3GIGB

Crystal structure of phosphorylated deskc in complex with amp-pcp
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
205
structure length
204
Chain Sequence
LEDANERIAELVKLEERQRIARDLDTLGQKLSLIGLKSDLARKLIYKDPEQAARELKSVQQTARTSLNEVRKIVSSMKGIRLKDELINIKQILEAADIMFIYEEEKWPENISLLNENILSMCLKEAVTNVVKHSQAKTCRVDIQQLWKEVVITVSDDGTFKGEENSFSKGHGLLGMRERLEFANGSLHIDTENGTKLTMAIPNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor histidine kinase desK
publication title Structural plasticity and catalysis regulation of a thermosensor histidine kinase
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 64
structure length 204
sequence length 205
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2009-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07730 HisKA_3 Histidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3gigB02
4QPKA 1B63A 3KE6A 1TBWA 5L3JA 3T2SA 3G7BA 2YI6A 1UYLA 1UYFA 2WI1A 4XTJA 4XKKA 5F3KA 1UYMA 2CGFA 2XDXA 1JM6A 2ZKJA 3HZ5A 4KSHA 2XX2A 1B62A 4MB9A 3EKRA 1YERA 1ZWHA 4YKWA 3U67A 3ZKBA 3FT5A 4CWPA 1UYKA 4I3HA 1YT2A 2YKBA 1YC3A 4YKTA 1EI1A 3VADA 1Y8OA 4L8ZA 4PRXA 1Z59A 4FCRA 1UY7A 4E02A 4AWPA 4XC0A 3K99A 4YKZA 1YT1A 1ZXNA 4JAUA 5GGZA 3TZ5A 3O2FA 4CWQA 2K5BA 4GEEA 3H4LA 4WUCA 4CE1A 4ZKIA 2O1UA 4HZ5A 4XD8A 3OWBA 4L91A 5CPHA 2BU7A 4MP7A 4W7TA 3T10A 4CWOA 2XDSA 2YGEA 3OWDA 4NH9A 3IEDA 4FPPA 3A0RA 1S14A 3WHAA 4PRVA 1YC4A 2VCJA 2BSMA 2BU2A 1QYEA 2GQPA 1AM1A 3D36A 4FCQA 5IN9A 1Z5CA 1KIJA 1H7SA 2PNRA 1EA6A 4HZ0A 1A4HA 1KZNA 2H8MA 4CWRA 4HYMA 2WERA 5FNDA 2YE8A 1YSRA 3H80A 3CGYA 2BT0A 3QTFA 4EFTA 1BKNA 3U2KA 1MX0A 1R62A 4UROA 4EGHA 4CWFA 4MP2A 3NMQA 3JZ3A 4MPEA 1ID0A 4LWHA 1UY9A 5CTXA 3R4NA 1Z5BA 1U0ZA 4ASGA 3EHFA 4ZVIA 2YI0A 2QF6A 4KQVA 2XHTA 2IOPA 2XDKA 3HEKA 4CWTA 1BXDA 4LPBA 4Q20A 2YI5A 3LNUA 4YKUA 3D0BA 3GIFA 3VHAA 3A0TA 3O6OA 5FWKA 2YE5A 4H7QA 1Y4UA 2XJGA 1AH8A 2IOQA 3OW6A 4HXWA 4BXIA 2BU8A 3QDDA 1YSZA 4XDMA 3LPSA 1AMWA 3WQ9A 2WEQA 5M4KA 3K97A 2FYPA 2HCHA 4HYPA 1UY8A 2CCUA 3A0YA 2YKCA 3K60A 3TUHA 4FCPA 1Y4SA 4AWOA 4X9LA 1NHHA 4CWSA 5D7DA 3OMUA 3BM9A 3U2DA 5M4NA 4AWQA 2IWXA 2WI6A 1I59A 1GJVA 4JAVA 3T0ZA 5D6QA 4URNA 4GQTA 3GIGA 2WI5A 2YGAA 2QFOA 2YE4A 1UYEA 2YK9A 4NH8A 2YEDA 1H7UA 2BREA 5FNCA 4KP4A 1OSFA 1QZRA 2BTZA 3ZXOA 1GKZA 4GT8A 2BRCA 2CG9A 2YEGA 3BMYA 2QG2A 3GIEA 4BQJA 2WI3A 5FNFA 4E01A 3TZ0A 3B24A 3HHUA 2XK2A 1Y8NA 3TTZA 4FMTA 3D2RA 1UYHA 4V26A 3R92A 4GGLA 3PEJA 2BYHA 4XIPA 4EM7A 3CWVA 2CCTA 5F5RA 4YKQA 3ZXQA 2YJXA 3A0ZA 2YEIA 1MU5A 4CE2A 2EXLA 2YEBA 4YKYA 2XJXA 4XIRA 4EGKA 4LP0A 4URMA 1I5AA 4XKAA 2JJCA 4LWFA 2VCIA 2YE2A 3FV5A 3FT8A 5J6AA 2VW5A 4NH7A 2XCMA 1TILA 1UYIA 2YEJA 3RKZA 5M4HA 2QG0A 2ZDXA 1I5BA 4GFNA 5D6PA 4XCJA 4GCZA 2Q8FA 4XITA 4EMVA 4JASA 3EHGA 2AKPA 1BGQA 4ASAA 3B26A 4HXZA 2ESAA 4MPNA 4U7NA 4B6CA 2WEPA 4BQGA 1YC1A 1S16A 2IWSA 4DUHA 5CTWA 3SL2A 3R4OA 2YEHA 4YKXA 2BYIA 4BAEA 1TC0A 4WUBA 4YKRA 1Z5AA 5C93A 2E0AA 2Q8HA 2XX4A 2Q8GA 3K98A 2ZBKB 2XDUA 3MNRP 1YT0A 2CCSA 4KSGA 4LWEA 2GFDA 5BODA 4I5SA 2YECA 2BU5A 4H81A 3R91A 4E00A 3TZ4A 3ZKDA 1AH6A 2C2AA 2WI7A 5M4PA 3VHCA 3RLRA 4ASBA 1TIDA 4XE2A 3G75A 4MOTA 2O1VA 3A0WA 1UYCA 2IORA 4BIZA 2HKJA 2YE3A 1I5CA 3HYYA 2ZDYA 4URLA 3T0HA 4B7PA 2BZ5A 3B27A 1L0OA 4XKOA 