3GIGB

Crystal structure of phosphorylated deskc in complex with amp-pcp
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
205
structure length
204
Chain Sequence
LEDANERIAELVKLEERQRIARDLDTLGQKLSLIGLKSDLARKLIYKDPEQAARELKSVQQTARTSLNEVRKIVSSMKGIRLKDELINIKQILEAADIMFIYEEEKWPENISLLNENILSMCLKEAVTNVVKHSQAKTCRVDIQQLWKEVVITVSDDGTFKGEENSFSKGHGLLGMRERLEFANGSLHIDTENGTKLTMAIPNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural plasticity and catalysis regulation of a thermosensor histidine kinase
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
molecule keywords Sensor histidine kinase desK
total genus 64
structure length 204
sequence length 205
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2009-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07730 HisKA_3 Histidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3gigB02
2AKPA 3EHGA 3MNRP 2YGFA 5F3KA 4ASAA 2XDLA 2Q8IA 4MOTA 3VHCA 1ZXMA 1BKNA 4KSHA 5IDMA 2YE4A 3R4OA 4PL9A 4YKYA 4BIZA 4BQGA 4FCRA 1YC1A 3D36A 4EM7A 4E00A 4BQJA 1UYCA 1I5BA 2YKBA 2Q8HA 1KZNA 3SL2A 4EGKA 2Q8FA 3H4LA 4ASFA 1EA6A 4H81A 1YSRA 3K60A 3K98A 4U7OA 2YE7A 3R4NA 2VWCA 3CRLA 2CCSA 4CE2A 3T1KA 3G75A 4O0BA 4AWPA 1ZXNA 4XIRA 5J71A 2IOPA 3G7EA 1Z5BA 1UYEA 2FWZA 4CWFA 2JKIA 3TZ4A 2XDKA 1H7UA 1UY8A 2WERA 4BIUA 4ZKIA 2YEGA 1QZRA 1TH8A 2XABA 1KIJA 2YGAA 4Q20A 5FNDA 1UY6A 5CTWA 2YEBA 5CPHA 2C2AA 2XD6A 2XDUA 4P8OA 5F5RA 4MBCA 2WI2A 4DZYA 4KP4A 1OSFA 1S14A 1UYKA 1YETA 3T0ZA 1MU5A 1JM6A 1Y8OA 2XHXA 3KE6A 2IORA 3FT8A 4AWOA 5D7DA 1Y4SA 3B24A 3B27A 4HYPA 3HZ5A 4L8ZA 4XE2A 1AJ6A 3U2KA 1ID0A 4GCZA 4E02A 4EFUA 4EMVA 1TBWA 2YEHA 4R3AA 4XCLA 4U93A 4QPJA 4XTJA 1B3QA 1NHIA 2ZKJA 2BT0A 4FCQA 2YE3A 2WI4A 1A4HA 2QG0A 4YKRA 3TUHA 3TZ0A 3ZXQA 1QY8A 4ZVIA 1UY7A 2HG1A 3U67A 4LPBA 1ZWHA 1ZW9A 1I59A 4LP0A 4LWFA 1AH8A 4JASA 2YE5A 4O04A 2XJJA 5D6PA 4WUBA 3CGZA 4LWIA 4KFGA 1YSZA 2YKJA 2BSMA 3TZ5A 3DGEA 2Q2EB 5CTXA 2ESAA 4KQVA 5CTUA 3R4PA 3LNUA 4FMTA 3INWA 2BREA 3OWDA 4GQTA 2WI7A 1U2OA 2CCUA 4L93A 1R62A 4HXZA 5FWKA 2YI0A 4URNA 2XHRA 3O2FA 3PEHA 4ASGA 4X9LA 4MB9A 1Y8NA 1UYLA 5M4EA 4YKUA 2YI5A 4XD8A 5CTYA 4AWQA 5J6AA 5D7RA 5IN9A 3K97A 3CGYA 4GFNA 4XDMA 3GIGB 3RKZA 3CRKA 3Q5KA 3T0HA 1UYDA 1GKZA 2O1WA 3IEDA 1AMWA 3B25A 4B6CA 4JAUA 4JAVA 4BAEA 2GFDA 3HYYA 2CG9A 2XCMA 3O0IA 4L91A 1L0OA 2XX2A 2VW5A 3JZ3A 4L90A 5M4PA 1B62A 2XHTA 2H55A 4BXIA 3WHAA 2XX4A 3OPDA 5IDJA 4MPCA 2ZDXA 1U0ZA 3R4MA 5GGZA 4XKAA 4I3HA 3U2DA 3G7BA 2ZBKB 3OWBA 3A0ZA 1YC4A 2BU5A 4PRVA 3PEJA 3EKOA 3INXA 1UYIA 4HY6A 1AM1A 3HZ1A 3EHJA 4V26A 1US7A 2GQPA 1I5CA 2IOQA 3B26A 5D6QA 3ZKBA 3R92A 4LWEA 5D7CA 4V25A 2O1VA 4CWTA 1THNA 4EEHA 1TC0A 1UYFA 2FXSA 3VADA 3TZ2A 4O07A 2YK2A 4CWNA 4GEEA 4YKQA 4CWRA 4XCJA 2VCIA 1Y4UA 3A0XA 4JQLA 3O6OA 4R3MA 4CWQA 4CWSA 1YT0A 2CCTA 4GT8A 3C11A 3FT5A 4URLA 2BZ5A 1GJVA 3A0RA 4XKKA 2JJCA 4P7AA 2XJGA 2YI7A 2QF6A 3ZXOA 4I5SA 3A0WA 4O05A 4E01A 4GGLA 2WEQA 2XX5A 4H85A 4YKXA 5CF0A 2ZDYA 4W7TA 3HEKA 2YEIA 3NMQA 1H7SA 1I58A 4URMA 4KSGA 1UYGA 1BYQA 2YKEA 2YJXA 2YI6A 5FNFA 3ZM7A 1YC3A 4WUDA 3HYZA 1PVGA 2WEPA 2YK9A 4UROA 5M4MA 2FWYA 3C0EA 4LWGA 5M4HA 2YEEA 2WI5A 4K4OA 4R1FA 4NH8A 4CE1A 4MPNA 1TIDA 4HYMA 3HHUA 4U7NA 2VCJA 3B28A 3TTZA 4EGHA 4L94A 4XKOA 3QDDA 1TILA 