3GHZA

2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from salmonella typhimurium
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
157
structure length
157
Chain Sequence
AMRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDEVNVKATTTEKLGFTGRGEGIACEAVALLMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title X-ray crystal structure of 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase from Salmonella typhimurium.
rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 53
structure length 157
sequence length 157
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2009-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3ghzA00
3GHZA 4C82A 3B6NA 3ELCA 3IEWA 3F6MA 1VH8A 1IV1A 1T0AA 3Q8HA 3QHDA 3F0GA 4C8GA 1VHAA 2UZHA 3P0ZA 1KNJA 3RE3A 1U40A 2AMTA 2PMPA 3MBMA 1U3PA 1JN1A 4C81A 3JVHA 1IV4A 3F0EA 4C8IA 1U3LA 1KNKA 3F0FA 3IKEA 1W57A 3IEQA 1IV3A 1H48A 3FPIA 3KE1A 3ESJA 3FBAA 1GX1A 3P10A 2GZLA 3EORA 1U43A 1IV2A 1YQNA 3F0DA 5B8FA 1H47A 1W55A 3IKFA 3K14A 3K2XA 3T80A 1JY8A 3ERNA 4C8EA
chains in the Genus database with same CATH superfamily
3VYTC 3FD5A 1K73H 1VQ8F 1ODEA 3F6MA 1VH8A 3CB2A 4ZOLB 4DXDA 1NJIH 4X1YA 1COMA 3UT5A 3TD4A 2UZHA 1GO1A 3C9RA 5IJ0A 4I50B 4X3MA 3NK6A 1T0KB 3S0YA 1X7OA 1FSZA 4ZHQB 1KNKA 2ZVZA 4YJ3A 2VAPA 2HQSC 4O4HB 3LYBA 1Z5WA 2QTPA 4O4JA 4I4TA 4B62A 3WPWA 3CG6A 1W55A 3JAWB 1UI9A 2WALA 4U3JA 5IT9M 2Z1UA 5LOVB 1W40A 5G4UC 3V7QA 3CD6F 5GAPK 1QD9A 3LFOA 2VGMA 3GTZA 4ZHVA 3CMEF 3TD5A 4EB6B 5KX5B 1TVKA 1FFXB 4X1KA 4C8IA 2UYPA 2CVLA 3TD3A 5LXTB 2FGYA 2B33A 5EIBD 4TUYA 3JAKA 5A2QM 3WGKA 3MDOA 3JARA 1KD1H 3K2XA 3OW2F 1W5EA 2VAMA 5FNVA 5EIBC 2R751 2CHSA 3NVKE 3CYPB 5EO3A 1JJ2F 4G4WA 1VQNF 1XBIA 3CCRF 1SA0B 2KTUA 4B5CA 4ZOLA 2CW4A 3QUWA 3RA5A 3MBMA 2DYYA 2CWJA 4TV8B 3RYIB 5J2UB 2P6YA 3QTYA 4O2BB 2Z1TA 3F0EA 3O85A 3OBYA 2HS3A 4I50A 4M8IA 3FPIA 5LP6C 4TZZA 3E22B 1SZQA 4X3LA 3VOAA 1YQNA 1FNJA 1W5BA 2VAWA 4O4HA 1IPAA 2H6LA 1RQ7A 1XRGA 1RQ2A 3T80A 4U39A 1DT9A 3N4YA 1X7PA 2RB9A 2H8CA 3UT5B 1Q8RA 5JQGB 5IJ9B 3S06A 3K0TA 2OTMA 3LDTA 5LOVA 4IIJB 2VXYA 4C81A 3FD6A 3L7QA 2ZAUA 2Z01A 3CCUF 3IKEA 5FJ4C 2G9IA 3VIUA 4EB6A 2RHOA 5KX5A 2OHWA 