3GINA

Crystal structure of e454k-cbd1
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
132
structure length
116
Chain Sequence
PVSKIFFEQGTYQCLENCGTVALTIIRRGGDLTNTVFVDFRTEDGTANAGSDYEFTEGTVVFKPGETQKEIRVGIIDDDIFEEDKNFLVHLSNVKVALACLGSPSTATVTIFDDDH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and functional analysis of a Ca2+ sensor mutant of the na+/ca2+ exchanger
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Metal binding protein
molecule keywords Sodium/calcium exchanger 1
total genus 20
structure length 116
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2030 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3ginA01
2KLTA 2DPKA 3FSOA 2LT9A 3E9UA 3EADA 3E9TA 2QVMA 3GINA 2FWUA 3FQ4A 3RB5A 3RB7A 3US9A 2QVKA 2KLSA 3H6AA 2FWSA
chains in the Genus database with same CATH superfamily
3DHJA 1PLAA 4X50A 3O0RL 4TVSa 3N55A 4TULH 1WBZB 1YYMH 5E7BA 4EDWH 4HPHA 1LP9E 5HDRA 1ASOA 4O58H 1BVLB 4EI6B 3CH1A 3PABB 3FW6A 1NCBH 3N9GH 4E9RA 4N2GA 1WVZA 4DPAX 2DQIL 1JXDA 1V8HA 2FBOJ 2PCFA 1RZIB 1EEYA 3A6CL 4WUUB 5J56B 1MQ8A 2R4RL 1TTBA 1FYTB 1SLWA 4Y19D 2BP0A 2DRUA 1GYUA 1MCEA 1XF2B 3IGUA 4A2DA 1GYWA 4U6XA 4N8UA 2ICWI 3TFKD 3FT2B 3QEGH 4B3VA 4MSWA 3MNZA 1XR8B 2PYEB 2YPVA 4FA6A 3ZT7A 4ZX6A 4MCMA 3FT0A 3TA3B 1UD8A 2D0HA 3F65A 3SOBH 4GXUM 1XDTT 2BNQD 4PJFE 5HHQA 3LIZH 4ZI8A 2A9MH 5D1QD 2OTUA 3L4CA 1XXFC 3G7TA 5KSUB 4LU5H 1ZLSH 5H37H 2F7PA 3AROA 4OVUA 3STZA 1XIWA 3GF8A 1P5VA 1WS7A 3VD9A 2YWYA 4YDNA 1O7DC 2X38A 3VYPA 5CBAA 4LSUH 4PJIF 3UO1H 1JGDA 2QDWA 5H8DA 1JF1A 4P2OD 1EJ8A 2Z0BA 4I89A 4U7KA 1RJYA 2X4RB 3DROB 2VQTA 5I0YA 3D2TA 5I16A 2ZXGA 4Z7QB 4GG6A 1VACB 2OR8A 2P24B 5TD4A 1R5IB 1KIUB 4ZO6A 5DJAA 3MREB 2X9XA 1WZKA 4NRYB 5GZOC 4HH9B 1GZQA 1UXLA 4XE5B 1R75A 1WG3A 4XMLL 1RPKA 1L7IL 3GNMH 4TSCH 5BRZA 3KBEA 2IDTA 1YY9C 2EKSB 3QS3A 4QPEA 1RVFH 4UNTA 4KI5C 3D52A 1QLEH 2NY6C 1DFBH 3GC3A 4X8JA 1FO0L 4OZIB 1GIGL 4W9KC 5B3SB 3DKHA 4LF3B 5F7KC 5DR5L 5F1OB 3RBGA 1IM9A 1VZGA 3U0PA 4V1DB 4WO4C 3RWIA 4U3XA 3WO3B 3EYSH 5IFHL 1TZGL 2IH3B 1MFBH 1D5ZA 3S35L 1OWRM 1HOCB 5TTRA 3RVWD 1A6VL 3KE0A 5DRXB 4X6BA 4GY4A 3X1NA 3VE0A 3M46A 3RDTA 4QT5B 1SF3A 1CGSH 5CNHA 4QY8B 3VXQB 4JPSA 5I6LA 5I8EA 5FUZH 3VG0L 3BWUF 5JPMB 4MB4A 2UXTA 5EOTB 3WS3B 4GKNB 3VI3A 3CCHB 2Q8BL 3RWHB 5IEKB 1F6FB 4M7JH 4D0CA 2MHAB 5E6IC 1I7UA 2EDTA 1F4WL 4HIHA 4A55A 4F8QA 2QKIA 3PHQB 2NXZD 4FKHA 1QFUL 3B6SB 4L4JA 1E5ZA 3TVMA 4JN2A 5L2KA 3IAPA 3X1BA 1ACZA 3JV4A 4G1MB 4N6RB 3VYOA 2OJEB 4QXUL 1MUJA 1F8TL 4OF8A 1BZ9B 2OMVB 5CLTA 4XN1A 5C7ZA 3VTMA 1H15B 4ONFH 4CMHC 4F57H 1S2EA 3D30A 4KKPA 2WQ8A 4HFWA 3F5WA 4TRPH 5DMJB 2FLMA 2QFPA 1ZA6A 2YAMA 5L9DH 2F8XC 3PAUA 4JPWL 3MV11 3KM1A 4X4MA 3GXUB 1M1XB 3VX1A 3AM8A 5IVXE 3RWGB 3QDGE 3ARBD 2BVTA 1X5AA 2VDRH 4GQ9L 5D7IF 2BRQA 4NZUH 1ZE3H 1H3TA 2GQHA 2BHUA 3WCYA 4YSDA 2BW5A 5JHDE 1OCRB 3QJSB 1NL0H 4UQBA 2CUMA 4WFEE 3EBGA 4WSJA 3LEXA 5I82A 2UZIH 3EBAA 3ML9A 3L7FA 4PV9B 2VDRB 1FVEB 3MFFA 3BKYL 5B7MA 4NO5B 4AIXA 5EZLA 4POZC 2HWZH 4HETA 3WTYA 2NY3B 4NKQB 3QJTB 4K71C 2ZG2A 1WLHA 3QQ3A 5SWQA 2JKLA 2JJSC 3P0VL 3IJYB 3SE3A 3NJMA 4BFRA 1G43A 4QGTA 1NBQA 5I1KL 2F5BL 3WXWH 2OPCA 5J06A 1LK2A 4YO0B 2ZG3A 5F9AC 2ZKHH 5I1GH 1MWAH 3X17A 2CLVA 4O02A 5SWSE 4Q89A 1IGTB 3Q5TA 2HRHA 2HX7A 4ZUTA 1QASA 5HYSA 1G7IB 5KVMC 5L8JB 1QI4A 1ZKAA 1JGVL 1YG9A 4PP1C 2APWA 3VFUB 1G94A 3A4FA 3QS2A 4U6HA 1DUYB 1TJHH 1TMQA 3SDCC 5HYQB 1QLRA 4K3DL 1FZOB 3HR5A 4PLJC 5EOCH 4AY0A 1LLAA 2MOGA 4QHUB 1PG7X 4GW5A 5LBGA 1BBJB 1QEXA 5I18H 4JFEE 5ABAA 2OFQA 3AREA 2PO6C 1P4LA 3EKCA 4YEEA 1TQBC 4D9QD 4XP1L 5D7JB 4XZ4A 3BT0A 2MTAA 4PJ9D 4AKOA 4NIYE 1A8ZA 3AXHA 1A7BA 3KPRA 4P23A 1Q0XL 5KBDA 4NT6A 4R2GD 3QFDA 5IEHB 1OQXA 4NQEB 2FO8A 4Q52A 1GXEA 4DGYH 2B9AA 4JM2F 4WFFD 4KQ4H 3SGKA 2OSXA 2RGSA 4XRCB 4M02A 3FCUB 1AIFA 3OD3A 4FI7A 5G4MA 3VSVA 3MXVH 3CTTA 2P1YA 1NJ9A 2I7OA 2D7TL 5AWNL 4AENB 5E6ID 3REVA 2GT9A 3HG1E 3OGCA 4JAMB 4BDVA 1V55B 2PPFA 4O4YL 3KYKH 3BDYL 2WSKA 3C5JB 3U46B 1GGCH 3WFHA 4JPKL 1KC5L 2G30A 4NQED 4QRRA 1BD2A 3OR7B 3WIHL 2W0FB 2L4OA 4X9IA 3PP4L 4WW2C 3UJTH 2K6ZA 1N4XL 2BFVH 3AC0A 2C9SA 3C60A 4AMKL 4K7PY 2EYTB 1F41A 2AQTA 4PJ7F 4AYGA 1JPGA 2DH2A 2EIMB 2DQTH 3AABA 2XZZA 4UZUA 1PKQE 1W6WA 5GXBB 4IMKC 2YSTA 1QHQA 2Y36L 1QBAA 3UTTE 1CL7H 2W65A 1HZLA 3CBRA 4QCIA 3HLAB 3GSNA 5DGQA 2Y5QA 2ZUUA 3LPFA 3REVB 1EHXA 3JWNC 4F5CA 2G0LA 5HI4C 3DO7A 3PHSA 1BJMA 4M4PA 4TUOB 1NAMB 3UG4A 3EUUA 5AKVA 1T1WA 3RGVD 4RCAA 2HVJB 2QQNL 1T22A 3RVVD 3C2AH 3CFKA 4UWQB 4LAQL 3DGGB 3SJVB 3TEZA 3LRLA 3QEUB 1Z1WA 4BH7B 5AOZA 3LKOA 4ZXBC 2KQMA 4NQSA 5LN8A 4OCYH 5E08L 4PJIA 5D7JA 3VFOB 3PV7A 1WFJA 1FQ9C 1CBVH 2WUBL 4KFMA 3QWNA 3INUH 5CEXA 2IWFA 4N26A 4F9PC 4N8VB 4GW5B 2F68X 4LGSB 3O3DB 3VI3F 3PWPD 3RU8H 4F7EA 1DUYA 5I28A 4R5VA 2HJKB 1JK8A 4P23C 4YEFA 4PBWD 4QYOB 1DVFB 1WWAX 2E7DA 4OLWH 4Z5RB 3LVEA 2XJKA 2HT2D 2VDKB 3EJUA 1XIWC 1EJFA 2YAEA 2HX8A 4ZFGH 3S2CA 1U8JB 2PPCA 3BH9B 3CIAA 3AB0C 3QJHA 4JG5A 4YIQA 5D2LA 5EC2B 3LTVA 4AIZB 4Z3GA 5FW8A 1QATA 2WLIB 3TH4T 4Y4FD 2V5TA 3PWLB 3T4AC 3IETA 2XXGA 1CD1A 4Y5VC 2Q3ZA 4LPXA 1WBYA 2WP3O 4U1MB 2J6EA 3PGDA 4I48B 5D7IE 