 3PI7A 4IQ8A 1ZK4A 3SBOA 2AMFA 1D7OA 3KSZO 1CDOA 2RAFA 4B3HA 1CQJA 2BGLA 2CVZA 3VPSA 4N18A 2QRKA 3INGA 1MG0A 5F1PA 2RH4A 4IY1A 4OKNA 1PJSA 4D3FA 1IUKA 4KMSA 3AM5A 1H6AA 1J5PA 1N1GA 1O9BA 1RJWA 1M76A 2EERA 1F12A 3HADA 4R41A 1ONPA 3GVPA 1NHGA 4WCFC 2Q4BA 2VZ0A 3PQEA 4BNIA 3ZWPA 2VWHA 3I6IA 3UFXA 2VYVA 1XA0A 2BD0A 2I9PA 3O8QB 2A35A 2P9EA 3GEMA 4XKJA 4XX0A 2CFCA 4AJOA 1PU2A 3BA1A 3CSDA 1E77A 4DGSA 3MJVA 3DZGA 1CYDA 3PHJA 4NK4A 2QZZA 3BZUA 1BMDA 4J7CA 3OJFA 1KEPA 1VL0A 4YRAA 4XB1A 3JQ6A 4E6PA 2Y66A 3KETA 1K6XA 3EVTA 1Z73A 1EZ4A 1U4SA 1A4IA 2NQ8A 3AOEC 3NT2A 3C85A 4UVGA 3ZNNA 2NTVA 4NBRA 4RZHA 6ADHA 2HUNA 1EVZA 2HK7A 4CMEC 4G2NA 1V3TA 3D5QA 4UUNA 4BO9A 3DHNA 4C4OA 5L51A 1B8PA 1YOVB 1I5RA 2CDAA 2G5CA 1K0UA 2X0IA 3M2PA 2D3TA 3PLNA 2B4TO 2V6FA 1D4FA 4EZBA 4YJGB 1GYPA 3OIGA 3ZV4A 1BVUA 2BFPA 3JTMA 4Y6PA 4C7KA 4PIVA 2YJZA 3C1AA 3MJCA 1PR3A 4YT2A 3WGQA 4PFJA 3W6UA 4B3JA 2GCGA 2X1HA 2VZ9A 1HE5A 1AUPA 5JAIA 2DTXA 3U4CA 5FWNA 4IQGA 3OH8A 3M2TA 1ZMOA 2PGDA 4J4HA 4B7XA 4RPJA 1UXIA 3GLQA 2NTJA 1MA0A 1IPEA 4J2HA 1A72A 4RQUA 1LXCA 4O0LA 4XR9A 4YJHA 5K9ZA 3QQPA 1LDGA 4R9RA 4WLFA 2W2LD 2P9CA 3KHUA 4QO7A 2IRWA 3I6QA 2X9VA 1Q2XA 2GN8A 1C3VA 3RIHA 4B8ZA 4EUHA 3KEOA 3OQ1A 1PTJA 4LGVA 2NQTA 2NVBA 1YKFA 5CPFA 1ISIA 3JSAA 4A5OA 4BB5A 5H83A 4BHTA 1AHHA 4OXNA 4QTZA 2NU6A 2RIRA 1XR3A 4M54A 1QYWA 1XGKA 3G1TA 2PZLA 3UOGA 1MLDA 3LC1O 1CF2O 3BXXA 3DMYA 3HNPA 4DLBA 3KYBA 1YXMA 2O3QA 4UULA 5I7VA 4CLDA 3DFZA 2FPIA 2X6TA 5C7IO 4CLRA 2P4HX 1YQGA 1JVSA 2F00A 5TC4A 4NJMA 1ISJA 3KV3O 4RGBA 4RLHA 3RU9A 4J43A 4UREA 1RYDA 5BQFA 4FBGA 1I3MA 2JKVA 4BNXA 4I9NA 1X1EA 2FP4A 2JCXA 1KC1A 4LW8A 4CMGA 3HFGA 3IP1A 1KC3A 1B16A 4W4TA 3PDJA 2Q3EA 1U8XX 2PY6A 2A94A 5KOIA 4HADA 5BNTA 1K6JA 3TFQA 5EESA 4PN3A 1MXFA 2EW8A 2UUOA 3RVDA 3QWFA 3QV1A 3TRIA 1GZ6A 3AM3A 4BKOA 4CM4A 3ULKA 2YY7A 2DFDA 2H9IA 3VPFA 4HXYA 4LRTB 5CPBA 1CJCA 4DYDA 2VUSA 4MVJG 4BV9A 1DSSG 3E9NA 2OBNA 3IJRA 3WXBA 2E82A 5CDSA 4TRMA 4BL5A 2XF8A 5L3ZA 2W4QA 1LSUA 2O3JA 3WX0A 3Q6IA 2VTEA 3L4SO 1KVRA 1UXGA 3DO5A 2FRDA 1FF9A 1YJQA 1YS4A 1ZSNA 1U2DA 1I24A 1VI2A 3HDHA 4J16A 4CM9A 2WDZA 4XYGA 3RAJA 3DAGA 1ZH8A 2E37A 1XG5A 3WJ7A 4DA9A 4ZQFA 1R0SA 2EEZA 2AE1A 3G1UA 3AUTA 5LC1A 1A5ZA 1JLLA 3EHEA 1XELA 1RPNA 4I5FA 2G76A 2QYTA 4AFNA 2YYYA 1ZKMA 2DAPA 2X0NA 3A1NA 4QX6A 3IAHA 4CLRB 3H9JA 4JXKA 4QO8A 3I9OA 3TL3A 3W8DA 4O5OA 5L7WA 1NFFA 1JA9A 5JAZA 4BO5A 3I83A 3KZVA 3JD1A 1KIFA 3JQFC 2GYYA 3BIOA 3COSA 3PYXA 1QMGA 3ON5A 4ALLA 4HWKA 1YWGO 3RUAA 1LC3A 3VZSA 4EDFA 1DHTA 2W98A 4BNYA 3CMCO 1QV7A 3H7AA 3PIIA 1JQBA 5JLAA 3GRPA 3LF1A 3P2OA 2YDXA 3K30A 3H2ZA 3K2BA 2E49A 4NBTA 2QQ5A 4J91A 3ENNA 3RWBA 5JDCC 4D3DA 3MOIA 7MDHA 3ORFA 4WLEA 2JL1A 2AXQA 3GK3A 2EJWA 1Q7GA 4A0SA 4CM4B 3DB2A 3L6DA 4FGSA 2VUUA 2AG5A 4FFRA 1Y6JA 3RKRA 2NVWA 1E1LA 4Q3NA 4WECA 1TLTA 4JJFA 4BO3A 3T7CA 3VVCA 2C29D 1Q0HA 4H7PA 1R0KA 5JY1A 3IKTA 4KQWA 2NU8A 1IY8A 5F5NA 2WJPA 1C1DA 1VKNA 3FF4A 4BO4A 1U3VA 4N5NA 2D59A 3GVCA 4HKTA 4IMRA 5DNAA 5ENVA 1NPYA 2EIHA 3ZWOA 1HYGA 2EHDA 2J5KA 2WWRA 3CH6A 3IJPA 5CDTA 3OIDA 4CL8A 4D0SA 2BH9A 1HTBA 4R1NA 1C1XB 3H6KA 5HS4A 2HJRA 3IS3A 2PA3A 4J1SA 4OJNA 1NR7A 4YAJA 2EW2A 5KTKA 3OFSA 3OJ0A 1JAYA 1UXHA 3WWYA 4FS3A 5HRUA 4ZA2A 5HTOA 3FD8A 1GAEO 2GRAA 2VWGA 3ICCA 3ZHYA 4R69A 1SMKA 2FZWA 4ILKA 4N5LA 3ZV3A 1I3NA 2J3JA 4GX1A 2B69A 2B83A 5JC1A 5T67A 2X58A 2Z1MA 3ZWXA 5U1PA 2DM6A 3AU9A 3ETGA 4YQYA 1P33A 3OIFA 4P8RA 1L7DA 1NP3A 2Y1FA 4CUZA 4P38A 5GZ3A 3AY7A 1YDEA 3ZWMA 5CDUA 3OF2A 1DPGA 1U5AA 5IZ4A 3K6JA 1H0KA 3WGGA 3DOCA 4I9UA 4WNCA 1R66A 4IZIA 4MP3A 4KUGA 3UN1A 4HBGA 2J3IA 5IDWA 1Y9AA 1O5IA 3UICA 4B4WA 2YHUA 3G3EA 4M87A 4BNHA 3VKUA 1DRWA 4EJMA 4F6CA 1YGYA 3NKLA 3SVTA 2EKPA 3T4EA 2WTBA 3W8FA 1A9YA 2HKIA 1B14A 3EMKA 3BAZA 5I8WA 2RHRA 4KDEA 1KVSA 3ZNQA 2HRZA 3IMFA 3R6DA 5LCXA 2NSDA 4J3FA 1RM3A 1ZVMA 3E9QA 5BSGA 1DIRA 1R37A 1YL7A 3F4LA 4NJOA 5TNXA 3WS7A 3A14A 3I3OA 1VM6A 4ALJA 1NVGA 2DBQA 3NTOA 1NM5A 2LDBA 4BMNA 1PGJA 1DOHA 4IDFA 3VZQA 3C24A 4ND3A 4ZQEA 1B0AA 1E3WB 4BVAA 2QZ9A 3FTPA 3VC7A 3VH4A 3QJ5A 3DZBA 3I9NA 