1FFXA 3P4EA 2BTOA 1OAPA 3G6EF 2OZBA 3ZP4A 3C8LA 3PAFA 1W5AA 3CCQF 2Q1YA 5MN5A 3CCJF 3RYCB 3WJQA 1Q7YH 3ELCA 1UFYA 3DC2A 2ZODA 3J80M 3QHDA 3IMPA 2QA4F 4YJ2B 4G4VA 1VQVA 3JVHA 1SA0A 4ZK7A 3LWVC 5EB1B 2HRYA 3V3TA 2GVIA 4TUYB 4F6RB 5HY0A 4TV8A 2EWCA 1W59A 5J2UA 4O2BA 2GZLA 4NWOB 3D00A 3I56F 1U43A 3N2GB 1QVFF 1NQ3A 3WJRA 1W41A 3HKCB 5B8FA 2N48A 2OTJF 3E22A 1DBFA 4G4ZA 1VQLF 3C9SA 5GONB 1RLGA 2PHNA 3JATB 5JQGA 5IJ9A 3JASB 1U3PA 2ZF8A 4O2AB 4BVTA 2UYNA 2LBWA 1U3LA 4IIJA 1VK3A 2BO1A 4O4LA 4IHJB 5EYPB 4EI7A 4BT4A 5J2TA 3WGJA 5GIOC 3CMAF 1N8RH 1TUBB 5MN4A 3RYHA 5EWRA 3RA6A 3WGNA 4C82A 3RYCA 3M1XA 3SIVA 3D54A 3F0GA 5EB0A 4BT5A 1W42A 3J7AR 3BYQA 5ITZB 4BT3A 3HTNA 4DRXB 2FC3A 4YJ2A 3OONA 4ZI7B 5C8YB 1SDSA 4NUTA 1GO0A 4F6RA 3RYFA 3SIUA 4ZHWA 3GYQA 1VQMF 1Q82H 3CCLF 3ERNA 3I7TA 3N2GA 5HP8A 1R1MA 2R6R1 3HKCA 2CSLA 5HP7A 1IV1A 1T0AA 3Q8HA 3CC4F 3KIZA 3KHNA 5CB4B 2IQQA 1XHOA 3RE3A 5GONA 2KGWA 3JATA 4E6EA 2HP0A 3JASA 2V9YA 3HAXD 4BY9D 2ALEA 5LP6B 4G88A 4O2AA 5KMGB 3CPWF 4IHJA 5EYPA 5JCOC 1VQ4F 4FFBA 4C8EA 1TUBA 1GZ0A 2CZWA 3U0OA 5GINC 3OBWA 3MCAB 5EZYB 4C8GA 2KG4A 2UYNB 1U40A 1W3EX 3HWUA 4O4LB 1M90H 3CC7F 1E7KA 5ITZA 3VOBA 1W57A 5J2TB 1YHQF 2YXZA 4DRXA 4ZI7A 3RYHB 3ZP7A 3EORA 2LCAA 5C8YA 1W581 1CK2A 3S02A 1QVGF 4WBNB 1YJWF 4O4IB 2LBTA 2DT4A 5JVDA 2UYKA 3LWOC 1VQPF 1VQ6F 3D01A 3C9TA 3WGMA 2HX0A 3VTIC 1QAHA 1H7MA 3S03A 1CN7A 2HS4A 1XV2A 2I6DA 3VYSC 1JN1A 3M4SA 5CB4A 2RHLA 4G4XA 3JCMM 1QU9A 5EAZA 3VO8A 3MQWA 3RYFB 3LWQC 3CPQA 3CCSF 3CC2F 5LP6A 4BVRA 5HY4A 3HKDB 2HRUA 5KMGA 3B6NA 3G71F 3KJJA 1RLUA 2JNBA 1KQSF 3LWRC 1VHAA 1JD1A 5DCVA 2HP0B 5EZYA 5G4VC 3VI6A 1JFFB 2BTQB 1H48A 5JH7B 1CLIA 3JALB 2LBXA 3P10A 4I55B 1YI2F 3V7EA 2ZOVA 4FFBB 2HS0A 3VCZA 4LNUA 1X52A 2KTVA 1JY8A 2HVYD 3N4ZA 3WXMB 1YITF 5IYZB 4WBNA 4O4IA 4C4WC 3WJPA 1FNKA 2L26A 3S0HA 1YJ9F 3MCQA 3M84A 4BVSA 1YJNF 3V4DA 2MQEA 1IV4A 5HXZA 4TV9B 3KJKA 5HY2A 3PLAC 5FLXM 2HP3A 5HWEA 1Q86H 3FBAA 4KWEA 5LA6B 3WGLA 5LYJA 5CA1B 2CHTA 4LCKA 2ZVYA 5CA0B 2IG8A 5JVDB 3VYUC 1H47A 3HKEB 1YGYA 3HJWC 3HKBB 3HKDA 3FFMA 1VQKF 5GIPC 1ONIA 1VQ5F 3ZO8A 3NVIB 4ZHYB 3IR9A 2I6RA 1VQOF 3AGKA 3CCVF 1VQ7F 3N2KB 2W8BC 3CXCF 1RA4A 2NMUA 3F0FA 3KE1A 