3GIGB

Crystal structure of phosphorylated deskc in complex with amp-pcp
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
205
structure length
204
Chain Sequence
b'LEDANERIAELVKLEERQRIARDLDTLGQKLSLIGLKSDLARKLIYKDPEQAARELKSVQQTARTSLNEVRKIVSSMKGIRLKDELINIKQILEAADIMFIYEEEKWPENISLLNENILSMCLKEAVTNVVKHSQAKTCRVDIQQLWKEVVITVSDDGTFKGEENSFSKGHGLLGMRERLEFANGSLHIDTENGTKLTMAIPNN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor histidine kinase desK
publication title Structural plasticity and catalysis regulation of a thermosensor histidine kinase
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 64
structure length 204
sequence length 205
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2009-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07730 HisKA_3 Histidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3gigB02
2BREA 1Y8PA 4EFUA 3OMUA 3VADA 4FCPA 1THNA 2XJJA 2PNRA 4X9LA 3Q5LA 5J6AA 2BRCA 3R4OA 4U7NA 5CTYA 3WHAA 2WI4A 2QG0A 2YEGA 1UYDA 3IEDA 4YKRA 2YEFA 2BYIA 3QDDA 3EKRA 4EGHA 1A4HA 2YGAA 5D7RA 4FCRA 1YC3A 4LWIA 4LPBA 4XKKA 2CCUA 4NH7A 4O04A 4JAVA 4CE3A 1AH8A 2VWCA 2WEPA 4O05A 3CRKA 3ZM7A 1YC1A 3FV5A 2Q8GA 1B63A 3PEJA 2ZDYA 4R3AA 2O1VA 2AKPA 2YKEA 2H55A 2ESAA 2YGEA 2WEQA 3R91A 3D36A 4KQVA 1NHIA 5D7DA 1UYLA 4MPCA 4XIQA 3D2RA 3TTZA 4XITA 1QZRA 2K5BA 3SL2A 2HKJA 2GFDA 5CF0A 5CTXA 3VHCA 4GCZA 1TH8A 3T2SA 4KFGA 4ASGA 1I59A 2XHTA 4L8ZA 1Y4UA 5C93A 2YI6A 3U67A 4JAUA 1I5CA 3Q5KA 3HZ5A 2IWSA 4CWNA 1EI1A 5M4EA 1UYIA 4XIRA 3HHUA 2QFOA 4L94A 5M4HA 3D0BA 2BU2A 2CCTA 4LWHA 4URNA 1YT1A 4HZ0A 4L93A 4BIZA 2YE3A 2FYPA 2O1UA 3B25A 2YKIA 2WI2A 1UY6A 3R4NA 3G75A 4BQJA 3K60A 5BOCA 3VHDA 5IDMA 4E00A 4MBCA 3ZKDA 4CWOA 4LWGA 4BXIA 2WI3A 5D7CA 1AM1A 1BXDA 3TZ2A 4I3HA 3CRLA 4FMTA 3BM9A 2XHRA 1Y8NA 3O0IA 4YKXA 1Z5AA 2QF6A 3R4MA 4P7AA 2FWZA 3OWBA 4CWPA 3K98A 4HXZA 4EEHA 4CE2A 4O07A 1B3QA 1JM6A 2WI7A 4O09A 3RLPA 2BTZA 3LNUA 4K4OA 2VW5A 3K97A 1ZXNA 4AWPA 2JKIA 2YECA 5D6PA 4CWFA 2BU7A 2YE2A 3MNRP 2YEDA 1US7A 4L91A 3ZXQA 4EGIA 3EKOA 2QG2A 4HY6A 2Q8HA 4QPKA 3BMYA 3INWA 4WUDA 4YKZA 2CCSA 4HZ5A 3GIFA 4CE1A 1TILA 2YEBA 2YI0A 2YK2A 2XJXA 2BU6A 3B28A 2ZBKB 3GIGA 2YE4A 3OW6A 2XJGA 3HEKA 4LP0A 2GQPA 5J71A 4BAEA 4CWRA 5M4MA 1YERA 3A0RA 3H4LA 3PEHA 1GJVA 1KIJA 4HXWA 2ZKJA 4KP4A 1TC0A 4MB9A 5L3JA 1S16A 1YSRA 1GKXA 5IDJA 3HYYA 4KTNA 1TBWA 4ZVIA 5M4NA 2VCJA 2BZ5A 2YKJA 4YKUA 3OPDA 5CPHA 1OSFA 3O2FA 3CGYA 2HG1A 3U2KA 4YKYA 3TZ5A 4H7QA 2BU8A 1MU5A 3RLQA 4E02A 1Y4SA 4YKWA 1UYCA 3HYZA 4PL9A 2O1WA 2XCMA 3A0TA 4MOTA 5M4PA 1U2OA 1Z5BA 2XDKA 3A0XA 2BT0A 3GIGB 4XE2A 5FNFA 4FCQA 2YEHA 2HCHA 4MP2A 3A0ZA 2IORA 3G7BA 2YEJA 3WQ9A 3VHAA 1BYQA 1YS3A 2YKCA 3LPSA 2FXSA 4QPJA 2XDXA 1UYEA 3B27A 2WI1A 4Q20A 2XX2A 1NHHA 3O6OA 1L0OA 1ZWHA 4ASAA 4BQGA 5BODA 1EA6A 1AH6A 3NMQA 4XTJA 2BU5A 3HZ1A 1BGQA 2CGFA 4LWFA 3INXA 4HYMA 2YE8A 4EFTA 2JJCA 3K99A 2H8MA 1KZNA 1I5DA 4EMVA 2XHXA 2WI6A 4AS9A 1AMWA 2XDLA 4MPNA 3CGZA 1ZW9A 4HYPA 2Q8IA 3U2DA 2YJXA 2FWYA 4XIPA 1U0ZA 4XDMA 4EM7A 2YEAA 3T10A 3EHJA 4HY1A 4YKTA 5CTWA 4H81A 4AWQA 4DUHA 1UY8A 2YI5A 3R92A 2XK2A 1QY8A 2WI5A 2C2AA 1H7SA 1NHJA 4NH9A 4FPPA 4JQLA 4ZKIA 4H85A 4R1FA 1UYKA 3TUHA 4GEEA 3FT5A 3QTFA 3C0EA 4L90A 5GGZA 1BKNA 2UWDA 4PU9A 2IOQA 