3OHSX 2VHXA 2VHZA 4WKGA 2Q99A 2GDZA 4CM7A 4CODB 3ZCXA 3ZW8A 3Q1LA 4FCCA 4F45A 1JU9A 3DR3A 4NFSA 1NBOA 5I9LA 3GUYA 2GASA 4QEDA 3VDQA 1H94A 2HSDA 5LDHA 1D3AA 4ZQGA 4AG3A 1TB4A 4JIGA 4BNVA 3D3WA 4ZGWA 3C7CB 1N5DA 1OC4A 1T24A 2I99A 4O63O 1R4NA 4MKXA 2NACA 1PL6A 2E4AA 3AUSA 5HBRA 4Z0TA 1I01A 1C0KA 1X15A 4IDDA 1SZJG 4I8XA 1QLHA 1H6CA 1WDMA 4FFPA 1ZW1A 1HE4A 4OHUA 1PJBA 4YT5A 5GZ1A 1YBAA 1H2BA 4PG5A 3JQ9A 4R3WA 2VT2A 1O8CA 3ETDA 3QWIA 1BXGA 1MUUA 3K8ZA 1KS9A 4U0KA 4J4BA 3DZIA 3I23A 2YHIA 4GSLA 3H9EO 5EINA 3GGOA 1J6UA 3RQSA 3N7UA 3O38A 2I6TA 2I65A 4BKUA 3MJTA 2G17A 4NMHA 4WCDA 4FJ2A 2GZ3A 2FR8A 3U62A 2R6JA 1QLJA 4OM8A 1B7GO 4XQEA 4CM5A 1N7GA 4OH1A 2UV8A 1E6EA 4ITUA 2Y99A 3NDRA 4PZEA 3FWNA 4W6ZA 4EUFA 4YT8A 3F1KA 1AGNA 1QYDA 1V3UA 2W90A 4R3NA 4NHEA 2Y0EA 2Q4EA 4OXYA 4LCEA 5TSDA 1XU9A 4BUCA 3OSUA 2X5KO 4DQUA 2RH8A 2WM3A 4BGVA 3KEQA 1NASA 1QYXA 4EJ6A 1DAPA 2C2YA 3PHIA 3UKOA 2ZJ1A 5G4KA 4IBOA 2OUIA 4F3YA 2HLPA 5ITWA 4D3SA 4DBZA 4S3MA 1DIAA 1I10A 2AQKA 4WUVA 4L75A 1HSOA 1KY4A 1CERA 4ZQBA 5DBIA 3WQQA 4P4GA 4RVFA 3LC7O 2EKLA 5ILGA 3GPIA 1NQTA 1R4NB 4J7UA 1P74A 3H5RA 4W9NA 1WZIA 3TSCA 3JV7A 1KY5A 3B1KA 4R01A 5KJFA 3GFGA 2O4UX 4XGNA 4CMAA 4ROSA 1QG6A 2ZB7A 4K26A 4PGFA 4XQCA 3C7DB 5G0SA 1R6DA 1DLJA 4RF3A 3H5NA 4CV0A 3JQ7A 3F5QA 1YONA 3K92A 3PRJA 4CMIA 4TZTA 1G1AA 1IE3A 1GCOA 1SB9A 2QRLA 2B36A 3OECA 1P3DA 2C59A 2J5QA 1UDBA 5ICSA 3QRWA 4E32A 2PZKA 3RJ9A 3ONDA 3GVIA 4ND1A 2B37A 3HQ4O 2Y1EA 1GD1O 1QV6A 1TEHA 1A7KA 4MKRA 4II2A 1QYCA 2JFFA 3HJAA 4B4OA 1DIHA 2GN4A 1VL8A 1ZMTA 1PGNA 3AU8A 3C8MA 3PGXA 5A04A 4ZVVA 4HUJA 4CQMA 4Z3KA 3BHIA 1AE1A 2PNFA 3EYWA 5EJ2A 4GAEA 4DQXA 4XIJA 3F4BA 2QW8A 5IAAA 3NX4A 1E0DA 1CRWG 4BB6A 4BNZA 3D0OA 3WICA 2NVUA 5I9MA 4R5MA 2X5OA 5JE8A 3DQPA 3ASVA 2W8ZA 3DONA 3WJAA 5A3JA 4LMRA 3NT4A 4MVJA 2BELA 3V8BA 2BKAA 4IDGA 2JCYA 3MJ4A 5AXBA 3WBFA 3I9LA 2Q45A 3U4DA 4HV4A 4FN4A 2IEDA 4FQ8A 4E33A 4NBVA 5L4LA 4XJTA 2OBYA 3S2IA 4IDEA 4YAGA 4J49A 3GZ4A 2VYVD 3P5SA 1ZNQO 1NAHA 4RF5A 1XCBA 3GN1A 4FDAA 4CQLB 3BMQB 3ANNA 1LSOA 2FR1A 4E0BA 3V5NA 4WE3A 4TRRA 1LLDA 2GGSA 2O7SA 5F5LA 5F1KA 4PZCA 2CMDA 1ZUD1 3R3SA 4M1QA 1XWFA 2P91A 4Z9FA 4YT4A 1XSEA 4GMGA 4YQZA 4NPCA 2Z1NA 1I32A 4I1IA 3KYDA 1MFPA 1E3JA 4EEZA 5JS6A 1BW9B 1LUAA 3GA0A 1EBFA 4OIMA 1E3EA 3DWFA 3FNHA 5AXCA 1T4DA 2AW5A 2NADA 2X8LA 4YB8A 4D43A 3JQBA 5KWEA 2O3UA 1YBMA 2P4QA 5L40A 3GVXA 2O23A 2F1KA 4Q3AA 1X7DA 1SC6A 1GDHA 4U6SA 3NV9A 1I3LA 1HKUA 3QVWA 1FMCA 3AI2A 4L4SA 4CM8A 2DC1A 1Q0LA 1DRUA 3PQFA 5G0WA 4BS9A 1SOVA 1ZEMA 4WNIA 1EE2A 5COQA 3DBRA 4WLOA 4GBJA 2NVUB 2CUKA 1NQAO 4RO0A 3W4KA 3VZPA 4Z9YA 1XYGA 1DB3A 1UZLA 2PZJA 3O03A 4WEQA 1KOLA 2B35A 1BXZA 1SAYA 2VRCA 3VPGA 3U0BA 3EZLA 3NJ8A 1GZ4A 1XDWA 4DWVA 2O2SA 3DEYX 2B5WA 2X86A 2VYNA 4U8GA 4ZD6A 3RD5A 4XYBA 1F14A 4PVDA 4ZHSA 4RPKA 1PJ4A 5CEEA 1F17A 1B3RA 2Q2VA 3QWHA 1ADFA 1K2WA 3FR7A 4XRGA 4Z9XA 3OETA 4YWJA 1U3WA 2FHSA 2Q46A 3VH3A 1T2DA 3WIDA 8LDHA 3I1JA 3RUIA 5MDHA 2G0TA 4MVJM 5JO9A 4CLOB 1EUCA 1NQ5A 3R3JA 3ZV6A 4EYEA 4R5HA 3V2HA 5FF9A 4GKBA 3LT1A 1EUZA 1V6AA 4WLVA 1K89A 2Q1UA 2BFAA 2VHWA 3E48A 3GT0A 4TVBA 4BO7A 2GN9A 1VC2A 1AHIA 3PHLA 2OOSA 2FPGA 4YJFB 3RC7A 1WMAA 1E3LA 3DBLB 3R1IA 5KVCA 3TWOA 3OM9A 1JWBB 5EERA 2OGUA 1O95A 3NTQA 1MGOA 4CM1A 4FOOA 4GQAA 4W7HA 2PKQO 3DZFA 4ZN6A 2EGHA 3RUHA 3W4JA 1MXHA 4CLEA 1HT0A 4CL3A 3ANMA 1FDTA 2EGGA 1B8UA 3W4IA 1H6DA 1GQYA 5T57A 3QVXA 5IN4A 1LDMA 2PKQP 3K2EA 3BHJA 3FSRA 5B37A 1LJ8A 3RFTA 2DTEA 2O50A 4ZRNA 1EEHA 5GMOA 2DPHA 3TL2A 2OHXA 3RC2A 4XIYA 3RKUA 1ZZEA 1E7SA 1V0JA 5A9SA 3E6AA 4BO1A 2R2GA 3JD4A 4FB5A 1PGQA 1GL3A 2HMVA 1E5QA 3CTMA 3Q9UA 4Q3BA 3RASA 1JAXA 4AJ1A 5KCZA 1QYVA 1NAIA 4MIOA 4P22A 1BG6A 3O4RA 1HRDA 3GHYA 2VHYA 3JYLA 3QY9A 3ITDA 2IYOA 4LCJA 1XIVA 4CM9D 1Z82A 4HP8A 2DBZA 3JQ8A 4JCOA 3ZV5A 3DXFA 1F06A 2HCTA 3PVZA 2RHCA 3DHEA 5K0ZA 1V35A 1DXYA 4GX0A 2ZB8A 3KLPX 1FJHA 1I36A 1FK8A 2JFHA 1ENZA 2PH3A 4DIBA 3D3EA 4PLCA 1NTOA 2Y1DA 1NVTA 1NNUA 4HFNA 2YV2A 1LSJA 4L0QA 3AY6A 4Y6SA 1EDOA 3GHHA 4PG4A 4M86A 1DFIA 3OJOA 3WB9A 2B4RO 3CZMA 3ZDFA 4UUMA 5EPOA 2HK8A 