3GHZA

2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from salmonella typhimurium
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
157
structure length
157
Chain Sequence
b'AMRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDEVNVKATTTEKLGFTGRGEGIACEAVALLMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
molecule tags Lyase
source organism Salmonella typhimurium
publication title X-ray crystal structure of 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase from Salmonella typhimurium.
rcsb
total genus 53
structure length 157
sequence length 157
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2009-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3ghzA00
3F0FA 3F0DA 1IV1A 1KNJA 3IEQA 1JY8A 3QHDA 1W55A 1JN1A 1U3PA 3EORA 2GZLA 4C8GA 3F6MA 4C81A 2AMTA 1GX1A 3KE1A 2UZHA 3IKFA 3T80A 3B6NA 3FPIA 4C8IA 3ELCA 3IKEA 1H47A 3F0GA 3K2XA 3P0ZA 4C82A 1VHAA 3ESJA 3IEWA 5B8FA 3MBMA 3RE3A 3ERNA 3P10A 3FBAA 1KNKA 3JVHA 1IV2A 3GHZA 1T0AA 1U43A 1YQNA 1VH8A 1IV4A 3K14A 2PMPA 1IV3A 1H48A 1W57A 4C8EA 1U40A 1U3LA 3F0EA 3Q8HA
chains in the Genus database with same CATH superfamily
5J2UA 1GZ0A 3L7QA 4BVQA 4G4XA 3LMEA 5EIBC 1FNJA 4O2BB 3JAMM 3F6MA 4C81A 5EO3A 1VQ5F 3JAWB 5EYPA 4LCKA 3FPIA 3F0GA 4BT4A 2VGNA 5LOVB 5C8YA 5JQGA 3HJWC 5MN6A 3WGLA 2KG4A 3P10A 4C4WC 3WJQA 3CYQA 3C9UA 3HKEA 2Q1YA 3M84A 1YI2F 4B46A 1K73H 3OBYA 3S0WA 1W5BA 2UYNA 3JAKB 2YYEA 3CXCF 4ZI7B 1KC8H 4BW0B 4FFBB 2QI2A 2UYNB 3IEQA 1CLIA 2HRYA 3RYFB 1J7HA 1X7OA 3WGJA 1GX1A 1Q86H 1H47A 3C8LA 2RHLA 1TVKB 3C9SA 5IJ0B 1KQSF 2VXYA 1E7KA 2Q1XA 2I6RA 1N8RH 5A2QM 4ZOLA 3N2KA 1W40A 2H8CA 3JARA 1SZQA 3WJPA 5KMGB 5FJ4C 3EORA 1OFUA 2VGMA 3JARB 1M1KH 3VYSC 2V9YA 3JALA 4YJ3A 3F0FA 3OONA 3CPWF 4B45A 2ZVYA 1W55A 2K1SA 3HKBA 1ONIA 3CB2A 3KIZA 2OHWA 3HKBB 3VYUC 3M4SA 3HAXD 3NK6A 1QAHA 5IJ9B 3TD4A 1Z5WA 1NQ3A 2LBTA 3TD3A 2NMUA 2ZF8A 1PF5A 3WGMA 1VQ9F 4I50B 1DT9A 1W5FA 2LBXA 3RYIA 3IR9A 4RHAA 3UT5B 3LWVC 3VOBA 2LCAA 3S06A 3SIUA 5IT9M 5IYZA 3HKCB 4I4TA 4U3JB 5ITZA 1JFFB 3N2KB 4O4LA 1W3EX 5FNVB 4M8IA 1VHAA 3MQWA 5B8FA 1SA0A 1XBIA 5HP8A 5MN4A 4HNAB 2VAPA 3V7EA 3RYHA 4O2BA 4R40B 5CA0A 5G4UC 1RLUA 1W5EA 4IIJB 