2YE6A 4O07A 3B25A 2YK2A 3C11A 4R3MA 2XX5A 4JQLA 4P7AA 3CRKA 1TH8A 2XHXA 4MPCA 2YKJA 1Y8PA 4DZYA 3DGEA 1ZXMA 2YE9A 1I58A 1I5DA 3O0IA 4LWIA 4XCLA 3OPDA 2JKIA 2XDLA 4CWNA 1AJ6A 4EGIA 4R3AA 4PU9A 5D7CA 3C0EA 1GKXA 2XJJA 3B28A 3INXA 3RLQA 1U2OA 1YESA 3EKOA 1UYDA 2YJWA 4L90A 4LWGA 1NHJA 2YEAA 3G7EA 2HG1A 3TZ2A 4KTNA 3Q5LA 4R1FA 2BU6A 2UWDA 1QY8A 4O04A 3ZM7A 4L93A 5D7RA 1UY6A 1BYQA 3RLPA 1ZW9A 3EHJA 1YS3A 5IDJA 2H55A 2WI4A 5M4EA 5CTUA 2YKEA 2YGFA 2VWCA 2XD6A 4U7OA 4EEHA 4EFUA 5M4MA 3VHDA 2XHRA 2YI7A 2CH4A 4U93A 4BIUA 3HZ1A 2YKIA 3PEHA 1NHIA 4O09A 1US7A 2O1WA 4HY6A 3R4MA 4K4OA 1TC6A 1YETA 4P8OA 5CF0A 3GIGB 4WUDA 3Q5KA 4AS9A 3HYZA 3CGZA 2YEFA 2FWZA 5BOCA 1PVGA 3T1KA 4CE3A 4QPJA 3INWA 2IWUA 3Q5JA 2YE7A 1B3QA 4O05A 2Q8IA 4KFGA 4PL9A 4ASFA 2WI2A 4L94A 3R4PA 2FWYA 1UYGA 2FXSA 4HY1A 4XIQA 4H85A 2Q2EB 5IDMA 5J71A 4V25A 5CTYA 2XABA 3CRLA 3A0XA 2YEEA 1THNA 3EHHA 4MBCA 4O0BA
chains in the Genus database with same CATH superfamily
4QPKA 1B63A 3S5TA 3KE6A 1TBWA 5L3JA 3T2SA 3G7BA 2YI6A 1UYLA 4E72A 1UYFA 2WI1A 4XTJA 4XKKA 5F3KA 1UYMA 2CGFA 2XDXA 1JM6A 2ZKJA 3HZ5A 4KSHA 2XX2A 3CYGA 1B62A 4MB9A 3EKRA 1YERA 1ZWHA 4YKWA 3U67A 3ZKBA 3FT5A 4CWPA 1UYKA 4I3HA 1YT2A 2YKBA 1YC3A 4YKTA 1EI1A 3VADA 1Y8OA 4L8ZA 4PRXA 1Z59A 4FCRA 1UY7A 4E02A 4AWPA 4XC0A 3K99A 4YKZA 1YT1A 1ZXNA 4JAUA 5GGZA 3TZ5A 3O2FA 4CWQA 2K5BA 4GEEA 3H4LA 4WUCA 4CE1A 4ZKIA 2O1UA 4HZ5A 4XD8A 3OWBA 4L91A 5CPHA 2BU7A 4MP7A 4W7TA 3T10A 4CWOA 2XDSA 2YGEA 3OWDA 4NH9A 3IEDA 4FPPA 3A0RA 1S14A 3WHAA 4PRVA 1YC4A 2VCJA 2BSMA 2BU2A 1QYEA 2GQPA 1AM1A 3D36A 4FCQA 5IN9A 1Z5CA 1KIJA 1H7SA 2PNRA 1EA6A 4HZ0A 1A4HA 1KZNA 2H8MA 4CWRA 4HYMA 2WERA 5FNDA 2YE8A 1YSRA 3H80A 3CGYA 2BT0A 3QTFA 4EFTA 1BKNA 3U2KA 1MX0A 1R62A 4UROA 4EGHA 4CWFA 4MP2A 3NMQA 3JZ3A 4MPEA 1ID0A 4LWHA 1UY9A 5CTXA 3R4NA 1Z5BA 1U0ZA 4ASGA 3EHFA 4ZVIA 2YI0A 2QF6A 4KQVA 2XHTA 2IOPA 2XDKA 3HEKA 4CWTA 1BXDA 4LPBA 4Q20A 2YI5A 3LNUA 4YKUA 3D0BA 3GIFA 3VHAA 3A0TA 3O6OA 5FWKA 2YE5A 4H7QA 1Y4UA 2XJGA 1AH8A 2IOQA 3OW6A 4HXWA 4BXIA 2BU8A 2FTKA 3QDDA 1YSZA 4XDMA 3LPSA 1AMWA 3WQ9A 2WEQA 5M4KA 3K97A 2FYPA 2HCHA 4HYPA 1UY8A 2CCUA 3A0YA 2YKCA 3K60A 3TUHA 4FCPA 1Y4SA 4AWOA 4X9LA 1NHHA 4CWSA 3LMMA 5D7DA 3OMUA 3BM9A 3U2DA 5M4NA 4AWQA 2IWXA 2WI6A 1I59A 1GJVA 4JAVA 3T0ZA 5D6QA 4URNA 4GQTA 3GIGA 2WI5A 2YGAA 2QFOA 2YE4A 1UYEA 2YK9A 4NH8A 2YEDA 1H7UA 2BREA 5FNCA 4KP4A 1OSFA 1QZRA 2BTZA 3ZXOA 1GKZA 4GT8A 2BRCA 2CG9A 2YEGA 3BMYA 2QG2A 3GIEA 4BQJA 2HHIA 2WI3A 5FNFA 4E01A 3TZ0A 3B24A 3HHUA 2XK2A 1Y8NA 3TTZA 4FMTA 3D2RA 1UYHA 4V26A 3R92A 4GGLA 3PEJA 2BYHA 4XIPA 4EM7A 3CWVA 2CCTA 5F5RA 4YKQA 3ZXQA 2YJXA 3A0ZA 2YEIA 1MU5A 4CE2A 2EXLA 2YEBA 4YKYA 2XJXA 4XIRA 4EGKA 4LP0A 4URMA 1I5AA 4XKAA 2JJCA 4LWFA 2VCIA 2YE2A 3FV5A 3FT8A 5J6AA 2VW5A 4NH7A 2XCMA 1TILA 1UYIA 2YEJA 3RKZA 5M4HA 2QG0A 2ZDXA 1I5BA 4GFNA 5D6PA 4XCJA 4GCZA 2Q8FA 4XITA 4EMVA 4JASA 3EHGA 2AKPA 1BGQA 5JENA 4ASAA 3B26A 4HXZA 2ESAA 4MPNA 4U7NA 4B6CA 2WEPA 4BQGA 1YC1A 1S16A 2IWSA 4DUHA 5CTWA 3SL2A 3R4OA 2YEHA 4YKXA 2BYIA 1IXMA 4BAEA 1TC0A 4WUBA 4YKRA 1Z5AA 5C93A 2E0AA 2Q8HA 2XX4A 2Q8GA 3K98A 2ZBKB 2XDUA 3MNRP 1YT0A 2CCSA 4KSGA 4LWEA 2GFDA 5BODA 4I5SA 2YECA 2BU5A 4H81A 3R91A 4E00A 3TZ4A 3ZKDA 1AH6A 2C2AA 2WI7A 5M4PA 3VHCA 1F51A 