5SWQB 3QIWC 2X7LB 3BSZA 3O4OC 1GYAA 1MCRA 1FFPB 3DDFA 4HJ0C 1HSAB 2H7WA 3II1A 3ZTDC 1RY7B 1Y6KR 4W1TA 4PV1C 1TUPA 4E9QA 5K59F 1NGWB 3SDCA 2WLYA 5B3JF 3KXFD 4QTHA 4EKJA 2BSRB 4ZYKA 1BXUA 5GGUA 3QIUD 1T20A 5FUCE 4OFKA 2X28A 2YKLH 1BZ7B 3L3DB 5DSCA 1QRNB 5JYLA 5LGJB 3ROLA 4OSUH 3MLWH 2ZX7A 4F7CB 4JVPA 2VQUA 1E4XI 1PZAA 4HLZG 2BSED 1JYNA 3OKMA 1ET7A 4N2EA 2BY0A 1PSKL 4UT9A 4MJIA 1HHGB 1S9XB 4PWHA 1I3UA 2X1OA 3GMNA 1SN2A 4ZSOB 4KXAA 3VXUB 4Z7VE 2J5LB 1BBDH 3IJ9A 2TSBA 4W6YB 4DK3A 1FYTD 3MNDA 2X9WA 1ADQH 3CMOL 4HHAB 5DEJA 3HE6C 1QACA 1UCBH 3BISA 5LGYA 3EF7A 3A22A 4HZLA 2V6HA 4MA1B 4NQUA 1GOHA 2YZ1A 3KPQB 3VXQA 1PU0A 1DLFL 4DJMA 5T8IA 4JGNA 2G75A 1W2KT 4CKVX 1A7QH 3ECWA 3VE0B 3TESA 1I9JH 3B56A 2ITCB 5T5NF 1U3HD 3IRCA 4N2KA 4I0KA 3U0WL 1MZZA 4KZ0A 4MD4A 3VDBA 4UBDD 2R9HC 5E70A 4N90D 3EDKA 1KTLA 3VXSB 3EGSA 2FH8A 2VLJB 3GM8A 1DQVA 1DEEB 5EOCL 1T0NA 1YYCA 5CINL 5GS1C 3W11C 2XTSA 2Y6TE 4F7TA 4GB9A 2K78A 1IM3D 2X0WA 4J3OH 4J27A 3L5JA 3C09C 1N0XH 5K9JL 2DQTL 4OFYA 5JIPA 5I1AB 2CGYA 4MDIB 4K8RH 5J6GA 1H8SA 2V5YA 1UWGL 4G6JL 2BFVL 2H47C 1KTDA 3KPSE 5F0PB 2PXYA 4XVUD 3DX3A 1LVEA 3VFSA 1NWOA 3MBWB 4GAJL 5GISL 3SKNB 1WAAF 2YPVH 5I1GL 1TFHA 4YOKA 1YZZA 4DUWA 2WWKO 4O4YH 3UGXA 1LE5B 1C16A 2EC8A 4DEPC 2Q7YA 3P0VH 1TKWB 2R29A 1YJDL 1HCYA 4PCSA 5B22A 1KXVA 3SDDB 4JMNA 3MLRL 1OSYA 1B4JL 3GRWL 4LDCA 1GAFH 2H2SD 5DEFA 3MNMA 2XFXA 3H0TA 3GBML 1NFDA 12E8H 1I8MA 3UIYA 3WFEL 4PB0H 5CAYB 2WUBH 1DVTA 4XN9A 5E51A 4Y4HA 5F89A 2GSIA 3OLDA 5LWYL 1T1ZB 3QIWB 3CHPA 3RKDC 4L37B 3I75B 1P4BH 3ZSTA 1WIOA 4GRLA 5DD0H 1TO5A 2FLBT 4J1UA 3HE7C 2VAAA 5DURB 4XP9L 2QQNH 2WKLA 3ZKMC 2BP3A 2YJQA 5KYUB 2YRZA 5T1LD 3LN5A 5DHVA 3DIFA 3PHOA 1JI1A 5AVYB 5AW9B 1RIUL 4AQAA 1DANU 2IO5A 2DI8A 4LL9A 3CC5B 4P5KB 2ZKYA 1HIML 2GJZA 1QVOA 3OB0H 5C0IA 1TJHL 4PI2A 4WWOA 3BPLC 1J18A 2B4CC 2E59A 3GGWB 3U36B 1MREH 3FO2B 4BD4A 5T1KD 2FQEA 5DUBA 5F0JB 5FOBB 4YHKL 1AGBA 3MLWL 1KCBA 3GK8L 3K0YA 1T1XB 3U30B 4PS4H 3VM5A 3ULVL 4QOKE 2DQGH 2J43A 3DTDA 1NOAA 2R0LL 3MYZA 4OF7A 4KKBC 2IFFH 1D7FA 3FQ2A 1L9OA 4OV6F 1MF2L 2HLFD 4QRTA 5FDYA 5IJDC 2I9LB 1GIGH 3L3OC 5FDWB 3P77B 1EXUB 1FN4B 3D3VE 2YPLA 5CZVL 2OXHB 2WBJD 5D2LE 5K9OA 4Z23A 4HG4J 3UTSD 4PWGA 3S8GB 3WHE1 1UC6A 2NUPB 1D7DA 4OAWA 3N0PB 2YSSB 4RFOH 3CFDA 5DQDL 2IGLA 5DGRA 3P2BA 5A3ID 4L29A 4PRID 3T0AA 2DQEL 3WUWA 3ARGB 2DEYX 5HVFB 3OV6A 2JTYA 3EYFB 2CR6A 4QLRA 2MQCA 5IOPA 1T0MB 4LCWB 1S7QA 5HVHB 3BYTA 3ARRA 2XN2A 3LRMA 3G6AA 1JVLA 2DYPB 2VDOH 4ETQA 4E2OA 5EN3A 2OCFD 1H3PH 1QSZA 3WJJC 3ZKSD 1GRWA 3JUZA 1EVUA 4ZUSB 2P80D 1KUMA 2ZCHH 3OL2A 4HWBL 4MAYD 1CDYA 4UQAA 5DVMA 5FF6B 4TVPL 5JQ6H 4K2UH 4ZOBA 4EIGB 1KGXA 5HDWA 1LK3H 3CSFA 4AYFA 1HHJB 3UTQA 2V7NB 1N6VA 3LH2H 5KSVA 3GT6A 1D9KB 2RFXA 5GGRY 4PP2A 1IBZA 2BXYA 1MFDL 5FM8A 3H6JA 2B9BA 2O6CA 3QJVB 1JVOA 3HR6A 3QG6B 1K8IB 2F74A 2WINA 4LCVA 3VFTB 4EMZA 1S5IL 2QV2A 1B0WA 5MERB 4AG4L 4RDQG 4GKSA 5IVNA 1OLZA 5C6TH 4QTFA 5D2NB 5GS2H 4GO6B 3TH2T 1FNLA 3ZKMD 5C6PB 3QQ9C 5EIIA 4PLJD 3E6FA 4KVNL 1AKJD 5I17B 3PHOB 3HBZA 1DBJL 2B59B 2XYBA 1NPJA 1N0LA 1UD4A 3PAZA 1MF2H 2BXZA 1MLCA 2AITA 2N01B 3HUJA 2WBWB 1WA2X 5F71A 1P7QA 1D5BB 2LLGA 2HT4C 1XGZA 5C0AA 3T6QC 4YC2C 1V10A 3MRFA 3PS6A 2NDFA 1N18A 2VDRL 4GQ9H 4YPGA 3ULUC 4MGXA 2K7PA 4MQXD 3MGOB 4U1SB 2MCAA 1NEZA 3JXAA 5DS8A 1AXTH 5GRUL 2VRKA 1P1VA 3A6OA 4NHCL 3S5LB 2GSIB 4RMBA 3TPKA 2WZ5A 2BOBB 4W70A 3IS0X 2F8VA 3FB8A 3NK4A 1UH3A 5A2BA 4WJKB 5AL0A 1GTNA 2XX0A 3U7YH 2QGBA 4N2HA 4GW1A 2DW5A 4WK4B 4KNQA 4LEOB 1OT4A 1PFOA 1PPIA 3TVMD 1PY0A 1BVNP 4ENZA 3BT2L 4F8OA 1F90H 3T1WA 2A6JB 4N5EC 2GUOB 3P30H 3EO9L 4XXWA 2X6CA 4YX2H 5HHXL 1BYOA 2ITFA 2OTWB 3FHAA 3E6HB 2WNWA 2W9EL 4F3FB 1S4IA 2G5UA 2GBTA 1JPTL 4OZIF 2YUVA 3FUJA 3M1BA 5IVZA 3ARTA 1DHKA 4LK4A 3CZKA 3OB0K 1QD0A 2EE6A 4HKXB 4ZBJA 1CFNA 4JM0A 4NC1E 1YEWA 3HE7A 4CSTA 4DIXA 3WFEH 2R83A 5GS3A 4FXGB 1UZ8A 2A73B 4AQZA 4E68A 2LW3A 2DM7A 3TCLB 3QIBD 1BAWA 1GAFL 5ALBL 3GZPA 2HJLA 4FLQA 3PIQA 4CBZA 3NFNB 1GOGA 4XODA 3ARGC 1A6TA 1QEWA 3HPLA 4L8DA 4F7TB 3US0A 3RAJL 2R4RH 1E5CA 4F37K 1HEHC 1PX3A 2W5PA 4K3EH 2GJPA 4MMZA 3UAJC 1BBDL 1HI6A 2CHZA 2P9RA 3DURA 5DEZA 3D4ZA 1A22B 2J56A 4DWHA 4OF6A 4QXGL 3PWVB 2EINB 2ITCA 4ZFOA 2BM3A 2ESVB 1XAKA 1CD0A 2A1WL 1Q9LA 5CN3A 4PJGE 5KSBE 2G75B 1KGJA 3CSYA 3SIKA 3F7YA 3UAEA 3L9RB 3BHBA 2VW7A 5JTWA 3L4YA 4KMTH 4F58L 3S36H 5AVSB 2V37A 1ZVNA 4LKCB 4WNQA 1ZVSB 3KL0A 2VLRD 5ANMB 2ARJA 1XZ0B 1KIRB 3EO9H 3VXOA 1L9SA 4Q9BA 2VDQL 3ME0A 1IEHA 3CHOA 3B5HA 1UM6L 3IDIA 1QOKA 4XMPH 3C08L 3O3AB 5C09D 4BV1A 2UY6A 1N12A 1NPUA 3CVHH 4ZSOA 4PRNB 4XXDA 3CAFA 3P4OB 1VFOA 1A3QA 3BW9B 3TWCH 1EUTA 1GS8A 2YGVA 3OAYH 3OKYA 4U6TA 3MRMA 1SVZA 3UGUA 5EEYA 4AQOA 1N6QL 5T3ZE 2VSDA 4JO4H 1QA9B 4PRHD 1E4WL 1HZHL 3WO4C 1G9EA 3NSJA 3W9EA 4WWKA 1K6QH 3T0EA 2BWDA 3SDXA 3QDJE 2E47A 2I60L 4P06A 5IBTH 35C8L 4UQ3B 4OGYL 4WY7L 1MQKH 3SDCB 3W0WA 1IFHH 4OIBA 4ZAKD 5HPMB 1SHSA 3A6CH 2D3NA 3MC0A 1WFNA 4ANXA 1TCRA 1UOVA 1L0XA 4NRXB 4XTRD 4GSDL 5D1XD 3NVQA 1NFDF 3V52H 3ZZSA 5BW7C 1VERA 3O4LD 3ARDC 3ZE1B 4FI6A 1BQLL 2EUVA 4DGIL 3HZMA 3SQOH 1JNLL 2YC1A 3LIUA 5LG1A 2FBRA 4EIUA 4DZ8A 