4NH8A 3CWVA 1TC6A 2XD6A 5CTUA 2XABA 4CWTA 4I5SA 4B6CA 1YSZA 1UY7A 2YE7A 5D6QA 1R62A 4R3MA 2YKBA 2IWXA 3JZ3A 3EHGA 4URMA 3H80A 4XD8A 4JASA 2WERA 4CWQA 3DGEA 4PRXA 3A0YA 3OWDA 4O0BA 4LWEA 1MX0A 4ASBA 3T1KA 2YK9A 2XDSA 2YE6A 4CWSA 1UYHA 3EHFA 4WUCA 2VCIA 3RKZA 3B24A 3C11A 1Z59A 4MP7A 5FNCA 3RLRA 1UYMA 2YGFA 3TZ0A 3KE6A 1H7UA 2XDUA 1ID0A 3Q5JA 2XX4A 5F3KA 5M4KA 2YE5A 3G7EA 1Y8OA 4EGKA 1S14A 1UYFA 2XX5A 3EHHA 4GQTA 3T0ZA 4U7OA 1PVGA 1GKZA 2CG9A 3ZXOA 1QYEA 2Q2EB 2ZDXA 1UY9A 4GFNA 4V25A 3ZKBA 2E0AA 4XCLA 1TIDA 2YEEA 3B26A 2IWUA 4WUBA 4XKOA 1ZXMA 2EXLA 4AWOA 1I5AA 1I5BA 1AJ6A 1YETA 1YESA 3T0HA 2BSMA 4ASFA 1YC4A 5FWKA 1UYGA 1B62A 4KSHA 5FNDA 4E01A 4PRVA 4YKQA 2CH4A 4XKAA 3A0WA 2Q8FA 4B7PA 4GT8A 4GGLA 5F5RA 4MPEA 4U93A 5IN9A 2YE9A 1I58A 2IOPA 1YT0A 4BIUA 4DZYA 2YJWA 4P8OA 2YI7A 4V26A 1Z5CA 3GIEA 3R4PA 2BYHA 4XCJA 4W7TA 2YEIA 4UROA 4XC0A 4KSGA 3TZ4A 4URLA 1YT2A 3FT8A
chains in the Genus database with same CATH superfamily
2BREA 1Y8PA 4EFUA 3OMUA 3VADA 4FCPA 1THNA 2XJJA 2PNRA 4X9LA 3Q5LA 5J6AA 2BRCA 3R4OA 4U7NA 5CTYA 3WHAA 2WI4A 2QG0A 2YEGA 1UYDA 3IEDA 4YKRA 2YEFA 2BYIA 3QDDA 3EKRA 4EGHA 1A4HA 2YGAA 5D7RA 4FCRA 1YC3A 4LWIA 4LPBA 4XKKA 2CCUA 4NH7A 4O04A 4JAVA 4CE3A 1AH8A 2VWCA 2WEPA 4O05A 3CRKA 3ZM7A 1YC1A 3FV5A 2Q8GA 1B63A 3PEJA 2ZDYA 4R3AA 2O1VA 2AKPA 2YKEA 2H55A 2ESAA 2YGEA 2WEQA 3R91A 3D36A 4KQVA 1NHIA 5D7DA 1UYLA 4MPCA 4XIQA 3D2RA 3TTZA 4XITA 3S5TA 1QZRA 2K5BA 3SL2A 2HKJA 2GFDA 5CF0A 5CTXA 3VHCA 4GCZA 1TH8A 3T2SA 4KFGA 2FTKA 4ASGA 1I59A 2XHTA 4L8ZA 1Y4UA 5C93A 2YI6A 3U67A 4JAUA 1I5CA 3Q5KA 3HZ5A 2IWSA 4CWNA 1EI1A 5M4EA 1UYIA 4XIRA 3HHUA 2QFOA 4L94A 5M4HA 3D0BA 2BU2A 2CCTA 4LWHA 4URNA 1YT1A 4HZ0A 4L93A 4BIZA 2YE3A 2FYPA 2O1UA 3B25A 2YKIA 2WI2A 1UY6A 3R4NA 3G75A 4BQJA 3K60A 5BOCA 3VHDA 5IDMA 4E00A 4MBCA 3ZKDA 4CWOA 4LWGA 4BXIA 2WI3A 5D7CA 1AM1A 1BXDA 3TZ2A 4I3HA 3CRLA 4FMTA 3BM9A 2XHRA 1Y8NA 3O0IA 4YKXA 1Z5AA 2QF6A 3R4MA 4P7AA 2FWZA 3OWBA 4CWPA 3K98A 4HXZA 4EEHA 4CE2A 4O07A 1B3QA 1JM6A 2WI7A 4O09A 3RLPA 2BTZA 3LNUA 4K4OA 2VW5A 3K97A 1ZXNA 4AWPA 3CYGA 2JKIA 2YECA 5D6PA 4CWFA 2BU7A 2YE2A 3MNRP 2YEDA 1US7A 4L91A 3ZXQA 4EGIA 3EKOA 5JENA 2QG2A 4HY6A 2Q8HA 4QPKA 3BMYA 3INWA 4WUDA 4YKZA 2CCSA 4HZ5A 3GIFA 4CE1A 1TILA 2YEBA 2YI0A 2YK2A 2XJXA 2BU6A 3B28A 2ZBKB 3GIGA 2YE4A 3OW6A 2XJGA 3HEKA 4LP0A 2GQPA 5J71A 4BAEA 4CWRA 5M4MA 1YERA 3A0RA 3H4LA 3PEHA 1GJVA 1KIJA 4HXWA 2ZKJA 4KP4A 1TC0A 4MB9A 5L3JA 1S16A 1YSRA 1GKXA 5IDJA 3HYYA 4KTNA 1TBWA 4ZVIA 5M4NA 2VCJA 2BZ5A 2YKJA 4YKUA 3OPDA 5CPHA 1OSFA 3O2FA 3CGYA 2HG1A 3U2KA 4YKYA 3TZ5A 4E72A 4H7QA 2BU8A 1MU5A 3RLQA 4E02A 1Y4SA 4YKWA 1UYCA 3HYZA 4PL9A 2O1WA 2XCMA 3A0TA 4MOTA 5M4PA 1U2OA 1Z5BA 2XDKA 3A0XA 2BT0A 3GIGB 4XE2A 5FNFA 4FCQA 2YEHA 2HCHA 4MP2A 3A0ZA 2IORA 3G7BA 2YEJA 3WQ9A 3VHAA 1BYQA 1YS3A 2YKCA 3LPSA 2FXSA 4QPJA 2XDXA 1UYEA 3B27A 2WI1A 4Q20A 2XX2A 1NHHA 3O6OA 1L0OA 1ZWHA 4ASAA 4BQGA 5BODA 1EA6A 1AH6A 3NMQA 4XTJA 2BU5A 3HZ1A 1BGQA 2CGFA 4LWFA 3INXA 4HYMA 2YE8A 4EFTA 2JJCA 3K99A 2H8MA 1KZNA 1I5DA 4EMVA 2XHXA 2WI6A 4AS9A 1AMWA 2XDLA 4MPNA 2C1GA 3CGZA 1ZW9A 4HYPA 2Q8IA 3U2DA 2YJXA 2FWYA 4XIPA 1U0ZA 4XDMA 4EM7A 2YEAA 3T10A 3EHJA 4HY1A 1F51A 4YKTA 5CTWA 4H81A 4AWQA 4DUHA 1UY8A 2YI5A 3R92A 2XK2A 1QY8A 2WI5A 