3RLRA 4ASBA 1TIDA 4XE2A 3G75A 4MOTA 2O1VA 3A0WA 1UYCA 2IORA 4BIZA 2HKJA 2YE3A 1I5CA 3HYYA 2ZDYA 4URLA 3T0HA 4B7PA 2BZ5A 3B27A 1L0OA 4XKOA 2YE6A 4O07A 3B25A 2YK2A 3C11A 4R3MA 2XX5A 4JQLA 4P7AA 3CRKA 1TH8A 2XHXA 4MPCA 2YKJA 1Y8PA 4DZYA 3DGEA 1ZXMA 2YE9A 1I58A 1I5DA 3O0IA 4LWIA 4XCLA 3OPDA 2JKIA 2XDLA 4CWNA 1AJ6A 4EGIA 4R3AA 4PU9A 5D7CA 3C0EA 1GKXA 2XJJA 3B28A 3INXA 3RLQA 1U2OA 1YESA 3EKOA 1UYDA 2YJWA 4L90A 4LWGA 1NHJA 2YEAA 3G7EA 2HG1A 3TZ2A 4KTNA 3Q5LA 4R1FA 2BU6A 2UWDA 1QY8A 4O04A 3ZM7A 4L93A 5D7RA 1UY6A 1BYQA 3RLPA 1ZW9A 3EHJA 1YS3A 5IDJA 2H55A 2WI4A 5M4EA 5CTUA 2YKEA 2YGFA 2VWCA 2XD6A 2C1GA 4U7OA 4EEHA 4EFUA 5M4MA 3VHDA 2XHRA 2YI7A 2CH4A 4U93A 4BIUA 3HZ1A 2YKIA 3PEHA 1NHIA 4O09A 2C1IA 1US7A 2O1WA 4HY6A 3R4MA 4K4OA 1TC6A 1YETA 4P8OA 5CF0A 3GIGB 4WUDA 3Q5KA 4AS9A 3HYZA 3CGZA 2YEFA 2FWZA 5BOCA 1PVGA 3T1KA 4CE3A 4QPJA 3INWA 2IWUA 3Q5JA 2YE7A 1B3QA 4O05A 2Q8IA 4KFGA 4PL9A 4ASFA 2WI2A 4L94A 3R4PA 2FWYA 1UYGA 2FXSA 4HY1A 4XIQA 4H85A 2Q2EB 5IDMA 5J71A 4V25A 5CTYA 2XABA 3CRLA 3A0XA 2YEEA 1THNA 3EHHA 4MBCA 4O0BA
chains in the Genus database with same CATH topology
4QPKA 1B63A 3KE6A 1TBWA 5L3JA 3T2SA 3G7BA 2YI6A 1UYLA 1UYFA 2WI1A 4XTJA 4XKKA 5F3KA 1UYMA 2CGFA 2XDXA 1JM6A 2ZKJA 3HZ5A 4KSHA 2XX2A 1B62A 4MB9A 3EKRA 1YERA 1ZWHA 4YKWA 3U67A 3ZKBA 3FT5A 4CWPA 1UYKA 4I3HA 1YT2A 2YKBA 1YC3A 4YKTA 1EI1A 3VADA 1Y8OA 4L8ZA 4PRXA 1Z59A 4FCRA 1UY7A 4E02A 4AWPA 4XC0A 3K99A 4YKZA 1YT1A 1ZXNA 4JAUA 5GGZA 3TZ5A 3O2FA 4CWQA 2K5BA 4GEEA 3H4LA 4WUCA 4CE1A 4ZKIA 2O1UA 4HZ5A 4XD8A 3OWBA 4L91A 5CPHA 2BU7A 4MP7A 4W7TA 3T10A 4CWOA 2XDSA 2YGEA 3OWDA 4NH9A 3IEDA 4FPPA 3A0RA 1S14A 3WHAA 4PRVA 1YC4A 2VCJA 2BSMA 2BU2A 1QYEA 2GQPA 1AM1A 3D36A 4FCQA 5IN9A 1Z5CA 1KIJA 1H7SA 2PNRA 1EA6A 4HZ0A 1A4HA 1KZNA 2H8MA 4CWRA 4HYMA 2WERA 5FNDA 2YE8A 1YSRA 3H80A 3CGYA 2BT0A 3QTFA 4EFTA 1BKNA 3U2KA 1MX0A 1R62A 4UROA 4EGHA 4CWFA 4MP2A 3NMQA 3JZ3A 4MPEA 1ID0A 4LWHA 1UY9A 5CTXA 3R4NA 1Z5BA 1U0ZA 4ASGA 3EHFA 4ZVIA 2YI0A 2QF6A 4KQVA 2XHTA 2IOPA 2XDKA 3HEKA 4CWTA 1BXDA 4LPBA 4Q20A 2YI5A 3LNUA 4YKUA 3D0BA 3GIFA 3VHAA 3A0TA 3O6OA 5FWKA 2YE5A 4H7QA 1Y4UA 2XJGA 1AH8A 2IOQA 3OW6A 4HXWA 4BXIA 2BU8A 3QDDA 1YSZA 4XDMA 3LPSA 1AMWA 3WQ9A 2WEQA 5M4KA 3K97A 2FYPA 2HCHA 4HYPA 1UY8A 2CCUA 3A0YA 2YKCA 3K60A 3TUHA 4FCPA 1Y4SA 4AWOA 4X9LA 1NHHA 4CWSA 5D7DA 3OMUA 3BM9A 3U2DA 5M4NA 4AWQA 2IWXA 2WI6A 1I59A 1GJVA 4JAVA 3T0ZA 5D6QA 4URNA 4GQTA 3GIGA 2WI5A 2YGAA 2QFOA 2YE4A 1UYEA 2YK9A 4NH8A 2YEDA 1H7UA 2BREA 5FNCA 4KP4A 1OSFA 1QZRA 2BTZA 3ZXOA 1GKZA 4GT8A 2BRCA 2CG9A 2YEGA 3BMYA 2QG2A 3GIEA 4BQJA 2WI3A 5FNFA 4E01A 3TZ0A 3B24A 3HHUA 2XK2A 1Y8NA 3TTZA 4FMTA 3D2RA 1UYHA 4V26A 3R92A 4GGLA 3PEJA 2BYHA 4XIPA 4EM7A 3CWVA 2CCTA 5F5RA 4YKQA 3ZXQA 2YJXA 3A0ZA 2YEIA 1MU5A 4CE2A 2EXLA 2YEBA 4YKYA 2XJXA 4XIRA 4EGKA 4LP0A 4URMA 1I5AA 4XKAA 2JJCA 4LWFA 2VCIA 2YE2A 3FV5A 3FT8A 5J6AA 2VW5A 4NH7A 2XCMA 1TILA 1UYIA 2YEJA 3RKZA 5M4HA 2QG0A 2ZDXA 1I5BA 4GFNA 5D6PA 4XCJA 4GCZA 2Q8FA 4XITA 4EMVA 4JASA 3EHGA 2AKPA 1BGQA 4ASAA 3B26A 4HXZA 2ESAA 4MPNA 4U7NA 4B6CA 2WEPA 4BQGA 1YC1A 1S16A 2IWSA 4DUHA 5CTWA 3SL2A 3R4OA 2YEHA 4YKXA 2BYIA 4BAEA 1TC0A 4WUBA 4YKRA 1Z5AA 5C93A 2E0AA 2Q8HA 2XX4A 2Q8GA 3K98A 2ZBKB 2XDUA 3MNRP 1YT0A 2CCSA 4KSGA 