1QLFB 5E0FA 3V4PH 3RL1B 4BA0A 3SYQA 5F9JB 2NZ1A 3AXIA 4KAQL 4WHYG 2QSQA 5EC2A 2O5ZL 2Z8VC 3D69A 5IJBC 3L3GB 4JZNA 1Y18B 2I69A 3S37L 5HYJB 2L3BA 1D9KC 1M7IA 3QORD 1X6LA 3WTTA 1VLXA 1AACA 1F4YL 4RWYL 1ZLVK 3H8NA 2R1XA 4Y1AD 1JK8B 4OZFB 4FNSA 3QG7L 1YNTF 3V0JA 3FT3A 2E75C 2YFNA 3QJOA 2B0SL 4A63A 4CN6A 1I8KB 3KLDA 1YUKB 5I1CH 2ZCHL 1CR9H 1KFGA 3EFFB 3KPSD 2Y7QB 3BP5B 4HWBH 5FGSA 5IV2B 1BLIA 2C1OA 5E1AB 1ZT7B 5F9OH 1T83A 1B0GB 1MJUH 3ASNB 1UB6A 5C0EB 3ARWA 3IXTA 2DQCL 4JY5L 1UB6B 2BK8A 3DX7A 1PQZA 4F9LC 1B0GA 4JR9L 2FGWL 4LRNH 4MJ4A 4WSGA 1JPSH 3MJ6A 4DVBA 2OW7A 4Q14A 3IXTB 2ADGB 5HGHB 4H1LA 2Q10A 3QCTH 4H40A 1R24A 1DQTA 4RFOL 5DQDH 5CXPA 4M93C 1NM9A 5AB2A 3DETC 3GSNB 5IV2A 2X1PA 5H94A 2DAVA 1I31A 5TGBA 2W07B 3QYMA 3B2DC 4QRFA 3FTZA 4HSAC 5KS9F 3Q2WA 4LHUB 2X1XR 4V2CB 2VMDA 4YHIA 4A38A 2WPGA 5KW9H 1P1ZB 5FYKL 1CE6A 3K7UA 1R5WA 3UACA 5DJ2A 3O45B 3ZUNC 1MNUH 3OKDA 4P5MB 1HT6A 1L6XA 1UM5L 5FWRA 2GB2A 2ZUWA 2NCMA 1CZ8H 1SM3L 2OYMA 1AY1L 2BP5M 3CFBB 5CEYB 1B4TA 3CLWA 2YEVB 2O6FA 3T2OA 5F0LB 4JZJA 1MRCL 2OJZH 2Y3AA 4UV7H 4B7LA 2XG4A 4NWUL 3HB3D 4I9WD 5E6RB 5C0RH 3MBEA 3OVUB 2NY7L 3QNZB 5B4MD 3NJIA 2VZOA 1R19A 2WJ5A 4JFZL 3WAKA 1PZUB 2AGJL 3N41F 1ZGLB 3LQAC 4DEUA 1AIFB 3HUJF 1FHNA 1SDAB 4D0BA 5LGHH 1MCKA 3KLHC 4QYAA 3ATDA 4X83A 4Y4KA 4ZZKA 3NIGB 4PTUA 5T1MA 3L81A 3V4VL 2E3VA 4NENA 2UV3A 1W8NA 3S34H 3DWTA 3BZFB 5A2IH 3FRPA 1JERA 2QQKL 3RWCB 3V4VB 5HGDA 5LJYH 5JHDB 4MS8C 1A7NH 3H3PL 1BQKA 2G9KA 5EZIL 2NR6C 3RIAF 4MA3B 4X4XA 5GGSY 3DX9B 4NUMA 4WHYH 3G6JE 5AWNH 2JH2A 1MW0A 3T4AA 2Z8SA 5JLZA 3WIIL 1EBAA 4KRPB 3IDIB 43C9A 4ABUA 3VFUA 3V0GA 1OK0A 3OG6B 3TF4A 3QH3A 4GIOA 4NJAH 4ODXB 1FA4A 4MXQC 2XTJB 5GRVL 1JWMA 3HCVB 3ESNA 2X44D 1GGIH 1Q0XH 1CE1H 2XVGA 1CICB 3FCTB 5CM1A 2Z4TA 5AZUA 4Z7NE 4M8QB 4PCYA 3X14B 2XI9A 5ANMA 3NCBB 4ZUUA 4RGMB 2K4WA 4MJ6B 2XU9A 3HN8A 3TIDB 4LKCA 1G6RL 4OB5H 3DTXA 4OGAC 1PSKH 2CM5A 1U9KA 3IDGA 1J8SA 2OJ1A 4JHWL 3MRLB 4FG2A 4QXUH 1N6QH 2Z92B 1EZSA 3MJ8B 4JM2C 3PG2A 1WZMA 3IGLA 4BZ2H 4XB8A 2X9YA 3OMNB 2W94A 4PR5A 3E80A 3K1KC 3L5IA 2MPAH 2APFA 1QHOA 5A3IC 4JVWA 4O51A 5BRPA 5I1CL 2ETWA 2YAOA 1UB5B 4PJ9A 4PUBH 1QEWB 4ZRGA 2KPNA 2VMJA 4P2QB 4H7VA 4KXDA 2ZPKL 2GW5A 3HZVB 3MNVA 4MA1C 4P3CL 1ZA6B 3V10A 4NQCE 2BHYA 3WY4A 5KAQG 3TURA 3HE7B 3KHOA 4LARH 5BJTB 2W60A 1MFCH 2WHVA 3OWRA 3QUXA 4JFFD 4KNSA 5IVZB 1U8HB 5D4HA 2RD0A 2NSMA 3BEWA 2BIQA 4JN2B 4N9OB 1KT2B 2X1QA 3TJHC 4YFEA 2BDNL 3L1FA 1U3ZA 4UTBL 1ORSB 4DUVA 3Q01A 4H5SB 3E3QE 3TEXA 1ERNA 1E2WA 4WW1A 4D0CB 3UMTA 4DKAA 4CBPA 1M3JA 4TTGA 1AZRA 1WGVA 3OJDB 1JGLL 3T71A 2B4CL 2FNBA 4QLWA 1FVDB 4NLHA 5IMKA 4JFHD 2Z93A 4FFTA 3FB6A 1U8KB 3NG5A 4RMRA 4BSWB 4G5ZH 3B37A 3UYRH 1SOKA 1NEZB 4P5SA 4Z7NB 4K7PH 4HUVB 4PV8A 2DM2A 4ZOCA 3KR3H 5I26A 5J6SA 3RZCC 3EXLA 1RV6X 5D93B 2C9PA 3S5LA 1P53A 3V5HB 3UH8A 1DTUA 3GS4A 4Q0XL 5E2TH 3WXVL 5I15H 3MGOA 3N04A 4U1SA 3I3EA 2AQ3A 5HDQH 1PS3A 5E6ZA 1N64H 2BZCA 2QADB 4NC0B 4NGHL 3P30L 3NCXA 2ZTBA 1T6WA 2I9TA 1KB5A 3HI6L 4L0ZA 5EUKB 4OD1H 1N0LB 5KOMC 4K55A 3G5ZB 1TNNA 4D9QE 1HU8A 3A4EA 3E6FB 4QTIL 3LXUX 1ZD6A 4XMPL 4KROD 3GMOA 1VEOA 2ZNWA 3FYIB 4MQXC 1EEUA 5D2NE 4ZJ9A 1REIA 3I02B 1CDGA 4HMDA 3W1ZA 4KTDL 4KRPC 5L4JA 2WN3A 4ORGA 4DSYA 4Z7UF 5TPWL 5DZAA 1A2YA 2V3EA 1RJYB 2X4RA 1MRDL 4HC1H 2G4GA 1T6BX 1W72L 3KW8A 2E7LA 3DSNB 1NCAH 5F1NB 1WFMA 2LHAA 4PJXE 1C7TA 1P7QD 1YJDC 1ES0B 1T3FB 2VDNL 3CZFB 3KH3A 4GIAA 5MEPB 3Q1SH 2Q20A 3WTWA 2MCG1 2V33A 3B4NA 4RFEB 1E27B 2Z65C 4HIJA 3DXAA 2XY2A 5DZPA 4LVEA 5DO8A 4X8CA 1O6VA 1AR2A 4MA8L 4WU5B 2Q87A 4XO9A 1W8OA 3TV8A 4KK9C 4MDRA 4OD2A 4BXSV 1GHFL 4X0KA 2Y6SC 3WNKA 4JX0A 1N67A 3D18A 3EOBB 4IBZA 3QI9C 3ZE1F 1W0VA 2EIKB 4RRPA 2PYEA 3CN1A 4JM2B 2XICA 1MVUB 4M29A 4OCYL 5DJ8A 1NGYA 4HJSA 2FJHB 2W9LA 4KROB 1FL3B 3AMLA 3L3OB 1GC1L 2BIPA 1FNSH 3MBXL 4UAOB 4YDJB 1DQQA 2FQDA 2FJHA 5IOPB 3KGSA 2ZSWA 2AS5M 4PJAB 2SODB 5H37A 1BAGA 4A7TA 2W9EH 5KS9A 5BV7B 5I6NA 4X0KB 1BZ8A 2R2CA 2IBZY 2ZXBA 3VXRD 2CDGB 2OXHA 2Q3AA 5LVEA 3P77A 4UQEA 3WELA 3FU9A 4GFTB 5F1IB 2FQGA 1QPPA 2UYLB 3BWAA 3QJUB 3MNWB 2IWEA 3LRSB 4JJ5A 2YPLB 1BXAA 2W0KA 3H54A 3TXAA 3KL5A 3F7VB 5CJBA 1AG0A 3IXAA 4TQ8A 1OHQA 1UXWB 4H25A 1KGIA 3IPFA 4JKLA 5CO1A 1PJ9A 3ZJAA 3FO2A 3IU3A 4EN3A 1KN2L 2WTRA 2D7QA 3QZWB 1QSED 2QHRH 4ORGB 2X4PA 5FOBA 4X7CC 2EZ0D 3L6FA 5EG6C 2N56A 3BRFA 1XR9A 3TP4A 4R97B 3GGWA 5DUJA 3BPNC 2HVKA 3GPSA 4JW3A 3RDTC 4NQDD 2OULB 1Z5LB 3O0RH 4BSVB 4LLYA 3CQPA 3UROR 1A6WL 1OAUH 1XB8A 3WFBL 5KYUA 2V9QA 1G7QB 1IGCL 3ARFD 5JXAL 1CTMA 1SYVA 3QA3A 5TE4H 3NRFA 4TNVK 3HA0A 3L4TA 3G08A 5ABZA 4CVUA 2N7BA 3NFSH 5JR1L 1B0RA 4DNLA 1C9SA 4AEIH 2YO3A 3PJSB 4AG4H 4K5PA 1EA9C 3BZ5A 4HUVA 4CJ0A 4F15C 2LE9A 4MB3A 5TK4A 2F8IA 3BAYA 4IOFD 4S1SH 3FB6B 3ARVA 3K4DA 5T1JA 1MFDH 1NCNA 1PZ5B 3SDXE 4PI0A 2X6MA 4XHJC 1T6VN 3VWKA 4F24A 3ZKND 2W80C 3QVAA 5AKSA 1ADQL 1V3LA 2G3NA 4FQXD 2ZOKA 2PW2A 1TPXB 1R4XA 1J88A 3MRHA 3G9VA 3P0YL 3HFFA 3MDJA 1WSST 4MD0A 2CO6A 3QI9D 4TPRH 1AO7B 2ZXWB 3CV5A 5GRUH 3ALXA 2ZAIA 5D1QC 1NBCA 3LPWA 4KZDH 1QHPA 4RMTA 1ZOXA 2ZX9A 2DOCA 2PXYB 1SEQH 3V0WH 4ZMVA 1Q1JH 4TQEH 3BAXA 4JO1L 5C09B 4C59B 1LILA 3EYSL 