3DMTA 3DBHA 1Q7BA 2VHVA 2Y67A 1M75A 3CPSA 5JO0A 4PLPA 1DC4A 3GF4A 3TN7A 5B1YA 3AWDA 1JDJA 3MJEA 3RUCA 2X5JO 4YAIA 2EF1A 3Q11A 4J4TA 1R15A 2DFVA 3RROA 1WP4A 3OA2A 4DIOA 4J9VA 3K73O 4J1TA 1XU7A 4RVSA 3GH3A 1DDOA 4J1NA 3EUWA 4LSMA 1ADCA 4WK6A 1UH5A 3SJ7A 2AEMA 4CMKA 4BNUA 1I3KA 1ZK2A 1AN9A 1EFKA 1NWCA 1VE9A 2IXAA 2NV6A 4U0JA 5KIAA 5MGBA 1FDUA 4KDFA 1WXDA 2IZZA 4JX8A 4NFHA 4FFOA 4B4VA 4DRYA 1IZ9A 4CPDA 4E5YA 4FOSA 2Q2WA 4E2WA 3TFOA 3VTZA 1BWSA 1SB8A 1ENPA 1ZBQA 3S55A 4P4LA 4Z3DA 4LRSB 3DDNA 3ZNPA 2IEBA 4BKQA 4R1SA 3MWEB 3UW3A 4YJHB 4GH5A 3GMDA 1Z75A 5FYDA 3GMSA 1PJLA 1TI7A 1C0LA 4PRLA 3JQ9C 1E3SA 3JQ8B 4XQGA 2DT5A 5KVQA 4JBHA 4KUEA 3ABIA 3PXXA 3ICPA 3KXDA 3DBVO 4CLHA 2PZMA 3LZ6A 3AUAA 3PPIA 2Y1OA 1DC6A 1H93A 5A5EA 3GUCA 3CEAA 4LVCA 2DTDA 2PWZA 3GFBA 2BHLA 4W82A 4E30A 1DEHA 1TA4A 3ROMA 4PLGA 1SNYA 4YPOA 1A7AA 1Y81A 5A9RA 1GEGA 1DFHA 1U9JA 3K5PA 3SXPA 1U7HA 3WSVA 4FW8A 4XA8A 3PGJA 1Y5RA 4BGEA 3D7LA 3GZNA 3A4VA 1XQ6A 1QR6A 4NJMB 4YRBA 5EQDA 5TRTA 2ZTUA 1HETA 3UVEA 3OQBA 3GVHA 4I08A 2NWQA 3ZU2A 4IMPA 4RL6A 3U4IA 3FR8A 3K96A 3LQFA 1OMOA 3KTDA 1TT5A 4G5HA 4AJ4A 1B2LA 4L76A 2XXBA 2FOIA 3FHLA 2OL4A 4JBIA 5HM8A 4L74A 3LK7A 3TZ6A 4W7IA 2E48A 3JQAA 2FN7A 4NBUA 5JFOA 1EVIA 4GMFA 1E7RA 2P2SA 4UEKA 4E4YA 4WPGA 4D7AA 5IDYA 4DIFA 4FJ0A 4RVDA 4R51A 5KJEA 1UDCA 3PQDA 2ZYAA 5TX7A 4JNKA 4BIIA 5GZ6A 3F6YA 2G1UA 3UAGA 1WNTA 2JJYA 1ULSA 2J6IA 1D1TA 2ZK7A 2JAHA 2W2KA 4E5PA 4W9NC 4FJ1A 2BF7A 3C1TA 4Y9DA 1P1HA 3DHYA 5JBIA 1ULUA 2AQHA 2X9GA 1P9LA 1G0OA 1JKJA 1GR0A 2IODA 2SCUA 3Q0EA 2GSDA 1U8FO 1Z7EA 4OAQA 1GPJA 3GNQA 4D79A 4JLWA 1I2CA 5JYDA 4Q39A 1KEWA 1P44A 1EQUA 4RPGA 1WW8A 3CE6A 1FXSA 4A73A 4WGGA 4D0RA 2EG9A 2X0RA 2YW9A 5I7SA 3PEFA 5DOVA 3EW7A 2YDYA 4AJKA 3NYWA 3KLMX 4ALNA 5IN5A 2CNBA 3RUDA 5BSHA 3FNEA 3BMCA 2Q50A 4H3VA 3DFUA 3HB5X 1ZJYA 4O1MA 4YJDA 2BGMA 3ZWAA 4DMMA 1BDMA 2O48X 4DL9A 2VT3A 3GZNB 4GLOA 1Q1NA 3QVOA 2UAGA 1X14A 3NDJA 4UEOA 3FI9A 1W8DA 1QXSA 2C07A 5G0UA 4AJEA 1TT5B 3O26A 5G0TA 5TIIA 4K9DA 3C1OA 4XYLA 1RM4A 1DJNA 2AE2A 2C5EA 2JHFA 4GKVA 3PWSA 4E2XA 3UH1A 5JXWA 5T5QA 5KJCA 1E7YA 2Y0CA 3E1KA 4TZKA 5TLSA 1LQUA 2UUPA 3A28A 1M66A 2CVQA 2DUWA 3PZRA 1LLCA 3RU7A 5JCJA 3KUXA 1X0XA 1IL0A 1NVMB 1PJTA 1DAOA 2NU9A 4QFDA 2IZ1A 3CINA 1Y5MA 3IOYA 3F3SA 3I5MA 5DP2A 1Q0QA 2EWMA 2CSUA 5IDXA 1VL6A 1FDVA 3DOJA 1Y1PA 3RBZA 4ALIA 4RPLA 3TZCA 1RM0A 5JPIA 1P0FA 4D46A 1Z7BA 3F47A 3GRKA 3M6IA 2GPTA 4BNFA 4J0FA 2GZ2A 4AJIA 3F1LA 5FI5A 3X2EA 1HZJA 1TVEA 4UUOA 5DBFA 4HY3A 1N7HA 5AYVA 1DBVO 1C1DB 1ENYA 2CDCA 3BMOA 1DIBA 4IQ0A 3ZHZA 1YH3A 1YRLA 2PKRA 2QYSA 3AOGA 4I5GA 2V65A 3ANLA 1U28A 3G17A 3ONEA 4QFCA 3WNQA 4BKPA 1OI7A 5IXSA 4ESOA 2Q1TA 3DC2A 3X2FA 4PVCA 1JW9B 2AA3A 1BHSA 2Y1GA 1GQ2A 2UVDA 3IQDB 4H15A 2J3HA 2AQIA 3OEWA 4XB2A 2POQX 4L8VA 2WE7A 4LN1A 3JQBC 1P45A 4BGIA 3TPCA 5IDQA 1HEUA 1R0LA 3L6EA 4QECA 4WOJA 2X4GA 4BNMA 5IF3A 1PJCA 1E7QA 3PLRA 1WWKA 1BRMA 4DPLA 4Q3EA 1E7MA 3GDFA 4CMHA 4ZRMA 3L6OO 3T4XA 3WSWA 2OXIA 3QHAA 2ZIZA 1KETA 1N8KA 1E6UA 2ZCVA 1KEVA 4JGBA 4XR4A 3PJEA 4DC1A 1QP8A 1EMDA 5DF1A 1KEUA 3E5RA 1UUFA 4KOAA 1SBYA 1T2FA 2AHRA 5ENDA 1IULA 5BNFA 3RC1A 1PS8A 2R00A 1QKIA 4ONEA 2NNLD 3H9GA 4WOKA 3ZWCA 3UCFA 5ICMA 4CMJA 2WD7A 3SLKA 4CR6A 1U5CA 1GUFA 1ZXLA 4DVJA 2ZQYA 4KZPA 3SJUA 1VJ0A 2WYWA 4OQYA 1GY8A 2H6EA 1NPTO 4II3A 3PK0A 4OOFA 4PLTA 3IDSA 3Q2IA 4NK5A 1PL7A 1YB4A 3L07A 1MX3A 3G49A 2GNAA 3LLSA 3RBVA 4CM6A 5L7YA 3FBTA 1ZIDA 2CZCA 4DQVA 2FMUA 5K6AA 4RF4A 4CQMD 3JYNA 1XLTA 1UR5A 3TF5A 1DFGA 3KSDO 3PP8A 1L7EA 1VJ1A 2VWQA 3QIVA 1I33A 1GUYA 5KKCA 3HB4X 1Y8QA 5TQVA 3U49A 4MVJI 5EL0A 3MTGA 4XJSA 3W6ZA 3FTNA 2JD0A 3GG9A 5TS3A 5JC8A 2BFOA 4L4XA 4TKMA 1YE3A 2PGJA 4CR8A 4GVXA 1YDWA 4MVJD 3WGOA 1N9GA 5C7LO 5IFLA 3LU1A 4YACA 1LDYA 5JDIA 4PG6A 2I67A 3RCBA 5DULA 1ISFA 3BYZA 5DT9A 5T6BA 3HE3A 4FGWA 5THQA 3ZN2A 3PJFA 3ONFA 2BFMA 5CEJA 3ROQA 4YAKA 3D3WB 1W4ZA 4AL4A 2VWPA 3HDYA 2FSSA 4F6LA 4ND2A 3QA9A 4MIYA 4PCVA 4M49A 4ND5A 1Z74A 1EDZA 2OORA 3LT0A 4FFLA 5FI3A 3UF0A 3U5TA 1GPDG 2OO5A 4RORA 2XPCA 4JJIA 4KTTE 3EC7A 1GFSA 4IGFA 3DZJA 