4LWEA 2GFDA 5BODA 4I5SA 2YECA 2BU5A 4H81A 3R91A 4E00A 3TZ4A 3ZKDA 1AH6A 2C2AA 2WI7A 5M4PA 3VHCA 3RLRA 4ASBA 1TIDA 4XE2A 3G75A 4MOTA 2O1VA 3A0WA 1UYCA 2IORA 4BIZA 2HKJA 2YE3A 1I5CA 3HYYA 2ZDYA 4URLA 3T0HA 4B7PA 2BZ5A 3B27A 1L0OA 4XKOA 2YE6A 4O07A 3B25A 2YK2A 3C11A 4R3MA 2XX5A 4JQLA 4P7AA 3CRKA 1TH8A 2XHXA 4MPCA 2YKJA 1Y8PA 4DZYA 3DGEA 1ZXMA 2YE9A 1I58A 1I5DA 3O0IA 4LWIA 4XCLA 3OPDA 2JKIA 2XDLA 4CWNA 1AJ6A 4EGIA 4R3AA 4PU9A 5D7CA 3C0EA 1GKXA 2XJJA 3B28A 3INXA 3RLQA 1U2OA 1YESA 3EKOA 1UYDA 2YJWA 4L90A 4LWGA 1NHJA 2YEAA 3G7EA 2HG1A 3TZ2A 4KTNA 3Q5LA 4R1FA 2BU6A 2UWDA 1QY8A 4O04A 3ZM7A 4L93A 5D7RA 1UY6A 1BYQA 3RLPA 1ZW9A 3EHJA 1YS3A 5IDJA 2H55A 2WI4A 5M4EA 5CTUA 2YKEA 2YGFA 2VWCA 2XD6A 4U7OA 4EEHA 4EFUA 5M4MA 3VHDA 2XHRA 2YI7A 2CH4A 4U93A 4BIUA 3HZ1A 2YKIA 3PEHA 1NHIA 4O09A 1US7A 2O1WA 4HY6A 3R4MA 4K4OA 1TC6A 1YETA 4P8OA 5CF0A 3GIGB 4WUDA 3Q5KA 4AS9A 3HYZA 3CGZA 2YEFA 2FWZA 5BOCA 1PVGA 3T1KA 4CE3A 4QPJA 3INWA 2IWUA 3Q5JA 2YE7A 1B3QA 4O05A 2Q8IA 4KFGA 4PL9A 4ASFA 2WI2A 4L94A 3R4PA 2FWYA 1UYGA 2FXSA 4HY1A 4XIQA 4H85A 2Q2EB 5IDMA 5J71A 4V25A 5CTYA 2XABA 3CRLA 3A0XA 2YEEA 1THNA 3EHHA 4MBCA 4O0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QPK A;  1B63 A;  3KE6 A;  1TBW A;  5L3J A;  3T2S A;  3G7B A;  2YI6 A;  1UYL A;  1UYF A;  2WI1 A;  4XTJ A;  4XKK A;  5F3K A;  1UYM A;  2CGF A;  2XDX A;  1JM6 A;  2ZKJ A;  3HZ5 A;  4KSH A;  2XX2 A;  1B62 A;  4MB9 A;  3EKR A;  1YER A;  1ZWH A;  4YKW A;  3U67 A;  3ZKB A;  3FT5 A;  4CWP A;  1UYK A;  4I3H A;  1YT2 A;  2YKB A;  1YC3 A;  4YKT A;  1EI1 A;  3VAD A;  1Y8O A;  4L8Z A;  4PRX A;  1Z59 A;  4FCR A;  1UY7 A;  4E02 A;  4AWP A;  4XC0 A;  3K99 A;  4YKZ A;  1YT1 A;  1ZXN A;  4JAU A;  5GGZ A;  3TZ5 A;  3O2F A;  4CWQ A;  2K5B A;  4GEE A;  3H4L A;  4WUC A;  4CE1 A;  4ZKI A;  2O1U A;  4HZ5 A;  4XD8 A;  3OWB A;  4L91 A;  5CPH A;  2BU7 A;  4MP7 A;  4W7T A;  3T10 A;  4CWO A;  2XDS A;  2YGE A;  3OWD A;  4NH9 A;  3IED A;  4FPP A;  3A0R A;  1S14 A;  3WHA A;  4PRV A;  1YC4 A;  2VCJ A;  2BSM A;  2BU2 A;  1QYE A;  2GQP A;  1AM1 A;  3D36 A;  4FCQ A;  5IN9 A;  1Z5C A;  1KIJ A;  1H7S A;  2PNR A;  1EA6 A;  4HZ0 A;  1A4H A;  1KZN A;  2H8M A;  4CWR A;  4HYM A;  2WER A;  5FND A;  2YE8 A;  1YSR A;  3H80 A;  3CGY A;  2BT0 A;  3QTF A;  4EFT A;  1BKN A;  3U2K A;  1MX0 A;  1R62 A;  4URO A;  4EGH A;  4CWF A;  4MP2 A;  3NMQ A;  3JZ3 A;  4MPE A;  1ID0 A;  4LWH A;  1UY9 A;  5CTX A;  3R4N A;  1Z5B A;  1U0Z A;  4ASG A;  3EHF A;  4ZVI A;  2YI0 A;  2QF6 A;  4KQV A;  2XHT A;  2IOP A;  2XDK A;  3HEK A;  4CWT A;  1BXD A;  4LPB A;  4Q20 A;  2YI5 A;  3LNU A;  4YKU A;  3D0B A;  3GIF A;  3VHA A;  3A0T A;  3O6O A;  5FWK A;  2YE5 A;  4H7Q A;  1Y4U A;  2XJG A;  1AH8 A;  2IOQ A;  3OW6 A;  4HXW A;  4BXI A;  2BU8 A;  3QDD A;  1YSZ A;  4XDM A;  3LPS A;  1AMW A;  3WQ9 A;  2WEQ A;  5M4K A;  3K97 A;  2FYP A;  2HCH A;  4HYP A;  1UY8 A;  2CCU A;  3A0Y A;  2YKC A;  3K60 A;  3TUH A;  4FCP A;  1Y4S A;  4AWO A;  4X9L A;  1NHH A;  4CWS A;  5D7D A;  3OMU A;  3BM9 A;  3U2D A;  5M4N A;  4AWQ A;  2IWX A;  2WI6 A;  1I59 A;  1GJV A;  4JAV A;  3T0Z A;  5D6Q A;  4URN A;  4GQT A;  3GIG A;  2WI5 A;  2YGA A;  2QFO A;  2YE4 A;  1UYE A;  2YK9 A;  4NH8 A;  2YED A;  1H7U A;  