4BVQA 1X25A 3JAMM 2QEXF 1J7HA 1PXWA 3K12A 1NMUB 1JFFA 3NK7A 3E1YA 5JH7A 3JALA 4I55A 3ON1A 2Q1XA 4R40B 5BMVA 3IEWA 2VGNA 4X20B 2F9ZC 1KC8H 3P0ZA 5IYZA 2AMTA 2PMPA 1VQ9F 4X1IB 4RQOA 3IEQA 4HNAB 1ZWZA 4XCQA 3I3FA 3DDNA 4ZHQA 4TV9A 1YIJF 4LNUB 1K9MH 1IV2A 3CCMF 2UYJA 1S72F 2K1SA 3LMEA 3K14A 5LA6A 1M1KH 5CA1A 4NQ3A 4X1YB 5CA0A 3JAWA 4B45A 2RHJA 2QI2A 5IJ0B 3HKEA 4EI9A 3I55F 1Q81H 3WPXA 3E20B 4BT2A 1KNJA 2OTLF 3HKBA 4YJ3B 3J81M 3LWPC 1Z5VA 5LYJB 1W2BF 1K8AH 4PWTA 4O4JB 3N2KA 4I4TB 2Z1FA 4BW0B 1GX1A 1W5FA 4BT7A 4B46A 4U3JB 5LXTA 2AIZP 1OFUA 1PF5A 3GHZA 3S0WA 2H8EA 5JCOA 3CCEF 5GANK 3ZOPA 3G4SF 4RHAA 1TVKB 4X1KB 3C9UA 4BT6A 4X20A 4EI8A 2BTUA 3CYQA 2GLZA 4ERHA 3R0PA 5HY1A 5HXUA 4G4YA 2IAFA 2Z1EA 3JAKB 5AVMA 3VMFB 1IV3A 3RYIA 2AIFA 3ESJA 3JARB 4X1IA 2RHHA 3F0DA 5MN6A 4HNAA 5FNVB 5BMVB 3NMUC 2YYEA 3IKFA
chains in the Genus database with same CATH topology
3GHZA 4C82A 3B6NA 3ELCA 3IEWA 3F6MA 1VH8A 1IV1A 1T0AA 3Q8HA 3QHDA 3F0GA 4C8GA 1VHAA 2UZHA 3P0ZA 1KNJA 3RE3A 1U40A 2AMTA 2PMPA 3MBMA 1U3PA 1JN1A 4C81A 3JVHA 1IV4A 3F0EA 4C8IA 1U3LA 1KNKA 3F0FA 3IKEA 1W57A 3IEQA 1IV3A 1H48A 3FPIA 3KE1A 3ESJA 3FBAA 1GX1A 3P10A 2GZLA 3EORA 1U43A 1IV2A 1YQNA 3F0DA 5B8FA 1H47A 1W55A 3IKFA 3K14A 3K2XA 3T80A 1JY8A 3ERNA 4C8EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GHZ A;  4C82 A;  3B6N A;  3ELC A;  3IEW A;  3F6M A;  1VH8 A;  1IV1 A;  1T0A A;  3Q8H A;  3QHD A;  3F0G A;  4C8G A;  1VHA A;  2UZH A;  3P0Z A;  1KNJ A;  3RE3 A;  1U40 A;  2AMT A;  2PMP A;  3MBM A;  1U3P A;  1JN1 A;  4C81 A;  3JVH A;  1IV4 A;  3F0E A;  4C8I A;  1U3L A;  1KNK A;  3F0F A;  3IKE A;  1W57 A;  3IEQ A;  1IV3 A;  1H48 A;  3FPI A;  3KE1 A;  3ESJ A;  3FBA A;  1GX1 A;  3P10 A;  2GZL A;  3EOR A;  1U43 A;  1IV2 A;  1YQN A;  3F0D A;  5B8F A;  1H47 A;  1W55 A;  3IKF A;  3K14 A;  3K2X A;  3T80 A;  1JY8 A;  3ERN A;  4C8E A; 
#chains in the Genus database with same CATH topology
