3GIWA

Crystal structure of a duf574 family protein (sav_2177) from streptomyces avermitilis ma-4680 at 1.45 a resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
262
structure length
262
Chain Sequence
RIDTESAHSARIYDYIIGGKDYYPADKEAGDAMSREWPALPVHMRANRDWMNRAVAHLAKEAGIRQFLDIGTGIPTSPNLHEIAQSVAPESRVVYVDNDPIVLTLSQGLLASTPEGRTAYVEADMLDPASILDAPELRDTLDLTRPVALTVIAIVHFVLDEDDAVGIVRRLLEPLPSGSYLAMSIGTAEFAPQEVGRVAREYAARNMPMRLRTHAEAEEFFEGLELVEPGIVQVHKWHPDAATADGIRDEDIAMYGAVARKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Rossmann-fold protein of unknown function (DUF574) (NP_823353.1) from Streptomyces avermitilis MA-4680 at 1.45 A resolution
rcsb
source organism Streptomyces avermitilis
molecule tags Unknown function
molecule keywords Protein of unknown function DUF574
total genus 84
structure length 262
sequence length 262
ec nomenclature
pdb deposition date 2009-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04672 Methyltransf_19 S-adenosyl methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3giwA00
5EHGA 5EIFA 3KU1A 4RTKA 3LCVB 4YV1A 3ER8A 5CVDA 2FRXA 3T0IA 2IH4A 4EMSA 2FK7A 3KPJA 2P35A 2Z6QA 1N7IA 5FTWA 2OBFA 3C6MA 1NW8A 3FRIA 3GCZA 1QZZA 4P58A 3JWIA 3BGDA 2B3TA 3OFJA 4U7TB 3IHTA 5E1MA 1AQJA 2C7OA 1G38A 2B78A 3GRVA 4V0RA 3PX2A 1M6YA 2AZTA 4V0QA 2IH2A 3BGVA 3I53A 4FS8A 2HV9A 2H11A 3RIEA 1IM8A 4UOEA 2OO3A 3OE4A 1KHHA 3A27A 3JWJA 2QM3A 3JWHA 3P9NA 4QPPA 2ZLBA 5HFJA 2ZWVA 2PSSA 1X1BA 4ISCA 4GEKA 4U7PB 5DWQA 2K4MA 3F4KA 4RX1A 1NV8A 5ERGB 4FP9A 2AR0A 3LKDA 1Q0SA 1N2XA 3OU2A 7MHTA 2I62A 3HCEA 5GIOE 4PGGA 5FA5A 3PX3A 3FTCA 1VPTA 3FUVA 4PNEA 1KYZA 5EOVA 5IKMA 2Z6UA 3PVCA 4AZTA 2IBTA 4X61A 2OXTA 3UJ7A 2O57A 4PIPA 5FQOA 4LECA 3B89A 5B1SA 4P7FA 4IV8A 5F2NA 2P7IA 2R6ZA 2UYHA 3HVKA 2ERCA 3T7TA 5D1NA 5BP7A 4PGHA 1WS6A 1QANA 3KQPA 3EVCA 5HILA 1EAMA 4RVHA 5DM2A 5LSAA 2HNKA 5E1OA 2DULA 1QAQA 5DM1A 1D2GA 5E1BA 3HVHA 4OA5A 1FPQA 5T67A 4RYLA 3TMAA 2QE6A 4ER7A 2YVLA 2I6GA 3GNLA 3P9CA 1P39A 3DP7A 5K03A 3DTNA 3ORHA 3THRA 5LQJA 1EJ0A 3THSA 4RVGA 2LD4A 3KR2A 4ER6A 2ZULA 1RI3A 1U2ZA 4PONA 5KQRA 4MIKA 2AVDA 4OQEA 1EJ6A 2ORED 2VP3A 2V74B 1G8SA 3TPZA 3UBTA 3HA7A 4KDCA 4OX9Y 5HZMA 3CKKA 1RJDA 3KR1A 1DUSA 4P7KA 5DTRA 4QTUB 5ICFA 2AN4A 3NWEA 3M33A 3UJ6A 4QTTB 1YB2A 4IWNA 3FPGA 2PWPA 1Q0TA 1ZG3A 2IIPA 3EEYA 5EKUA 2AS0A 3UA3A 1VL5A 2FK8A 4C08A 4YUZA 1OR8A 4DCMA 3FTFA 2B25A 3TM5A 5HIKA 2E5WA 4CTKA 5E9QA 3E05A 