2BRE A;  5FNC A;  4KP4 A;  1OSF A;  1QZR A;  2BTZ A;  3ZXO A;  1GKZ A;  4GT8 A;  2BRC A;  2CG9 A;  2YEG A;  3BMY A;  2QG2 A;  3GIE A;  4BQJ A;  2WI3 A;  5FNF A;  4E01 A;  3TZ0 A;  3B24 A;  3HHU A;  2XK2 A;  1Y8N A;  3TTZ A;  4FMT A;  3D2R A;  1UYH A;  4V26 A;  3R92 A;  4GGL A;  3PEJ A;  2BYH A;  4XIP A;  4EM7 A;  3CWV A;  2CCT A;  5F5R A;  4YKQ A;  3ZXQ A;  2YJX A;  3A0Z A;  2YEI A;  1MU5 A;  4CE2 A;  2EXL A;  2YEB A;  4YKY A;  2XJX A;  4XIR A;  4EGK A;  4LP0 A;  4URM A;  1I5A A;  4XKA A;  2JJC A;  4LWF A;  2VCI A;  2YE2 A;  3FV5 A;  3FT8 A;  5J6A A;  2VW5 A;  4NH7 A;  2XCM A;  1TIL A;  1UYI A;  2YEJ A;  3RKZ A;  5M4H A;  2QG0 A;  2ZDX A;  1I5B A;  4GFN A;  5D6P A;  4XCJ A;  4GCZ A;  2Q8F A;  4XIT A;  4EMV A;  4JAS A;  3EHG A;  2AKP A;  1BGQ A;  4ASA A;  3B26 A;  4HXZ A;  2ESA A;  4MPN A;  4U7N A;  4B6C A;  2WEP A;  4BQG A;  1YC1 A;  1S16 A;  2IWS A;  4DUH A;  5CTW A;  3SL2 A;  3R4O A;  2YEH A;  4YKX A;  2BYI A;  4BAE A;  1TC0 A;  4WUB A;  4YKR A;  1Z5A A;  5C93 A;  2E0A A;  2Q8H A;  2XX4 A;  2Q8G A;  3K98 A;  2ZBK B;  2XDU A;  3MNR P;  1YT0 A;  2CCS A;  4KSG A;  4LWE A;  2GFD A;  5BOD A;  4I5S A;  2YEC A;  2BU5 A;  4H81 A;  3R91 A;  4E00 A;  3TZ4 A;  3ZKD A;  1AH6 A;  2C2A A;  2WI7 A;  5M4P A;  3VHC A;  3RLR A;  4ASB A;  1TID A;  4XE2 A;  3G75 A;  4MOT A;  2O1V A;  3A0W A;  1UYC A;  2IOR A;  4BIZ A;  2HKJ A;  2YE3 A;  1I5C A;  3HYY A;  2ZDY A;  4URL A;  3T0H A;  4B7P A;  2BZ5 A;  3B27 A;  1L0O A;  4XKO A;  2YE6 A;  4O07 A;  3B25 A;  2YK2 A;  3C11 A;  4R3M A;  2XX5 A;  4JQL A;  4P7A A;  3CRK A;  1TH8 A;  2XHX A;  4MPC A;  2YKJ A;  1Y8P A;  4DZY A;  3DGE A;  1ZXM A;  2YE9 A;  1I58 A;  1I5D A;  3O0I A;  4LWI A;  4XCL A;  3OPD A;  2JKI A;  2XDL A;  4CWN A;  1AJ6 A;  4EGI A;  4R3A A;  4PU9 A;  5D7C A;  3C0E A;  1GKX A;  2XJJ A;  3B28 A;  3INX A;  3RLQ A;  1U2O A;  1YES A;  3EKO A;  1UYD A;  2YJW A;  4L90 A;  4LWG A;  1NHJ A;  2YEA A;  3G7E A;  2HG1 A;  3TZ2 A;  4KTN A;  3Q5L A;  4R1F A;  2BU6 A;  2UWD A;  1QY8 A;  4O04 A;  3ZM7 A;  4L93 A;  5D7R A;  1UY6 A;  1BYQ A;  3RLP A;  1ZW9 A;  3EHJ A;  1YS3 A;  5IDJ A;  2H55 A;  2WI4 A;  5M4E A;  5CTU A;  2YKE A;  2YGF A;  2VWC A;  2XD6 A;  4U7O A;  4EEH A;  4EFU A;  5M4M A;  3VHD A;  2XHR A;  2YI7 A;  2CH4 A;  4U93 A;  4BIU A;  3HZ1 A;  2YKI A;  3PEH A;  1NHI A;  4O09 A;  1US7 A;  2O1W A;  4HY6 A;  3R4M A;  4K4O A;  1TC6 A;  1YET A;  4P8O A;  5CF0 A;  3GIG B;  4WUD A;  3Q5K A;  4AS9 A;  3HYZ A;  3CGZ A;  2YEF A;  2FWZ A;  5BOC A;  1PVG A;  3T1K A;  4CE3 A;  4QPJ A;  3INW A;  2IWU A;  3Q5J A;  2YE7 A;  1B3Q A;  4O05 A;  2Q8I A;  4KFG A;  4PL9 A;  4ASF A;  2WI2 A;  4L94 A;  3R4P A;  2FWY A;  1UYG A;  2FXS A;  4HY1 A;  4XIQ A;  4H85 A;  2Q2E B;  5IDM A;  5J71 A;  4V25 A;  5CTY A;  2XAB A;  3CRL A;  3A0X A;  2YEE A;  1THN A;  3EHH A;  4MBC A;  4O0B A; 
#chains in the Genus database with same CATH topology