5C93A 2Q8GA 2K5BA 3GIGA 4O09A 4CWPA 3OW6A 4CE3A 2YECA 1YT1A 2E0AA 1Z59A 2YEFA 4DUHA 3QTFA 4HZ5A 3RLPA 4MP2A 2YKIA 5M4KA 4MPEA 2CGFA 2YJWA 2EXLA 3BM9A 1YESA 1YERA 2UWDA 1Y8PA 3BMYA 3T2SA 2WI1A 3LPSA 4XIPA 4H7QA 3GIFA 3D0BA 2YEAA 4ASBA 3A0TA 2IWXA 2YGEA 4NH9A 1AH6A 2CH4A 2BU2A 2BU8A 2YE9A 5M4NA 4XIQA 3VHAA 3RLRA 2H8MA 3RLQA 5FNCA 2BYHA 2XJXA 1Z5CA 3FV5A 4QPKA 1BGQA 5BODA 2XK2A 1UYMA 1QYEA 1BXDA 3OMUA 2HCHA 3GIEA 3EKRA 2FYPA 3A0YA 4YKZA 4EGIA 2YEJA 5BOCA 4LWHA 1UY9A 1NHHA 4KTNA 4XC0A 1MX0A 3EHHA 3H80A 5L3JA 2QFOA 3ZKDA 2BU6A 4HXWA 1YS3A 2XDSA 2YE8A 3VHDA 2WI6A 2BYIA 2YE2A 3T10A 1I5DA 2YKCA 4PU9A 4HZ0A 4PRXA 1S16A 2XDXA 3R91A 1Z5AA 2YE6A 3Q5JA 4CWOA 4AS9A 4YKTA 4YKWA 4FCPA 3Q5LA 4MP7A 3EHFA 4NH7A 4XITA 2YEDA 4EFTA 2IWUA 1TC6A 2BRCA 1YT2A 2PNRA 3D2RA 4HY1A 2IWSA 3CWVA 4FPPA 2WI3A 2QG2A 3WQ9A 3K99A 2BTZA 1NHJA 4B7PA 2HKJA 1UYHA 1B63A 1I5AA 2O1UA 2BU7A 4WUCA 1EI1A 1GKXA
chains in the Genus database with same CATH superfamily
2AKPA 3EHGA 3MNRP 2YGFA 5F3KA 4ASAA 2XDLA 2Q8IA 4MOTA 3VHCA 1ZXMA 1BKNA 4KSHA 5IDMA 2YE4A 3R4OA 4PL9A 4YKYA 4BIZA 4BQGA 4FCRA 1YC1A 3D36A 4EM7A 4E00A 4BQJA 1UYCA 1I5BA 2YKBA 2Q8HA 1KZNA 3SL2A 4EGKA 2Q8FA 3H4LA 4ASFA 1EA6A 4H81A 1YSRA 3K60A 3K98A 4U7OA 2YE7A 3R4NA 2VWCA 3CRLA 2CCSA 4CE2A 3T1KA 3G75A 4O0BA 4AWPA 1ZXNA 4XIRA 5J71A 5JENA 2IOPA 3G7EA 1Z5BA 1UYEA 2FWZA 4CWFA 2JKIA 3TZ4A 2XDKA 1H7UA 1UY8A 2WERA 4BIUA 4ZKIA 2YEGA 1QZRA 1TH8A 2XABA 2FTKA 1KIJA 2YGAA 4Q20A 5FNDA 1UY6A 5CTWA 2YEBA 5CPHA 2C2AA 2XD6A 3CYGA 2XDUA 4P8OA 5F5RA 4MBCA 2WI2A 4DZYA 4KP4A 1OSFA 1S14A 1UYKA 1YETA 3T0ZA 1MU5A 1JM6A 1Y8OA 2XHXA 3KE6A 2IORA 3FT8A 4AWOA 5D7DA 1Y4SA 3B24A 3B27A 4HYPA 3HZ5A 4L8ZA 4XE2A 1AJ6A 3U2KA 1ID0A 4GCZA 4E02A 4EFUA 4EMVA 1TBWA 2YEHA 4R3AA 4XCLA 3S5TA 4U93A 4QPJA 4XTJA 1B3QA 1NHIA 2ZKJA 2BT0A 4FCQA 2YE3A 2WI4A 1A4HA 2QG0A 4YKRA 3TUHA 3TZ0A 3ZXQA 1QY8A 4ZVIA 1UY7A 2HG1A 3U67A 4LPBA 1ZWHA 1ZW9A 1I59A 4LP0A 4LWFA 1AH8A 4JASA 2YE5A 4O04A 2XJJA 5D6PA 4WUBA 3CGZA 4LWIA 4E72A 4KFGA 1YSZA 2YKJA 2BSMA 3TZ5A 3DGEA 2Q2EB 5CTXA 2ESAA 4KQVA 5CTUA 3R4PA 3LNUA 4FMTA 3INWA 2BREA 3OWDA 4GQTA 2WI7A 1U2OA 2CCUA 4L93A 1R62A 4HXZA 1IXMA 5FWKA 2YI0A 4URNA 1F51A 2XHRA 3O2FA 3PEHA 4ASGA 4X9LA 4MB9A 1Y8NA 1UYLA 5M4EA 4YKUA 2YI5A 4XD8A 5CTYA 4AWQA 5J6AA 5D7RA 5IN9A 3K97A 3CGYA 4GFNA 4XDMA 3GIGB 3RKZA 3CRKA 3Q5KA 3T0HA 2C1GA 1UYDA 1GKZA 2O1WA 3IEDA 1AMWA 3B25A 4B6CA 4JAUA 4JAVA 4BAEA 2GFDA 3HYYA 2CG9A 2XCMA 3O0IA 4L91A 1L0OA 2XX2A 2VW5A 3JZ3A 4L90A 5M4PA 1B62A 2XHTA 2H55A 4BXIA 3WHAA 2XX4A 3OPDA 5IDJA 4MPCA 2ZDXA 1U0ZA 3R4MA 5GGZA 4XKAA 4I3HA 3U2DA 3G7BA 2ZBKB 3OWBA 3A0ZA 1YC4A 2BU5A 4PRVA 3PEJA 3EKOA 3INXA 1UYIA 4HY6A 1AM1A 3HZ1A 3EHJA 4V26A 1US7A 2GQPA 1I5CA 2IOQA 3B26A 5D6QA 3ZKBA 3R92A 4LWEA 5D7CA 4V25A 2O1VA 4CWTA 1THNA 4EEHA 1TC0A 1UYFA 2FXSA 3VADA 3TZ2A 4O07A 2YK2A 4CWNA 4GEEA 4YKQA 4CWRA 4XCJA 2VCIA 4JQLA 1Y4UA 3A0XA 3O6OA 4R3MA 4CWQA 4CWSA 1YT0A 2CCTA 4GT8A 3C11A 3FT5A 4URLA 2BZ5A 1GJVA 3A0RA 4XKKA 2JJCA 4P7AA 2XJGA 2YI7A 2QF6A 3ZXOA 4I5SA 3A0WA 4O05A 4E01A 4GGLA 2WEQA 2XX5A 4H85A 4YKXA 5CF0A 2ZDYA 4W7TA 3HEKA 2YEIA 3NMQA 1H7SA 1I58A 4URMA 4KSGA 1UYGA 1BYQA 2YKEA 2YJXA 2YI6A 5FNFA 3ZM7A 1YC3A 2HHIA 4WUDA 3HYZA 1PVGA 2WEPA 2YK9A 4UROA 5M4MA 