4UV4H 4YSUA 5TPWH 1XL6A 4LIQH 2ZWNA 4KPHL 2OCCB 2A0LC 5JW4R 1IV8A 2VR6A 1HCZA 4KH2A 2AZAA 2NNFA 5D1XE 3BUDA 5CMAA 5TF0A 3A67H 1Z6JT 2F54D 1OARH 3R4RA 2R2BA 4IBVA 4IKLA 2UWEE 3MRLA 4JQIH 1KG0B 1EBPA 2AHIA 1PZCA 3KNBB 2C34A 4MB5A 4JLRA 1ZRUA 1J0YA 2DWXA 5F7LB 1I9EA 4ERSH 2VDMB 2ENQA 4U2YA 1AE6L 1W80A 2FDBP 5DHXB 5E4IA 4HX1A 4Z7UE 1OAQH 3MMEA 1K5NA 4FDWA 1F8TH 4RBPH 5I66A 3NGBC 3OKLA 1TETH 5HDBB 5D7SL 4C56D 1IGYA 5L88H 3MLSH 2I24N 2UUDH 3UADA 3ULAB 2B2XH 4J6RL 3O3EB 4GO8A 1CGTA 1FV1B 4WW2F 4BCXA 1U8PB 1CBJA 2GAZB 2KZKA 4ODXA 5I1LB 2CK2A 2HKAA 2VNCA 2CD0A 3QQDA 3SBRA 4Y5VB 1E4JA 3NAAL 3VXNB 3KCWA 4U4IA 3R8BB 2W8CA 2VDOL 2EO9A 3ZYOA 3CSGA 2AK4D 1X4YA 3BCFA 4R7DA 5IESH 3BPOB 4JQIA 1HWWA 1JZ3A 5HHPB 1AIZA 3LB6C 1FGNH 3KH4A 4LHUD 4PREB 5DFVC 3MLTA 4GXFA 4HUWB 1DO5A 1V27A 3ROLB 3SE8L 2X2YA 5LDUA 3LB6D 5HDBE 5MI0B 1P7HL 4NYLA 4LKXA 4ZYKB 1TTUA 4HYTB 4N90E 1JZ5A 4J3TA 1MG2C 3LS5H 4A2EA 4M7KL 3QQ9D 3OWEA 2FX9H 3RX9A 3MRGA 1CFMA 4G6AD 4JZOA 3L2NA 4U1MA 1RZFL 4LQ1A 1TZHA 3BN9D 3ULUD 3CLEL 1F11B 1KV3A 1M4KA 2HFFB 1S5HB 2E86A 1ETZB 1I1AB 4UAHA 1QO3A 1FAKT 4AL8L 3B5TA 1KN2H 3RJDA 5IMMB 1GJUA 1A9VA 4PSRA 3R4DA 4F20A 3QRGL 4CU7A 4L3EB 2CMRL 1U91A 1FPTL 1LTXA 3T6ZA 1MELA 3X1FA 1GJIA 1USZA 3G6DL 3QXDB 2W92A 2JWYA 4ZMPA 2AABH 3WIHH 4N1EA 3KXFA 2ADJA 1YEIH 3QUYD 4XO3A 4C55A 2R4SH 4I3RL 2WBKA 4KTDH 1LEGB 2HH0H 2O5XH 1XSIA 2VDPL 1T4KB 3BDYH 3IE4A 5ISZA 3U9UB 4FJZA 1E67A 2HJKA 4BUQA 1EJOH 4CA4A 2FJGA 1A9BA 3LNEA 1INEH 2VDLB 2IDUA 4C83A 5HJ3A 1NFAA 4G8GD 2WVUA 2FT8A 3BJLA 5FPIA 2LVCA 2V8LA 4DGYL 5DFAA 2NZ9D 2Z91A 4HK0A 4F37F 3TM6A 4ZMTA 5EO1B 3R7RA 3KWXA 1G1OA 4JJHA 4NJ9L 4ZTOL 1OE1A 5DJXB 3VNZA 3WIIH 2WAQA 1KYAA 1TCMA 2VE6B 1PD1A 1NGQL 3O8XC 3TCTA 3X13A 3GI8L 4CDGC 3BKJH 1EFXD 5E5LA 1TZAA 1RZJL 3L4XA 4LCUB 4TUOA 1ZCRA 1ZSHA 2FB4L 1E30A 1NDMA 3QUMB 4JY6A 4NPYB 4ZS6C 4YHML 1YVLA 3NIDF 1GGUA 3B2XA 1I4FB 4WKZA 4YN3A 3RX5A 3K6FA 4UNUA 1X9QA 1Z5YD 2NYYD 3HUJE 3DO7B 4LVNC 4L4VA 1B2WL 5IQ9B 1KV7A 1WP6A 4FYSA 3WLBA 43CAA 4OZGE 5IHBA 2VH5L 1QSFA 2AJSH 1WH0A 5T1DL 4PJIE 4ZODA 5C08D 1PZDA 2AQ2A 1AOHA 2OMTB 2VC2L 5IMLB 1JNNL 1IFGA 1F3DJ 5E08H 5D7IB 3GMRA 4HS8L 4MYWB 3NIFB 3RJOA 3UCRA 1JXFA 4S1RH 3TVMC 5IQOA 4Z78B 1JN6B 4Z3FA 3GZKA 2QPFA 1OTUD 3P4NB 4M62H 5J13B 5HYJA 1R3HA 5IVOA 4ZNEA 5DJCB 4MNGE 3QUZB 2C9XA 3FSAA 3QW9A 1XZWA 5F88B 1J12A 5DC2A 4KY1L 5IB5A 1NJ9B 5HHVL 2G5RA 4J4PC 3QDGB 2WBJB 4A67A 3QJFA 1ZHLB 5HHOD 2HT3D 2VN7A 4M93B 3ORJA 1KLGB 1T7WA 1PL3A 2PXYC 5BQDA 3JV5A 1XSKA 1A6UH 1K8DB 8FABB 3ZZQA 4N2DA 1IGMH 3JTSB 4PY8J 2X3AA 2UUDK 4PLOB 1BEYL 4YUEL 3AWEA 3S98A 5TQ2H 2VJXA 4KGJA 4JO1H 4AGLA 3FO9A 2VE6A 2EVJA 4F2EA 5T3XE 3HJEA 3ALWA 4P57B 2R0KH 2VERA 4LEBA 4EKXA 2VZ1A 2CGRH 1TOXA 1N70A 2DQUH 4R90H 1GZPA 4OZGF 2LOEA 1KLFA 4WUKL 2CLZB 3W9EB 1LD9B 4JFUA 3NAAH 4N2BA 3IK2A 4TPRL 2X4UA 1GGYA 3MODH 1MRFL 1UVQA 1J11A 3ZE2F 5F7DA 3OKKA 4G7VH 4MYPA 3LZFL 4ZFGL 4FFZH 1XF5B 2KYIA 4GSDH 1O6TA 1GR7A 3CMOH 3U9UA 3D09A 3NQKA 2H3NB 3VXPA 5A2JH 5J6HB 2ZP9A 4H88L 35C8H 3RZCA 1KCSL 2G60L 3O6FD 3RI5F 1OAQL 2NNAA 3VXOB 3V0VA 4MHHI 3WG7B 3QDHA 3N50A 2AQPA 2QT6A 1WIPA 5A7BA 2F58H 2J1ZA 2YEZB 3X3GL 3RI5K 3U79A 4XBEL 4KKZA 3HNTH 4QXTA 4H2AA 4B5ZA 1KSRA 3BHBB 2CBTA 1U4EA 3N41B 4L3CA 1LMKA 5F0MB 2XTJC 1TZHB 3LHPH 3N3EA 3PXJA 1H6UA 3VX0A 4A04A 1G4MA 4JZOB 3CZGA 4B9ZA 3K1DA 2A5UA 3U4BL 4I3SH 1FL5B 3LQZA 3BP6A 1VEPA 3Q0HA 4MWFA 1VKXB 4C83B 1H0DB 5TQ0L 5I5RA 3DOHA 5L88L 2ZJSH 5E2UL 4UOZA 2HJFB 1CICC 2CMRH 2M26A 2DD8H 4KKAD 1Z66A 1JRHI 1LEGA 1E6OH 1Y6NR 2QHRL 2GTWA 1P84K 2GK2A 4G8GA 4OB5L 4ECNA 1UFGA 1E9PA 1KJ2A 2WO4A 1J10A 1NEPA 3DA0A 4R4BA 4UTCA 3JV4B 4JE4B 4U1JA 5E95B 1OARL 1A3LH 5BRZD 4BQBA 4M7LH 2OJEA 2QKIB 3V0EA 4WW2A 1QO3B 4JNXA 3O3EA 2D7MA 1D5MA 4YZFE 4JPIA 3RE0A 4E41A 4Y8DC 1S7WA 1BX2B 3AITA 4GH7B 3JVGC 4GI8A 1SXAA 5DD6B 1L3NA 4NQXB 3CXDH 1LO2H 2DLHA 3AQZA 3MYJA 5ID0B 5DRXA 4D2NA 3EW3B 4X6CF 2YGNA 5B38G 1KPVA 5EO9B 2WMPB 4K7FA 4JFXA 2FUQA 2CRMA 3O41A 2Y07H 2NSQA 4HIXL 4EQ3A 5IMOB 1HCFX 4CADA 3BFQG 1I3GL 1WT5C 2IH3A 3C75A 3MJWA 4PVMA 3WL9B 4OZIA 4R7DB 5E0QA 2Y7SA 4FP8H 4S1DC 1WFUA 3K6IA 1FI8C 4N85A 1MFNA 3BUBA 2YZ8A 1N3NB 4M00A 5FCUL 3B3IB 1INEL 3GDBA 3SBWC 2GIXA 2WY3B 4KK5C 1JNHB 1YLBB 4MZ2A 2B59A 3NIDE 1DDHA 1NAML 4M8VA 2ATAA 3V8CA 1NC2B 2OMXB 4EO5A 4MRCA 2DDQH 2APVA 1UOKA 1FV1A 2WD0A 3O2DA 4K15A 5FHAH 2VDLH 1S3KL 1DJZA 1R5IA 1FF5A 4LP8A 1DSYA 3V6BR 4XNYH 1DBKL 2OQJA 4U1IB 4KROC 2K6YA 5KVGL 1L9RA 3CSPA 1AO7A 2YPKA 4PJXB 4MS8D 4U1HA 5TDPB 3MMEB 2BMKA 2FJSA 5DRZA 1NBVL 3I6KA 4FQ1L 3OXRA 4XHJD 3STZB 1LQBC 4HJUA 1RIHH 5JXAH 1Z9SA 1D9KA 4M8UA 2KLSA 2KT6A 3WEMA 4P46A 1NUGA 4H0IA 1RZGA 4FQHB 4L1HA 3QDAA 1WHOA 3VFGL 3X3FL 1LQSR 3A21A 5HHME 1UXMA 3GJFA 3QXVA 2EIEA 4W9HC 5T5FL 1TVHB 4UYPA 3FB5A 2NY5H 5E9DE 3ABZA 3KDPB 2X6UA 5M94B 4ZMLA 4MBOA 4YSTA 4K9EC 3T0DA 3C87A 5BVJB 1MJ7L 3L3KB 1AGFA 3MGAA 4PJDF 4L8BB 1UKSA 1KCLA 3G08B 4EDXB 3GYRA 3MNZB 3MLXH 1MJJB 5EU5A 1X7QA 2BWQA 3MV8E 3NSFA 4BSJA 5E8EB 3OXSB 4JY4A 1QFWM 4MNQD 2CO6B 4XPFL 4K2UL 3GTVA 2GITB 1OCWH 1PG7H 1NLBL 1RZIA 4XB3A 4EI6A 2VZ3A 3B2VH 3MRHB 3NZHL 4XAWH 5D72L 1ESOA 