 4QPK A;  1B63 A;  3S5T A;  3KE6 A;  1TBW A;  5L3J A;  3T2S A;  3G7B A;  2YI6 A;  1UYL A;  4E72 A;  1UYF A;  2WI1 A;  4XTJ A;  4XKK A;  5F3K A;  1UYM A;  2CGF A;  2XDX A;  1JM6 A;  2ZKJ A;  3HZ5 A;  4KSH A;  2XX2 A;  3CYG A;  1B62 A;  4MB9 A;  3EKR A;  1YER A;  1ZWH A;  4YKW A;  3U67 A;  3ZKB A;  3FT5 A;  4CWP A;  1UYK A;  4I3H A;  1YT2 A;  2YKB A;  1YC3 A;  4YKT A;  1EI1 A;  3VAD A;  1Y8O A;  4L8Z A;  4PRX A;  1Z59 A;  4FCR A;  1UY7 A;  4E02 A;  4AWP A;  4XC0 A;  3K99 A;  4YKZ A;  1YT1 A;  1ZXN A;  4JAU A;  5GGZ A;  3TZ5 A;  3O2F A;  4CWQ A;  2K5B A;  4GEE A;  3H4L A;  4WUC A;  4CE1 A;  4ZKI A;  2O1U A;  4HZ5 A;  4XD8 A;  3OWB A;  4L91 A;  5CPH A;  2BU7 A;  4MP7 A;  4W7T A;  3T10 A;  4CWO A;  2XDS A;  2YGE A;  3OWD A;  4NH9 A;  3IED A;  4FPP A;  3A0R A;  1S14 A;  3WHA A;  4PRV A;  1YC4 A;  2VCJ A;  2BSM A;  2BU2 A;  1QYE A;  2GQP A;  1AM1 A;  3D36 A;  4FCQ A;  5IN9 A;  1Z5C A;  1KIJ A;  1H7S A;  2PNR A;  1EA6 A;  4HZ0 A;  1A4H A;  1KZN A;  2H8M A;  4CWR A;  4HYM A;  2WER A;  5FND A;  2YE8 A;  1YSR A;  3H80 A;  3CGY A;  2BT0 A;  3QTF A;  4EFT A;  1BKN A;  3U2K A;  1MX0 A;  1R62 A;  4URO A;  4EGH A;  4CWF A;  4MP2 A;  3NMQ A;  3JZ3 A;  4MPE A;  1ID0 A;  4LWH A;  1UY9 A;  5CTX A;  3R4N A;  1Z5B A;  1U0Z A;  4ASG A;  3EHF A;  4ZVI A;  2YI0 A;  2QF6 A;  4KQV A;  2XHT A;  2IOP A;  2XDK A;  3HEK A;  4CWT A;  1BXD A;  4LPB A;  4Q20 A;  2YI5 A;  3LNU A;  4YKU A;  3D0B A;  3GIF A;  3VHA A;  3A0T A;  3O6O A;  5FWK A;  2YE5 A;  4H7Q A;  1Y4U A;  2XJG A;  1AH8 A;  2IOQ A;  3OW6 A;  4HXW A;  4BXI A;  2BU8 A;  2FTK A;  3QDD A;  1YSZ A;  4XDM A;  3LPS A;  1AMW A;  3WQ9 A;  2WEQ A;  5M4K A;  3K97 A;  2FYP A;  2HCH A;  4HYP A;  1UY8 A;  2CCU A;  3A0Y A;  2YKC A;  3K60 A;  3TUH A;  4FCP A;  1Y4S A;  4AWO A;  4X9L A;  1NHH A;  4CWS A;  3LMM A;  5D7D A;  3OMU A;  3BM9 A;  3U2D A;  5M4N A;  4AWQ A;  2IWX A;  2WI6 A;  1I59 A;  1GJV A;  4JAV A;  3T0Z A;  5D6Q A;  4URN A;  4GQT A;  3GIG A;  2WI5 A;  2YGA A;  2QFO A;  2YE4 A;  1UYE A;  2YK9 A;  4NH8 A;  2YED A;  1H7U A;  2BRE A;  5FNC A;  4KP4 A;  1OSF A;  1QZR A;  2BTZ A;  3ZXO A;  1GKZ A;  4GT8 A;  2BRC A;  2CG9 A;  2YEG A;  3BMY A;  2QG2 A;  3GIE A;  4BQJ A;  2HHI A;  2WI3 A;  5FNF A;  4E01 A;  3TZ0 A;  3B24 A;  3HHU A;  2XK2 A;  1Y8N A;  3TTZ A;  4FMT A;  3D2R A;  1UYH A;  4V26 A;  3R92 A;  4GGL A;  3PEJ A;  2BYH A;  4XIP A;  4EM7 A;  3CWV A;  2CCT A;  5F5R A;  4YKQ A;  3ZXQ A;  2YJX A;  3A0Z A;  2YEI A;  1MU5 A;  4CE2 A;  2EXL A;  2YEB A;  4YKY A;  2XJX A;  4XIR A;  4EGK A;  4LP0 A;  4URM A;  1I5A A;  4XKA A;  2JJC A;  4LWF A;  2VCI A;  2YE2 A;  3FV5 A;  3FT8 A;  5J6A A;  2VW5 A;  4NH7 A;  2XCM A;  1TIL A;  1UYI A;  2YEJ A;  3RKZ A;  5M4H A;  2QG0 A;  2ZDX A;  1I5B A;  4GFN A;  5D6P A;  4XCJ A;  4GCZ A;  2Q8F A;  4XIT A;  4EMV A;  4JAS A;  3EHG A;  2AKP A;  1BGQ A;  5JEN A;  4ASA A;  3B26 A;  4HXZ A;  2ESA A;  4MPN A;  4U7N A;  4B6C A;  2WEP A;  4BQG A;  1YC1 A;  1S16 A;  2IWS A;  4DUH A;  5CTW A;  3SL2 A;  3R4O A;  2YEH A;  4YKX A;  2BYI A;  1IXM A;  4BAE A;  1TC0 A;  4WUB A;  4YKR A;  1Z5A A;  5C93 A;  2E0A A;  2Q8H A;  2XX4 A;  2Q8G A;  3K98 A;  2ZBK B;  2XDU A;  3MNR P;  1YT0 A;  2CCS A;  4KSG A;  4LWE A;  2GFD A;  5BOD A;  4I5S A;  2YEC A;  2BU5 A;  4H81 A;  3R91 A;  4E00 A;  3TZ4 A;  3ZKD A;  1AH6 A;  2C2A A;  2WI7 A;  5M4P A;  3VHC A;  1F51 A;  3RLR A;  4ASB A;  1TID A;  4XE2 A;  3G75 A;  4MOT A;  2O1V A;  3A0W A;  1UYC A;  2IOR A;  4BIZ A;  2HKJ A;  2YE3 A;  1I5C A;  3HYY A;  