4Y6RA 1P1RA 3F46A 3ZNOA 1LA2A 1BXGB 1PGPA 4NIMA 2YQ5A 4YXFA 2YHIB 4B8WA 2C2XA 2I3AA 2NUAA 3VDRA 3ENKA 3AW9A 1YJ8A 5A05A 3ZHBA 4O6VA 3ITKA 3HG7A 3KBOA 4NH4A 4IINA 2X23A 3HSKA 1SO8A 2X0JA 1HDRA 4EJ0A 3OP4A 4RPHA 2GF2A 1Y8RA 4DBVO 1GTMA 4PLFA 1PJ3A 4Z6KA 2P5YA 4RJTA 3T7EA 3GAFA 1ML3A 1E3IA 4RZIA 3DMTC 1VPDA 5G0VA 4IJVA 2DBRA 1PZEA 4XGKA 1U3TA 1KERA 4BO8A 2Z5LA 4FIZA 4BMVA 4NU5A 2QRJA 3WGHA 4NQZA 4NR0A 1CIVA 1PQWA 1Y8QB 3M1AA 5JAMA 3TQHA 1LC0A 1N92A 3E03A 1YVEI 5G4KB 5ILOA 2FPPA 4MDHA 4UAGA 1T2AA 3O9ZA 3BTVA 2OZPA 2VRCD 4Y67A 1W0CA 1H9AA 1LRKA 2ZB3A 5A3VA 1XHLA 3BMNA 3DAFA 4XYEA 2QIOA 2CY0A 1K6IA 3ETEA 3JQGA 2VYND 3V1UA 4TVOA 2H63A 4GSKA 2C7GA 4EITA 4MJLA 5TF4A 5C37A 4CMBA 4NDNE 3INTA 1IZ0A 2VN8A 5EN4A 1ZFNA 5DDIP 5I8ZA 5AQ1A 2V6BA 4BNGA 2BI8A 3NGLA 5JY6A 4RVGA 1GV0A 4E2YA 1HL3A 4MVJP 1GADO 1GYQA 4BNJA 1LRJA 2OP1A 3BTSA 3HUDA 1O94A 4XEHA 1KBZA 4AJHA 2Q1WA 4HNGA 5ITVA 4J0EA 5JAQA 3N58A 1U7TA 3JQ7B 4XDZA 4ZU3A 1QSGA 4PLWA 4CMIB 3WLFA 5A5FA 3CKYA 3D1LA 2IXBA 3VPXA 1LDBA 3QVTA
chains in the Genus database with same CATH superfamily
2DH5A 4ZIRB 3EK2A 4ZZ3A 3PGLA 2QN7A 3TLGA 2Q21A 4I5DA 1JIIA 1SVSA 2NAPA 2PIDA 3PIRA 3WLTA 4DARA 4JC5A 3CN9A 3ZZUA 3N59A 4B87A 5FADA 1PR6A 3OZAA 4AMVA 1HDXA 4HLUC 2YVAA 2BFBA 3GRFA 3IL2A 3JYOA 3KO8A 3USCS 4DMKA 2EEPA 1C8KA 5EJ8A 4TQAA 3RYCB 2Q9BA 1A9ZA 1V8FA 4IHKA 4O4JA 1Z0UA 3IP9A 5FO1A 3Q4GA 5B3JC 3DS8A 2ET6A 3PHHA 3TB6A 1CZUA 4ZZ0A 5KVVA 1VCMA 2BRUA 1U1IA 4RD6A 5GIPE 4RA6A 2QSUA 4DVGA 1O97D 4I4LA 4MWZA 3I52A 3N0RA 2HLDA 3FX2A 3MTJA 3C7TA 4R9SA 1E1CB 3TZHA 1A27A 2IF0A 4ARCA 5BXYA 1U8CB 1GO2A 1NBHA 1ZOLA 2ZJ7A 2XE7A 2JFGA 4O4HA 2P5SA 4ADSG 3KQVA 2H1SA 1BQ3A 2VAPA 1G291 3HYTA 3O3MB 4IS2A 4RS3A 5B4VA 4O2AA 1D2EA 2AL7A 1F0YA 5DNEA 4B6FA 4DMLA 2E5LB 4MVCA 3JQGB 4KUHA 1HZZA 4BTLA 4EG4A 1QF6A 4KQ9A 2EP7A 3RTEA 4G4SO 3H0CA 3F8TA 4B9AA 4O59O 3GGSA 4RAOA 3BS4A 4U4AA 1YOVA 4F3RA 1O0SA 1DXOA 4BRUA 3TLCA 2P9GA 2IY8A 5C31A 4XVHA 2JIBA 4ARAA 2H7XA 2PRSA 3SN6A 1KVQA 2PWBA 4DLVA 3ESQA 1N3LA 3IVAA 1I1OA 1ILEA 3SEZA 5H7XA 4BWGA 5CDFE 1GFWA 5JRZA 3RE1A 1ECCA 1PJ2A 4GM1A 3IC5A 3H9QA 3RI3A 4RDHA 5AVYA 2QGZA 1CE8A 3TR6A 3S81A 2BZGA 4KP7A 3I3SR 4URVR 4JI2B 5FBKA 4HEJA 5J4KA 5HWSA 1LBQA 5DCYA 1RT9A 2R25B 3L93A 1PK8A 3MC1A 4U2KA 2AKAB 4F2PA 4K0RA 4HWOA 5AI0A 2DQSA 3CUKA 1D8AA 2XVAA 2XUGA 1XOIA 1Z7GA 3GGPA 5LQRA 1QG0A 3ZWQA 2D4AA 2QNBA 2LW7A 2WHXA 3UUWA 2FEAA 2FUNB 2HMYB 3VPHA 2DQ4A 1MCZA 1NXSA 1T1SA 2VP0A 3KYDB 4LYGA 4R40A 2Y68A 5LDDC 3H3JA 3R5HA 4XGIA 2EARA 2BLLA 4KRFA 5HFNA 1Z8NA 2HA2A 2OHHA 2PX4A 5AHOA 1JJFA 5COBA 1M83A 1FZQA 1ZPDA 2AXPA 2EBFX 2ZT8A 3FUCA 1Y8ZA 3U3OA 1LI4A 1W2HA 3ASYA 4GG1A 1TTTA 2ISCA 9LDBA 1AK2A 1O58A 4HVAA 5IF9A 2X9QA 1MFZA 1UZUA 2RHOA 2ZSJA 1E3TA 1TTQB 1W5FA 2XSZA 4PIPA 4RZ3A 3VR4D 1NE2A 4UVEA 4RWZA 5A0VA 2RGEA 3QPDA 5AFSA 4NOMA 1LEHA 1NYQA 1POXA 2HBZA 4KFCA 5H02A 2QIPA 3GJZA 4X1OA 2FPRA 2F8SA 3AB3A 3CV3A 1MU0A 1UJ5A 1VZ3A 2NZ2A 3FOAA 1E2UA 1I7LA 3L77A 4E7OA 2XCRB 5KTTA 1KU6A 1P0IA 3CUEF 4C4PA 3IAUA 4YECA 5CVJA 1I13A 2B8TA 3GFVA 4BFXA 2OQRA 1LVHA 4Z7JA 4O4HB 1PQUA 4O3MA 1A8SA 4NI5A 1SUEA 3VYSB 5HOEA 1SVWA 1DC8A 2IPAB 2PHZA 5M7EA 2IZ7A 4FMDF 1JSCA 3PJGA 3SX4A 4YWHA 1NVWQ 4AU1A 3HN2A 3H2YA 3UPUA 4S1PA 4YS6A 2FH5B 3N8GA 4KLAA 3OPMA 3O94A 3QGMA 1I7PA 1RQGA 3VNUA 5JSHA 1KO1A 2O2HA 4F85A 2JAWA 3U7IA 4FHDA 1E1KA 3R0VA 4OHVA 2P4UA 1E9VA 3ICWA 4L22A 3HCWA 2GERA 4P53A 4Q66C 5DOZA 5EJFA 2ERYA 3QW2A 1G8YA 4XCXA 5TVKA 1X87A 2WT9A 3SF8A 1JLKA 1G3QA 1P0PA 2GD1O 2KQUA 3E3LA 1N5LA 4LFAB 1P62B 1UJMA 1XX6A 1UXKA 2EX4A 4HX5A 4QVGA 3D54D 4R3UC 1ODFA 3VDMA 2XNKA 4LMPA 5CG1A 2JLYA 1RIFA 1EUCB 3C3PA 3GOQA 3R41A 4IJWA 3MUOA 3OT4A 4IRXA 5KYKA 1CS0A 3GV0A 1LQTA 1V1JA 4BQRA 1T29A 4G81A 5ALIA 3N53A 3COZA 1CRQA 2GZ1A 3OZRA 3IP6A 4I50A 5AK4A 1UOPA 3H2IA 3HUTA 3QQ5A 1U02A 2CLIB 3DL4A 3FDXA 3GOHA 4GZMA 1ZNWA 2C61A 2B8EA 4I3HA 1Z26A 1M34E 2GWRA 1WDTA 2QVCA 2QZPA 1P5JA 3FF1A 1SRRA 4MQEB 3LBNA 2G40A 1JKFA 2F59A 4XDYA 1GN9A 1RTKA 5K2MA 1RCTE 5BP7A 2HBQA 1MP0A 4B79A 8GPBA 1IZ8A 2VOJA 4OQXA 4Q21A 