4G4ZA 4YJ2B 1TUBA 2RHHA 1JD1A 5LA6A 4EI9A 4TZZA 1TUBB 3FD5A 4O2AA 4TV9A 1R1MA 3GYQA 3R0PA 5HY1A 2YXZA 5EB1B 1XHOA 2GLZA 5MN5A 2HP0B 1NMUB 2R751 3CCJF 4X20A 3MBMA 1W42A 3WGKA 4BVTA 3K12A 4G88A 4TV8B 2P6YA 3V4DA 5EB0A 4X3LA 4NWOB 4BT6A 3OBWA 1JJ2F 5JCOC 4RQOA 2CHSA 1RQ2A 1Q7YH 2H8EA 4C8GA 1DBFA 2CZWA 1VQ6F 3SIVA 3T80A 5FNVA 2WALA 3VO8A 4X3MA 1CN7A 4HNAA 3JVHA 2ALEA 1NJIH 5EZYA 4G4VA 3C9RA 3N4ZA 2CW4A 5LA6B 1QVGF 1Z5VA 3LWQC 1TVKA 5IJ0A 1XV2A 1KNJA 3S02A 4O4JA 1U3PA 3O85A 3CCSF 3CPQA 3G4SF 4IHJA 4B5CA 3VYTC 4NUTA 3UT5A 5C8YB 5JQGB 2IAFA 1YJWF 4LNUA 3CG6A 1YITF 5FLXM 3HKEB 4BT3A 5EIBD 3VMFB 3BYQA 3F0EA 3PLAC 4DXDA 4WBNB 5IJ9A 5GIOC 1QVFF 2F9ZC 3LWOC 4BVRA 5EAZA 1JN1A 3LYBA 3RYCB 2CHTA 1ODEA 2BTQB 3VOAA 5HXUA 3U0OA 3J81M 3CCMF 1GO0A 4X1KA 3RYCA 3MDOA 3VIUA 1UI9A 4FFBA 3CMAF 4ZHQA 3K2XA 3N2GA 4ZHQB 3RA6A 2AIFA 3HKDA 1PXWA 1IPAA 2JNBA 5BMVA 5KX5B 4O4JB 3JATA 3CYPB 1H48A 1RA4A 4C8EA 2IQQA 3E22B 5LP6A 5CA1B 3CC7F 3TD5A 1X25A 4ZOLB 3NVIB 2ZAUA 4ZHWA 1IV1A 2HX0A 5CA1A 3S03A 1W41A 3JAWA 5EYPB 4LNUB 4PWTA 3I7TA 1YGYA 3G6EF 2DT4A 2Z01A 3M1XA 3KJKA 4EB6B 2BO1A 3C9TA 2DYYA 5LOVA 5LXTB 3QTYA 2Z1UA 3CCVF 1FNKA 4E6EA 1S72F 4TUYB 1VQOF 1YIJF 4BT7A 3CC2F 2GVIA 4G4WA 5JCOA 3G71F 1VQ4F 2KTUA 4ZI7A 2QTPA 1YJNF 5HY2A 2OTMA 1X7PA 5GANK 1QU9A 3IKFA 1JFFA 4NQ3A 4C8IA 2G9IA 5GONA 5KX5A 3D54A 2AIZP 3ESJA 3IEWA 3DDNA 3I56F 2RB9A 3ERNA 3HKDB 5GONB 3RA5A 1RLGA 3RYHB 3ZOPA 1YQNA 5J2TA 1Q82H 2L26A 2PHNA 1IV4A 5DCVA 2PMPA 2HS0A 1ZWZA 1U3LA 3F0DA 5J2TB 3Q8HA 1FFXA 2ZVZA 2MQEA 4X1IA 5HP7A 1VQKF 3VTIC 3CCEF 3KJJA 2W8BC 4TV9B 4ZK7A 2GZLA 4X1IB 1K9MH 3OW2F 2B33A 2UYJA 5EZYB 3V3TA 5JH7A 2HRUA 4O2AB 3NMUC 4BVSA 4TUYA 2Z1TA 4G4YA 2CVLA 4I50A 1KNKA 3IMPA 1VQPF 2CSLA 2BTOA 2HQSC 4O4IA 1W581 1VH8A 3AGKA 4B62A 1W57A 5EWRA 2OTJF 3RYIB 3JASB 2EWCA 3WPWA 1T0KB 3D01A 4F6RA 2Z1EA 5BMVB 3JASA 1VQVA 4ZHVA 2UZHA 3FFMA 1YJ9F 3ZO8A 4C82A 1VQNF 1YHQF 4BT5A 5HY0A 1Q8RA 3LDTA 2FC3A 3LFOA 5JVDA 3JALB 4YJ3B 2RHOA 3DC2A 3E20B 3K14A 3J7AR 4X1KB 3CCLF 1VQLF 2N48A 1OAPA 5JH7B 1W59A 4U39A 1JY8A 2HP0A 3NVKE 1VK3A 3JCMM 2UYPA 5HWEA 4ZHYB 2IG8A 3J80M 4XCQA 4O4IB 4EI8A 5LYJA 4DRXA 3QUWA 2LBWA 4ERHA 5HXZA 2R6R1 4I55A 3RYFA 4DRXB 