2FWYA 3C0EA 4LWGA 5M4HA 2YEEA 2WI5A 4K4OA 4R1FA 4NH8A 4CE1A 4MPNA 1TIDA 4HYMA 3HHUA 4U7NA 2VCJA 3B28A 3TTZA 4EGHA 4L94A 4XKOA 3QDDA 1TILA 5C93A 2Q8GA 2K5BA 3GIGA 4O09A 4CWPA 3OW6A 4CE3A 2YECA 1YT1A 2E0AA 1Z59A 2YEFA 4DUHA 3QTFA 4HZ5A 3LMMA 3RLPA 4MP2A 2YKIA 5M4KA 4MPEA 2CGFA 2YJWA 2EXLA 3BM9A 1YESA 1YERA 2UWDA 1Y8PA 3BMYA 3T2SA 2WI1A 3LPSA 4XIPA 4H7QA 3GIFA 3D0BA 2YEAA 4ASBA 3A0TA 2IWXA 2YGEA 4NH9A 1AH6A 2CH4A 2BU2A 2BU8A 2YE9A 5M4NA 4XIQA 3VHAA 3RLRA 2H8MA 3RLQA 5FNCA 2BYHA 2XJXA 1Z5CA 3FV5A 4QPKA 1BGQA 5BODA 2XK2A 1UYMA 2C1IA 1QYEA 1BXDA 3OMUA 2HCHA 3GIEA 3EKRA 2FYPA 3A0YA 4YKZA 4EGIA 2YEJA 5BOCA 4LWHA 1UY9A 1NHHA 4KTNA 4XC0A 1MX0A 3EHHA 3H80A 5L3JA 2QFOA 3ZKDA 2BU6A 4HXWA 1YS3A 2XDSA 2YE8A 3VHDA 2WI6A 2BYIA 2YE2A 3T10A 1I5DA 2YKCA 4PU9A 4HZ0A 4PRXA 1S16A 2XDXA 3R91A 1Z5AA 2YE6A 3Q5JA 4CWOA 4AS9A 4YKTA 4YKWA 4FCPA 3Q5LA 4MP7A 3EHFA 4NH7A 4XITA 2YEDA 4EFTA 2IWUA 1TC6A 2BRCA 1YT2A 2PNRA 3D2RA 4HY1A 2IWSA 3CWVA 4FPPA 2WI3A 2QG2A 3WQ9A 3K99A 2BTZA 1NHJA 4B7PA 2HKJA 1UYHA 1B63A 1I5AA 2O1UA 2BU7A 4WUCA 1EI1A 1GKXA
chains in the Genus database with same CATH topology
2AKPA 3EHGA 3MNRP 2YGFA 5F3KA 4ASAA 2XDLA 2Q8IA 4MOTA 3VHCA 1ZXMA 1BKNA 4KSHA 5IDMA 2YE4A 3R4OA 4PL9A 4YKYA 4BIZA 4BQGA 4FCRA 1YC1A 3D36A 4EM7A 4E00A 4BQJA 1UYCA 1I5BA 2YKBA 2Q8HA 1KZNA 3SL2A 4EGKA 2Q8FA 3H4LA 4ASFA 1EA6A 4H81A 1YSRA 3K60A 3K98A 4U7OA 2YE7A 3R4NA 2VWCA 3CRLA 2CCSA 4CE2A 3T1KA 3G75A 4O0BA 4AWPA 1ZXNA 4XIRA 5J71A 2IOPA 3G7EA 1Z5BA 1UYEA 2FWZA 4CWFA 2JKIA 3TZ4A 2XDKA 1H7UA 1UY8A 2WERA 4BIUA 4ZKIA 2YEGA 1QZRA 1TH8A 2XABA 1KIJA 2YGAA 4Q20A 5FNDA 1UY6A 5CTWA 2YEBA 5CPHA 2C2AA 2XD6A 2XDUA 4P8OA 5F5RA 4MBCA 2WI2A 4DZYA 4KP4A 1OSFA 1S14A 1UYKA 1YETA 3T0ZA 1MU5A 1JM6A 1Y8OA 2XHXA 3KE6A 2IORA 3FT8A 4AWOA 5D7DA 1Y4SA 3B24A 3B27A 4HYPA 3HZ5A 4L8ZA 4XE2A 1AJ6A 3U2KA 1ID0A 4GCZA 4E02A 4EFUA 4EMVA 1TBWA 2YEHA 4R3AA 4XCLA 4U93A 4QPJA 4XTJA 1B3QA 1NHIA 2ZKJA 2BT0A 4FCQA 2YE3A 2WI4A 1A4HA 2QG0A 4YKRA 3TUHA 3TZ0A 3ZXQA 1QY8A 4ZVIA 1UY7A 2HG1A 3U67A 4LPBA 1ZWHA 1ZW9A 1I59A 4LP0A 4LWFA 1AH8A 4JASA 2YE5A 4O04A 2XJJA 5D6PA 4WUBA 3CGZA 4LWIA 4KFGA 1YSZA 2YKJA 2BSMA 3TZ5A 3DGEA 2Q2EB 5CTXA 2ESAA 4KQVA 5CTUA 3R4PA 3LNUA 4FMTA 3INWA 2BREA 3OWDA 4GQTA 2WI7A 1U2OA 2CCUA 4L93A 1R62A 4HXZA 5FWKA 2YI0A 4URNA 2XHRA 3O2FA 3PEHA 4ASGA 4X9LA 4MB9A 1Y8NA 1UYLA 5M4EA 4YKUA 2YI5A 4XD8A 5CTYA 4AWQA 5J6AA 5D7RA 5IN9A 3K97A 3CGYA 4GFNA 4XDMA 3GIGB 3RKZA 3CRKA 3Q5KA 3T0HA 1UYDA 1GKZA 2O1WA 3IEDA 1AMWA 3B25A 4B6CA 4JAUA 4JAVA 4BAEA 2GFDA 3HYYA 2CG9A 2XCMA 3O0IA 4L91A 1L0OA 2XX2A 2VW5A 3JZ3A 4L90A 5M4PA 1B62A 2XHTA 2H55A 4BXIA 3WHAA 2XX4A 3OPDA 5IDJA 4MPCA 2ZDXA 1U0ZA 3R4MA 5GGZA 4XKAA 4I3HA 3U2DA 3G7BA 2ZBKB 3OWBA 3A0ZA 1YC4A 2BU5A 4PRVA 3PEJA 3EKOA 3INXA 1UYIA 4HY6A 1AM1A 3HZ1A 3EHJA 4V26A 1US7A 2GQPA 1I5CA 2IOQA 3B26A 5D6QA 3ZKBA 3R92A 4LWEA 5D7CA 4V25A 2O1VA 4CWTA 1THNA 4EEHA 1TC0A 1UYFA 2FXSA 3VADA 3TZ2A 4O07A 2YK2A 4CWNA 4GEEA 4YKQA 4CWRA 4XCJA 2VCIA 1Y4UA 3A0XA 4JQLA 3O6OA 4R3MA 4CWQA 4CWSA 1YT0A 2CCTA 4GT8A 3C11A 3FT5A 4URLA 2BZ5A 1GJVA 3A0RA 4XKKA 2JJCA 4P7AA 2XJGA 2YI7A 2QF6A 3ZXOA 4I5SA 3A0WA 4O05A 4E01A 4GGLA 2WEQA 2XX5A 4H85A 4YKXA 5CF0A 2ZDYA 4W7TA 3HEKA 2YEIA 3NMQA 1H7SA 1I58A 4URMA 