 3VYT C;  3FD5 A;  1K73 H;  1VQ8 F;  1ODE A;  3F6M A;  1VH8 A;  3CB2 A;  4ZOL B;  4DXD A;  1NJI H;  4X1Y A;  1COM A;  3UT5 A;  3TD4 A;  2UZH A;  1GO1 A;  3C9R A;  5IJ0 A;  4I50 B;  4X3M A;  3NK6 A;  1T0K B;  3S0Y A;  1X7O A;  1FSZ A;  4ZHQ B;  1KNK A;  2ZVZ A;  4YJ3 A;  2VAP A;  2HQS C;  4O4H B;  3LYB A;  1Z5W A;  2QTP A;  4O4J A;  4I4T A;  4B62 A;  3WPW A;  3CG6 A;  1W55 A;  3JAW B;  1UI9 A;  2WAL A;  4U3J A;  5IT9 M;  2Z1U A;  5LOV B;  1W40 A;  5G4U C;  3V7Q A;  3CD6 F;  5GAP K;  1QD9 A;  3LFO A;  2VGM A;  3GTZ A;  4ZHV A;  3CME F;  3TD5 A;  4EB6 B;  5KX5 B;  1TVK A;  1FFX B;  4X1K A;  4C8I A;  2UYP A;  2CVL A;  3TD3 A;  5LXT B;  2FGY A;  2B33 A;  5EIB D;  4TUY A;  3JAK A;  5A2Q M;  3WGK A;  3MDO A;  3JAR A;  1KD1 H;  3K2X A;  3OW2 F;  1W5E A;  2VAM A;  5FNV A;  5EIB C;  2R75 1;  2CHS A;  3NVK E;  3CYP B;  5EO3 A;  1JJ2 F;  4G4W A;  1VQN F;  1XBI A;  3CCR F;  1SA0 B;  2KTU A;  4B5C A;  4ZOL A;  2CW4 A;  3QUW A;  3RA5 A;  3MBM A;  2DYY A;  2CWJ A;  4TV8 B;  3RYI B;  5J2U B;  2P6Y A;  3QTY A;  4O2B B;  2Z1T A;  3F0E A;  3O85 A;  3OBY A;  2HS3 A;  4I50 A;  4M8I A;  3FPI A;  5LP6 C;  4TZZ A;  3E22 B;  1SZQ A;  4X3L A;  3VOA A;  1YQN A;  1FNJ A;  1W5B A;  2VAW A;  4O4H A;  1IPA A;  2H6L A;  1RQ7 A;  1XRG A;  1RQ2 A;  3T80 A;  4U39 A;  1DT9 A;  3N4Y A;  1X7P A;  2RB9 A;  2H8C A;  3UT5 B;  1Q8R A;  5JQG B;  5IJ9 B;  3S06 A;  3K0T A;  2OTM A;  3LDT A;  5LOV A;  4IIJ B;  2VXY A;  4C81 A;  3FD6 A;  3L7Q A;  2ZAU A;  2Z01 A;  3CCU F;  3IKE A;  5FJ4 C;  2G9I A;  3VIU A;  4EB6 A;  2RHO A;  5KX5 A;  2OHW A;  1FFX A;  3P4E A;  2BTO A;  1OAP A;  3G6E F;  2OZB A;  3ZP4 A;  3C8L A;  3PAF A;  1W5A A;  3CCQ F;  2Q1Y A;  5MN5 A;  3CCJ F;  3RYC B;  3WJQ A;  1Q7Y H;  3ELC A;  1UFY A;  3DC2 A;  2ZOD A;  3J80 M;  3QHD A;  3IMP A;  2QA4 F;  4YJ2 B;  4G4V A;  1VQV A;  3JVH A;  1SA0 A;  4ZK7 A;  3LWV C;  5EB1 B;  2HRY A;  3V3T A;  2GVI A;  4TUY B;  4F6R B;  5HY0 A;  4TV8 A;  2EWC A;  1W59 A;  5J2U A;  4O2B A;  2GZL A;  4NWO B;  3D00 A;  3I56 F;  1U43 A;  3N2G B;  1QVF F;  1NQ3 A;  3WJR A;  1W41 A;  3HKC B;  5B8F A;  2N48 A;  2OTJ F;  3E22 A;  1DBF A;  4G4Z A;  1VQL F;  3C9S A;  5GON B;  1RLG A;  2PHN A;  3JAT B;  5JQG A;  5IJ9 A;  3JAS B;  1U3P A;  2ZF8 A;  4O2A B;  4BVT A;  2UYN A;  2LBW A;  1U3L A;  4IIJ A;  1VK3 A;  2BO1 A;  4O4L A;  4IHJ B;  5EYP B;  4EI7 A;  4BT4 A;  5J2T A;  3WGJ A;  5GIO C;  3CMA F;  