2C2AA 1H7SA 1NHJA 3LMMA 4NH9A 4FPPA 4JQLA 4ZKIA 4H85A 4R1FA 1UYKA 3TUHA 4GEEA 3FT5A 3QTFA 3C0EA 4L90A 5GGZA 1BKNA 2UWDA 4PU9A 2IOQA 4NH8A 3CWVA 1TC6A 2XD6A 5CTUA 2XABA 4CWTA 4I5SA 4B6CA 1YSZA 1UY7A 2YE7A 5D6QA 1R62A 4R3MA 2YKBA 2IWXA 3JZ3A 3EHGA 4URMA 3H80A 4XD8A 4JASA 2WERA 4CWQA 3DGEA 2C1IA 4PRXA 3A0YA 3OWDA 4O0BA 4LWEA 1MX0A 4ASBA 3T1KA 2YK9A 2XDSA 2YE6A 4CWSA 1UYHA 3EHFA 4WUCA 2VCIA 3RKZA 3B24A 3C11A 1Z59A 4MP7A 5FNCA 3RLRA 1UYMA 2YGFA 3TZ0A 3KE6A 1H7UA 2XDUA 1ID0A 3Q5JA 2XX4A 5F3KA 5M4KA 2YE5A 3G7EA 1Y8OA 4EGKA 1S14A 1UYFA 2XX5A 3EHHA 4GQTA 3T0ZA 4U7OA 1PVGA 1GKZA 2CG9A 3ZXOA 1QYEA 2Q2EB 2HHIA 2ZDXA 1UY9A 4GFNA 4V25A 3ZKBA 2E0AA 4XCLA 1TIDA 2YEEA 3B26A 2IWUA 4WUBA 4XKOA 1ZXMA 2EXLA 4AWOA 1I5AA 1I5BA 1AJ6A 1YETA 1YESA 3T0HA 2BSMA 4ASFA 1IXMA 1YC4A 5FWKA 1UYGA 1B62A 4KSHA 5FNDA 4E01A 4PRVA 4YKQA 2CH4A 4XKAA 3A0WA 2Q8FA 4B7PA 4GT8A 4GGLA 5F5RA 4MPEA 4U93A 5IN9A 2YE9A 1I58A 2IOPA 1YT0A 4BIUA 4DZYA 2YJWA 4P8OA 2YI7A 4V26A 1Z5CA 3GIEA 3R4PA 2BYHA 4XCJA 4W7TA 2YEIA 4UROA 4XC0A 4KSGA 3TZ4A 4URLA 1YT2A 3FT8A
chains in the Genus database with same CATH topology
2BREA 1Y8PA 4EFUA 3OMUA 3VADA 4FCPA 1THNA 2XJJA 2PNRA 4X9LA 3Q5LA 5J6AA 2BRCA 3R4OA 4U7NA 5CTYA 3WHAA 2WI4A 2QG0A 2YEGA 1UYDA 3IEDA 4YKRA 2YEFA 2BYIA 3QDDA 3EKRA 4EGHA 1A4HA 2YGAA 5D7RA 4FCRA 1YC3A 4LWIA 4LPBA 4XKKA 2CCUA 4NH7A 4O04A 4JAVA 4CE3A 1AH8A 2VWCA 2WEPA 4O05A 3CRKA 3ZM7A 1YC1A 3FV5A 2Q8GA 1B63A 3PEJA 2ZDYA 4R3AA 2O1VA 2AKPA 2YKEA 2H55A 2ESAA 2YGEA 2WEQA 3R91A 3D36A 4KQVA 1NHIA 5D7DA 1UYLA 4MPCA 4XIQA 3D2RA 3TTZA 4XITA 1QZRA 2K5BA 3SL2A 2HKJA 2GFDA 5CF0A 5CTXA 3VHCA 4GCZA 1TH8A 3T2SA 4KFGA 4ASGA 1I59A 2XHTA 4L8ZA 1Y4UA 5C93A 2YI6A 3U67A 4JAUA 1I5CA 3Q5KA 3HZ5A 2IWSA 4CWNA 1EI1A 5M4EA 1UYIA 4XIRA 3HHUA 2QFOA 4L94A 5M4HA 3D0BA 2BU2A 2CCTA 4LWHA 4URNA 1YT1A 4HZ0A 4L93A 4BIZA 2YE3A 2FYPA 2O1UA 3B25A 2YKIA 2WI2A 1UY6A 3R4NA 3G75A 4BQJA 3K60A 5BOCA 3VHDA 5IDMA 4E00A 4MBCA 3ZKDA 4CWOA 4LWGA 4BXIA 2WI3A 5D7CA 1AM1A 1BXDA 3TZ2A 4I3HA 3CRLA 4FMTA 3BM9A 2XHRA 1Y8NA 3O0IA 4YKXA 1Z5AA 2QF6A 3R4MA 4P7AA 2FWZA 3OWBA 4CWPA 3K98A 4HXZA 4EEHA 4CE2A 4O07A 1B3QA 1JM6A 2WI7A 4O09A 3RLPA 2BTZA 3LNUA 4K4OA 2VW5A 3K97A 1ZXNA 4AWPA 2JKIA 2YECA 5D6PA 4CWFA 2BU7A 2YE2A 3MNRP 2YEDA 1US7A 4L91A 3ZXQA 4EGIA 3EKOA 2QG2A 4HY6A 2Q8HA 4QPKA 3BMYA 3INWA 4WUDA 4YKZA 2CCSA 4HZ5A 3GIFA 4CE1A 1TILA 2YEBA 2YI0A 2YK2A 2XJXA 2BU6A 3B28A 2ZBKB 3GIGA 2YE4A 3OW6A 2XJGA 3HEKA 4LP0A 2GQPA 5J71A 4BAEA 4CWRA 5M4MA 1YERA 3A0RA 3H4LA 3PEHA 1GJVA 1KIJA 4HXWA 2ZKJA 4KP4A 1TC0A 4MB9A 5L3JA 1S16A 1YSRA 1GKXA 5IDJA 3HYYA 4KTNA 1TBWA 4ZVIA 5M4NA 2VCJA 2BZ5A 2YKJA 4YKUA 3OPDA 5CPHA 1OSFA 3O2FA 3CGYA 2HG1A 3U2KA 4YKYA 3TZ5A 4H7QA 2BU8A 1MU5A 3RLQA 4E02A 1Y4SA 4YKWA 1UYCA 3HYZA 4PL9A 2O1WA 2XCMA 3A0TA 4MOTA 5M4PA 1U2OA 1Z5BA 2XDKA 3A0XA 2BT0A 3GIGB 4XE2A 5FNFA 4FCQA 2YEHA 2HCHA 4MP2A 3A0ZA 2IORA 3G7BA 2YEJA 3WQ9A 3VHAA 1BYQA 1YS3A 2YKCA 3LPSA 2FXSA 4QPJA 2XDXA 1UYEA 3B27A 2WI1A 4Q20A 2XX2A 1NHHA 3O6OA 1L0OA 1ZWHA 4ASAA 4BQGA 5BODA 1EA6A 1AH6A 3NMQA 4XTJA 2BU5A 3HZ1A 1BGQA 2CGFA 4LWFA 3INXA 4HYMA 2YE8A 4EFTA 2JJCA 3K99A 2H8MA 1KZNA 1I5DA 4EMVA 2XHXA 2WI6A 4AS9A 1AMWA 2XDLA 4MPNA 3CGZA 1ZW9A 4HYPA 2Q8IA 3U2DA 2YJXA 2FWYA 4XIPA 