2MKWA 1G87A 3NPZB 2NUPA 4CC4C 3MLYL 2F2HA 4LLMB 3Q9QA 3NCYP 3SOBL 4BKSC 1LEIB 4UMGA 4Z7WE 1UJ3C 4LPYA 3M8OH 5BMFH 1J05B 3OBAA 3I6SA 1FN4A 1H6FA 4CUCA 3E3QC 2PTTB 1XGTB 3BQUD 4HUUB 2DJ4A 4Y0GA 3RIKA 2CJ3A 2XVLA 1OE3A 1JGEA 3D2UB 4JFYB 3WEBA 1MFCL 2VDOB 3P9MA 3ZTJG 1UXWA 2WLJA 1RERA 4LVOC 1JHLH 4M43L 1PVHA 3SE9L 2CK0L 3ZDZE 3KVPA 4B9PA 5C6TL 4LNRA 5EORH 5JHLL 5IBLC 4K3JL 3H9SB 4M48L 1USQA 4CN1A 3MGTB 2IANB 4L8CA 3U36A 2DMKA 3CVBA 3QCVL 5I75C 3L45A 3NZ8A 2YGOA 4OZGA 3LN4A 4UANA 4KHXH 5JW4Q 1BGXL 4OQ1A 3UEZA 4UIKL 5E8EA 3QUGA 3O9WB 5AOIA 2IFFL 1M6UA 3U9PL 4DP9X 2PPAA 1DQQB 1MHPL 4Y19E 1X5XA 1IVLA 4MX7A 4L8BA 4TVPH 2JKRM 2ZXAA 4K7PL 1W72H 4O02H 1GMEA 4WWID 1BF2A 1CD8A 1A0QH 2JIXA 3QUYB 5I1JH 3BWZA 4AJYV 4R97C 3VD0A 4LNRB 1EEZA 3FB5B 5ID1B 1KIQA 4LPWA 1K4CA 1XCTB 2B4CH 4L4TB 5DFTA 3GEFA 4K7PX 2EDBA 2X10A 5DZOA 3WLWC 3GMLB 3D0VB 3WEXA 1JP5A 2OMWB 1YY8A 4G7SB 4OJDH 4G8GE 1LO2L 4IOFC 4FQ2L 4X98A 4QHKI 3T0ED 5JW3L 1Q90A 1J1PL 5E2VH 4YX2L 4CC0A 2CXGA 2QV4A 4FXTA 4XC1L 4RFEA 5D2LF 2OP4L 1XCQA 2JE8A 4Q8BA 1F13A 4LLMA 1QNZL 3IPBA 3OXRB 4I85A 4ZW7A 2BVOB 4LARL 4FJ6A 2EH8L 4NFCA 1X3DA 4Q6IC 5FHBH 3EOAB 2L7JA 2WLHA 1CGSL 1TKWA 4LOEA 2WGNB 4K3JH 3TBSA 3VFRB 1Z9NA 4TSAL 3RA7H 2Z0UA 1C16B 4HQQL 5KS9E 3UCQA 3CZJA 2OQJB 3BUQA 2EEBA 3NEOA 3K5RA 4G9FE 2X2HA 3NGBB 3L4ZA 1RKRA 3APMA 2Y2YA 3PF2A 4N9GB 3CQQA 1TQCB 3HOGA 1J86A 4WSKA 3AT8A 2CCLA 3ZDYE 2AF2A 1IGCH 3Q48A 4OFVA 1JD7A 3SZKC 3MV9A 1MHPH 3D18B 3B9DA 3EOBA 1OXYA 1M9WA 2BVPB 3RZCD 2DWEA 2R59A 2ITEA 4AUUA 3S5ZA 4DGUA 3SDAA 3KW7A 4JHWH 4M61A 4F2ME 2VXTH 4P0DA 3RIAK 3B9KC 3TU6A 2WXLA 4JFHE 5J89A 3R06A 2QLVB 3GBNL 4P5TA 2BS8A 3HMXL 4G80A 4AUYA 1KFAH 3KPTA 2NW2A 5FGCE 2AMGA 3RWFA 4FP8L 5ID0A 1EHNA 2AK4E 1IGFH 5CILL 3L9YA 4XH2B 4XP5L 1KJ3H 4NQXA 4ELDA 3ESMA 1T4WA 5CGTA 5IW6A 4DGVH 5CD5D 1QP1A 1S7WB 1QWUA 1HXMA 2ISDA 4LSPH 1NMAH 3PQYE 4GMTH 3IJ7A 4O2FA 1L4IA 1WA0X 5AAWC 3D85D 4QAMB 4EQ2A 5CD5C 3QJQB 5MEPA 3CZUB 3BGMB 4KI1A 3QDMD 3G5ZA 4LASH 4C8XA 1GZHC 4WQOA 4ZX4A 2XPZA 1F02I 2VDPB 5FUOL 3K4AA 5DWPA 1OCWL 2H26B 2WYTA 5EZIH 4KMLB 3I9GH 2CUIA 4Y4FB 3KYMB 4EOWH 1DN2A 1M7XA 3OF6A 4XXWC 5E8PA 3JWNH 5EU6A 3ZKXB 5IMOA 3UL4A 1YN6B 3TO4A 1NGPL 1QRNA 4KXZI 2Y5EA 2E46A 1ZY9A 4HLJA 1YRKA 1IAKA 5HVWA 4OJCA 4BSWA 2WV3A 5FO7B 2R29H 1QYGH 2EDRA 2VABB 2VXQA 3QSKB 4U3SA 3L5WB 2H1LM 1MCQA 3NCMA 2BVYA 5DD6A 1EANA 3NCFB 4YDIL 5DC0A 2QVKA 3ZQWA 1QKZL 1IC0A 3BVUA 3KPPB 2E7BA 2NXYC 1BD2E 1CXFA 2OL3A 4E41B 3PGDB 3EFDH 3O6FA 2WP3T 2VQ4A 1KB3A 3FHEA 5DVNA 1I3GH 3ARGD 2YRPA 3ZHKA 4DPBX 3N1PC 4GKZA 4YDLC 2W60B 1C8PA 1O7VA 3EH1A 2LABA 4Y2LA 5JW5A 3PGFH 2WB1A 2CU9A 3JYCA 1P2CB 4HFUL 1YC7A 4RISH 5ITFB 5FO8A 4H0HB 4YZWA 1NAKH 3M8OL 3AQDA 4IGBC 3MOAH 3AY4C 1CIDA 2BZDA 2E8YA 4QHKJ 3MRCB 3NA4A 3SGJC 3VXPB 1I1AC 4X7DC 1UYWH 3F00A 3TYFB 3PNWB 3PLYA 3KPNA 4PY7A 3DJTA 4YXHL 2R56L 5E24E 2XV2A 2YRBA 3B1UA 1R46A 4LCWE 4TUKH 2GC4C 3BP6B 3P1VA 2ZCLH 4OZHF 2D4DA 1BYNA 4BKLA 4OW6A 3KPRD 1WEJL 2DLTA 4MCZA 4NWUH 2Z6FA 2BNRD 3STLA 4PJ5E 5AW6B 5C6WH 3DLQR 2AQQA 2AJZB 1MCWM 2JCCB 3FRPB 5E4OA 4L1BA 3FK3A 2UX6A 1PTZA 4Y2OB 2RA1A 3CHSA 1EIBA 3P3TA 3DGGA 4LQFH 4WO0A 3A0OA 4YHOH 3SJVA 1K8DA 2H3XC 1D7CA 1LWJA 2JNZA 4PJFA 4G82A 3K6SB 3H9HA 3H4HA 3RNQA 1N9PA 3MV01 2H4EA 2P28B 4I9WE 3BAEL 3KS0H 1R0AL 2E4FA 3AS3A 3T08A 4AEHH 1KGYE 4R2GB 1CBVL 1JPEA 2AK1L 1SXBA 3QNZA 5F88A 4DPRA 4QCIB 2BJML 2E9IA 2WYIA 3ISWA 4DN3H 1RFDH 4HFUH 2OS7A 2RIKA 2VL4A 1LO3L 4QHLA 3QUML 3OKKB 5BUAA 1FYTE 4IJTA 1UD6A 4W81A 1TQUA 1KBGH 4IBQA 3DGCR 3VFVA 4KRLB 4TLTA 1R5WB 3ASOB 3EJCA 4UILL 5CF3A 1MH5A 1OT2A 1GZPB 1HQRA 1L0PA 4RMSA 5FYLE 5JIQA 4DKFL 3GSNH 2WXMA 4M1DH 4QRRB 4YXLL 5EU7C 1XBDA 3TWYA 5LCVA 3G5VA 1NAMH 2C3WA 2PNDA 2JJVA 4HAFA 2W07A 3QR1A 5JXED 4DK5A 1FE8L 4JDVA 5FA3A 4FNUA 4NM4H 3ZKXC 2VH5H 1NDMB 1N26A 3AB0B 3QUMA 5CR1A 4HPYL 3QUXD 1YNLL 4JFFA 2LLLA 4XRCA 3RURA 1KLGA 1AY1H 1EDYA 5J13C 3KXFE 4JG0H 4PJCE 2XIBA 3T0VA 3TBWB 1Q0YH 1SMOA 4GEIA 1IIKA 1JDDA 2XIDA 3LHPL 1HXYB 5J11B 3R7QA 1JUFB 5JORB 4DP8X 1JZ4A 4GG8A 2C1OB 5CEYA 4TSAH 3RA7L 2Y7OA 2BVQA 1UGKA 2NXYB 5HJ3B 4P59L 2EXYC 4JMXA 4X0NA 3GMRB 5DJ2B 1UM6H 4LIQE 2K8QA 2UY7B 2ZX8A 4CU8A 2K0RA 4D0DA 1EVTC 5HHXH 4LAQH 2ZD0A 1A5FL 3WNLA 4LSSL 5DQ9B 4YHIB 3VXRE 1MY5A 4ZXBD 4YBQD 4L9LB 4L4VB 2KQNA 3ULVC 1CFTA 1WE5A 4JO5A 1MFUA 2D7NA 3ELAT 5H94B 1ZJAA 5TGBB 1UT1A 3QYCA 2YEQA 3ARPA 3L3GA 2IQAB 4JKPH 3H3PH 4GKOA 4YHNA 1CGYA 2ZZUT 3B9EA 3EBHA 4QWWD 5F9JA 4ODSL 3ECVA 4YXKH 2CIKA 3O4LE 1ETZA 4A2FA 1CD9B 1G7HB 3H85A 4AMKH 2Y5TA 5DJXA 3ZL1A 2YKLL 3NCJL 3C5ZD 4YVNA 1NFKA 2NTSP 2IDCA 3FQUA 1KBPA 4WTQA 5FYJH 2JKSA 1MHHB 3RWEB 3KJ4C 3TFKC 5K59E 3GJFH 1M57B 4OIIH 1A3RH 4UNIA 2HTKD 2NQCA 3LRHA 1AGDB 1F3RB 1FC2D 1UWYA 3EYVB 3GRWA 1KY6A 1U8IB 3DX8A 2E4TA 3P9LA 4PREA 1YMMD 4UV4L 5T3ZD 2CXKA 2HLAA 2VMCA 1C8QA 3FT3B 4EIZC 4J3UA 3QWOA 5CJOH 2BRRL 4XBEH 3UTPD 4HS3A 1AP2A 3TN0D 4AV0A 4CAGA 2IWGA 2ENYA 3IMVA 3L4VA 4B97A 3GFUA 4NS0A 1RPUA 1GCFA 4LQFL 4RAVB 4XVTH 2XKSA 3D08A 5F7UA 5I23A 4Y5YA 3NA9H 3V7MA 3GSVB 4IIQC 1H15A 3S97C 4BFJA 2VXSH 1KCSH 2Z7WA 2JVUA 3O3AA 1QSVA 4X6DB 5F93C 4MNHB 1QSFE 