2ZOVA 2CWJA 3MCAB 3HKCA 5HY4A 4WBNA 3WXMB 1SDSA 1KD1H 1UFYA 4O4HB 3E1YA 3CCRF 3V7QA 3WPXA 1K8AH 3QHDA 5IYZB 5GINC 3KE1A 4O4LB 2HS3A 3PAFA 3ELCA 4BY9D 1FFXB 3P0ZA 3S0YA 2OTLF 4KWEA 3D00A 5CB4B 3RE3A 3VCZA 2HVYD 2VAWA 3S0HA 1RQ7A 2KTVA 1QD9A 1CK2A 3CMEF 1U40A 3LWPC 2QA4F 4X20B 1VQ7F 3CCUF 5GAPK 3VI6A 2FGYA 3E22A 5AVMA 2HP3A 2Z1FA 3ZP4A 3K0TA 5J2UB 5LP6B 3FD6A 3CC4F 5KMGA 4TV8A 3CD6F 3IKEA 1M90H 3MCQA 3I55F 1H7MA 1W2BF 4EI7A 1Q81H 3KHNA 1VQ8F 2RHJA 3ON1A 1XRGA 4I55B 2HS4A 5LXTA 2QEXF 3WGNA 3N4YA 2OZBA 4U3JA 3GTZA 5ITZB 3CCQF 4EB6A 1IV3A 2I6DA 3FBAA 4X1YB 5LP6C 1SA0B 3ZP7A 1VQMF 1GO1A 4O4HA 2VAMA 3I3FA 4X1YA 3WJRA 5JVDB 5CB4A 3LWRC 2H6LA 5CA0B 2AMTA 3HWUA 3JAKA 3NK7A 4IIJA 4YJ2A 3B6NA 2BTUA 3N2GB 1COMA 5G4VC 2ZODA 2UYKA 3P4EA 1W5AA 3HTNA 4BT2A 1X52A 1IV2A 3JATB 1FSZA 2KGWA 1T0AA 1U43A 4F6RB 4I4TB 3GHZA 4IHJB 5GIPC 5LYJB
chains in the Genus database with same CATH topology
3F0FA 3F0DA 1IV1A 1KNJA 3IEQA 1JY8A 3QHDA 1W55A 1JN1A 1U3PA 3EORA 2GZLA 4C8GA 3F6MA 4C81A 2AMTA 1GX1A 3KE1A 2UZHA 3IKFA 3T80A 3B6NA 3FPIA 4C8IA 3ELCA 3IKEA 1H47A 3F0GA 3K2XA 3P0ZA 4C82A 1VHAA 3ESJA 3IEWA 5B8FA 3MBMA 3RE3A 3ERNA 3P10A 3FBAA 1KNKA 3JVHA 1IV2A 3GHZA 1T0AA 1U43A 1YQNA 1VH8A 1IV4A 3K14A 2PMPA 1IV3A 1H48A 1W57A 4C8EA 1U40A 1U3LA 3F0EA 3Q8HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F0F A;  3F0D A;  1IV1 A;  1KNJ A;  3IEQ A;  1JY8 A;  3QHD A;  1W55 A;  1JN1 A;  1U3P A;  3EOR A;  2GZL A;  4C8G A;  3F6M A;  4C81 A;  2AMT A;  1GX1 A;  3KE1 A;  2UZH A;  3IKF A;  3T80 A;  3B6N A;  3FPI A;  4C8I A;  3ELC A;  3IKE A;  1H47 A;  3F0G A;  3K2X A;  3P0Z A;  4C82 A;  1VHA A;  3ESJ A;  3IEW A;  5B8F A;  3MBM A;  3RE3 A;  3ERN A;  3P10 A;  3FBA A;  1KNK A;  3JVH A;  1IV2 A;  3GHZ A;  1T0A A;  1U43 A;  1YQN A;  1VH8 A;  1IV4 A;  3K14 A;  2PMP A;  1IV3 A;  1H48 A;  1W57 A;  4C8E A;  1U40 A;  1U3L A;  3F0E A;  3Q8H A; 
#chains in the Genus database with same CATH topology