1U0ZA 4XDMA 4EM7A 2YEAA 3T10A 3EHJA 4HY1A 4YKTA 5CTWA 4H81A 4AWQA 4DUHA 1UY8A 2YI5A 3R92A 2XK2A 1QY8A 2WI5A 2C2AA 1H7SA 1NHJA 4NH9A 4FPPA 4JQLA 4ZKIA 4H85A 4R1FA 1UYKA 3TUHA 4GEEA 3FT5A 3QTFA 3C0EA 4L90A 5GGZA 1BKNA 2UWDA 4PU9A 2IOQA 4NH8A 3CWVA 1TC6A 2XD6A 5CTUA 2XABA 4CWTA 4I5SA 4B6CA 1YSZA 1UY7A 2YE7A 5D6QA 1R62A 4R3MA 2YKBA 2IWXA 3JZ3A 3EHGA 4URMA 3H80A 4XD8A 4JASA 2WERA 4CWQA 3DGEA 4PRXA 3A0YA 3OWDA 4O0BA 4LWEA 1MX0A 4ASBA 3T1KA 2YK9A 2XDSA 2YE6A 4CWSA 1UYHA 3EHFA 4WUCA 2VCIA 3RKZA 3B24A 3C11A 1Z59A 4MP7A 5FNCA 3RLRA 1UYMA 2YGFA 3TZ0A 3KE6A 1H7UA 2XDUA 1ID0A 3Q5JA 2XX4A 5F3KA 5M4KA 2YE5A 3G7EA 1Y8OA 4EGKA 1S14A 1UYFA 2XX5A 3EHHA 4GQTA 3T0ZA 4U7OA 1PVGA 1GKZA 2CG9A 3ZXOA 1QYEA 2Q2EB 2ZDXA 1UY9A 4GFNA 4V25A 3ZKBA 2E0AA 4XCLA 1TIDA 2YEEA 3B26A 2IWUA 4WUBA 4XKOA 1ZXMA 2EXLA 4AWOA 1I5AA 1I5BA 1AJ6A 1YETA 1YESA 3T0HA 2BSMA 4ASFA 1YC4A 5FWKA 1UYGA 1B62A 4KSHA 5FNDA 4E01A 4PRVA 4YKQA 2CH4A 4XKAA 3A0WA 2Q8FA 4B7PA 4GT8A 4GGLA 5F5RA 4MPEA 4U93A 5IN9A 2YE9A 1I58A 2IOPA 1YT0A 4BIUA 4DZYA 2YJWA 4P8OA 2YI7A 4V26A 1Z5CA 3GIEA 3R4PA 2BYHA 4XCJA 4W7TA 2YEIA 4UROA 4XC0A 4KSGA 3TZ4A 4URLA 1YT2A 3FT8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BRE A;  1Y8P A;  4EFU A;  3OMU A;  3VAD A;  4FCP A;  1THN A;  2XJJ A;  2PNR A;  4X9L A;  3Q5L A;  5J6A A;  2BRC A;  3R4O A;  4U7N A;  5CTY A;  3WHA A;  2WI4 A;  2QG0 A;  2YEG A;  1UYD A;  3IED A;  4YKR A;  2YEF A;  2BYI A;  3QDD A;  3EKR A;  4EGH A;  1A4H A;  2YGA A;  5D7R A;  4FCR A;  1YC3 A;  4LWI A;  4LPB A;  4XKK A;  2CCU A;  4NH7 A;  4O04 A;  4JAV A;  4CE3 A;  1AH8 A;  2VWC A;  2WEP A;  4O05 A;  3CRK A;  3ZM7 A;  1YC1 A;  3FV5 A;  2Q8G A;  1B63 A;  3PEJ A;  2ZDY A;  4R3A A;  2O1V A;  2AKP A;  2YKE A;  2H55 A;  2ESA A;  2YGE A;  2WEQ A;  3R91 A;  3D36 A;  4KQV A;  1NHI A;  5D7D A;  1UYL A;  4MPC A;  4XIQ A;  3D2R A;  3TTZ A;  4XIT A;  1QZR A;  2K5B A;  3SL2 A;  2HKJ A;  2GFD A;  5CF0 A;  5CTX A;  3VHC A;  4GCZ A;  1TH8 A;  3T2S A;  4KFG A;  4ASG A;  1I59 A;  2XHT A;  4L8Z A;  1Y4U A;  5C93 A;  2YI6 A;  3U67 A;  4JAU A;  1I5C A;  3Q5K A;  3HZ5 A;  2IWS A;  4CWN A;  1EI1 A;  5M4E A;  1UYI A;  4XIR A;  3HHU A;  2QFO A;  4L94 A;  5M4H A;  3D0B A;  2BU2 A;  2CCT A;  4LWH A;  4URN A;  1YT1 A;  4HZ0 A;  4L93 A;  4BIZ A;  2YE3 A;  2FYP A;  2O1U A;  3B25 A;  2YKI A;  2WI2 A;  1UY6 A;  3R4N A;  3G75 A;  4BQJ A;  3K60 A;  5BOC A;  3VHD A;  5IDM A;  4E00 A;  4MBC A;  3ZKD A;  4CWO A;  4LWG A;  4BXI A;  2WI3 A;  5D7C A;  1AM1 A;  1BXD A;  3TZ2 A;  4I3H A;  3CRL A;  4FMT A;  3BM9 A;  2XHR A;  1Y8N A;  3O0I A;  4YKX A;  1Z5A A;  2QF6 A;  3R4M A;  4P7A A;  2FWZ A;  3OWB A;  4CWP A;  3K98 A;  4HXZ A;  4EEH A;  4CE2 A;  4O07 A;  1B3Q A;  1JM6 A;  2WI7 A;  4O09 A;  3RLP A;  2BTZ A;  3LNU A;  4K4O A;  2VW5 A;  3K97 A;  1ZXN A;  4AWP A;  2JKI A;  2YEC A;  5D6P A;  4CWF A;  2BU7 A;  2YE2 A;  3MNR P;  2YED A;  1US7 A;  4L91 A;  3ZXQ A;  4EGI A;  3EKO A;  2QG2 A;  4HY6 A;  2Q8H A;  4QPK A;  3BMY A;  3INW A;  4WUD A;  4YKZ A;  2CCS A;  4HZ5 A;  3GIF A;  4CE1 A;  1TIL A;  2YEB A;  2YI0 A;  2YK2 A;  2XJX A;  2BU6 A;  3B28 A;  2ZBK B;  3GIG A;  2YE4 A;  3OW6 A;  2XJG A;  3HEK A;  4LP0 A;  2GQP A;  5J71 A;  4BAE A;  4CWR