4HG4K 5T1DH 2VXVL 2VRQA 3AGWA 5SX5K 1WEJH 2WIIB 3MR9A 4ELMA 3UBXG 2AVFA 5JXEC 4XX5A 5AZEH 1CLYL 2X9ZA 5KYXA 5I66B 5DZNA 3RUGF 1OM9A 4PJFB 4P3DB 3Q13A 4GNKB 1I1YA 2RCSL 3IMUA 3QFJA 5JPMA 2KS0A 4CVXB 1H3VA 2V17H 4PW9A 2DQUL 4JR9H 2YXVA 2UVFA 3RNKB 4AC4A 3ZW3A 4X7TB 1QABA 2FWUA 1HHKB 5TDNB 2I27N 4X6BB 2HKFL 3K8LA 4KO9A 4MAUL 2HX9A 4YH6A 5SWZD 5HHPA 2YKKA 3T0EB 2VIRB 2VJ0A 4GPVA 2XBDA 1SXCA 2XV3A 1DBJH 4OQTL 3ZE0F 1I8UA 2DWDB 4J3OD 3TYFA 3WNNA 5GIRA 1F1AA 4N3TA 1WQVT 4E9YA 3QRFM 1ZTMA 3PPSA 3BUIA 5I9QC 2J8UF 2VZSA 1RP8A 3Q8AA 1CURA 2YOAA 5KTEL 4QF1B 1IAMA 5EZJA 2BFGA 1T04A 4KQ3H 5CJXA 4GKZB 1KIUA 4J3VA 5GSRA 5HI3C 3T8XB 4NQCD 3IGKA 4JREC 4F3FA 3V6OC 4X6CB 2RJMA 2YD9A 3EADA 3CDFA 4RH4A 2NLJB 4Y1TA 3T0EE 3GMQA 4C56E 3ARXA 2DIEA 4HKZB 3MRDA 4BFKA 2CDEA 5EFIA 3CSYB 5MENE 1TTGA 4JHUA 2A6JA 3VB9A 2UWEF 4BWTA 1IAOA 4BHUA 2R2BB 3UBHA 3FSVA 2A83B 4Y4HD 3I9GL 5BPPA 2D0FA 5HHMB 3WDJA 4PG2A 4HXAL 2OTUB 2C9QA 3UZQA 2YAPA 4KITB 4BK5A 2O26U 1AFVH 2F54E 3QCUL 4NDMA 4P05A 1RSYA 1XGUB 2BCKA 2BOBA 1QFUH 2G0KA 3BLPX 1FFOB 5MHSE 4B95C 2B1AH 1S7SA 2YUZA 4J8QA 4FFVD 1K2DB 2HFEA 3RBSA 4XN4A 3CNKA 1AZBA 4PJCF 1JZJA 1KCRL 2A74C 2DQEH 1ZT1A 1AJ7L 3QIBB 4UINL 4WFED 4U6VL 5EU6E 3WOVA 2VJ8A 2GCYA 3TONA 1CC3A 3LIZA 2HT2C 1CXEA 2EIZB 1G4RA 4ODWB 4YZFF 4AM0Q 4CC4A 1MCLA 4MD0B 2BSSA 2X53A 3HG1B 3QBTB 5E1IA 1MCSA 3LH9A 2PCFB 2WK2A 3E6HA 1IC7H 3VWJD 5CCKH 4BUHA 4HXBH 4LVHB 2BSCA 3T09A 7PCYA 4TLUA 4K94H 3UC2A 3EGXA 5D2NA 4FA8A 1RUMH 1TNMA 1P6AB 3EYUL 1JDAA 5DZ9A 5IFJA 2EDXA 1B2YA 3B2MA 1KLUA 2J3SA 1BPVA 4AYSA 2X05A 5JLZB 4HD9A 5KVFL 1PZ5A 4KMTL 4F58H 4X6DE 2VZTA 5F3FA 1F58L 1HNGA 3MV7B 2WLLA 4ZD3H 4FFYL 3PGCB 4FLHA 5JOPD 2XN9D 5BV7H 3OAWA 4AYFB 1DJIA 1HIMH 2CUAA 1N68A 1BDYA 1DBMH 4YHYB 5JHLA 3SDAB 4PJEE 2D7PA 2VUOA 4MNQE 3A4DA 2YQBA 4WI7A 1U3HB 3U4EB 3J27A 3UTOA 3MAWA 5C0AB 3HBGA 5C97A 3FC8A 2VMFA 1HAUA 3BESR 4PH8A 1OANA 4ZUSA 1N8ZB 4MMXB 2AKRA 1H9DA 2JI2A 1A7RL 5ALBH 4X4YA 3ZMRA 4LLYB 4NFBA 3VXRB 1TTAA 2FUTA 2DYPA 1E3ZA 4AGPA 1ZHNB 2JKWA 3KJ4B 2HVKB 5C0DA 1ZS2A 3H6AA 1S7QB 4EI5C 4OI9A 1OB1B 3D4GA 3FTXA 3DI2B 2Y2WA 2EYSB 1YPZB 1PZBA 3MROA 4XBGB 3QZWA 3TTSA 4AZUA 3HZ3A 5LNEA 3QUHA 3AXLB 3UTSE 3APDA 2NY3D 4PQXA 3WNMA 4K9JA 1DJYA 1DEDA 4HOMA 2NMSA 4RX4D 3T1FA 3QK0A 3B7TA 4FZ8H 5J3HC 1S7XA 2V5RA 2RFXB 3WLWD 1G9NC 5IJKC 2Z35B 3WFBH 2FJUB 2UYLA 3WMQA 4Z7OF 2XKNB 4ELMF 3GMLA 3N44B 5J9PB 3QJXA 4YK4B 5EBWB 3LZFH 1UD2A 2Q1EA 5IW3A 5KS9B 4UB0H 1AC0A 1F4HA 4KQ3L 2GI7A 5DD0L 3NZSA 2X12A 5D1QE 1TEYA 5HYSG 2ED9A 3HC4L 4PJ5A 5IWLC 5CLXA 3WXWL 3AXLA 5KBKA 2G3ZA 1UWEH 1K5WA 4QXVA 1YPZA 4XI5C 1CQKA 1FL3A 1T0MA 3DRQA 1QZNA 1TZGH 3O9WA 1VDGA 3ZVVA 2PMZA 4JM2A 4FNPA 1N8ZA 5I8CB 2ROXA 4Q6IB 3FQTA 4X4YB 1M1SA 3MA9H 4FQ1H 1XB6A 4M8RA 4XMTA 2P47B 4MAUH 3CVIH 3NCJH 4Y1AE 5TDOB 2O5NA 4HIJB 4WWPA 4K0OA 2R7EA 3MV7A 3O81A 5D70L 4EE2A 1DBAH 3QDJD 5E8NA 1AJ7H 4UINH 5DJ0A 5F1NA 4TRPL 4ELME 3Q2LA 4UI2A 1X5MA 3BD4A 2ZXQA 4QRPB 2LT9A 3GHEH 1XGQA 5FFOA 3W56A 2ESVD 1F6AB 3EGXB 1SMDA 4WK2B 4EI5A 3BGFB 1NMBH 2G5BA 4IIQA 3VFNA 2FSEB 2H6OA 5IFJB 2NY5L 4F8TA 3S88H 1S6NA 2V3DA 2GITA 4LT7A 3CC5A 2O61A 2E6PA 1YMMA 1HYSD 4GFXA 4JDTH 4ODWA 5E1GA 2XWTA 4XMVA 4AQAB 4R90L 2XX1A 4FQJH 3QIBA 3QIWD 4N8PA 5BVJA 2V7HA 3H7BB 3NK3A 1XGYH 1FBIH 1WITA 2Y6SD 3E2HB 3EOYG 4JANA 4AQ1C 2OAAA 5KBLA 4L37A 4RMVA 4LRIC 4ZMYA 2A74B 4EPSA 3V4UH 2WLKA 4AKPA 4UAOC 1KGUA 3JWOC 1FVDA 2AJYL 5IMKB 4Y4HB 2MFNA 32C2B 4ZPVA 5H2BB 4A7SA 4H8UA 4KJWC 5ECGA 2OMZB 4G6KH 2MRYA 3H0TB 4IRJB 4J12A 4U6YB 4FNTA 3UXFA 4D9LH 1UH4A 4N1CA 4OF0A 5DI8B 1DBML 1LJMA 5FCSH 3JBG7 4QRRD 4HIIA 4HIEA 1SLUA 4EF3A 1M05A 4FFYH 5IW1B 1PCSA 1JHKL 3P11H 5LUMA 4ATWA 5IQNA 3DGDA 1U95B 3LNGA 4XO5A 3V0AC 2IAAC 4P2RB 3VU1A 1CMOA 2EIBA 3QO0B 5BJTA 2J7LA 4HJ1A 4XXCA 4NO2B 4M8QA 2EXYD 4N2NA 4OLWL 3HI5L 1G9NL 1WO2A 4F2MA 3IBOA 3FF7A 3HCVA 1C5BH 2WQXA 5D1ZI 2O4EA 1SUHA 4K94L 3PFUA 4GINA 2ZOLA 4OUOA 4WLCA 3TYGL 5E8DH 4YHZL 5GIRB 3K2UL 4TNFA 1OOWA 2WZ6A 2XQYG 1XBRA 5F96H 3BXNB 1PLGL 3ET9F 4ODTH 3ZDZB 5GS0C 2GEEA 3PDDA 1R5VA 2VLRA 4U1KB 5I1EH 5MEOA 5F7BA 4PR5B 2XPGA 1RUQH 3OKMB 3VUAA 1LO4L 4FTVA 4G9FA 4DKEL 3TT1H 1B6UA 1NGQH 3VXSA 2VSCA 1YQ2A 2BVEA 1O75A 3PNRB 4HK3J 3O41B 4UZGA 2A9AA 5TDNA 5TF1H 4F80A 2Z92A 3MJ8A 4NAJA 4MAZA 4MD4B 3WFCL 4UIMB 2WMPA 3AG1B 5T1KA 4A7GF 2F5AL 3IE9A 4NLAA 4DP0X 3EJTA 2W9DL 2FX7H 4DTGL 4KKQA 1TLKA 3KPQA 4IKJA 4GI9A 3HPJA 2C7UB 1FDLL 4IGBB 4GRWB 4JHBA 2W0LA 4HZLB 1FSKB 3N9GL 3MZTA 3GKWL 4UT9H 4ABVA 1D5MB 2HG0A 3DSFH 1CICA 2K7QA 4ZNEE 3S34L 3NT0A 1F3DH 4AX3A 1SF5A 4APXB 1IKFL 1WGOA 2QPEB 3HS0B 3ISRA 3S96A 4PBDA 4NN6C 2XBTA 1BMZA 1TT6A 4RAVA 3TN0C 3L4WA 4N1HB 3UJTL 4PJ8A 4QR7A 2GJ6E 1PG7W 3GMNB 4P5MA 3GSVA 1AP2B 1HHGA 1S9XA 4X4XB 4ALAC 4YK4C 4ODHH 4WUUE 4EVNA 4YWGL 1M6OB 1JZ6A 1PEZA 3BOVA 4QYOA 4C56A 5BNXD 1MXGA 3GXPA 5MENA 4L8SC 3BSZH 1E4KA 3EAKA 5JHDA 1JYXA 3L4UA 3MJ9L 3QWOB 4H8HA 4F7EB 3FDWA 3A6BL 5DSCB 1KWGA 2H0EA 2R2HA 4JS7A 5D1QA 2FX9L 3ARBB 2ZXCA 1CE1L 3V9EA 5ERWB 3WIAA 3C2SA 5CEXB 1AGDA 5G5DA 1JMXA 1JV2B 4KJQC 4OCMC 2HG5B 3QAZC 5KEZA 3VFOA 1K4DB 2EDJA 4FHKA 1MHHA 1FFPA 1D6VH 3QIUA 4OJEH 