 5J2U A;  1GZ0 A;  3L7Q A;  4BVQ A;  4G4X A;  3LME A;  5EIB C;  1FNJ A;  4O2B B;  3JAM M;  3F6M A;  4C81 A;  5EO3 A;  1VQ5 F;  3JAW B;  5EYP A;  4LCK A;  3FPI A;  3F0G A;  4BT4 A;  2VGN A;  5LOV B;  5C8Y A;  5JQG A;  3HJW C;  5MN6 A;  3WGL A;  2KG4 A;  3P10 A;  4C4W C;  3WJQ A;  3CYQ A;  3C9U A;  3HKE A;  2Q1Y A;  3M84 A;  1YI2 F;  4B46 A;  1K73 H;  3OBY A;  3S0W A;  1W5B A;  2UYN A;  3JAK B;  2YYE A;  3CXC F;  4ZI7 B;  1KC8 H;  4BW0 B;  4FFB B;  2QI2 A;  2UYN B;  3IEQ A;  1CLI A;  2HRY A;  3RYF B;  1J7H A;  1X7O A;  3WGJ A;  1GX1 A;  1Q86 H;  1H47 A;  3C8L A;  2RHL A;  1TVK B;  3C9S A;  5IJ0 B;  1KQS F;  2VXY A;  1E7K A;  2Q1X A;  2I6R A;  1N8R H;  5A2Q M;  4ZOL A;  3N2K A;  1W40 A;  2H8C A;  3JAR A;  1SZQ A;  3WJP A;  5KMG B;  5FJ4 C;  3EOR A;  1OFU A;  2VGM A;  3JAR B;  1M1K H;  3VYS C;  2V9Y A;  3JAL A;  4YJ3 A;  3F0F A;  3OON A;  3CPW F;  4B45 A;  2ZVY A;  1W55 A;  2K1S A;  3HKB A;  1ONI A;  3CB2 A;  3KIZ A;  2OHW A;  3HKB B;  3VYU C;  3M4S A;  3HAX D;  3NK6 A;  1QAH A;  5IJ9 B;  3TD4 A;  1Z5W A;  1NQ3 A;  2LBT A;  3TD3 A;  2NMU A;  2ZF8 A;  1PF5 A;  3WGM A;  1VQ9 F;  4I50 B;  1DT9 A;  1W5F A;  2LBX A;  3RYI A;  3IR9 A;  4RHA A;  3UT5 B;  3LWV C;  3VOB A;  2LCA A;  3S06 A;  3SIU A;  5IT9 M;  5IYZ A;  3HKC B;  4I4T A;  4U3J B;  5ITZ A;  1JFF B;  3N2K B;  4O4L A;  1W3E X;  5FNV B;  4M8I A;  1VHA A;  3MQW A;  5B8F A;  1SA0 A;  1XBI A;  5HP8 A;  5MN4 A;  4HNA B;  2VAP A;  3V7E A;  3RYH A;  4O2B A;  4R40 B;  5CA0 A;  5G4U C;  1RLU A;  1W5E A;  4IIJ B;  4G4Z A;  4YJ2 B;  1TUB A;  2RHH A;  1JD1 A;  5LA6 A;  4EI9 A;  4TZZ A;  1TUB B;  3FD5 A;  4O2A A;  4TV9 A;  1R1M A;  3GYQ A;  3R0P A;  5HY1 A;  2YXZ A;  5EB1 B;  1XHO A;  2GLZ A;  5MN5 A;  2HP0 B;  1NMU B;  2R75 1;  3CCJ F;  4X20 A;  3MBM A;  1W42 A;  3WGK A;  4BVT A;  3K12 A;  4G88 A;  4TV8 B;  2P6Y A;  3V4D A;  5EB0 A;  4X3L A;  4NWO B;  4BT6 A;  3OBW A;  1JJ2 F;  5JCO C;  4RQO A;  2CHS A;  1RQ2 A;  1Q7Y H;  2H8E A;  4C8G A;  1DBF A;  2CZW A;  1VQ6 F;  3SIV A;  3T80 A;  5FNV A;  2WAL A;  3VO8 A;  4X3M A;  1CN7 A;  4HNA A;  3JVH A;  2ALE A;  1NJI H;  5EZY A;  4G4V A;  3C9R A;  3N4Z A;  2CW4 A;  5LA6 B;  1QVG F;  1Z5V A;  3LWQ C;  1TVK A;  5IJ0 A;  1XV2 A;  1KNJ A;  3S02 A;  4O4J A;  1U3P A;  3O85 A;  3CCS F;  3CPQ A;  3G4S F;  4IHJ A;  4B5C A;  3VYT C;  4NUT A;  3UT5 A;  5C8Y B;  5JQG B;  2IAF A;  1YJW F;  4LNU A;  3CG6 A;  