2ZDY A;  4URL A;  3T0H A;  4B7P A;  2BZ5 A;  3B27 A;  1L0O A;  4XKO A;  2YE6 A;  4O07 A;  3B25 A;  2YK2 A;  3C11 A;  4R3M A;  2XX5 A;  4JQL A;  4P7A A;  3CRK A;  1TH8 A;  2XHX A;  4MPC A;  2YKJ A;  1Y8P A;  4DZY A;  3DGE A;  1ZXM A;  2YE9 A;  1I58 A;  1I5D A;  3O0I A;  4LWI A;  4XCL A;  3OPD A;  2JKI A;  2XDL A;  4CWN A;  1AJ6 A;  4EGI A;  4R3A A;  4PU9 A;  5D7C A;  3C0E A;  1GKX A;  2XJJ A;  3B28 A;  3INX A;  3RLQ A;  1U2O A;  1YES A;  3EKO A;  1UYD A;  2YJW A;  4L90 A;  4LWG A;  1NHJ A;  2YEA A;  3G7E A;  2HG1 A;  3TZ2 A;  4KTN A;  3Q5L A;  4R1F A;  2BU6 A;  2UWD A;  1QY8 A;  4O04 A;  3ZM7 A;  4L93 A;  5D7R A;  1UY6 A;  1BYQ A;  3RLP A;  1ZW9 A;  3EHJ A;  1YS3 A;  5IDJ A;  2H55 A;  2WI4 A;  5M4E A;  5CTU A;  2YKE A;  2YGF A;  2VWC A;  2XD6 A;  2C1G A;  4U7O A;  4EEH A;  4EFU A;  5M4M A;  3VHD A;  2XHR A;  2YI7 A;  2CH4 A;  4U93 A;  4BIU A;  3HZ1 A;  2YKI A;  3PEH A;  1NHI A;  4O09 A;  2C1I A;  1US7 A;  2O1W A;  4HY6 A;  3R4M A;  4K4O A;  1TC6 A;  1YET A;  4P8O A;  5CF0 A;  3GIG B;  4WUD A;  3Q5K A;  4AS9 A;  3HYZ A;  3CGZ A;  2YEF A;  2FWZ A;  5BOC A;  1PVG A;  3T1K A;  4CE3 A;  4QPJ A;  3INW A;  2IWU A;  3Q5J A;  2YE7 A;  1B3Q A;  4O05 A;  2Q8I A;  4KFG A;  4PL9 A;  4ASF A;  2WI2 A;  4L94 A;  3R4P A;  2FWY A;  1UYG A;  2FXS A;  4HY1 A;  4XIQ A;  4H85 A;  2Q2E B;  5IDM A;  5J71 A;  4V25 A;  5CTY A;  2XAB A;  3CRL A;  3A0X A;  2YEE A;  1THN A;  3EHH A;  4MBC A;  4O0B A; 
#chains in the Genus database with same CATH homology
 4QPK A;  1B63 A;  3KE6 A;  1TBW A;  5L3J A;  3T2S A;  3G7B A;  2YI6 A;  1UYL A;  1UYF A;  2WI1 A;  4XTJ A;  4XKK A;  5F3K A;  1UYM A;  2CGF A;  2XDX A;  1JM6 A;  2ZKJ A;  3HZ5 A;  4KSH A;  2XX2 A;  1B62 A;  4MB9 A;  3EKR A;  1YER A;  1ZWH A;  4YKW A;  3U67 A;  3ZKB A;  3FT5 A;  4CWP A;  1UYK A;  4I3H A;  1YT2 A;  2YKB A;  1YC3 A;  4YKT A;  1EI1 A;  3VAD A;  1Y8O A;  4L8Z A;  4PRX A;  1Z59 A;  4FCR A;  1UY7 A;  4E02 A;  4AWP A;  4XC0 A;  3K99 A;  4YKZ A;  1YT1 A;  1ZXN A;  4JAU A;  5GGZ A;  3TZ5 A;  3O2F A;  4CWQ A;  2K5B A;  4GEE A;  3H4L A;  4WUC A;  4CE1 A;  4ZKI A;  2O1U A;  4HZ5 A;  4XD8 A;  3OWB A;  4L91 A;  5CPH A;  2BU7 A;  4MP7 A;  4W7T A;  3T10 A;  4CWO A;  2XDS A;  2YGE A;  3OWD A;  4NH9 A;  3IED A;  4FPP A;  3A0R A;  1S14 A;  3WHA A;  4PRV A;  1YC4 A;  2VCJ A;  2BSM A;  2BU2 A;  1QYE A;  2GQP A;  1AM1 A;  3D36 A;  4FCQ A;  5IN9 A;  1Z5C A;  1KIJ A;  1H7S A;  2PNR A;  1EA6 A;  4HZ0 A;  1A4H A;  1KZN A;  2H8M A;  4CWR A;  4HYM A;  2WER A;  5FND A;  2YE8 A;  1YSR A;  3H80 A;  3CGY A;  2BT0 A;  3QTF A;  4EFT A;  1BKN A;  3U2K A;  1MX0 A;  1R62 A;  4URO A;  4EGH A;  4CWF A;  4MP2 A;  3NMQ A;  3JZ3 A;  4MPE A;  1ID0 A;  4LWH A;  1UY9 A;  5CTX A;  3R4N A;  1Z5B A;  1U0Z A;  4ASG A;  3EHF A;  4ZVI A;  2YI0 A;  2QF6 A;  4KQV A;  2XHT A;  2IOP A;  2XDK A;  3HEK A;  4CWT A;  1BXD A;  4LPB A;  4Q20 A;  2YI5 A;  3LNU A;  4YKU A;  3D0B A;  3GIF A;  3VHA A;  3A0T A;  3O6O A;  5FWK A;  2YE5 A;  4H7Q A;  1Y4U A;  2XJG A;  1AH8 A;  2IOQ A;  3OW6 A;  4HXW A;  4BXI A;  2BU8 A;  3QDD A;  1YSZ A;  4XDM A;  3LPS A;  1AMW A;  3WQ9 A;  2WEQ A;  5M4K A;  3K97 A;  2FYP A;  2HCH A;  4HYP A;  1UY8 A;  2CCU A;  3A0Y A;  2YKC A;  