A;  5M4M A;  1YER A;  3A0R A;  3H4L A;  3PEH A;  1GJV A;  1KIJ A;  4HXW A;  2ZKJ A;  4KP4 A;  1TC0 A;  4MB9 A;  5L3J A;  1S16 A;  1YSR A;  1GKX A;  5IDJ A;  3HYY A;  4KTN A;  1TBW A;  4ZVI A;  5M4N A;  2VCJ A;  2BZ5 A;  2YKJ A;  4YKU A;  3OPD A;  5CPH A;  1OSF A;  3O2F A;  3CGY A;  2HG1 A;  3U2K A;  4YKY A;  3TZ5 A;  4H7Q A;  2BU8 A;  1MU5 A;  3RLQ A;  4E02 A;  1Y4S A;  4YKW A;  1UYC A;  3HYZ A;  4PL9 A;  2O1W A;  2XCM A;  3A0T A;  4MOT A;  5M4P A;  1U2O A;  1Z5B A;  2XDK A;  3A0X A;  2BT0 A;  3GIG B;  4XE2 A;  5FNF A;  4FCQ A;  2YEH A;  2HCH A;  4MP2 A;  3A0Z A;  2IOR A;  3G7B A;  2YEJ A;  3WQ9 A;  3VHA A;  1BYQ A;  1YS3 A;  2YKC A;  3LPS A;  2FXS A;  4QPJ A;  2XDX A;  1UYE A;  3B27 A;  2WI1 A;  4Q20 A;  2XX2 A;  1NHH A;  3O6O A;  1L0O A;  1ZWH A;  4ASA A;  4BQG A;  5BOD A;  1EA6 A;  1AH6 A;  3NMQ A;  4XTJ A;  2BU5 A;  3HZ1 A;  1BGQ A;  2CGF A;  4LWF A;  3INX A;  4HYM A;  2YE8 A;  4EFT A;  2JJC A;  3K99 A;  2H8M A;  1KZN A;  1I5D A;  4EMV A;  2XHX A;  2WI6 A;  4AS9 A;  1AMW A;  2XDL A;  4MPN A;  3CGZ A;  1ZW9 A;  4HYP A;  2Q8I A;  3U2D A;  2YJX A;  2FWY A;  4XIP A;  1U0Z A;  4XDM A;  4EM7 A;  2YEA A;  3T10 A;  3EHJ A;  4HY1 A;  4YKT A;  5CTW A;  4H81 A;  4AWQ A;  4DUH A;  1UY8 A;  2YI5 A;  3R92 A;  2XK2 A;  1QY8 A;  2WI5 A;  2C2A A;  1H7S A;  1NHJ A;  4NH9 A;  4FPP A;  4JQL A;  4ZKI A;  4H85 A;  4R1F A;  1UYK A;  3TUH A;  4GEE A;  3FT5 A;  3QTF A;  3C0E A;  4L90 A;  5GGZ A;  1BKN A;  2UWD A;  4PU9 A;  2IOQ A;  4NH8 A;  3CWV A;  1TC6 A;  2XD6 A;  5CTU A;  2XAB A;  4CWT A;  4I5S A;  4B6C A;  1YSZ A;  1UY7 A;  2YE7 A;  5D6Q A;  1R62 A;  4R3M A;  2YKB A;  2IWX A;  3JZ3 A;  3EHG A;  4URM A;  3H80 A;  4XD8 A;  4JAS A;  2WER A;  4CWQ A;  3DGE A;  4PRX A;  3A0Y A;  3OWD A;  4O0B A;  4LWE A;  1MX0 A;  4ASB A;  3T1K A;  2YK9 A;  2XDS A;  2YE6 A;  4CWS A;  1UYH A;  3EHF A;  4WUC A;  2VCI A;  3RKZ A;  3B24 A;  3C11 A;  1Z59 A;  4MP7 A;  5FNC A;  3RLR A;  1UYM A;  2YGF A;  3TZ0 A;  3KE6 A;  1H7U A;  2XDU A;  1ID0 A;  3Q5J A;  2XX4 A;  5F3K A;  5M4K A;  2YE5 A;  3G7E A;  1Y8O A;  4EGK A;  1S14 A;  1UYF A;  2XX5 A;  3EHH A;  4GQT A;  3T0Z A;  4U7O A;  1PVG A;  1GKZ A;  2CG9 A;  3ZXO A;  1QYE A;  2Q2E B;  2ZDX A;  1UY9 A;  4GFN A;  4V25 A;  3ZKB A;  2E0A A;  4XCL A;  1TID A;  2YEE A;  3B26 A;  2IWU A;  4WUB A;  4XKO A;  1ZXM A;  2EXL A;  4AWO A;  1I5A A;  1I5B A;  1AJ6 A;  1YET A;  1YES A;  3T0H A;  2BSM A;  4ASF A;  1YC4 A;  5FWK A;  1UYG A;  1B62 A;  4KSH A;  5FND A;  4E01 A;  4PRV A;  4YKQ A;  2CH4 A;  4XKA A;  3A0W A;  2Q8F A;  4B7P A;  4GT8 A;  4GGL A;  5F5R A;  4MPE A;  4U93 A;  5IN9 A;  2YE9 A;  1I58 A;  2IOP A;  1YT0 A;  4BIU A;  4DZY A;  2YJW A;  4P8O A;  2YI7 A;  4V26 A;  1Z5C A;  3GIE A;  3R4P A;  2BYH A;  4XCJ A;  4W7T A;  2YEI A;  4URO A;  4XC0 A;  4KSG A;  3TZ4 A;  4URL A;  1YT2 A;  3FT8 A; 
#chains in the Genus database with same CATH topology