1YIT F;  5FLX M;  3HKE B;  4BT3 A;  5EIB D;  3VMF B;  3BYQ A;  3F0E A;  3PLA C;  4DXD A;  4WBN B;  5IJ9 A;  5GIO C;  1QVF F;  2F9Z C;  3LWO C;  4BVR A;  5EAZ A;  1JN1 A;  3LYB A;  3RYC B;  2CHT A;  1ODE A;  2BTQ B;  3VOA A;  5HXU A;  3U0O A;  3J81 M;  3CCM F;  1GO0 A;  4X1K A;  3RYC A;  3MDO A;  3VIU A;  1UI9 A;  4FFB A;  3CMA F;  4ZHQ A;  3K2X A;  3N2G A;  4ZHQ B;  3RA6 A;  2AIF A;  3HKD A;  1PXW A;  1IPA A;  2JNB A;  5BMV A;  5KX5 B;  4O4J B;  3JAT A;  3CYP B;  1H48 A;  1RA4 A;  4C8E A;  2IQQ A;  3E22 B;  5LP6 A;  5CA1 B;  3CC7 F;  3TD5 A;  1X25 A;  4ZOL B;  3NVI B;  2ZAU A;  4ZHW A;  1IV1 A;  2HX0 A;  5CA1 A;  3S03 A;  1W41 A;  3JAW A;  5EYP B;  4LNU B;  4PWT A;  3I7T A;  1YGY A;  3G6E F;  2DT4 A;  2Z01 A;  3M1X A;  3KJK A;  4EB6 B;  2BO1 A;  3C9T A;  2DYY A;  5LOV A;  5LXT B;  3QTY A;  2Z1U A;  3CCV F;  1FNK A;  4E6E A;  1S72 F;  4TUY B;  1VQO F;  1YIJ F;  4BT7 A;  3CC2 F;  2GVI A;  4G4W A;  5JCO A;  3G71 F;  1VQ4 F;  2KTU A;  4ZI7 A;  2QTP A;  1YJN F;  5HY2 A;  2OTM A;  1X7P A;  5GAN K;  1QU9 A;  3IKF A;  1JFF A;  4NQ3 A;  4C8I A;  2G9I A;  5GON A;  5KX5 A;  3D54 A;  2AIZ P;  3ESJ A;  3IEW A;  3DDN A;  3I56 F;  2RB9 A;  3ERN A;  3HKD B;  5GON B;  3RA5 A;  1RLG A;  3RYH B;  3ZOP A;  1YQN A;  5J2T A;  1Q82 H;  2L26 A;  2PHN A;  1IV4 A;  5DCV A;  2PMP A;  2HS0 A;  1ZWZ A;  1U3L A;  3F0D A;  5J2T B;  3Q8H A;  1FFX A;  2ZVZ A;  2MQE A;  4X1I A;  5HP7 A;  1VQK F;  3VTI C;  3CCE F;  3KJJ A;  2W8B C;  4TV9 B;  4ZK7 A;  2GZL A;  4X1I B;  1K9M H;  3OW2 F;  2B33 A;  2UYJ A;  5EZY B;  3V3T A;  5JH7 A;  2HRU A;  4O2A B;  3NMU C;  4BVS A;  4TUY A;  2Z1T A;  4G4Y A;  2CVL A;  4I50 A;  1KNK A;  3IMP A;  1VQP F;  2CSL A;  2BTO A;  2HQS C;  4O4I A;  1W58 1;  1VH8 A;  3AGK A;  4B62 A;  1W57 A;  5EWR A;  2OTJ F;  3RYI B;  3JAS B;  2EWC A;  3WPW A;  1T0K B;  3D01 A;  4F6R A;  2Z1E A;  5BMV B;  3JAS A;  1VQV A;  4ZHV A;  2UZH A;  3FFM A;  1YJ9 F;  3ZO8 A;  4C82 A;  1VQN F;  1YHQ F;  4BT5 A;  5HY0 A;  1Q8R A;  3LDT A;  2FC3 A;  3LFO A;  5JVD A;  3JAL B;  4YJ3 B;  2RHO A;  3DC2 A;  3E20 B;  3K14 A;  3J7A R;  4X1K B;  3CCL F;  1VQL F;  2N48 A;  1OAP A;  5JH7 B;  1W59 A;  4U39 