5ICFA 4MWSA 1ECGA 3T0GA 3U3DA 5A4KA 1VSBA 3H75A 2J30A 1J56A 4XYMA 5FH9A 4MGHA 2Q0HA 4PICA 4UNQA 1DIGA 4DDKA 2A0KA 3Q3HA 1VJ5A 3TSOA 1YKSA 3LZDA 5GY7A 1XAGA 1JPNA 3WB2A 4C3ZA 2CKDA 5JQGB 1SCNE 3EA4A 3VYUB 4A0HA 1WHTA 2O8VA 2PH5A 2Q5QA 2Q8PA 3C1UA 3PGVA 2EU8A 3QU7A 3VQTA 4D3XA 4HVLA 1XDGA 3IDOA 4BX2A 2OCYC 4K2AA 4QDTA 1ZKDA 4YR9A 3U7RA 4PGGA 3ZPXA 5EJ4A 5IM4A 2UXBB 1E2JA 4KN9S 4LUCA 2ZR9A 5ALTA 1OU4A 2G07A 3DW1X 4LAFA 4WEOA 4C4YA 4YASA 1UBHS 3Q2KA 4I46A 1RBYA 2A1UA 3M9WA 4DPMA 4UXJA 4OQFA 3WLJA 1PZFA 3A1SA 3T3MB 2Z58A 2CJWB 4FUQA 2WILA 3TZQA 5J43A 3U3KA 3PLAE 4BBAA 3GAAA 4KKVA 2PRZA 2WG2A 4RKWA 1LPNA 1N5OX 3I28A 3P9ZA 5HRCA 3V8QA 4LTNA 2G9UA 3P19A 4YUAA 2FZ5A 1G2PA 4LC9A 2UYYA 1RM5A 4RK0A 5JHHB 3L41A 2B8WA 3HVJA 4IJQA 1AXEA 2ZIXB 1N2SA 2XB6A 4N0EA 1C3OA 1CY6A 5AVOA 4BLOA 2O6LA 3AL2A 2BGKA 3OQIA 3QMPA 4OREX 5BN5A 5KYGA 3EQ2A 1E1MA 3RS9A 4DR3B 1JVBA 2VF8A 4ZHQB 4D42A 2C5AA 1KBQA 4U9UA 1C7FA 5B7NA 3U4QB 2LTAA 1RAAA 5AQEA 1L7MA 1U90A 2ZSAA 4XFJA 1MA3A 2R0QC 3K09A 3N2KB 4TS3A 1GU7A 2JCGA 2OM2A 2XOXA 1J49A 1HYHA 3MMXA 4P1ZA 1V39A 1H4TA 3UWMA 5DTEA 3V1YA 2HFKA 4G0MA 4B47A 4KWIA 1SC1A 2NTNA 5J2UB 3IQXA 4KEAA 2GJKA 3Q7TA 1T26A 2G82A 5HCIA 2RHTA 3JD3A 1ST3A 1WUIS 2B8JA 5CCBA 1BS1A 4EKNB 1M2VB 4UNSA 5KNLA 3CT6A 3A9WA 1Q83A 4M0PA 3VSAA 1J20A 5EJ9A 1E99A 2JAPA 3I34X 1KH3A 2PK3A 2YJTD 3LG2A 4TROA 3R7SA 3L6UA 4GOXA 5KHLB 4QOJA 1VRWA 5CIYA 3EXEB 4ID9A 1DX6A 1GGEA 3UGKA 2GSWA 3IUQA 4B7AA 3EXFB 4WX2B 1YZHA 2X19A 2XUZA 1Y1SA 1T0UA 2QX6A 4KKXB 2C31A 4DZTA 4F6RA 1X7YA 2RAVA 3WQSB 5FV4A 3F97A 5ALXA 3TGPA 4N47A 1DE0A 1CF9A 2NU7A 5LYJA 4HQ0A 4DMCA 1DTSA 2L2QA 4LRQA 1ONOA 3NWEA 3OM8A 2DH6A 3STXA 3IB6A 5CM2Z 3ZUPA 1ZIPA 2CLOB 3OPNA 3JASB 4C7OA 1P1KA 1PT5A 4RHXA 3LCCA 4HLNA 1U2RA 3F2VA 1JB9A 1WY5A 2Q9AA 4M7PA 3PZBA 2YJGA 2HA3A 2QJWA 4G0XA 4W7SA 2DBYA 2FXVA 3UJNA 3D8NA 3AR4A 2IYPA 4LZPA 4EKGA 1VKJA 2W6JD 1HDOA 1EK1A 4WN3A 1TKBA 2JKZA 1F38A 5JMWA 2PVPA 1B74A 3SC3A 1E20A 2IS6A 3BXFA 1GNRA 4OQQA 3QE2A 1UOEA 2H1HA 4D81A 3VZRA 2QYHA 1PJRA 3C2QA 3DGFC 2BSXA 4MUYA 5H81A 2H8KA 4XSGA 4R8LA 4P7KA 4YDHB 5BN5B 3TR0A 3PU6A 4WCFA 4IM7A 5B2FA 5HJEA 2BSQA 5KNBD 1B26A 1JIUA 1Z4LA 1FEZA 1XD8A 5BVGA 3L8FA 3QFRA 4KO2S 3O8BA 1IMOA 1NW8A 5EXTA 1QRUA 3TKAA 5SY9A 4TSRA 1PK9A 4KPFC 1J21A 3QI7A 5F52A 2PTHA 4EO4A 1NQWA 1RABA 2WKRA 1YI0A 4OSOA 1QORA 4TKUB 1H4SA 1MT3A 1JG4A 2YMMA 1V9LA 4EA6A 1UJCA 2I4RA 3CBQA 1T1RA 1K97A 2YMQA 4Y7DA 3AESB 1MABB 1CX9B 2VDPB 1FPQA 1TNDA 4WZAE 5H59A 4UEJA 5DM1A 4ZO9A 5BQ3A 3WGIA 1ISHA 1UMBB 3R5SA 1HE2A 1KZHA 4AJJA 2XCUA 2R65A 3LHSA 1EP2B 4G5OA 3RYFA 2O2JA 4R9UC 1G7RA 4G4GA 4ND8A 5KVSA 2D5CA 3C6ZA 2XCIA 3NBUA 2R3SA 4C05A 1YZKA 3RHZA 4U3JB 3MILA 2O3RA 1R7RA 2VCYA 2JLQA 1X8KA 4OUDB 1HURA 5EUMA 4TXMA 1RLIA 1XMPA 2D0IA 2HDHA 4ENUA 2GM4A 3A3OA 3A1FA 3B1JA 3D2CA 1Z17A 5HFAA 4A26A 2VQ3A 3VNVA 4DTCA 2ID4A 5IUJC 5FHQA 4IIXA 4NDZA 2I66A 2YMLA 2OVBA 1UZAA 4DY6A 2AGVA 4ZQCB 2RGDA 4FD2A 1BS2A 1E6MA 2QG6A 1PNTA 2Y1CA 3F6CA 2JW5A 3ASZA 3K15A 4OGKA 5EP1A 2PYZA 4W99A 4RACA 3HUUA 3KQTA 3IB3A 3A2LA 5E95A 1N2GA 1TA9A 4EFKA 3WG9A 1OLXA 3GEDA 2FG6C 3PDUA 3HKEA 3GN2A 1F48A 4QBFA 2VPXA 2Z43A 1KDPA 3SM9A 4P4NA 3SP1A 1JFFB 1HYEA 2G25A 1IM2A 4Z0PA 5HJ7A 4OO3A 5F73A 5KSYA 1FDSA 1FDWA 1ZGHA 4UNRA 2WIDA 3LKBA 2VDVE 1L4KA 5A4MS 4OFZA 3E58A 4ENSA 1N1EA 1XZJA 4Z7NB 5GONA 1BEUB 3L7YA 3MS4A 2FMIA 3TE7A 1P1IA 3ODPA 4GQIA 4I3FA 1WL8A 2HRBA 2I34A 3GH1A 4WCFB 4EFMA 4TXJA 2FY8A 1T5TA 3SXUB 5BSVA 2CDNA 1UZMA 4M0MA 3S4YA 2CHGA 3VOBA 3LRXA 2XGGA 1JL3A 1ODLA 3TJRA 4ZVSA 1KJ8A 3BMCB 6CHYA 5AW3A 4LC1A 2DHRA 3JQQA 3P2JA 2VIIA 1L4FA 3B3QA 3WFJA 2JFNA 2O20A 2QRHA 3QVSA 3NAQA 3N0VA 1RYEA 3V48A 4PXSA 2WF9A 1ZQ9A 4LJ6A 2YXLA 4MAMA 3LCJA 3TRFA 3EBOA 3ZU3A 1T3GA 2DERA 1CSEE 2OHVA 1IN8A 1UEIA 3HSSA 1IUNA 3L9XA 5IKXA 3OWOA 2A9PA 1R3UA 4X45A 3CW8X 3U17A 3HZOA 2HWXA 5SYAA 1G6HA 3P9IA 4HI0E 2QMQA 1CP3A 1G3MA 1ZJWA 1J9ZA 1S9DA 5CX1B 5I7OA 1VL1A 3OOYA 1KHHA 2IZ6A 3ZHXA 2F3SA 1II0A 3B6JA 1ISGA 1NNI1 3PE4A 4U39A 4G0WA 2QJTA 2YINC 2CFTA 3AIOA 3FROA 3LWNA 4P5EA 3BWBA 