4KSGA 1UYGA 1BYQA 2YKEA 2YJXA 2YI6A 5FNFA 3ZM7A 1YC3A 4WUDA 3HYZA 1PVGA 2WEPA 2YK9A 4UROA 5M4MA 2FWYA 3C0EA 4LWGA 5M4HA 2YEEA 2WI5A 4K4OA 4R1FA 4NH8A 4CE1A 4MPNA 1TIDA 4HYMA 3HHUA 4U7NA 2VCJA 3B28A 3TTZA 4EGHA 4L94A 4XKOA 3QDDA 1TILA 5C93A 2Q8GA 2K5BA 3GIGA 4O09A 4CWPA 3OW6A 4CE3A 2YECA 1YT1A 2E0AA 1Z59A 2YEFA 4DUHA 3QTFA 4HZ5A 3RLPA 4MP2A 2YKIA 5M4KA 4MPEA 2CGFA 2YJWA 2EXLA 3BM9A 1YESA 1YERA 2UWDA 1Y8PA 3BMYA 3T2SA 2WI1A 3LPSA 4XIPA 4H7QA 3GIFA 3D0BA 2YEAA 4ASBA 3A0TA 2IWXA 2YGEA 4NH9A 1AH6A 2CH4A 2BU2A 2BU8A 2YE9A 5M4NA 4XIQA 3VHAA 3RLRA 2H8MA 3RLQA 5FNCA 2BYHA 2XJXA 1Z5CA 3FV5A 4QPKA 1BGQA 5BODA 2XK2A 1UYMA 1QYEA 1BXDA 3OMUA 2HCHA 3GIEA 3EKRA 2FYPA 3A0YA 4YKZA 4EGIA 2YEJA 5BOCA 4LWHA 1UY9A 1NHHA 4KTNA 4XC0A 1MX0A 3EHHA 3H80A 5L3JA 2QFOA 3ZKDA 2BU6A 4HXWA 1YS3A 2XDSA 2YE8A 3VHDA 2WI6A 2BYIA 2YE2A 3T10A 1I5DA 2YKCA 4PU9A 4HZ0A 4PRXA 1S16A 2XDXA 3R91A 1Z5AA 2YE6A 3Q5JA 4CWOA 4AS9A 4YKTA 4YKWA 4FCPA 3Q5LA 4MP7A 3EHFA 4NH7A 4XITA 2YEDA 4EFTA 2IWUA 1TC6A 2BRCA 1YT2A 2PNRA 3D2RA 4HY1A 2IWSA 3CWVA 4FPPA 2WI3A 2QG2A 3WQ9A 3K99A 2BTZA 1NHJA 4B7PA 2HKJA 1UYHA 1B63A 1I5AA 2O1UA 2BU7A 4WUCA 1EI1A 1GKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AKP A;  3EHG A;  3MNR P;  2YGF A;  5F3K A;  4ASA A;  2XDL A;  2Q8I A;  4MOT A;  3VHC A;  1ZXM A;  1BKN A;  4KSH A;  5IDM A;  2YE4 A;  3R4O A;  4PL9 A;  4YKY A;  4BIZ A;  4BQG A;  4FCR A;  1YC1 A;  3D36 A;  4EM7 A;  4E00 A;  4BQJ A;  1UYC A;  1I5B A;  2YKB A;  2Q8H A;  1KZN A;  3SL2 A;  4EGK A;  2Q8F A;  3H4L A;  4ASF A;  1EA6 A;  4H81 A;  1YSR A;  3K60 A;  3K98 A;  4U7O A;  2YE7 A;  3R4N A;  2VWC A;  3CRL A;  2CCS A;  4CE2 A;  3T1K A;  3G75 A;  4O0B A;  4AWP A;  1ZXN A;  4XIR A;  5J71 A;  2IOP A;  3G7E A;  1Z5B A;  1UYE A;  2FWZ A;  4CWF A;  2JKI A;  3TZ4 A;  2XDK A;  1H7U A;  1UY8 A;  2WER A;  4BIU A;  4ZKI A;  2YEG A;  1QZR A;  1TH8 A;  2XAB A;  1KIJ A;  2YGA A;  4Q20 A;  5FND A;  1UY6 A;  5CTW A;  2YEB A;  5CPH A;  2C2A A;  2XD6 A;  2XDU A;  4P8O A;  5F5R A;  4MBC A;  2WI2 A;  4DZY A;  4KP4 A;  1OSF A;  1S14 A;  1UYK A;  1YET A;  3T0Z A;  1MU5 A;  1JM6 A;  1Y8O A;  2XHX A;  3KE6 A;  2IOR A;  3FT8 A;  4AWO A;  5D7D A;  1Y4S A;  3B24 A;  3B27 A;  4HYP A;  3HZ5 A;  4L8Z A;  4XE2 A;  1AJ6 A;  3U2K A;  1ID0 A;  4GCZ A;  4E02 A;  4EFU A;  4EMV A;  1TBW A;  2YEH A;  4R3A A;  4XCL A;  4U93 A;  4QPJ A;  4XTJ A;  1B3Q A;  1NHI A;  2ZKJ A;  2BT0 A;  4FCQ A;  2YE3 A;  2WI4 A;  1A4H A;  2QG0 A;  4YKR A;  3TUH A;  3TZ0 A;  3ZXQ A;  1QY8 A;  4ZVI A;  1UY7 A;  2HG1 A;  3U67 A;  4LPB A;  1ZWH A;  1ZW9 A;  1I59 A;  4LP0 A;  4LWF A;  1AH8 A;  4JAS A;  2YE5 A;  4O04 A;  2XJJ A;  5D6P A;  4WUB A;  3CGZ A;  4LWI A;  4KFG A;  1YSZ A;  2YKJ A;  2BSM A;  3TZ5 A;  3DGE A;  2Q2E B;  5CTX A;  2ESA A;  4KQV A;  5CTU A;  3R4P A;  3LNU A;  4FMT A;  3INW A;  2BRE A;  3OWD A;  4GQT A;  2WI7 A;  1U2O A;  2CCU A;  4L93 A;  1R62 A;  4HXZ A;  5FWK A;  2YI0 A;  4URN A;  2XHR A;  3O2F A;  3PEH A;  4ASG A;  4X9L A;  4MB9 A;  1Y8N A;  1UYL A;  5M4E A;  4YKU A;  2YI5 A;  4XD8 A;  5CTY A;  4AWQ A;  5J6A A;  5D7R A;  5IN9 A;  3K97 A;  3CGY A;  4GFN A;  4XDM A;  3GIG B;  3RKZ A;  3CRK A;  3Q5K A;  3T0H A;  1UYD A;  1GKZ A;  2O1W A;  3IED