1N8R H;  1TUB B;  5MN4 A;  3RYH A;  5EWR A;  3RA6 A;  3WGN A;  4C82 A;  3RYC A;  3M1X A;  3SIV A;  3D54 A;  3F0G A;  5EB0 A;  4BT5 A;  1W42 A;  3J7A R;  3BYQ A;  5ITZ B;  4BT3 A;  3HTN A;  4DRX B;  2FC3 A;  4YJ2 A;  3OON A;  4ZI7 B;  5C8Y B;  1SDS A;  4NUT A;  1GO0 A;  4F6R A;  3RYF A;  3SIU A;  4ZHW A;  3GYQ A;  1VQM F;  1Q82 H;  3CCL F;  3ERN A;  3I7T A;  3N2G A;  5HP8 A;  1R1M A;  2R6R 1;  3HKC A;  2CSL A;  5HP7 A;  1IV1 A;  1T0A A;  3Q8H A;  3CC4 F;  3KIZ A;  3KHN A;  5CB4 B;  2IQQ A;  1XHO A;  3RE3 A;  5GON A;  2KGW A;  3JAT A;  4E6E A;  2HP0 A;  3JAS A;  2V9Y A;  3HAX D;  4BY9 D;  2ALE A;  5LP6 B;  4G88 A;  4O2A A;  5KMG B;  3CPW F;  4IHJ A;  5EYP A;  5JCO C;  1VQ4 F;  4FFB A;  4C8E A;  1TUB A;  1GZ0 A;  2CZW A;  3U0O A;  5GIN C;  3OBW A;  3MCA B;  5EZY B;  4C8G A;  2KG4 A;  2UYN B;  1U40 A;  1W3E X;  3HWU A;  4O4L B;  1M90 H;  3CC7 F;  1E7K A;  5ITZ A;  3VOB A;  1W57 A;  5J2T B;  1YHQ F;  2YXZ A;  4DRX A;  4ZI7 A;  3RYH B;  3ZP7 A;  3EOR A;  2LCA A;  5C8Y A;  1W58 1;  1CK2 A;  3S02 A;  1QVG F;  4WBN B;  1YJW F;  4O4I B;  2LBT A;  2DT4 A;  5JVD A;  2UYK A;  3LWO C;  1VQP F;  1VQ6 F;  3D01 A;  3C9T A;  3WGM A;  2HX0 A;  3VTI C;  1QAH A;  1H7M A;  3S03 A;  1CN7 A;  2HS4 A;  1XV2 A;  2I6D A;  3VYS C;  1JN1 A;  3M4S A;  5CB4 A;  2RHL A;  4G4X A;  3JCM M;  1QU9 A;  5EAZ A;  3VO8 A;  3MQW A;  3RYF B;  3LWQ C;  3CPQ A;  3CCS F;  3CC2 F;  5LP6 A;  4BVR A;  5HY4 A;  3HKD B;  2HRU A;  5KMG A;  3B6N A;  3G71 F;  3KJJ A;  1RLU A;  2JNB A;  1KQS F;  3LWR C;  1VHA A;  1JD1 A;  5DCV A;  2HP0 B;  5EZY A;  5G4V C;  3VI6 A;  1JFF B;  2BTQ B;  1H48 A;  5JH7 B;  1CLI A;  3JAL B;  2LBX A;  3P10 A;  4I55 B;  1YI2 F;  3V7E A;  2ZOV A;  4FFB B;  2HS0 A;  3VCZ A;  4LNU A;  1X52 A;  2KTV A;  1JY8 A;  2HVY D;  3N4Z A;  3WXM B;  1YIT F;  5IYZ B;  4WBN A;  4O4I A;  4C4W C;  3WJP A;  1FNK A;  2L26 A;  3S0H A;  1YJ9 F;  3MCQ A;  3M84 A;  4BVS A;  1YJN F;  3V4D A;  2MQE A;  1IV4 A;  5HXZ A;  4TV9 B;  3KJK A;  5HY2 A;  3PLA C;  5FLX M;  2HP3 A;  5HWE A;  1Q86 H;  3FBA A;  4KWE A;  5LA6 B;  3WGL A;  5LYJ A;  5CA1 B;  2CHT A;  4LCK A;  2ZVY A;  5CA0 B;  2IG8 A;  5JVD B;  3VYU C;  