 2BRE A;  1Y8P A;  4EFU A;  3OMU A;  3VAD A;  4FCP A;  1THN A;  2XJJ A;  2PNR A;  4X9L A;  3Q5L A;  5J6A A;  2BRC A;  3R4O A;  4U7N A;  5CTY A;  3WHA A;  2WI4 A;  2QG0 A;  2YEG A;  1UYD A;  3IED A;  4YKR A;  2YEF A;  2BYI A;  3QDD A;  3EKR A;  4EGH A;  1A4H A;  2YGA A;  5D7R A;  4FCR A;  1YC3 A;  4LWI A;  4LPB A;  4XKK A;  2CCU A;  4NH7 A;  4O04 A;  4JAV A;  4CE3 A;  1AH8 A;  2VWC A;  2WEP A;  4O05 A;  3CRK A;  3ZM7 A;  1YC1 A;  3FV5 A;  2Q8G A;  1B63 A;  3PEJ A;  2ZDY A;  4R3A A;  2O1V A;  2AKP A;  2YKE A;  2H55 A;  2ESA A;  2YGE A;  2WEQ A;  3R91 A;  3D36 A;  4KQV A;  1NHI A;  5D7D A;  1UYL A;  4MPC A;  4XIQ A;  3D2R A;  3TTZ A;  4XIT A;  3S5T A;  1QZR A;  2K5B A;  3SL2 A;  2HKJ A;  2GFD A;  5CF0 A;  5CTX A;  3VHC A;  4GCZ A;  1TH8 A;  3T2S A;  4KFG A;  2FTK A;  4ASG A;  1I59 A;  2XHT A;  4L8Z A;  1Y4U A;  5C93 A;  2YI6 A;  3U67 A;  4JAU A;  1I5C A;  3Q5K A;  3HZ5 A;  2IWS A;  4CWN A;  1EI1 A;  5M4E A;  1UYI A;  4XIR A;  3HHU A;  2QFO A;  4L94 A;  5M4H A;  3D0B A;  2BU2 A;  2CCT A;  4LWH A;  4URN A;  1YT1 A;  4HZ0 A;  4L93 A;  4BIZ A;  2YE3 A;  2FYP A;  2O1U A;  3B25 A;  2YKI A;  2WI2 A;  1UY6 A;  3R4N A;  3G75 A;  4BQJ A;  3K60 A;  5BOC A;  3VHD A;  5IDM A;  4E00 A;  4MBC A;  3ZKD A;  4CWO A;  4LWG A;  4BXI A;  2WI3 A;  5D7C A;  1AM1 A;  1BXD A;  3TZ2 A;  4I3H A;  3CRL A;  4FMT A;  3BM9 A;  2XHR A;  1Y8N A;  3O0I A;  4YKX A;  1Z5A A;  2QF6 A;  3R4M A;  4P7A A;  2FWZ A;  3OWB A;  4CWP A;  3K98 A;  4HXZ A;  4EEH A;  4CE2 A;  4O07 A;  1B3Q A;  1JM6 A;  2WI7 A;  4O09 A;  3RLP A;  2BTZ A;  3LNU A;  4K4O A;  2VW5 A;  3K97 A;  1ZXN A;  4AWP A;  3CYG A;  2JKI A;  2YEC A;  5D6P A;  4CWF A;  2BU7 A;  2YE2 A;  3MNR P;  2YED A;  1US7 A;  4L91 A;  3ZXQ A;  4EGI A;  3EKO A;  5JEN A;  2QG2 A;  4HY6 A;  2Q8H A;  4QPK A;  3BMY A;  3INW A;  4WUD A;  4YKZ A;  2CCS A;  4HZ5 A;  3GIF A;  4CE1 A;  1TIL A;  2YEB A;  2YI0 A;  2YK2 A;  2XJX A;  2BU6 A;  3B28 A;  2ZBK B;  3GIG A;  2YE4 A;  3OW6 A;  2XJG A;  3HEK A;  4LP0 A;  2GQP A;  5J71 A;  4BAE A;  4CWR A;  5M4M A;  1YER A;  3A0R A;  3H4L A;  3PEH A;  1GJV A;  1KIJ A;  4HXW A;  2ZKJ A;  4KP4 A;  1TC0 A;  4MB9 A;  5L3J A;  1S16 A;  1YSR A;  1GKX A;  5IDJ A;  3HYY A;  4KTN A;  1TBW A;  4ZVI A;  5M4N A;  2VCJ A;  2BZ5 A;  2YKJ A;  4YKU A;  3OPD A;  5CPH A;  1OSF A;  3O2F A;  3CGY A;  2HG1 A;  3U2K A;  4YKY A;  3TZ5 A;  4E72 A;  4H7Q A;  2BU8 A;  1MU5 A;  3RLQ A;  4E02 A;  1Y4S A;  4YKW A;  1UYC A;  3HYZ A;  4PL9 A;  2O1W A;  2XCM A;  3A0T A;  4MOT A;  5M4P A;  1U2O A;  1Z5B A;  2XDK A;  3A0X A;  2BT0 A;  3GIG B;  4XE2 A;  5FNF A;  4FCQ A;  2YEH A;  2HCH A;  4MP2 A;  3A0Z A;  2IOR A;  3G7B A;  2YEJ A;  3WQ9 A;  3VHA A;  1BYQ A;  1YS3 A;  2YKC A;  3LPS A;  2FXS A;  4QPJ A;  2XDX A;  1UYE A;  3B27 A;  2WI1 A;  4Q20 A;  2XX2 A;  1NHH A;  3O6O A;  1L0O A;  1ZWH A;  4ASA A;  4BQG A;  5BOD A;  1EA6 A;  1AH6 A;  3NMQ A;  4XTJ A;  2BU5 A;  3HZ1 A;  1BGQ A;  2CGF A;  4LWF A;  3INX A;  4HYM A;  2YE8 A;  4EFT A;  2JJC A;  3K99 A;  2H8M A;  1KZN A;  1I5D A;  4EMV A;  2XHX A;  2WI6 A;  4AS9 A;  1AMW A;  2XDL A;  4MPN A;  2C1G A;  3CGZ A;  1ZW9 A;  4HYP A;  2Q8I A;  3U2D A;  2YJX A;  2FWY A;  4XIP A;  1U0Z A;  4XDM A;  4EM7 A;  2YEA A;  3T10 A;  3EHJ A;  4HY1 A;  1F51 A;  4YKT A;  5CTW A;  4H81 A;  4AWQ A;  4DUH A;  1UY8 A;  2YI5 A;  3R92 A;  2XK2 A;  1QY8 A;  2WI5 A;  2C2A A;  1H7S A;  1NHJ A;  3LMM A;  4NH9 A;  4FPP A;  4JQL A;  4ZKI A;  4H85 A;  4R1F A;  1UYK A;  3TUH A;  4GEE A;  3FT5 A;  3QTF A;  