A;  1AMW A;  3B25 A;  4B6C A;  4JAU A;  4JAV A;  4BAE A;  2GFD A;  3HYY A;  2CG9 A;  2XCM A;  3O0I A;  4L91 A;  1L0O A;  2XX2 A;  2VW5 A;  3JZ3 A;  4L90 A;  5M4P A;  1B62 A;  2XHT A;  2H55 A;  4BXI A;  3WHA A;  2XX4 A;  3OPD A;  5IDJ A;  4MPC A;  2ZDX A;  1U0Z A;  3R4M A;  5GGZ A;  4XKA A;  4I3H A;  3U2D A;  3G7B A;  2ZBK B;  3OWB A;  3A0Z A;  1YC4 A;  2BU5 A;  4PRV A;  3PEJ A;  3EKO A;  3INX A;  1UYI A;  4HY6 A;  1AM1 A;  3HZ1 A;  3EHJ A;  4V26 A;  1US7 A;  2GQP A;  1I5C A;  2IOQ A;  3B26 A;  5D6Q A;  3ZKB A;  3R92 A;  4LWE A;  5D7C A;  4V25 A;  2O1V A;  4CWT A;  1THN A;  4EEH A;  1TC0 A;  1UYF A;  2FXS A;  3VAD A;  3TZ2 A;  4O07 A;  2YK2 A;  4CWN A;  4GEE A;  4YKQ A;  4CWR A;  4XCJ A;  2VCI A;  1Y4U A;  3A0X A;  4JQL A;  3O6O A;  4R3M A;  4CWQ A;  4CWS A;  1YT0 A;  2CCT A;  4GT8 A;  3C11 A;  3FT5 A;  4URL A;  2BZ5 A;  1GJV A;  3A0R A;  4XKK A;  2JJC A;  4P7A A;  2XJG A;  2YI7 A;  2QF6 A;  3ZXO A;  4I5S A;  3A0W A;  4O05 A;  4E01 A;  4GGL A;  2WEQ A;  2XX5 A;  4H85 A;  4YKX A;  5CF0 A;  2ZDY A;  4W7T A;  3HEK A;  2YEI A;  3NMQ A;  1H7S A;  1I58 A;  4URM A;  4KSG A;  1UYG A;  1BYQ A;  2YKE A;  2YJX A;  2YI6 A;  5FNF A;  3ZM7 A;  1YC3 A;  4WUD A;  3HYZ A;  1PVG A;  2WEP A;  2YK9 A;  4URO A;  5M4M A;  2FWY A;  3C0E A;  4LWG A;  5M4H A;  2YEE A;  2WI5 A;  4K4O A;  4R1F A;  4NH8 A;  4CE1 A;  4MPN A;  1TID A;  4HYM A;  3HHU A;  4U7N A;  2VCJ A;  3B28 A;  3TTZ A;  4EGH A;  4L94 A;  4XKO A;  3QDD A;  1TIL A;  5C93 A;  2Q8G A;  2K5B A;  3GIG A;  4O09 A;  4CWP A;  3OW6 A;  4CE3 A;  2YEC A;  1YT1 A;  2E0A A;  1Z59 A;  2YEF A;  4DUH A;  3QTF A;  4HZ5 A;  3RLP A;  4MP2 A;  2YKI A;  5M4K A;  4MPE A;  2CGF A;  2YJW A;  2EXL A;  3BM9 A;  1YES A;  1YER A;  2UWD A;  1Y8P A;  3BMY A;  3T2S A;  2WI1 A;  3LPS A;  4XIP A;  4H7Q A;  3GIF A;  3D0B A;  2YEA A;  4ASB A;  3A0T A;  2IWX A;  2YGE A;  4NH9 A;  1AH6 A;  2CH4 A;  2BU2 A;  2BU8 A;  2YE9 A;  5M4N A;  4XIQ A;  3VHA A;  3RLR A;  2H8M A;  3RLQ A;  5FNC A;  2BYH A;  2XJX A;  1Z5C A;  3FV5 A;  4QPK A;  1BGQ A;  5BOD A;  2XK2 A;  1UYM A;  1QYE A;  1BXD A;  3OMU A;  2HCH A;  3GIE A;  3EKR A;  2FYP A;  3A0Y A;  4YKZ A;  4EGI A;  2YEJ A;  5BOC A;  4LWH A;  1UY9 A;  1NHH A;  4KTN A;  4XC0 A;  1MX0 A;  3EHH A;  3H80 A;  5L3J A;  2QFO A;  3ZKD A;  2BU6 A;  4HXW A;  1YS3 A;  2XDS A;  2YE8 A;  3VHD A;  2WI6 A;  2BYI A;  2YE2 A;  3T10 A;  1I5D A;  2YKC A;  4PU9 A;  4HZ0 A;  4PRX A;  1S16 A;  2XDX A;  3R91 A;  1Z5A A;  2YE6 A;  3Q5J A;  4CWO A;  4AS9 A;  4YKT A;  4YKW A;  4FCP A;  3Q5L A;  4MP7 A;  3EHF A;  4NH7 A;  4XIT A;  2YED A;  4EFT A;  2IWU A;  1TC6 A;  2BRC A;  1YT2 A;  2PNR A;  3D2R A;  4HY1 A;  2IWS A;  3CWV A;  4FPP A;  2WI3 A;  2QG2 A;  3WQ9 A;  3K99 A;  2BTZ A;  1NHJ A;  4B7P A;  2HKJ A;  1UYH A;  1B63 A;  1I5A A;  2O1U A;  2BU7 A;  4WUC A;  1EI1 A;  1GKX A; 
#chains in the Genus database with same CATH topology