2ILTA 1O96A 4EX7A 3C39A 10MHA 1GPMA 4HDAA 1W5EA 1V11B 3EAGA 4X6UA 1I1QB 5FA8A 2W2MA 4M0CA 1RXWA 1OVGA 1KFKB 2OK8A 2ORED 3QKUA 4TRJA 2B0CA 4H16A 4KTVE 1MB4A 4CV2A 3CKLA 1NJ6A 3H1EA 4CL0A 3F6PA 1IYZA 2C20A 2GAFA 3GR6A 4ZOLB 5JCZA 5DW3A 1A2BA 5C1IA 3S28A 3D4LA 2D00A 3F67A 4JVSB 3BRWA 3H5OA 5AVRA 2XE8A 3CUYA 3TR5A 3GFSA 4GS5A 4MWCA 1WUTA 3ADBA 1JHYA 3RT7A 2ONYA 3LLUA 4IKEA 1YGPA 3ENZA 3KB6A 4LXQA 4XLLA 1PS0A 1E8DA 4E5MA 3RVLA 4QE3A 1OFUA 2QGFA 1T6XA 2JGDA 3ICOA 2R6GA 4QXOA 1HA3A 5AKYA 2A88A 5AOVA 2W2QA 5JVDA 4A7PA 3WADA 4MV7A 2IVZA 5F51A 1UINA 2HMSA 1W35A 1ZITA 1RAGA 2XIJA 1KI6A 2OAEA 2P35A 2Q8NA 2JI8A 2HQ1A 1CJMA 3OQVA 5E1BA 2JJ1A 5THKA 4EQ6A 4GR5A 3RTGA 1Z0AA 2WPDD 5BSFA 1V1MA 3E2IA 3TAXA 2Q07A 3C6XA 4A82A 3ROPA 4WKCA 1OCEA 5L6LB 1RWBA 2DKFA 3SU8A 2OZLA 2ZE6A 4E5NA 5EQFA 3AFIA 3IX7A 2XZDA 1I7NA 1T3HA 3RC9A 2HF7A 2I2BA 1EYZA 2CLFB 2VP2A 3IO3A 4ZT5A 3T52A 2Q1XA 1Y7LA 4EYKA 3JVEA 2K5UA 3H3FA 4JJGA 2QF7A 4P7FA 1G5IA 3T3GA 4TSFD 2IXEA 1XQYA 4ZC8A 3KLBA 3SR0A 4H7JA 5IUKC 1QS0B 3QG1A 1YVUA 1CU1A 4KO1S 4OAOA 3DE3X 4EFLA 5BR4A 4JR1A 5ALGA 3FPCA 2RFLA 3VR5D 3HKCA 3UAZA 5JSFA 3GUUA 4Q15A 3NPAA 2Z2ZA 3WWDA 4WZZA 5DNUA 4R8MA 1QB8A 3JQFA 3QY0A 4IGEA 2GCNA 4MRNA 5GQSA 1II8B 2TMGA 3NAZA 3VV2A 1D4OA 1XAHA 3RFVA 4MPDA 1NFRA 3KJGA 1C9DB 1MG5A 5LKAA 2DWQA 3ADKA 1IHXA 1KNXA 3MWLA 3PNOA 4YJ3F 3WVNA 3RFCA 3HCBA 1P80A 1NYRA 3ABRB 4IIEA 4AS2A 2C54A 4AJLA 2GKGA 3B48A 3NHYA 4U8HA 3CWZA 5ER9A 4CRWB 2RI1A 3ORQA 1ZSVA 3SG0A 1SUIA 3O75A 3P0HA 4M9SA 4UCWA 4CKYA 4IIVA 1L5LA 3IA7A 4BLSA 3RT9A 3S1AA 4EY4A 1QQ7A 5JDCA 3V3KA 3NPMA 4UTOA 2WSSD 3HH8A 3LYLA 1CNEA 3JQDA 4WASA 1COWD 2A9JA 2HWWA 4KWHA 4D6XA 2FDCA 1H6BA 1CR0A 4EW6A 2WD7B 2X14A 1YS9A 1FMTA 1SEPA 4MGZR 5EUCA 3KAKA 1F0KA 4FI3F 2FSVA 1HO3A 1LBEA 4RXUA 3N2IA 2JGLA 4LYJA 4AJNA 1GRRA 2A86A 5TGDA 1B15A 3KIPA 3WYAA 2JD2A 2VJLA 1UXOA 4P84A 5AKLA 2B5OA 2O2CA 4KODA 4RV9A 5DZSA 4B17A 1M33A 3BMQA 2C58A 2JHCA 3GZTB 3EBLA 3B2EA 4JQYA 4KYVA 3ZQ6A 1V8ZA 4EQ6B 1SQSA 3LWBA 3BTUA 1ZJJA 1EZZA 1M8GA 2APJA 4POAA 3WYFA 2TMDA 1V1MB 4A27A 5T8KC 3AK4A 4QATA 3CQ9A 2Q8QA 4M0UA 1DQSA 4CTJA 2I3ZA 3MVEA 3VC2A 4YDRA 3GRYA 3FI0A 2PD4A 2P0EA 1E0AA 1NJ8A 2IH5A 3WK4A 4LDAA 1J25A 1USIA 1C41A 3CXRA 3T5CA 1F2TA 3ZGYA 1PSDA 1JHUA 2OFFA 1KQGA 1V37A 4IPTA 1TW2A 1IWPB 1M67A 4LJ9A 1WXGA 1OLUB 2RHMA 3FMFA 3NB0A 3WRWA 1EUDA 2F3UA 2R1VB 3B6ZA 3NUGA 4PNPA 5FI1B 3PC7A 1B4DA 3GFQA 3I32A 2IZ0A 1VBNA 4EY3A 3D31A 1ZM2A 1MB2A 5DIFA 1B41A 1ZP6A 4Q9AA 3C5HA 4NTZA 1OBCA 1Z45A 3MMNA 4JVLA 1MO4A 3OTHA 4OYLA 3UM9A 2UZ4A 5KNCH 2WAAA 2VNAA 3GLHE 1YJBA 3S2YA 2UU9B 3RSGA 2GZAA 2B5VA 2WYVA 1ZLYA 1I9CA 3UK7A 5U9CA 3D4OA 1LK0A 3D7NA 4EUEA 2GXAA 2GT1A 2BMAA 2UDPA 4KXYA 2BWJA 4F84A 1XVIA 2TRSB 1X13A 3WY9A 3UMRA 5JV5A 1HDEA 5K0SA 4X61A 4PYMA 4F93B 2J4CA 4QOHA 4BQIA 5BV7A 2OEPA 2F6RA 1K5PA 3RVNA 2PFKA 3NYIA 4BNDA 4DCTA 2Q6TA 4M22A 1Y4AE 3QEMA 4E46A 2QENA 1G4UR 5F4ZA 3SR3A 1PBTA 3FE2A 2XLBA 2HK9A 3NATA 3EVAA 4EG7A 4DCNA 1Q19A 1TEZA 4Q4CA 2PBLA 3OT1B 4L3VA 4NCXA 4QUKA 2A59A 5K2OA 2YXPX 3DTVB 3I9JA 2FA9A 4QD3A 1TEVA 5PGMA 1XL1A 4TMKA 3FSGD 2NUAB 3K9FC 3UAWA 1EFAA 1B3BA 2OV8A 3DQQA 5AI8A 4JBWA 4IWNA 2BTOA 2HBYA 1XPOA 1XRJA 3PTAA 2C3UA 1LU9A 3C74A 1H1DA 1PK7A 3WR5A 3A06A 3EWIA 5FLXA 2NNWB 2PV7A 3H65A 1J09A 3GRZA 4CN9A 1FBNA 3B3JA 4KQJA 4UXIA 1G5RA 1ZWKA 3TD9A 1BE0A 2XGMA 3D1JA 3N8HA 3O8QA 1KFCB 3PTZA 3VNBA 3VTFA 3A6LA 3HA7A 1N2BA 1N5RA 2JCVA 4L3OA 4IS3A 4GXNA 2RI0A 1C9YA 3PWZA 5ALHA 4AM8A 1T1EA 1ZO8A 1F8XA 3LP6A 4JC8A 3W1VA 3WFIA 4F91B 3T41A 1Z2DA 3EDMA 5K3DA 2PDAA 4EI2A 1QRTA 1NONA 4LXXA 1V2GA 4LVUA 5B58T 1IJKA 5HMMA 4P34A 2XMRA 3RFXA 3A6JA 4QYIB 1MC5A 1FFSA 3IVRA 5L53A 3F5SA 2DT8A 4BZXA 2NO4A 4YBZA 4HYYA 3DBLA 3LXMA 2Q7XA 3ADCA 2FPPB 4YXWD 3KJNA 3IOCA 3RKSA 1DKOA 5FT9A 4OXKA 3TLJA 2JLSA 1BTOA 3UXYA 1JR6A 3DMDA 2M2IA 4H7KA 1UJ2A 4AJPA 1WMBA 3U5ZB 3G79A 1TAUA 4TKLA 4LF4B 3GB9A 2HU2A 1KVTA 2Q0SA 4EYOA 4AZVA 5FWYB 4LX8A 5JWRA 1EX1A 1J1UA 2GARA 3KRTA 4GPBA 3WKEA 1ZUNA 1KZGB 3W2EA 3HB0A 1NXQA 2FAXA 1VJDA 4JLMA 4P3NA 5EMNA 5TJHA 4X3PA 1TMKA 4Q3CA 2Z4TA 1K9SA 3WWEA 2I7TA 1YRQA 2YR0A 5K8TA 1DCFA 3GCDA 4NZ9A 5I4CA 2GEKA 5KBYA 3KPVA 1ZK4A 2HSWA 3MT0A 3LY9A 2AMFA 3LUPA 1D7OA 2PLRA 3KSZO 4MVYA 4REQA 4EX6A 2NSJA 4B3HA 2I3DA 1GZHB 1CQJA 4C22A 1ESDA 2BGLA 5A62A 4JFAA 2QTLA 4PSCA 1MG0A 1VA4A 5A6VA 2V1XA 2IYZA 3H97A 3IE2A 3WBJA 4IIBA 3AM5A 2PKWA 3Q6NA 1ZN2A 1HTTA 1SBCA 1J5PA 4UCQA 3T61A 5E6SA 5C7YA 1TECE 2QOEA 2FG7C 4MUHA 1ZI9A 1M76A 3B3FA 4WOCA 4R9NA 3V1NA 5F2NA 1JVNA 3OO1A 4QWMA 4PAMA 1ONPA 2BOVA 2CJFA 5C1OA 4B7CA 2VZ0A 2W2TA 4XTRA 3ZQKA 3ZWPA 1KGSA 1ZU5A 4OTZA 4DV0B 3N5KA 2I4NA 2XYGA 4UEQA 3L0SA 2PYIA 2YZ2A 3O8QB 5DHPA 5FQOA 2NPFA 3TI7A 3RQIA 4LJ4A 2AZXA 3L8DA 1HOTA 2JGMA 3WDKA 2GEFA 1CYDA 1QQ6A 3PHJA 4NQRA 2QZZA 5JYBA 3HUEA 3NHMA 1XO1A 1KEPA 1F4PA 2Q5EA 3BFJA 4NFLA 4YRAA 4XB1A 4E6PA 5AHKA 5C34B 1RE0A 4Q19A 1TQ6A 2W0MA 5EZYF 2YX1A 3EVTA 2K6GA 1EZ4A 1I4DD 3R5JA 1A4IA 3F8WA 5DWVA 3WHPA 1X7WA 1KAGA 1K1EA 4UVGA 3C85A 4HQNA 3HM9A 3ZNNA 3AVOA 3E27A 3GYBA 4EPXA 3GJ5A 4F1WA 3N2ZB 4AZ3A 5B6PA 1XVTA 2QGNA 3JPYA 3WHLA 4CMEC 2WTUA 2XB8A 1A88A 3V4PB 3VSEA 1N3YA 1T8UA 1FIUA 5I9TA 2E1RA 3DHNA 1ONBA 5IP5A 1GQRA 1Q6YA 4PHHA 1X1AA 2P4EA 4JBLA 2HFJA 3KKOA 2Z6AA 1B8PA 1GPBA 3QUTA 3V6LA 2BFDA 5GPBA 4H1VA 1AC5A 2ZJOA 2XCTB 2Z6QA 3F96A 1I2AA 3P8ZA 2V6FA 3RG2A 1GYPA 3OIGA 4UDOA 2HSEA 2BFPA 3C1AA 2HIGA 4M76B 2R7NA 4GOKA 3LZCA 3WGQA 1GQFA 4B3JA 2GCGA 1A1SA 1U81A 1AQLA 1AUPA 2H5IA 4X6XA 1Z36A 3KPWA 3U4CA 5FWNA 5JAIA 4M21A 2H4WA 4F21A 3QBDA 4J4HA 1NULA 2F1OA 3GLQA 1T5LA 1MH1A 2HREA 4XR9A 4YJHA 1G8HA 2ZUSA 2WTAA 4BVFA 5HKOA 4LYFA 1KU0A 4OQLA 2I4LA 4GEGA 4QO7A 1KARA 3KHUA 4RMJA 1TJNA 3RIHA 1H05A 2GN8A 1O0CA 2JZOA 3PC3A 3FIUA 3HKDA 4U63A 3RTBA 4REMA 3OQ1A 4QRIA 1HE1C 5FYQA 3TINA 1WQ1R 3OLZA 3DDOA 2NVBA 1YKFA 3JQRA 3I1IA 4DB4A 3MTQA 1BX3A 3JSAA 5SZJA 1EXNA 3UO8B 4NS1A 4BHTA 2IH2A 5C4GB 1NF3A 4QTZA 2ODTX 2QLTA 4LA4A 2JHAA 1XTZA 2PJDA 2P41A 1QYWA 2RK3A 4PXAA 3H2HA 2P2NA 1ZISA 5KQMA 5IHPA 3HCAA 3VUEA 2FPLA 3HNPA 3QITA 1E6LA 1MBZA 1YXMA 3KYBA 4RXTA 3K1YA 1U1FA 4PHCA 2E85A 4NCNA 3TLYA 5I7VA 5EIBD 4V3CA 4CLRA 3CNLA 2A0YA 3MA0A 1JVSA 2F00A 2YIDA 2XZPA 4MJXA 1IVNA 5H3HA 3NCTA 1ISJA 4RGBA 5TC4A 4RLHA 4DUGA 3K20A 3RU9A 3E4CA 4PNHA 2YRFA 4UREA 4PQGA 1KMQA 3B78A 3O4HA 4FBGA 2Q5JA 1I3MA 1USWA 3X1JA 2LR0A 3VR3A 4DUYB 3VYWA 1YR7A 2BBTA 4D02A 5BUZA 2FPOA 2YJ4A 4LOKA 3BGVA 2Q2NA 3SY8A 5BN3A 421PA 1E8MA 1Q21A 1CDEA 3J7AC 3A11A 3IMKA 1FXWF 3DP9A 3X1MA 4D9GA 2VA8A 1TVCA 5HK9A 1XYYA 2X13A 1XUOA 4PANA 5NULA 1IOVA 1K6JA 3VDXA 1J1ZA 1BHQ1 5EESA 4D8TA 1EAMA 1R9GA 4BB9A 2EW8A 2Y27A 3A9UA 2R5FA 4OHPA 4PN7A 1CEYA 3QWFA 4TTPA 3WO1A 1JG6A 3T4PA 1DOZA 3HZRA 4V2UA 4FMCB 2G8LA 4L27A 1NVAA 5AVUA 1JG2A 4N6NA 2YY7A 4ZALA 3SR4A 1SCUB 1QFZA 3LDUA 4HXYA 2CHFA 1CJCA 1GUAA 1NT2A 1F8UA 2L69A 4WZBB 4BV9A 4DYDA 4S04A 5KO2A 1ZGJA 5DHQA 7MHTA 3CW2A 4L78A 3LBAA 5CDSA 4MEAA 4FILA 4TRMA 5F12A 2CN1A 1VIAA 4BL5A 5A5VA 3CB2A 2PV0A 4HXEB 3TEJA 1LSUA 2GEDA 2O3JA 4FHEA 5GVRA 4NAVA 5IJ0A 5KPDA 2RJOA 1KI8A 2Y0PA 2IH4A 1SU6A 4BX8A 1E1RD 2FRDA 4C30A 1G5PA 2WOOA 2ECPA 1YJQA 2VPTA 4V1CA 5T4FA 1ZSNA 1AA9A 3HDHA 4IILA 4JA0A 4R2IA 4BLVA 3QXSA 1Z07A 4EG1A 2SKEA 2QDXA 1NF2A 3TRHA 1OV4A 3DAGA 4OJMX 1NJ1A 1RQ2A 2PUVA 1N1DA 2OTCA 1XLVA 1A1VA 1LGYA 2HIMA 4ZQFA 1R0SA 2YWBA 3ND9A 2ZJAA 3HYRA 3L4KA 1A5ZA 4MYTA 2NZVG 1KEZA 2CB9A 2C9MA 2QYTA 1AS0A 3ESAA 3IOBA 4MA5A 2YYYA 4WVFA 3R9XB 3GZJA 1JYFA 1SBTA 3A1UA 4CLRB 4M3NA 5C1BA 3G9UA 3H9JA 2FU5C 2YC4C 1PR4A 4IHJA 3EPHA 4MQ5A 4IFTA 4I55A 1RLMA 2FWAA 4F1JA 2JC3A 1EVQA 3I05A 3OOHA 3K9LA 1B1AA 1DQRA 4FDUA 4LOLA 5EWLA 1KIFA 1F6WA 1WCV1 3UK6A 3VJRA 4F3TA 3ON5A 3EF0A 3UAVA 4HWKA 4BN0A 4CF6A 2D62A 2B4KA 2E5FA 3RUAA 1LC3A 3DDCA 2N75A 4IJMA 1GZ5A 1QIKA 3IDQA 4BNYA 4IDNA 1P7ZA 3WSTA 1JZSA 4HGPA 1EH5A 1JEQA 3GP3A 1AJEA 4WKNA 3F9RA 2E49A 1YHZA 3HB9A 3BSYA 3E7DA 2ZR7A 2G5GX 3ANTA 2QJOA 3RWBA 5KWVA 5EY5B 3ER9A 3ZD7A 2IIVA 3KU4A 4HT3B 5FLKA 2JL1A 1GXSA 4PE5B 2ATVA 3BBLA 5CCXA 3DB2A 4QM7A 1ORDA 2AG5A 1BDJA 2NZ8A 3LPLA 1FU4A 2NVWA 1N1MA 1QQAA 3EY9A 1O7JA 4JJFA 5CTJA 1TAGA 5DM0A 1MN6A 3ZCSA 4L2IB 