1H47 A;  3HKE B;  1YGY A;  3HJW C;  3HKB B;  3HKD A;  3FFM A;  1VQK F;  5GIP C;  1ONI A;  1VQ5 F;  3ZO8 A;  3NVI B;  4ZHY B;  3IR9 A;  2I6R A;  1VQO F;  3AGK A;  3CCV F;  1VQ7 F;  3N2K B;  2W8B C;  3CXC F;  1RA4 A;  2NMU A;  3F0F A;  3KE1 A;  4BVQ A;  1X25 A;  3JAM M;  2QEX F;  1J7H A;  1PXW A;  3K12 A;  1NMU B;  1JFF A;  3NK7 A;  3E1Y A;  5JH7 A;  3JAL A;  4I55 A;  3ON1 A;  2Q1X A;  4R40 B;  5BMV A;  3IEW A;  2VGN A;  4X20 B;  2F9Z C;  1KC8 H;  3P0Z A;  5IYZ A;  2AMT A;  2PMP A;  1VQ9 F;  4X1I B;  4RQO A;  3IEQ A;  4HNA B;  1ZWZ A;  4XCQ A;  3I3F A;  3DDN A;  4ZHQ A;  4TV9 A;  1YIJ F;  4LNU B;  1K9M H;  1IV2 A;  3CCM F;  2UYJ A;  1S72 F;  2K1S A;  3LME A;  3K14 A;  5LA6 A;  1M1K H;  5CA1 A;  4NQ3 A;  4X1Y B;  5CA0 A;  3JAW A;  4B45 A;  2RHJ A;  2QI2 A;  5IJ0 B;  3HKE A;  4EI9 A;  3I55 F;  1Q81 H;  3WPX A;  3E20 B;  4BT2 A;  1KNJ A;  2OTL F;  3HKB A;  4YJ3 B;  3J81 M;  3LWP C;  1Z5V A;  5LYJ B;  1W2B F;  1K8A H;  4PWT A;  4O4J B;  3N2K A;  4I4T B;  2Z1F A;  4BW0 B;  1GX1 A;  1W5F A;  4BT7 A;  4B46 A;  4U3J B;  5LXT A;  2AIZ P;  1OFU A;  1PF5 A;  3GHZ A;  3S0W A;  2H8E A;  5JCO A;  3CCE F;  5GAN K;  3ZOP A;  3G4S F;  4RHA A;  1TVK B;  4X1K B;  3C9U A;  4BT6 A;  4X20 A;  4EI8 A;  2BTU A;  3CYQ A;  2GLZ A;  4ERH A;  3R0P A;  5HY1 A;  5HXU A;  4G4Y A;  2IAF A;  2Z1E A;  3JAK B;  5AVM A;  3VMF B;  1IV3 A;  3RYI A;  2AIF A;  3ESJ A;  3JAR B;  4X1I A;  2RHH A;  3F0D A;  5MN6 A;  4HNA A;  5FNV B;  5BMV B;  3NMU C;  2YYE A;  3IKF A; 
#chains in the Genus database with same CATH homology
 3GHZ A;  4C82 A;  3B6N A;  3ELC A;  3IEW A;  3F6M A;  1VH8 A;  1IV1 A;  1T0A A;  3Q8H A;  3QHD A;  3F0G A;  4C8G A;  1VHA A;  2UZH A;  3P0Z A;  1KNJ A;  3RE3 A;  1U40 A;  2AMT A;  2PMP A;  3MBM A;  1U3P A;  1JN1 A;  4C81 A;  3JVH A;  1IV4 A;  3F0E A;  4C8I A;  1U3L A;  1KNK A;  3F0F A;  3IKE A;  1W57 A;  3IEQ A;  1IV3 A;  1H48 A;  3FPI A;  3KE1 A;  3ESJ A;  3FBA A;  1GX1 A;  3P10 A;  2GZL A;  3EOR A;  1U43 A;  1IV2 A;  1YQN A;  3F0D A;  5B8F A;  1H47 A;  1W55 A;  3IKF A;  3K14 A;  3K2X A;  3T80 A;  1JY8 A;  3ERN A;  4C8E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...