 2AKP A;  3EHG A;  3MNR P;  2YGF A;  5F3K A;  4ASA A;  2XDL A;  2Q8I A;  4MOT A;  3VHC A;  1ZXM A;  1BKN A;  4KSH A;  5IDM A;  2YE4 A;  3R4O A;  4PL9 A;  4YKY A;  4BIZ A;  4BQG A;  4FCR A;  1YC1 A;  3D36 A;  4EM7 A;  4E00 A;  4BQJ A;  1UYC A;  1I5B A;  2YKB A;  2Q8H A;  1KZN A;  3SL2 A;  4EGK A;  2Q8F A;  3H4L A;  4ASF A;  1EA6 A;  4H81 A;  1YSR A;  3K60 A;  3K98 A;  4U7O A;  2YE7 A;  3R4N A;  2VWC A;  3CRL A;  2CCS A;  4CE2 A;  3T1K A;  3G75 A;  4O0B A;  4AWP A;  1ZXN A;  4XIR A;  5J71 A;  5JEN A;  2IOP A;  3G7E A;  1Z5B A;  1UYE A;  2FWZ A;  4CWF A;  2JKI A;  3TZ4 A;  2XDK A;  1H7U A;  1UY8 A;  2WER A;  4BIU A;  4ZKI A;  2YEG A;  1QZR A;  1TH8 A;  2XAB A;  2FTK A;  1KIJ A;  2YGA A;  4Q20 A;  5FND A;  1UY6 A;  5CTW A;  2YEB A;  5CPH A;  2C2A A;  2XD6 A;  3CYG A;  2XDU A;  4P8O A;  5F5R A;  4MBC A;  2WI2 A;  4DZY A;  4KP4 A;  1OSF A;  1S14 A;  1UYK A;  1YET A;  3T0Z A;  1MU5 A;  1JM6 A;  1Y8O A;  2XHX A;  3KE6 A;  2IOR A;  3FT8 A;  4AWO A;  5D7D A;  1Y4S A;  3B24 A;  3B27 A;  4HYP A;  3HZ5 A;  4L8Z A;  4XE2 A;  1AJ6 A;  3U2K A;  1ID0 A;  4GCZ A;  4E02 A;  4EFU A;  4EMV A;  1TBW A;  2YEH A;  4R3A A;  4XCL A;  3S5T A;  4U93 A;  4QPJ A;  4XTJ A;  1B3Q A;  1NHI A;  2ZKJ A;  2BT0 A;  4FCQ A;  2YE3 A;  2WI4 A;  1A4H A;  2QG0 A;  4YKR A;  3TUH A;  3TZ0 A;  3ZXQ A;  1QY8 A;  4ZVI A;  1UY7 A;  2HG1 A;  3U67 A;  4LPB A;  1ZWH A;  1ZW9 A;  1I59 A;  4LP0 A;  4LWF A;  1AH8 A;  4JAS A;  2YE5 A;  4O04 A;  2XJJ A;  5D6P A;  4WUB A;  3CGZ A;  4LWI A;  4E72 A;  4KFG A;  1YSZ A;  2YKJ A;  2BSM A;  3TZ5 A;  3DGE A;  2Q2E B;  5CTX A;  2ESA A;  4KQV A;  5CTU A;  3R4P A;  3LNU A;  4FMT A;  3INW A;  2BRE A;  3OWD A;  4GQT A;  2WI7 A;  1U2O A;  2CCU A;  4L93 A;  1R62 A;  4HXZ A;  1IXM A;  5FWK A;  2YI0 A;  4URN A;  1F51 A;  2XHR A;  3O2F A;  3PEH A;  4ASG A;  4X9L A;  4MB9 A;  1Y8N A;  1UYL A;  5M4E A;  4YKU A;  2YI5 A;  4XD8 A;  5CTY A;  4AWQ A;  5J6A A;  5D7R A;  5IN9 A;  3K97 A;  3CGY A;  4GFN A;  4XDM A;  3GIG B;  3RKZ A;  3CRK A;  3Q5K A;  3T0H A;  2C1G A;  1UYD A;  1GKZ A;  2O1W A;  3IED A;  1AMW A;  3B25 A;  4B6C A;  4JAU A;  4JAV A;  4BAE A;  2GFD A;  3HYY A;  2CG9 A;  2XCM A;  3O0I A;  4L91 A;  1L0O A;  2XX2 A;  2VW5 A;  3JZ3 A;  4L90 A;  5M4P A;  1B62 A;  2XHT A;  2H55 A;  4BXI A;  3WHA A;  2XX4 A;  3OPD A;  5IDJ A;  4MPC A;  2ZDX A;  1U0Z A;  3R4M A;  5GGZ A;  4XKA A;  4I3H A;  3U2D A;  3G7B A;  2ZBK B;  3OWB A;  3A0Z A;  1YC4 A;  2BU5 A;  4PRV A;  3PEJ A;  3EKO A;  3INX A;  1UYI A;  4HY6 A;  1AM1 A;  3HZ1 A;  3EHJ A;  4V26 A;  1US7 A;  2GQP A;  1I5C A;  2IOQ A;  3B26 A;  5D6Q A;  3ZKB A;  3R92 A;  4LWE A;  5D7C A;  4V25 A;  2O1V A;  4CWT A;  1THN A;  4EEH A;  1TC0 A;  1UYF A;  2FXS A;  3VAD A;  3TZ2 A;  4O07 A;  2YK2 A;  4CWN A;  4GEE A;  4YKQ A;  4CWR A;  4XCJ A;  2VCI A;  4JQL A;  1Y4U A;  3A0X A;  3O6O A;  4R3M A;  4CWQ A;  4CWS A;  1YT0 A;  2CCT A;  4GT8 A;  3C11 A;  3FT5 A;  4URL A;  2BZ5 A;  1GJV A;  3A0R A;  4XKK A;  2JJC A;  4P7A A;  2XJG A;  2YI7 A;  2QF6 A;  3ZXO A;  4I5S A;  3A0W A;  4O05 A;  4E01 A;  4GGL A;  2WEQ A;  2XX5 A;  4H85 A;  4YKX A;  5CF0 A;  2ZDY A;  4W7T A;  3HEK A;  2YEI A;  3NMQ A;  1H7S A;  1I58 A;  4URM A;  4KSG A;  1UYG A;  1BYQ A;  2YKE A;  2YJX A;  2YI6 A;  5FNF A;  3ZM7 A;  1YC3 A;  2HHI A;  4WUD A;  3HYZ A;  1PVG A;  2WEP A;  2YK9 A;  4URO A;  5M4M A;  2FWY A;  3C0E A;  4LWG A;  5M4H A;  2YEE A;  2WI5 A;  4K4O A;  4R1F A;  4NH8 A;  4CE1 A;  4MPN A;  1TID A;  4HYM A;  3HHU A;  4U7N A;  2VCJ A;  