1P5UA 5IG7B 4UU9B 4X80H 4WTWA 4AEHL 3DX7B 2VDQB 4OQTA 4I0PB 4K23H 2W81C 3CGTA 1CD1B 2PWDA 3AVEA 4U1NB 3SO3B 5A6LA 2YEZA 2Y1YA 2EEDA 3MODL 1FH2A 2I5YL 2E6QA 1QAWA 5JIDA 1AHMA 3SPCA 3EFFA 2NNAB 2CGRL 2IQAA 3EDJA 3T3PB 2YQ2A 3ZHDA 3ISYA 5FFGA 1JHTA 5TQ2L 2H3NA 5FGRA 1WC7B 1IC1A 4WO4A 4OGXH 5EF0A 5AVQB 3IF1B 2KUTA 3KYNA 3ZN6A 1UVQB 3W0WE 5B21A 1TZIA 5SV3A 3PGFL 4WI6A 3VGHA 4OLYL 5C0CD 4GG8B 5T1LB 2CLZA 4MJHA 2DQHH 2XYCA 3T65A 2AEOA 3SBWA 2HP4A 1AXSA 4XP1H 1UM4L 4E9XA 5LHDA 3WFZA 3S35H 4DO5A 1HXYA 4PRIE 3DHUA 3RFZC 2H32A 1JTPA 3HZMB 3JTSA 4NFDA 4L9LC 3NCCB 4PS7A 5FYKH 5KOVC 1J8RA 1P5UB 1RZKH 2AJVH 5E94A 1ZA3B 3VJ6B 4HWZB 5F3HB 1T1WB 4ZFZA 5C2BL 1NLDL 3RGHA 3V4VH 1OQOA 2AJSL 1JPFB 2AABL 1A1NA 4HJJH 3QFDB 2QKSA 1E4XL 4NZUL 5IB5B 3UPRB 1L7IH 3GNML 4PJAF 4TSCL 2APBA 4HEPA 3JVGA 4YHOL 4G6FB 4MAYC 3F7PC 3H9SD 1QA9A 3SE3C 4E9WA 4P23D 4UB0L 1L9MA 1T5WA 4UTAA 3OJMB 4AE0A 4LCYB 1YC8A 2AQNA 5JNYB 1UJTA 2AXFB 3BW9A 4YSPA 1BBJA 2KLRA 4PRNA 4XXDB 1QSFB 4FG6D 4N22A 2EUZA 4Q9QH 1QLRB 3ZE0E 1HINH 4NJ9H 2EDNA 3EJRA 4ZTOH 4XMKH 3O9WD 5FYJU 3Q6FA 2F61A 4WU7A 5FUOH 1SOSA 4P99A 1MJ8H 4P2CG 5E9NA 3S3PA 2NR6D 2OR9L 5FUZL 3VG0H 1GH7A 3UP1A 4JY6B 5CU9A 1BD2D 3IJSA 1KGWA 3VI4B 3M17B 3KVQA 4R9HA 4KKAC 2C7UA 1TCRB 5E8DL 1BF5A 2CDFA 2ENPA 5AEAA 2R69A 1V7NH 3GRBA 1D5XA 2JCCA 4Z95H 4DERA 2N1KA 3VSUA 3LQAH 4U3CA 3KPRB 4IDJH 4G6FD 4UIMA 2BSDA 4XGZA 4HMEA 4DP2X 3DURB 3C09B 3PU7A 3H2QA 1XWVA 5BZDA 1AFVL 1IKFH 3LRKA 1MFMA 4NNYB 4DP5X 1DSFL 4YLCA 1MIML 5I6MA 1SZNA 5AG8A 1ORQB 4XMLH 3KPNB 1AHWB 3VW3L 3L3HA 2A73A 5FS5A 5D93C 4ZS6D 4BZ1A 2HFGH 4XMZA 3QORC 3TASA 4F7MB 1BFVL 3QDME 5KYWA 2E6JA 2Y7LA 2BNRB 3JWNG 4R3SB 4EXKA 1LDPH 5BXFA 3L5XL 4RLDA 3RJQB 5M7QA 4I8DA 3DIVA 1PZSA 4P4RA 1IGTA 3PQYD 2NY6B 4XMXA 3D39E 1RUPH 4HEMA 4P2RA 1NCWL 3TVMB 4R8WH 2H1PH 2FQFA 4PMEA 5IW1A 5DD1L 5IIEB 3IJYA 2DWTA 4ZFOB 4HIIB 3AQYA 4CGUB 3FCSA 1QFWL 3K2UH 3BKMH 4GKNA 1TLMA 2VABA 3VCLB 2FEJA 5ESVA 3QC6X 4RAUA 2B1HL 2VN6A 4ZPVB 5H2BA 4X6FB 4AXWA 2IPUK 3L7FB 3TJHD 1CGXA 5GZNC 3TO4B 3EYQC 3PIQB 1HL9A 1E40A 3GRGA 4A7GA 5BCAA 3NACL 3TCLA 1P4IL 5K1JA 1H6TA 1BVNT 4Y4FA 3U0PB 4X99B 4F8NA 2BO0A 2V7HB 4TF4A 3FOMA 1MJ7H 1S46A 4BELD 1AE6H 1B4LA 3HUJB 3Q3GB 3BVTA 4MS6A 5F8QC 5GRZA 4Y5VA 1MLCB 3SO3C 1E4KC 3IFNL 3KD4A 2NXZB 1TO4A 1ZVYA 1U8PA 2GAZA 2X3CA 5JOPE 1ILUA 5IHHA 4EDWL 3X3FH 3BH8B 2Z34A 1DYZA 5TE7H 3HB3C 3PWPB 1UKQA 1Q8MA 2ADFL 3QR2A 2Q6WB 3PHQA 1GGBL 1I7UB 4GW1B 1E8XA 1BZOA 4JGMA 4HX1B 4JE0A 1XGYL 3FT9A 5I16B 3CFUA 2DLFL 5L2KD 4QRQB 1X5LA 4HJIA 5L2JA 4PP1D 2XQYK 4M48H 5I1KH 1HHJA 3ARDD 3UTQB 4ZMNA 1P6FA 1SN0A 1BFVH 2JK5A 1HOCA 3BFWA 3SE9H 1SXZA 1OK8A 4P5TB 3ZHLA 1SXNA 3R06B 3VI4E 1QX1A 4OLYH 2NW3B 3DHPA 2XC8A 1AHKA 1P7QB 5ANME 2ZYIA 3GWJA 1ZK5A 2Z3FA 3WMPA 4Q97A 2DY2A 1JRHH 3C5ZB 1UG9A 2BVPA 3CDCA 2DYPD 4AYBA 1IC5L 2YAFA 3FQTB 1T2XA 2EKSA 4FF9A 1N7ML 4DVRL 4ETQB 5I8CA 2HKFH 3G6AB 1F6LL 2QGCA 2XWXA 3LSOB 5JQ6L 3B2VL 3NZHH 4XAWL 2O1AA 5C9JB 4M6AA 3REWA 5AYQA 3O2DL 1HAWA 3VFPA 3CU7A 4E9LA 2LQRA 4FJYA 1J7VR 4U6XB 3IFNH 2XV0A 3ARGA 3NJFA 4B3EA 4BK5C 3LQAL 5SX5H 1T2QL 3MREA 5DWUL 4E42B 2GJ6D 4U2ZA 4ZW8A 4M1CC 4O02L 3NEEA 1IRAY 1FG2A 5KANG 4FA7B 5AYTA 5A7EA 2BVOA 5KN5A 4AEIL 4OCRH 1KMGA 2IXQA 2PYED 3HEIB 3RVTC 3X11A 3U6XS 1D6VL 1EWHA 1YAZA 3CJJA 3DVGA 4YSCA 1T5KA 2H32H 2P7TA 3BI9X 3QUKA 5EF1A 4HJTA 4MMXC 2H5UA 1RZKC 2VQ1B 4M4RB 4DESA 5FECB 4ZAKB 5HGAA 4Q9QL 4OLUH 5DUMH 2H6PA 4GLRI 4N68A 5IWLA 5ID1A 3A6BH 1T1XA 5D6CB 1ZEAL 3T3PF 2X4SB 1U0QA 1OP5H 2J71A 1RIHL 1RIVL 1RPQA 2JJWA 3MLUL 4RA0C 4HU8A 5AB0A 2C3XA 1MFBL 3ARQA 4BHUI 3VD5A 1JWSA 4UT7H 5BVPH 5FO9B 4LSQH 3MROB 3W5NA 4LCWA 3TOPA 3FQRA 4PGJA 5F70A 3IB4A 3JQOB 2JV6A 5E2WL 4L5FH 2VM3A 5D9SB 3D8MA 5CKAA 2PN5A 4P2RD 5D1ZB 1Z5LA 5FGCB 4E5XB 2YSSA 1IEAA 3OTTA 1N8OE 2A9NL 1XR9B 1XTLA 3SO5A 1EZVX 3QHFL 3NESA 5IBLD 3Q8BA 4XCFH 3CH1B 4JFZH 1GGTA 4CMMB 3U4EA 1IO4C 1KXHA 2ZWKA 4POYA 1JWSB 3L3JB 3I75A 3MGTA 4L8CB 1U8MA 5EC1A 1GZHA 1NSNH 4M3HA 4QRTB 4KMQA 4N0RA 1LEKB 5INDA 2WQAA 5D6CA 2JB6B 3D2UA 2UZXB 5KWYC 2EXWD 1JVKA 2H6UA 2XVKA 1CLOL 1FNSL 3MBXH 2OMUA 4NQEE 3FQXB 3WNPA 1BV8A 5T5NG 1I8MB 1HS6A 1IKNC 4M56A 5DUBB 3FH5A 5CLYA 4F8LA 1JV5A 3U4KA 1LO4H 3CFNA 4BM7A 3I6LE 1NUNB 3BZDA 4PM1A 3WNJA 2JIXD 5JPNC 1YEGH 1QVOB 3WY1A 4J28A 3B3BA 1MDAA 3ENEA 2H8PA 3AAZB 4K5OA 3VXSE 4HDIA 1ANUA 4R8WL 6FABH 1QBBA 3RWJA 5CN2A 3NABL 2X4QB 3V9FA 3LN5B 3II3A 5CZKA 1UZ6E 1H8LA 5BV7L 5DS2A 5EIVA 5FOJA 5SWSD 3RPKA 3GI9L 3VFPB 2EQDA 3EDDA 3O2VH 1N5YH 4J1UB 4YR6A 1KPRB 1MHCB 2OMNA 4EN3C 2R2EA 4AUJA 1TVHA 1M71A 4RMWA 4JRXE 3WENA 4DW2L 3C6LC 2XA8L 1OP9A 1EAPB 1Z0NA 3UJJH 3I2CH 1BIIB 3AM8C 3EYUH 3WUZA 4QRAA 5A1AA 1OEZW 3WKMH 1J5IA 4AYDC 3EGSB 1GW6A 1EZLA 3RKDD 3LNHA 1NFDB 2ZF8A 3T5WA 2MEJB 2JK5B 2G2NA 5JHDD 1ETA1 3CDZB 5B3NA 2PF6A 5A43C 1Z9SB 2G3MA 2B15A 5EWIH 2GJRA 1UM5H 3FCGA 4PJXA 4AH2B 1UTDA 1VEMA 1O5DT 4X6CA 4PWJA 4U1IA 5I8KL 4WIQA 2MMXA 4A6YL 5LXGL 4Y5XB 3TPUB 3VAEA 1SY6L 5F8RC 2VITA 4KVCL 3GSRA 1NC2A 2OMXA 3Q9PA 4L1DA 2CZNA 2ZAHA 2ZOUA 1KTDB 1HHHA 3HNSH 4LSTL 1I9RH 4KOCA 1JNHA 4UCFA 1LXMA 3ZDYF 4QHMB 4ISVB 5I6XB 1OY3B 3B3IA 