3SC2B 4X8MA 3T7CA 5DK4A 1A8HA 1L8LA 1Q0HA 4HQKA 3DF9A 1E0KA 1ZCAA 2BKEA 2NX2A 2OBFA 4ZU6X 4L0CA 4ZI7F 2V0GA 2JGAA 1VKNA 2EZUA 3G0IA 2IPOA 1U3VA 4YMLA 5IRCD 4X7RA 2PX6A 4IMRA 4FEAA 4Q6BA 4IO0A 1U4NA 5DNAA 5ENVA 4EVQA 4D4IA 1HYGA 2J5KA 2WWRA 4GXRA 3ER6A 4LX0A 1QK5A 4HDQB 2IA5A 3UOAB 5CDTA 4MLPA 6NULA 5LSAA 1Z5PA 3TDMA 1PTKA 4H7IA 3HXKA 2PX3A 2YN0A 4RYLA 1WKBA 1ZICA 4ZYVA 3L8YA 2HJRA 3IS3A 2HZ7A 4YAJA 4OJNA 5CA1F 5HS4A 4IFIA 1GG9A 4JI1B 5JZVA 2X2EA 3BFPA 2O57A 2CHEA 1GLGA 1YE5A 3OJ0A 4LYEA 2ZUEA 3CRVA 4BAZA 3MCUA 2HIHA 1UXHA 3WWYA 4RMHA 1RC0A 1IZYA 2Y1XA 3FD8A 2GRAA 3DULA 4YUXA 4C4RA 2FZWA 3G1WA 3EEIA 4MUXA 4YO8A 3VNQA 1GKKA 2VC2B 4G56A 4PFQA 1OYOA 5LA6A 5JWOA 5CFNA 2B69A 2B83A 5EWLB 1Z3IX 2O59A 3IIKA 5T67A 3JQPA 4DGQA 1E98A 2HPAA 3MAAC 4P80A 1TUBB 3PSAA 3DAHA 3VX3A 2M1XA 3MFQA 4ZCSA 3P2MA 4P8RA 2OD7A 3AH8A 1R5BA 3FFXA 3D6UA 2Y1FA 3GMTA 5AK6A 4CUZA 1BVHA 3K6KA 3QXHA 2O7NA 3AG5A 3JTEA 4JJZA 3UJ9A 1DKQA 4M0EA 3X3HA 4CQLA 3NNNA 4QNMA 3U1VA 2C57A 2Z04A 4BP1A 4E3WA 3MYRA 3CVUA 3H5LA 3HY3A 2FEKA 3I6ZA 2EGUA 3OF2A 1JLSA 4GF5A 3K6JA 3TOVA 1JXMA 2H2HA 1WOYA 3QYPA 3CLVA 4KO3S 4LZWA 2DFNA 2KHZA 5ADWA 2N1MA 2W5UA 2CCKA 4BEVA 2GTIA 1MEEA 4KAFA 4XUGB 3WP1B 1A3CA 1AGXA 2WNSA 1NW4A 4UMVA 1AQJA 4RTLA 1G8AA 1R0YA 1SXJE 2HU8A 3NKLA 3T4EA 2IUUA 1T0JB 1Z4NA 3RNLA 1GNVA 1VSTA 3BAZA 1BC5A 2LRHA 4AZ0A 2C96A 3ZNQA 1KVSA 1OD6A 5TEWA 4D92A 1RZUA 2HRZA 3IMFA 5DGXA 1IM5A 2AX3A 4MRMB 5AJUA 1SC4A 1R37A 1YL7A 1JDZA 2W48A 4NJOA 2IHUA 1EWKA 5AJWA 3LS2A 4DLTA 1UIMA 4AG5A 3E84A 3PR2B 4OGFA 1VM6A 1IG3A 4IUDS 4ZVRA 3W3ZB 3G2NA 4BE9A 2PT6A 2FK8A 2BFEB 1E4VA 4QPNA 4XTCS 4URYR 5EXPA 1GARA 5CT4A 1O9HA 3BH6A 2VLBA 4QYXA 3LKVA 4IDFA 3TJMA 3SPXA 2PLNA 3W2IA 3PPYA 3A0RB 3FLBA 3VBEA 4HSGA 5D51S 3UAOA 1IU9A 3MLAA 4ZK2A 4TL9A 1P0QA 5FULA 3E2MA 1Z4IA 1H1LA 4G9EA 3VH4A 3QJ5A 4GC9A 2OGWA 3DZBA 3C97A 3SYLA 3WLAA 5C8DA 1C8BA 3I9NA 1Z12A 3I01A 3O4JA 3GCWA 5CDFA 4CODB 3SF0A 1QLWA 1JU9A 3T7KA 3DR3A 3K1JA 3TQQA 3HA2A 1I3CA 5E4JA 3ZTTA 3GEIA 4ZPJA 5K03A 5LDHA 2M6RA 4QEDA 1H94A 4NH0A 3DVAA 1D3AA 4ZQGA 1QP4A 1CUZA 4JIGA 4YRFA 4ZGWA 3NC4A 1U6IA 2NW6A 4O63O 1KJZA 2PXXA 3O8CA 4DBLC 4JFRA 2KS6A 2J1LA 2FSUA 4B4DA 1I01A 1KTVA 4MYSA 1PI3A 2IUTA 1CR1A 4I8XA 4PXYA 1V4BA 4FFPA 5HIJA 2EFGA 1Q2UA 1KYYA 1LVGA 1TM7E 1WZNA 2C9YA 1PJBA 1XZMA 2HGSA 2JFVA 1Z06A 2H5EA 3UXHA 5GZ1A 2WRZA 3JQ9A 1FRQA 2VT2A 5DLDA 3PNYA 3IUEA 3ZJVA 3IHWA 2FJ0A 3ESBA 1OX4B 1YZNA 1T4MA 3FPJA 1BXGA 3PPWA 2D8MA 3QWIA 5DLYA 3TLZA 3WB0A 1KS9A 2WJGA 4KO4S 1XDBA 4U0KA 5FL7D 2FRVA 4UU8A 2QQEA 3J80A 2YHIA 2OQVA 3C5EA 4R2HA 4L8FA 2HA7A 3WGMA 1DV1A 4BBPA 4D0NA 5IBCA 3GGOA 1J6UA 1GT91 2JFOA 1IHUA 2FFRA 2I6TA 1IB0A 1ZINA 1AKWA 2IYQA 3NXSA 4BKUA 1GA6A 3MJTA 1ZW6A 2ID7A 1MTZA 3D3NA 3PQ6A 4WCDA 5EKXA 4F3CA 2FUG1 1YS6A 2ZUBA 1EP9A 2R6JA 2JIDA 3DF7A 3IXMA 4ZYUA 5MGNA 4HJRA 1ADYA 1DTWA 1COZA 2FLKA 2PPVA 2B3DA 3G2QA 4JYCA 4EOGA 1V7QA 2WUDA 4DR1B 2Y99A 3G59A 1UWCA 3PUHA 4PZEA 1N5MA 2RC6A 4C4ZA 4YT8A 1GILA 1NKVA 1QYDA 2CBGA 4KLNA 2IL1A 1QO7A 1K68A 2FW7A 3A2MA 4BFSA 4X65B 1BGWA 1Z29A 3PQ7A 4FDMA 4BUCA 1YVPA 2JCBA 4J6EA 3U56A 1GDTA 2RH8A 1UOOA 1KMNA 3KEQA 4G97A 3ZUGA 1NASA 2DP4E 3DOIA 5EWMB 1D04A 4CFSA 2AC4A 2BI4A 2A5JA 3UKOA 4QXRA 2ZJ1A 3WNBA 1MQ8B 5G4KA 1H1LB 3T3IA 4LOHA 3O2NA 3D1VA 2H0QA 5CTAA 5LZ8A 4F3YA 3D4IA 2HLPA 3FVQA 3R24A 3R0XA 4DBZA 1PE0A 3H6GA 2C88A 2PZFA 4S3MA 3SIRA 2IOFK 3GMIA 2GLUA 3IILA 4YBRA 4PSAA 2ZIEA 3EEQA 1QO0A 1IEXA 4OATA 1N9ZA 4UE6A 2FZVA 4JSRA 3B2QA 3QK7A 4ZQBA 3P9KA 4OAPA 4Q1DA 4MNTA 5DBIA 5IAGA 1Q0PA 3Q12A 4RVFA 5ALDA 2HNBA 3KKEA 3P0JA 3U3ZA 3X43A 4J7UA 4W9NA 1BE1A 1WZIA 3JWHA 2XVYA 1ZNZA 5GTDA 2C97A 4LZNA 3GLRA 3M5DA 3KQPA 3WGVA 2WHRA 1BFDA 4C0LA 4C76A 1PZXA 2V8OA 4ROSA 1M34A 1P0MA 3C3JA 4RIFA 4K26A 4YJKA 2QRMA 1QGZA 2PRJA 3C7DB 5G0SA 4EM6A 2VTBB 1ZCFA 2DR0A 1KK3A 3O1LA 4DSUA 1DLJA 1KYZA 4RF3A 4CV0A 4DJ5X 3OKFA 3PRJA 2NTYC 4DV4B 4FOPA 1HFWA 3IUMA 4LI0A 4DCPA 5KNCA 2AMYA 5DX1A 1G1AA 3C98A 3N70A 5HJ2A 1KQNA 4D9HA 4MUNA 1SB9A 1TUEA 1DL5A 1USGA 1YK1A 4GNKA 1Q16A 2HJHA 5CIQA 1LTKA </