3B28 A;  3TTZ A;  4EGH A;  4L94 A;  4XKO A;  3QDD A;  1TIL A;  5C93 A;  2Q8G A;  2K5B A;  3GIG A;  4O09 A;  4CWP A;  3OW6 A;  4CE3 A;  2YEC A;  1YT1 A;  2E0A A;  1Z59 A;  2YEF A;  4DUH A;  3QTF A;  4HZ5 A;  3LMM A;  3RLP A;  4MP2 A;  2YKI A;  5M4K A;  4MPE A;  2CGF A;  2YJW A;  2EXL A;  3BM9 A;  1YES A;  1YER A;  2UWD A;  1Y8P A;  3BMY A;  3T2S A;  2WI1 A;  3LPS A;  4XIP A;  4H7Q A;  3GIF A;  3D0B A;  2YEA A;  4ASB A;  3A0T A;  2IWX A;  2YGE A;  4NH9 A;  1AH6 A;  2CH4 A;  2BU2 A;  2BU8 A;  2YE9 A;  5M4N A;  4XIQ A;  3VHA A;  3RLR A;  2H8M A;  3RLQ A;  5FNC A;  2BYH A;  2XJX A;  1Z5C A;  3FV5 A;  4QPK A;  1BGQ A;  5BOD A;  2XK2 A;  1UYM A;  2C1I A;  1QYE A;  1BXD A;  3OMU A;  2HCH A;  3GIE A;  3EKR A;  2FYP A;  3A0Y A;  4YKZ A;  4EGI A;  2YEJ A;  5BOC A;  4LWH A;  1UY9 A;  1NHH A;  4KTN A;  4XC0 A;  1MX0 A;  3EHH A;  3H80 A;  5L3J A;  2QFO A;  3ZKD A;  2BU6 A;  4HXW A;  1YS3 A;  2XDS A;  2YE8 A;  3VHD A;  2WI6 A;  2BYI A;  2YE2 A;  3T10 A;  1I5D A;  2YKC A;  4PU9 A;  4HZ0 A;  4PRX A;  1S16 A;  2XDX A;  3R91 A;  1Z5A A;  2YE6 A;  3Q5J A;  4CWO A;  4AS9 A;  4YKT A;  4YKW A;  4FCP A;  3Q5L A;  4MP7 A;  3EHF A;  4NH7 A;  4XIT A;  2YED A;  4EFT A;  2IWU A;  1TC6 A;  2BRC A;  1YT2 A;  2PNR A;  3D2R A;  4HY1 A;  2IWS A;  3CWV A;  4FPP A;  2WI3 A;  2QG2 A;  3WQ9 A;  3K99 A;  2BTZ A;  1NHJ A;  4B7P A;  2HKJ A;  1UYH A;  1B63 A;  1I5A A;  2O1U A;  2BU7 A;  4WUC A;  1EI1 A;  1GKX A; 
#chains in the Genus database with same CATH homology
 2AKP A;  3EHG A;  3MNR P;  2YGF A;  5F3K A;  4ASA A;  2XDL A;  2Q8I A;  4MOT A;  3VHC A;  1ZXM A;  1BKN A;  4KSH A;  5IDM A;  2YE4 A;  3R4O A;  4PL9 A;  4YKY A;  4BIZ A;  4BQG A;  4FCR A;  1YC1 A;  3D36 A;  4EM7 A;  4E00 A;  4BQJ A;  1UYC A;  1I5B A;  2YKB A;  2Q8H A;  1KZN A;  3SL2 A;  4EGK A;  2Q8F A;  3H4L A;  4ASF A;  1EA6 A;  4H81 A;  1YSR A;  3K60 A;  3K98 A;  4U7O A;  2YE7 A;  3R4N A;  2VWC A;  3CRL A;  2CCS A;  4CE2 A;  3T1K A;  3G75 A;  4O0B A;  4AWP A;  1ZXN A;  4XIR A;  5J71 A;  2IOP A;  3G7E A;  1Z5B A;  1UYE A;  2FWZ A;  4CWF A;  2JKI A;  3TZ4 A;  2XDK A;  1H7U A;  1UY8 A;  2WER A;  4BIU A;  4ZKI A;  2YEG A;  1QZR A;  1TH8 A;  2XAB A;  1KIJ A;  2YGA A;  4Q20 A;  5FND A;  1UY6 A;  5CTW A;  2YEB A;  5CPH A;  2C2A A;  2XD6 A;  2XDU A;  4P8O A;  5F5R A;  4MBC A;  2WI2 A;  4DZY A;  4KP4 A;  1OSF A;  1S14 A;  1UYK A;  1YET A;  3T0Z A;  1MU5 A;  1JM6 A;  1Y8O A;  2XHX A;  3KE6 A;  2IOR A;  3FT8 A;  4AWO A;  5D7D A;  1Y4S A;  3B24 A;  3B27 A;  4HYP A;  3HZ5 A;  4L8Z A;  4XE2 A;  1AJ6 A;  3U2K A;  1ID0 A;  4GCZ A;  4E02 A;  4EFU A;  4EMV A;  1TBW A;  2YEH A;  4R3A A;  4XCL A;  4U93 A;  4QPJ A;  4XTJ A;  1B3Q A;  1NHI A;  2ZKJ A;  2BT0 A;  4FCQ A;  2YE3 A;  2WI4 A;  1A4H A;  2QG0 A;  4YKR A;  3TUH A;  3TZ0 A;  3ZXQ A;  1QY8 A;  4ZVI A;  1UY7 A;  2HG1 A;  3U67 A;  4LPB A;  1ZWH A;  1ZW9 A;  1I59 A;  4LP0 A;  4LWF A;  1AH8 A;  4JAS A;  2YE5 A;  4O04 A;  2XJJ A;  5D6P A;  4WUB A;  3CGZ A;  4LWI A;  4KFG A;  1YSZ A;  2YKJ A;  2BSM A;  3TZ5 A;  3DGE A;  2Q2E B;  5CTX A;  2ESA A;  4KQV A;  5CTU A;  3R4P A;  3LNU A;  4FMT A;  3INW A;  2BRE A;  3OWD A;  4GQT A;  2WI7 A;  1U2O A;  2CCU A;  4L93 A;  1R62 A;  4HXZ A;  5FWK A;  2YI0 A;  4URN A;  2XHR A;  3O2F A;  3PEH A;  4ASG A;  4X9L A;  4MB9 A;  1Y8N A;  1UYL A;  5M4E A;  4YKU A;  2YI5 A;  4XD8 A;  5CTY A;  4AWQ A;  5J6A A;  5D7R A;  5IN9 A;  3K97 A;  3CGY A;  4GFN A;  4XDM A;  3GIG B;  3RKZ A;  3CRK A;  3Q5K A;  3T0H A;  1UYD A;  1GKZ A;  2O1W A;  3IED A;  1AMW A;  3B25 A;  4B6C A;  4JAU A;  4JAV A;  4BAE A;  2GFD A;  3HYY A;  2CG9 A;  2XCM A;  3O0I A;  4L91 A;  1L0O A;  2XX2 A;  2VW5 A;  3JZ3 A;  4L90 A;  5M4P A;  1B62 A;  2XHT A;  2H55 A;  4BXI A;  3WHA A;  2XX4 A;  3OPD A;  5IDJ A;  4MPC A;  2ZDX A;  1U0Z A;  3R4M A;  5GGZ A;  4XKA A;  4I3H A;  3U2D A;  3G7B A;  2ZBK B;  3OWB A;  3A0Z A;  1YC4 A;  2BU5 A;  4PRV A;  3PEJ A;  3EKO A;  3INX A;  1UYI A;  4HY6 A;  1AM1 A;  3HZ1 A;  3EHJ A;  4V26 A;  1US7 A;  2GQP A;  1I5C A;  2IOQ A;  3B26 A;  5D6Q A;  3ZKB A;  3R92 A;  4LWE A;  5D7C A;  4V25 A;  2O1V A;  4CWT A;  1THN A;  4EEH A;  1TC0 A;  1UYF A;  2FXS A;  3VAD A;  3TZ2 A;  4O07 A;  2YK2 A;  4CWN A;  4GEE A;  4YKQ A;  4CWR A;  4XCJ A;  2VCI A;  1Y4U A;  3A0X A;  4JQL A;  3O6O A;  4R3M A;  4CWQ A;  4CWS A;  1YT0 A;  2CCT A;  4GT8 A;  3C11 A;  3FT5 A;  4URL A;  2BZ5 A;  1GJV A;  3A0R A;  4XKK A;  2JJC A;  4P7A A;  2XJG A;  2YI7 A;  2QF6 A;  3ZXO A;  4I5S A;  3A0W A;  4O05 A;  4E01 A;  4GGL A;  2WEQ A;  2XX5 A;  4H85 A;  4YKX A;  5CF0 A;  2ZDY A;  4W7T A;  3HEK A;  2YEI A;  3NMQ A;  1H7S A;  1I58 A;  4URM A;  4KSG A;  1UYG A;  1BYQ A;  2YKE A;  2YJX A;  2YI6 A;  5FNF A;  3ZM7 A;  1YC3 A;  4WUD A;  3HYZ A;  1PVG A;  2WEP A;  2YK9 A;  4URO A;  5M4M A;  2FWY A;  3C0E A;  4LWG A;  5M4H A;  2YEE A;  2WI5 A;  4K4O A;  4R1F A;  4NH8 A;  4CE1 A;  4MPN A;  1TID A;  4HYM A;  3HHU A;  4U7N A;  2VCJ A;  3B28 A;  3TTZ A;  4EGH A;  4L94 A;  4XKO A;  3QDD A;  1TIL A;  5C93 A;  2Q8G A;  2K5B A;  3GIG A;  4O09 A;  4CWP A;  3OW6 A;  4CE3 A;  2YEC A;  1YT1 A;  2E0A A;  1Z59 A;  2YEF A;  4DUH A;  3QTF A;  4HZ5 A;  3RLP A;  4MP2 A;  2YKI A;  5M4K A;  4MPE A;  2CGF A;  2YJW A;  2EXL A;  3BM9 A;  1YES A;  1YER A;  2UWD A;  1Y8P A;  3BMY A;  3T2S A;  2WI1 A;  3LPS A;  4XIP A;  4H7Q A;  3GIF A;  3D0B A;  2YEA A;  4ASB A;  3A0T A;  2IWX A;  2YGE A;  4NH9 A;  1AH6 A;  2CH4 A;  2BU2 A;  2BU8 A;  2YE9 A;  5M4N A;  4XIQ A;  3VHA A;  3RLR A;  2H8M A;  3RLQ A;  5FNC A;  2BYH A;  2XJX A;  1Z5C A;  3FV5 A;  4QPK A;  1BGQ A;  5BOD A;  2XK2 A;  1UYM A;  1QYE A;  1BXD A;  3OMU A;  2HCH A;  3GIE A;  3EKR A;  2FYP A;  3A0Y A;  4YKZ A;  4EGI A;  2YEJ A;  5BOC A;  4LWH A;  1UY9 A;  1NHH A;  4KTN A;  4XC0 A;  1MX0 A;  3EHH A;  3H80 A;  5L3J A;  2QFO A;  3ZKD A;  2BU6 A;  4HXW A;  1YS3 A;  2XDS A;  2YE8 A;  3VHD A;  2WI6 A;  2BYI A;  2YE2 A;  3T10 A;  1I5D A;  2YKC A;  4PU9 A;  4HZ0 A;  4PRX A;  1S16 A;  2XDX A;  3R91 A;  1Z5A A;  2YE6 A;  3Q5J A;  4CWO A;  4AS9 A;  4YKT A;  4YKW A;  4FCP A;  3Q5L A;  4MP7 A;  3EHF A;  4NH7 A;  4XIT A;  2YED A;  4EFT A;  2IWU A;  1TC6 A;  2BRC A;  1YT2 A;  2PNR A;  3D2R A;  4HY1 A;  2IWS A;  3CWV A;  4FPP A;  2WI3 A;  2QG2 A;  3WQ9 A;  3K99 A;  2BTZ A;  1NHJ A;  4B7P A;  2HKJ A;  1UYH A;  1B63 A;  1I5A A;  2O1U A;  2BU7 A;  4WUC A;  1EI1 A;  1GKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...