3C0E A;  4L90 A;  5GGZ A;  1BKN A;  2UWD A;  4PU9 A;  2IOQ A;  4NH8 A;  3CWV A;  1TC6 A;  2XD6 A;  5CTU A;  2XAB A;  4CWT A;  4I5S A;  4B6C A;  1YSZ A;  1UY7 A;  2YE7 A;  5D6Q A;  1R62 A;  4R3M A;  2YKB A;  2IWX A;  3JZ3 A;  3EHG A;  4URM A;  3H80 A;  4XD8 A;  4JAS A;  2WER A;  4CWQ A;  3DGE A;  2C1I A;  4PRX A;  3A0Y A;  3OWD A;  4O0B A;  4LWE A;  1MX0 A;  4ASB A;  3T1K A;  2YK9 A;  2XDS A;  2YE6 A;  4CWS A;  1UYH A;  3EHF A;  4WUC A;  2VCI A;  3RKZ A;  3B24 A;  3C11 A;  1Z59 A;  4MP7 A;  5FNC A;  3RLR A;  1UYM A;  2YGF A;  3TZ0 A;  3KE6 A;  1H7U A;  2XDU A;  1ID0 A;  3Q5J A;  2XX4 A;  5F3K A;  5M4K A;  2YE5 A;  3G7E A;  1Y8O A;  4EGK A;  1S14 A;  1UYF A;  2XX5 A;  3EHH A;  4GQT A;  3T0Z A;  4U7O A;  1PVG A;  1GKZ A;  2CG9 A;  3ZXO A;  1QYE A;  2Q2E B;  2HHI A;  2ZDX A;  1UY9 A;  4GFN A;  4V25 A;  3ZKB A;  2E0A A;  4XCL A;  1TID A;  2YEE A;  3B26 A;  2IWU A;  4WUB A;  4XKO A;  1ZXM A;  2EXL A;  4AWO A;  1I5A A;  1I5B A;  1AJ6 A;  1YET A;  1YES A;  3T0H A;  2BSM A;  4ASF A;  1IXM A;  1YC4 A;  5FWK A;  1UYG A;  1B62 A;  4KSH A;  5FND A;  4E01 A;  4PRV A;  4YKQ A;  2CH4 A;  4XKA A;  3A0W A;  2Q8F A;  4B7P A;  4GT8 A;  4GGL A;  5F5R A;  4MPE A;  4U93 A;  5IN9 A;  2YE9 A;  1I58 A;  2IOP A;  1YT0 A;  4BIU A;  4DZY A;  2YJW A;  4P8O A;  2YI7 A;  4V26 A;  1Z5C A;  3GIE A;  3R4P A;  2BYH A;  4XCJ A;  4W7T A;  2YEI A;  4URO A;  4XC0 A;  4KSG A;  3TZ4 A;  4URL A;  1YT2 A;  3FT8 A; 
#chains in the Genus database with same CATH homology
 2BRE A;  1Y8P A;  4EFU A;  3OMU A;  3VAD A;  4FCP A;  1THN A;  2XJJ A;  2PNR A;  4X9L A;  3Q5L A;  5J6A A;  2BRC A;  3R4O A;  4U7N A;  5CTY A;  3WHA A;  2WI4 A;  2QG0 A;  2YEG A;  1UYD A;  3IED A;  4YKR A;  2YEF A;  2BYI A;  3QDD A;  3EKR A;  4EGH A;  1A4H A;  2YGA A;  5D7R A;  4FCR A;  1YC3 A;  4LWI A;  4LPB A;  4XKK A;  2CCU A;  4NH7 A;  4O04 A;  4JAV A;  4CE3 A;  1AH8 A;  2VWC A;  2WEP A;  4O05 A;  3CRK A;  3ZM7 A;  1YC1 A;  3FV5 A;  2Q8G A;  1B63 A;  3PEJ A;  2ZDY A;  4R3A A;  2O1V A;  2AKP A;  2YKE A;  2H55 A;  2ESA A;  2YGE A;  2WEQ A;  3R91 A;  3D36 A;  4KQV A;  1NHI A;  5D7D A;  1UYL A;  4MPC A;  4XIQ A;  3D2R A;  3TTZ A;  4XIT A;  1QZR A;  2K5B A;  3SL2 A;  2HKJ A;  2GFD A;  5CF0 A;  5CTX A;  3VHC A;  4GCZ A;  1TH8 A;  3T2S A;  4KFG A;  4ASG A;  1I59 A;  2XHT A;  4L8Z A;  1Y4U A;  5C93 A;  2YI6 A;  3U67 A;  4JAU A;  1I5C A;  3Q5K A;  3HZ5 A;  2IWS A;  4CWN A;  1EI1 A;  5M4E A;  1UYI A;  4XIR A;  3HHU A;  2QFO A;  4L94 A;  5M4H A;  3D0B A;  2BU2 A;  2CCT A;  4LWH A;  4URN A;  1YT1 A;  4HZ0 A;  4L93 A;  4BIZ A;  2YE3 A;  2FYP A;  2O1U A;  3B25 A;  2YKI A;  2WI2 A;  1UY6 A;  3R4N A;  3G75 A;  4BQJ A;  3K60 A;  5BOC A;  3VHD A;  5IDM A;  4E00 A;  4MBC A;  3ZKD A;  4CWO A;  4LWG A;  4BXI A;  2WI3 A;  5D7C A;  1AM1 A;  1BXD A;  3TZ2 A;  4I3H A;  3CRL A;  4FMT A;  3BM9 A;  2XHR A;  1Y8N A;  3O0I A;  4YKX A;  1Z5A A;  2QF6 A;  3R4M A;  4P7A A;  2FWZ A;  3OWB A;  4CWP A;  3K98 A;  4HXZ A;  4EEH A;  4CE2 A;  4O07 A;  1B3Q A;  1JM6 A;  2WI7 A;  4O09 A;  3RLP A;  2BTZ A;  3LNU A;  4K4O A;  2VW5 A;  3K97 A;  1ZXN A;  4AWP A;  2JKI A;  2YEC A;  5D6P A;  4CWF A;  2BU7 A;  2YE2 A;  3MNR P;  2YED A;  1US7 A;  4L91 A;  