A;  1JY8 A;  2HP0 A;  3NVK E;  1VK3 A;  3JCM M;  2UYP A;  5HWE A;  4ZHY B;  2IG8 A;  3J80 M;  4XCQ A;  4O4I B;  4EI8 A;  5LYJ A;  4DRX A;  3QUW A;  2LBW A;  4ERH A;  5HXZ A;  2R6R 1;  4I55 A;  3RYF A;  4DRX B;  2ZOV A;  2CWJ A;  3MCA B;  3HKC A;  5HY4 A;  4WBN A;  3WXM B;  1SDS A;  1KD1 H;  1UFY A;  4O4H B;  3E1Y A;  3CCR F;  3V7Q A;  3WPX A;  1K8A H;  3QHD A;  5IYZ B;  5GIN C;  3KE1 A;  4O4L B;  2HS3 A;  3PAF A;  3ELC A;  4BY9 D;  1FFX B;  3P0Z A;  3S0Y A;  2OTL F;  4KWE A;  3D00 A;  5CB4 B;  3RE3 A;  3VCZ A;  2HVY D;  2VAW A;  3S0H A;  1RQ7 A;  2KTV A;  1QD9 A;  1CK2 A;  3CME F;  1U40 A;  3LWP C;  2QA4 F;  4X20 B;  1VQ7 F;  3CCU F;  5GAP K;  3VI6 A;  2FGY A;  3E22 A;  5AVM A;  2HP3 A;  2Z1F A;  3ZP4 A;  3K0T A;  5J2U B;  5LP6 B;  3FD6 A;  3CC4 F;  5KMG A;  4TV8 A;  3CD6 F;  3IKE A;  1M90 H;  3MCQ A;  3I55 F;  1H7M A;  1W2B F;  4EI7 A;  1Q81 H;  3KHN A;  1VQ8 F;  2RHJ A;  3ON1 A;  1XRG A;  4I55 B;  2HS4 A;  5LXT A;  2QEX F;  3WGN A;  3N4Y A;  2OZB A;  4U3J A;  3GTZ A;  5ITZ B;  3CCQ F;  4EB6 A;  1IV3 A;  2I6D A;  3FBA A;  4X1Y B;  5LP6 C;  1SA0 B;  3ZP7 A;  1VQM F;  1GO1 A;  4O4H A;  2VAM A;  3I3F A;  4X1Y A;  3WJR A;  5JVD B;  5CB4 A;  3LWR C;  2H6L A;  5CA0 B;  2AMT A;  3HWU A;  3JAK A;  3NK7 A;  4IIJ A;  4YJ2 A;  3B6N A;  2BTU A;  3N2G B;  1COM A;  5G4V C;  2ZOD A;  2UYK A;  3P4E A;  1W5A A;  3HTN A;  4BT2 A;  1X52 A;  1IV2 A;  3JAT B;  1FSZ A;  2KGW A;  1T0A A;  1U43 A;  4F6R B;  4I4T B;  3GHZ A;  4IHJ B;  5GIP C;  5LYJ B; 
#chains in the Genus database with same CATH homology
 3F0F A;  3F0D A;  1IV1 A;  1KNJ A;  3IEQ A;  1JY8 A;  3QHD A;  1W55 A;  1JN1 A;  1U3P A;  3EOR A;  2GZL A;  4C8G A;  3F6M A;  4C81 A;  2AMT A;  1GX1 A;  3KE1 A;  2UZH A;  3IKF A;  3T80 A;  3B6N A;  3FPI A;  4C8I A;  3ELC A;  3IKE A;  1H47 A;  3F0G A;  3K2X A;  3P0Z A;  4C82 A;  1VHA A;  3ESJ A;  3IEW A;  5B8F A;  3MBM A;  3RE3 A;  3ERN A;  3P10 A;  3FBA A;  1KNK A;  3JVH A;  1IV2 A;  3GHZ A;  1T0A A;  1U43 A;  1YQN A;  1VH8 A;  1IV4 A;  3K14 A;  2PMP A;  1IV3 A;  1H48 A;  1W57 A;  4C8E A;  1U40 A;  1U3L A;  3F0E A;  3Q8H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...