4PEEA 4RZKA 5LDSA 1QFHA 1I3RA 2HMIC 4NN5C 4CADB 3GO1L 5IVXA 1KYOK 4MXVE 2XN9A 1KTLB 4U4BA 1WAAE 2J5LC 4XNUH 3V5HA 1PKQB 1URZA 1TQVA 3MKKA 1HJCA 1RQ5A 3W11D 3EJQA 4NZRH 4WGVB 3LPOA 1ITCA 3O6LL 1AI1L 4APQB 9PCYA 1HHKA 4HCIA 3BKCL 3BQUC 1CI3M 1AD9B 3FF8A 3ARDB 5D7LA 3D0AA 4W9FC 3TEUA 1P0SE 1KPVB 5EO9A 3E38A 4KTEL 3ZDYB 4F5CE 3DX4A 1IGIL 4G7YL 2LGNA 4JPIB 3MOBH 4WW1B 4R5TA 3VG9C 1BQHB 3BIBX 3GJEA 5CZVH 1IC4L 4I18B 3IDYC 5DA4A 3PWLA 1U8HA 1ZLDA 2WC7A 3IDJB 1U2YA 3FUFA 1KJ3L 1U8JA 3BH9A 2AV7B 1IIIA 5KJ7E 3G6DH 1UOLA 3TA3D 5IHZB 2ADIB 4MJIB 3HAEH 1KXVC 3QZWG 4UF7C 3FQ1A 4ZUWA 4F7MA 2Q9OA 3DX0A 4UQ9A 4KK5D 1BF8A 5GISH 3Q8CA 4XBMA 1Y1UA 3H2WA 5FKAB 1BAFH 1XGRB 3WTXA 1UB5A 2EEAA 2B3RA 2LU5A 4P4KB 1Q4NX 5I30H 3NZUA 4EAEA 2YD6A 3IJHB 4XVSL 3CBJB 3FMGL 1A7PL 2FH6A 5F7NC 3H3BC 4F8PA 1ZT4A 4GBXC 1NBYB 4DTGH 1W0WA 3FQWA 1SJEB 4MBRA 3RWEA 3K0WA 5AKRA 1G9HA 4PJ5D 1OSPH 5E1QA 4XTRC 5D1XC 3FQUB 5JDSB 3KPRE 1FL6A 4PS3A 1AS7A 4KKCD 3ULUF 5DURD 5EOQL 5F7WC 1FLTX 1U36A 1NMCC 1ZWIB 3ARUA 3MUZ1 3TIDA 1YY9D 1P84J 3RGVB 5CGYD 2P5EB 2HVJA 2OZ4H 4IRZA 4J8RA 4OY9A 5E5UB 1SDYA 3D9AL 4E9VA 1XSOA 1HFUA 5L4MA 2WLMA 1JWMB 1ZPLA 5IFAH 1QNZH 4KJYA 3U0TB 2VR9A 4PGDA 4WO4D 4IOSA 1AMXA 3WDIA 3PV6B 2VOTA 3GRWH 1PD6A 1WF5A 1ULVA 3TIEB 5I1EL 3UDWC 1BQRA 1KTKE 1BQHG 5DK2B 1JGVH 3NJKA 4Z7QE 1A3ZA 4QAWA 5J6HA 1CYGA 4UM8B 3F62A 2V9RA 1MN4A 4XN7A 1LD9A 3BMVA 2W88A 2NY0D 1AKPA 1GJWA 1JMZA 2W0FA 2XN0A 4PGCB 3G5WA 3HMXH 2BVQB 4XMUA 5GGQH 2YBRA 1C5BL 3PREA 1P7KA 5CFAA 5HD8D 1W72A 2J6EH 2OI9C 4NUGL 3WHE0 4TTDD 2A9BA 1G9NH 3FFOA 3LKOB 3WFDH 2E9BA 2CO7A 5DQJB 3WY3A 1NWPA 4XWGL 3AY2A 1UWGH 2GT9B 3OGCB 4G6KL 3HBPA 5C07B 1VF5C 4IMLA 8FABA 3EJYC 3A4AA 5E4EB 1A1NB 2YD7A 1T22B 4KV5E 4N2CA 3LQMA 3RFRA 4UQDA 4HWZA 4ZFZB 4Y16C 1T1YA 4F7PB 1U2HA 2XWZA 2ZONA 1FIGH 2NY6D 5F21B 2UZIL 4M03A 5CIPB 2Q8AH 3W5MA 3QJFB 5B1AB 4Y2DC 3VTAA 4U3HA 2GBUA 2FX7L 2DJMA 1SFHA 3V4UL 1Z9LA 2F0CA 5BO1L 4Y2DD 3QUZA 3V4PL 4Y88A 3U2SA 2JSFA 1WTLA 4QJ5B 3BDBA 1P5UC 4M43H 4K3GA 4U7SA 2CWRA 4JO3L 2XZCH 4N2MA 4XNXL 3VFWA 4HWNA 4UM8A 4LRNL 1P1ZA 3P4MB 4AWJC 1CT8B 3GD1C 1ND0A 1PNCA 3WJMB 5FYKU 3JWDL 4H13C 3TIEA 5L7XL 3INOA 2KLTA 4H88H 4W9LC 2B39A 5AW2B 4TQHA 5GJTH 3LVTA 3C5JA 4W9GC 3PL6D 1JHTB 1AQDA 1T89C 3HHSA 4TNWK 2PW1B 4X7SL 3L8QA 4QXWA 4XCNA 1AH1A 1DJGA 5B4MC 2IALA 4GW4B 5DA0B 1IL1A 1F3JB 2N3JA 3BPCA 4MNQB 4S1QH 3RVXC 2A9NH 1T2QH 2ADGA 2CLVB 4O02B 5HGHA 3RPIA 2EZ0C 3AU1A 1I9RL 3GSNL 3ULUL 1PZ3A 5F2FA 2QFRA 4NPYA 3X13B 3DHMA 4L4TE 2FECL 1IT9H 3HC2A 5C0EA 2F53D 1SJXA 1UWXK 4IBTA 3QIUB 4KXBA 1KXQA 1LO3H 3VXMA 3EOTH 1ZT4B 2CO3A 1I8KA 2X2JA 4PV9A 3VXMD 5EZOL 5AD0A 1KF9B 4FZEH 5AFAA 3GIVB 3O2WL 3DDGA 2WNXA 1NIEA 4LVOB 4ZTEA 4AJVA 1TFPA 2XRAH 5KVDE 4P2YA 1LM8V 1YEKL 3EH3B 4POZD 3LEYH 2GY7B 4TQEL 1GSMA 1T5XA 5HYQA 3UGEA 4XN2A 4JFED 3K5SA 2R1XB 3RWGA 3VSQA 1MLBB 6TAAA 3KXFB 1ML0A 4JFFE 3RY6C 2VW6A 1A25A 3EXJA 2IG2L 1BIHA 4CNIB 2PCXA 2NT1A 1NKGA 1RJZA 3CIQA 3F7QA 4ZUTB 2ADIA 2Q7AA 3F5WB 3BJ91 3O6LH 3WTVA 2XA8H 4MLSA 4AI7A 3D25A 2OCJA 4KOBA 5DJ6A 1YA5A 1P2CA 2P5PA 1MUJB 4HA1A 2Z8WC 4RRPG 2W38A 3P0GB 4BCZA 4DZ8B 3ZHFA 5I73B 1J9TA 3VGEA 1BP3B 3B6SA 3MLYH 5F3BA 3OAZH 4TUKL 3D5OF 2PUQT 3LKSA 4S1QL 1I1AA 1PG7L 1XSJA 5GS2D 2P48B 3NCWA 1TQBB 3DTUB 5IEKA 2J8UB 3S2AA 4N0UE 3NIFE 4NRXA 1KBWA 4ZW3A 4BFGA 5I1IH 3LEVL 1MCOL 2EAEA 5EZLB 1ITBB 2D3VA 4N6QA 3L5WA 3KPMA 3CVHL 4M3KB 2B5IC 3MLSL 1LP9B 4M5SA 3JWDH 4UQ3A 4DEWA 1QBLH 2Q7NA 1EO8L 1F4WH 4DN4L 3QORB 3SODB 1I85A 4A6YH 3CFIC 3FBKA 3OQ3B 3WKNA 2DYRB 3WS6C 2HB0A 4O5LH 1U58B 5HI3D 4JK0D 3F7RA 2CJUH 3HAEB 3IFOB 5ESQB 1IGFL 5IM7A 2FZ3B 1NC2D 1UQSA 4FABH 1BFTA 1JTOA 2X6AA 4BRVA 4G42B 3BXNA 4WEBH 4X9HA 1A6WH 1CG9B 4WRLA 5SX4H 3FT1A 1OAKH 1TZOA 3KPSA 2K9UA 4AQEA 2LLNA 2ZOLB 1WT5A 3BGMA 3JWOH 1CL7L 5EU3B 1DN0A 4HH9A 3OF6D 1WCBB 3F6LA 2ZOWA 4HOXA 4FOMA 1OTUC 4KX7A 3MUY1 1FGVH 3UZVB 1VACA 5DHDA 3RUGE 3OB8A 4ZT1A 1RUAL 3GSQB 4XWGH 5F7YC 4YMPA 1OAXH 3L9RA 4JLRB 1CTOA 4HF5H 1UACH 4LRIA 3ILDA 4ACPA 4H8PA 1KG0A 1Y1DA 1SVBA 4WK0B 2ZCKH 3KLSA 3ULVD 4G6AC 2CCWA 2WAHA 5DRWB 3ZZLA 1GGCL 3V7AE 1F58H 4OJYA 1D5ZB 2JJTC 4NKOB 2OL3H 4FHJA 2YGQA 4IRJA 4U6YA 1MVFA 1P4IH 4MMZB 3QI9B 4WFGD 2JF1A 3EFOA 3PL6C 5IF0B 1FZJA 2HLEB 2VUYA 3HVNA 2QPSA 3U82B 2ZIDA 2OP4H 3EG9B 4YSSA 1TJMA 3FTVA 5ADPL 3MV9B 4HEPG 1MKFA 1UZ8B 1VGEL 4Y16B 1KCWA 2XZCL 2M1KA 1IARB 4KUCF 1FVCA 1ODAA 3H42L 3HFMH 3VTTA 3WJLA 4Y4HC 2WCGA 5KUMA 2JKXA 3POHA 4NQDE 3V6FA 3CX5K 2KC0A 4PB0L 4U6VH 5HVGB 1K3IA 1OCCB 5SWZA 1ZMYA 3L95A 3DROA 4A37A 2IBGA 1X5FA 2GUOA 2PW2B 1GPOL 3VGDA 1XO8A 3D2UD 3GM0A 1CQYA 1OTSC 3OMIB 1J5DA 5I5JA 4G8FB 4WI8A 3SBQA 2MH4A 3BFOA 1XIWB 4IIQB 4BGLA 4YHLL 4PPTA 3ARZA 3FPYA 3WE1A 2XTJD 3NSYA 2P49B 2UX7A 5DDHA 3V8OA 5IQMA 1RP9A 3C5ZC 4C54A 5D7HA 1F56A 3OZ9L 1RZ8A 1VCAA 2OMWA 4M1GH 2K70A 2XCMC 2YXMA 4XNXH 3ZDZF 4XNAA 3DC0A 2R27A 1QFOA 4NQDB 1BQUA 4FNLL 4PJ9C 4Z77A 4WNJA 4F27A 1SHXA 4YLQT 3IPEA 1HL8A 1VB9A 2YD3A 3FT2A 1X5IA 5CLWA 5LQBH 3A67L 4UTBA 1QTSA 2GG1A 1YEKH 1VENA 5GHWH 4GQZA 3T4YB 1G7QA 3DMMC 2BP0B 1MY7A 4HLEA 3M86A 3VQLA 5JPNB 2AJVL 1ZLWK 4OD3L 1CICD 1E50A </