3ZXQ A;  4EGI A;  3EKO A;  2QG2 A;  4HY6 A;  2Q8H A;  4QPK A;  3BMY A;  3INW A;  4WUD A;  4YKZ A;  2CCS A;  4HZ5 A;  3GIF A;  4CE1 A;  1TIL A;  2YEB A;  2YI0 A;  2YK2 A;  2XJX A;  2BU6 A;  3B28 A;  2ZBK B;  3GIG A;  2YE4 A;  3OW6 A;  2XJG A;  3HEK A;  4LP0 A;  2GQP A;  5J71 A;  4BAE A;  4CWR A;  5M4M A;  1YER A;  3A0R A;  3H4L A;  3PEH A;  1GJV A;  1KIJ A;  4HXW A;  2ZKJ A;  4KP4 A;  1TC0 A;  4MB9 A;  5L3J A;  1S16 A;  1YSR A;  1GKX A;  5IDJ A;  3HYY A;  4KTN A;  1TBW A;  4ZVI A;  5M4N A;  2VCJ A;  2BZ5 A;  2YKJ A;  4YKU A;  3OPD A;  5CPH A;  1OSF A;  3O2F A;  3CGY A;  2HG1 A;  3U2K A;  4YKY A;  3TZ5 A;  4H7Q A;  2BU8 A;  1MU5 A;  3RLQ A;  4E02 A;  1Y4S A;  4YKW A;  1UYC A;  3HYZ A;  4PL9 A;  2O1W A;  2XCM A;  3A0T A;  4MOT A;  5M4P A;  1U2O A;  1Z5B A;  2XDK A;  3A0X A;  2BT0 A;  3GIG B;  4XE2 A;  5FNF A;  4FCQ A;  2YEH A;  2HCH A;  4MP2 A;  3A0Z A;  2IOR A;  3G7B A;  2YEJ A;  3WQ9 A;  3VHA A;  1BYQ A;  1YS3 A;  2YKC A;  3LPS A;  2FXS A;  4QPJ A;  2XDX A;  1UYE A;  3B27 A;  2WI1 A;  4Q20 A;  2XX2 A;  1NHH A;  3O6O A;  1L0O A;  1ZWH A;  4ASA A;  4BQG A;  5BOD A;  1EA6 A;  1AH6 A;  3NMQ A;  4XTJ A;  2BU5 A;  3HZ1 A;  1BGQ A;  2CGF A;  4LWF A;  3INX A;  4HYM A;  2YE8 A;  4EFT A;  2JJC A;  3K99 A;  2H8M A;  1KZN A;  1I5D A;  4EMV A;  2XHX A;  2WI6 A;  4AS9 A;  1AMW A;  2XDL A;  4MPN A;  3CGZ A;  1ZW9 A;  4HYP A;  2Q8I A;  3U2D A;  2YJX A;  2FWY A;  4XIP A;  1U0Z A;  4XDM A;  4EM7 A;  2YEA A;  3T10 A;  3EHJ A;  4HY1 A;  4YKT A;  5CTW A;  4H81 A;  4AWQ A;  4DUH A;  1UY8 A;  2YI5 A;  3R92 A;  2XK2 A;  1QY8 A;  2WI5 A;  2C2A A;  1H7S A;  1NHJ A;  4NH9 A;  4FPP A;  4JQL A;  4ZKI A;  4H85 A;  4R1F A;  1UYK A;  3TUH A;  4GEE A;  3FT5 A;  3QTF A;  3C0E A;  4L90 A;  5GGZ A;  1BKN A;  2UWD A;  4PU9 A;  2IOQ A;  4NH8 A;  3CWV A;  1TC6 A;  2XD6 A;  5CTU A;  2XAB A;  4CWT A;  4I5S A;  4B6C A;  1YSZ A;  1UY7 A;  2YE7 A;  5D6Q A;  1R62 A;  4R3M A;  2YKB A;  2IWX A;  3JZ3 A;  3EHG A;  4URM A;  3H80 A;  4XD8 A;  4JAS A;  2WER A;  4CWQ A;  3DGE A;  4PRX A;  3A0Y A;  3OWD A;  4O0B A;  4LWE A;  1MX0 A;  4ASB A;  3T1K A;  2YK9 A;  2XDS A;  2YE6 A;  4CWS A;  1UYH A;  3EHF A;  4WUC A;  2VCI A;  3RKZ A;  3B24 A;  3C11 A;  1Z59 A;  4MP7 A;  5FNC A;  3RLR A;  1UYM A;  2YGF A;  3TZ0 A;  3KE6 A;  1H7U A;  2XDU A;  1ID0 A;  3Q5J A;  2XX4 A;  5F3K A;  5M4K A;  2YE5 A;  3G7E A;  1Y8O A;  4EGK A;  1S14 A;  1UYF A;  2XX5 A;  3EHH A;  4GQT A;  3T0Z A;  4U7O A;  1PVG A;  1GKZ A;  2CG9 A;  3ZXO A;  1QYE A;  2Q2E B;  2ZDX A;  1UY9 A;  4GFN A;  4V25 A;  3ZKB A;  2E0A A;  4XCL A;  1TID A;  2YEE A;  3B26 A;  2IWU A;  4WUB A;  4XKO A;  1ZXM A;  2EXL A;  4AWO A;  1I5A A;  1I5B A;  1AJ6 A;  1YET A;  1YES A;  3T0H A;  2BSM A;  4ASF A;  1YC4 A;  5FWK A;  1UYG A;  1B62 A;  4KSH A;  5FND A;  4E01 A;  4PRV A;  4YKQ A;  2CH4 A;  4XKA A;  3A0W A;  2Q8F A;  4B7P A;  4GT8 A;  4GGL A;  5F5R A;  4MPE A;  4U93 A;  5IN9 A;  2YE9 A;  1I58 A;  2IOP A;  1YT0 A;  4BIU A;  4DZY A;  2YJW A;  4P8O A;  2YI7 A;  4V26 A;  1Z5C A;  3GIE A;  3R4P A;  2BYH A;  4XCJ A;  4W7T A;  2YEI A;  4URO A;  4XC0 A;  4KSG A;  3TZ4 A;  4URL A;  1YT2 A;  3FT8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...