3K60 A;  3TUH A;  4FCP A;  1Y4S A;  4AWO A;  4X9L A;  1NHH A;  4CWS A;  5D7D A;  3OMU A;  3BM9 A;  3U2D A;  5M4N A;  4AWQ A;  2IWX A;  2WI6 A;  1I59 A;  1GJV A;  4JAV A;  3T0Z A;  5D6Q A;  4URN A;  4GQT A;  3GIG A;  2WI5 A;  2YGA A;  2QFO A;  2YE4 A;  1UYE A;  2YK9 A;  4NH8 A;  2YED A;  1H7U A;  2BRE A;  5FNC A;  4KP4 A;  1OSF A;  1QZR A;  2BTZ A;  3ZXO A;  1GKZ A;  4GT8 A;  2BRC A;  2CG9 A;  2YEG A;  3BMY A;  2QG2 A;  3GIE A;  4BQJ A;  2WI3 A;  5FNF A;  4E01 A;  3TZ0 A;  3B24 A;  3HHU A;  2XK2 A;  1Y8N A;  3TTZ A;  4FMT A;  3D2R A;  1UYH A;  4V26 A;  3R92 A;  4GGL A;  3PEJ A;  2BYH A;  4XIP A;  4EM7 A;  3CWV A;  2CCT A;  5F5R A;  4YKQ A;  3ZXQ A;  2YJX A;  3A0Z A;  2YEI A;  1MU5 A;  4CE2 A;  2EXL A;  2YEB A;  4YKY A;  2XJX A;  4XIR A;  4EGK A;  4LP0 A;  4URM A;  1I5A A;  4XKA A;  2JJC A;  4LWF A;  2VCI A;  2YE2 A;  3FV5 A;  3FT8 A;  5J6A A;  2VW5 A;  4NH7 A;  2XCM A;  1TIL A;  1UYI A;  2YEJ A;  3RKZ A;  5M4H A;  2QG0 A;  2ZDX A;  1I5B A;  4GFN A;  5D6P A;  4XCJ A;  4GCZ A;  2Q8F A;  4XIT A;  4EMV A;  4JAS A;  3EHG A;  2AKP A;  1BGQ A;  4ASA A;  3B26 A;  4HXZ A;  2ESA A;  4MPN A;  4U7N A;  4B6C A;  2WEP A;  4BQG A;  1YC1 A;  1S16 A;  2IWS A;  4DUH A;  5CTW A;  3SL2 A;  3R4O A;  2YEH A;  4YKX A;  2BYI A;  4BAE A;  1TC0 A;  4WUB A;  4YKR A;  1Z5A A;  5C93 A;  2E0A A;  2Q8H A;  2XX4 A;  2Q8G A;  3K98 A;  2ZBK B;  2XDU A;  3MNR P;  1YT0 A;  2CCS A;  4KSG A;  4LWE A;  2GFD A;  5BOD A;  4I5S A;  2YEC A;  2BU5 A;  4H81 A;  3R91 A;  4E00 A;  3TZ4 A;  3ZKD A;  1AH6 A;  2C2A A;  2WI7 A;  5M4P A;  3VHC A;  3RLR A;  4ASB A;  1TID A;  4XE2 A;  3G75 A;  4MOT A;  2O1V A;  3A0W A;  1UYC A;  2IOR A;  4BIZ A;  2HKJ A;  2YE3 A;  1I5C A;  3HYY A;  2ZDY A;  4URL A;  3T0H A;  4B7P A;  2BZ5 A;  3B27 A;  1L0O A;  4XKO A;  2YE6 A;  4O07 A;  3B25 A;  2YK2 A;  3C11 A;  4R3M A;  2XX5 A;  4JQL A;  4P7A A;  3CRK A;  1TH8 A;  2XHX A;  4MPC A;  2YKJ A;  1Y8P A;  4DZY A;  3DGE A;  1ZXM A;  2YE9 A;  1I58 A;  1I5D A;  3O0I A;  4LWI A;  4XCL A;  3OPD A;  2JKI A;  2XDL A;  4CWN A;  1AJ6 A;  4EGI A;  4R3A A;  4PU9 A;  5D7C A;  3C0E A;  1GKX A;  2XJJ A;  3B28 A;  3INX A;  3RLQ A;  1U2O A;  1YES A;  3EKO A;  1UYD A;  2YJW A;  4L90 A;  4LWG A;  1NHJ A;  2YEA A;  3G7E A;  2HG1 A;  3TZ2 A;  4KTN A;  3Q5L A;  4R1F A;  2BU6 A;  2UWD A;  1QY8 A;  4O04 A;  3ZM7 A;  4L93 A;  5D7R A;  1UY6 A;  1BYQ A;  3RLP A;  1ZW9 A;  3EHJ A;  1YS3 A;  5IDJ A;  2H55 A;  2WI4 A;  5M4E A;  5CTU A;  2YKE A;  2YGF A;  2VWC A;  2XD6 A;  4U7O A;  4EEH A;  4EFU A;  5M4M A;  3VHD A;  2XHR A;  2YI7 A;  2CH4 A;  4U93 A;  4BIU A;  3HZ1 A;  2YKI A;  3PEH A;  1NHI A;  4O09 A;  1US7 A;  2O1W A;  4HY6 A;  3R4M A;  4K4O A;  1TC6 A;  1YET A;  4P8O A;  5CF0 A;  3GIG B;  4WUD A;  3Q5K A;  4AS9 A;  3HYZ A;  3CGZ A;  2YEF A;  2FWZ A;  5BOC A;  1PVG A;  3T1K A;  4CE3 A;  4QPJ A;  3INW A;  2IWU A;  3Q5J A;  2YE7 A;  1B3Q A;  4O05 A;  2Q8I A;  4KFG A;  4PL9 A;  4ASF A;  2WI2 A;  4L94 A;  3R4P A;  2FWY A;  1UYG A;  2FXS A;  4HY1 A;  4XIQ A;  4H85 A;  2Q2E B;  5IDM A;  5J71 A;  4V25 A;  5CTY A;  2XAB A;  3CRL A;  3A0X A;  2YEE A;  1THN A;  3EHH A;  4MBC A;  4O0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...