4DKJA 3O7WA 1JQ3A 3LKZA 3UJCA 2IDKA 4HG2A 3MB5A 2ADMA 4RWZA 4OBXA 5FA8A 5E8JA 1SUSA 1D2HA 1KXZA 2UYQA 1SKMA 1RI4A 3SGLA 3HP7A 2F8LA 3FTEA 4P7GA 1PJZA 4YMHA 2ZZNA 3V97A 2AOWA 1NV9A 5E1DA 2CMGA 3G2QA 2ONZA 4AUKA 3KPUA 1XVAA 3NDJA 5HIIA 3E8SA 4KIFA 2AOUA 4GOOD 5EHIA 4KDRA 2ZBQA 4RVDA 3M70A 1G6Q1 2IDJA 5K0CA 1KYWA 5HIJA 4QPNA 4EKIA 2HWKA 3NMUF 2NYUA 4GOLD 5FULA 4DQ0A 3O31A 3SX0A 3G89A 2G1PA 4YV0A 4DCGA 3PFGA 3K6RA 4YUVA 2P40A 1WXXA 4E33A 3KPYA 1O9HA 1SQGA 4GOMD 2HR1A 3DLIA 5CD1A 4F86A 4KW7A 5EGSA 4YMGA 3MERA 3HEMA 4QVGA 2PLWA 3IV6A 4BLVA 1VBFA 4M36A 1KIAA 4XUCA 4GOND 5EQJB 4P7JA 3I9FA 4YV2A 3B5IA 3GRZA 1SVUA 3R6TA 4PYNA 4R05A 5GWXA 3U81A 5DSTA 2P7HA 2VDWA 4OQDA 1X1DA 5DTMA 1ZGAA 3DH0A 4EVIA 2PGXA 4MQ4A 4GBED 3UJAA 2PX5A 3DMGA 3FPFA 2YXEA 4PIMA 5DTQA 1JQEA 2VDVE 3C3YA 3HCCA 2CKDA 3TM4A 2YXDA 3RODA 3EVGA 3AJDA 3A4TA 5M5BA 2QRVA 3G2MA 3HM2A 2EG5A 2YUIA 1X19A 3LDUA 4NECA 1BKYA 4CKBA 5FUBA 4AZVA 1M6EX 2NNWB 2XBMA 5DRYA 4E31A 4F84A 5GM1A 1QAOA 3REOA 2WA2A 3FUUA 1INLA 2PT9A 2DPMA 3FRHA 3FPJA 1YZHA 4IV0A 5G02A 4C4AA 1MHTA 2XVAA 5EMKA 5BW5A 4FT4A 3A26A 5CVJA 5CVUA 3TLJA 4HC4A 4CKEA 4E2ZA 1XJ5A 2PX8A 2QY6A 5K0EA 1D2CA 1RJGA 4PINA 3G8AA 3BWCA 3E23A 3KQYA 3PT9A 5DXAA 3Q87B 5CCBA 3PTAA 3CCFA 1YFJA 5GP1A 5K0BA 1N7JA 3NWBA 2Z6AA 3EEOA 5FQNA 3EMDA 4GC5A 2AOVA 2NXNA 3IYLW 4A6EA 2NXCA 2O07A 3KPVA 3TR6A 3SSOA 4PYJA 4IKPA 4DA4A 5EZQA 1JG4A 5E9JA 2PWYA 4ATNA 4AZWA 4E32A 2BM8A 2G70A 3EPPA 5D1HA 1NKVA 1XDZA 2NXJA 4RTNA 1WXWA 3BKXA 3GRYA 4RTSA 2PX2A 5K0NA 3KPWA 4EK9A 2PXAA 1G8AA 4FSXA 2P8JA 5P8WA 3MHTA 4K6MA 3MTIA 5EZSA 3LCCA 5GM2A 3TRKA 2JHCA 4A6DA 1BC5A 3ELYA 9MHTA 3M6XA 2BR4A 3P2EA 2XVMA 5U4XA 4RTPA 1G55A 4JXJA 4O29A 5ICEA 2JHPA 1RI2A 3GRRA 5K0FA 1R74A 3FPHA 1F3LA 1TPYA 3R0QA 2JH9A 1F38A 5DM4A 1XTPA 5EEGA 3EVFA 3UJDA 3UJ8A 3LSTA 4R8RA 1O54A 4YUWA 3MCZA 1L1EA 4Y2HA 3TFWA 3P9IA 4BLWA 3C6KA 5K0JA 4OBWA 4R6XA 4XUDA 3P2KA 2BH2A 3TOSA 3ERCA 3UFBA 3AXSA 3LHDA 4E30A 1I1NA 4QQNA 4KWCA 5K09A 1YFLA 1L9KA 4XCXA 5E9WA 4AZSA 5DX1A 3ANXA 3ID6C 3R24A 2Y1XA 3Q7EA 2OB1A 4WVLA 3HCBA 5EKXA 5BW4A 2WK1A 3S68A 3BZBA 4MHTA 2BR3A 3KQSA 3LBFA 4B17A 3LL7A 1NE2A 1R8YA 2CWWA 2FHPA 3AWIA 3G2PA 1P1CA 2C7PA 3SR4A 1NW3A 5DM0A 5JUWA 2BZGA 5DX0A 5EVJA 3KQTA 5C0OE 3PLAE 1O9GA 2HTEA 2OPBA 3C3PA 5EMLA 1JQDA 3CJQA 5LQUA 2ZWAA 1KPHA 3OZRA 5KVAA 2GH1A 1WG8A 3EVAA 4RV9A 3G2OA 4E70A 2VDUE 5H02A 2JHAA 3VYWA 2UZ4A 2ZSUA 1L3BA 4RVFA 2G8NA 5DLYA 2PJDA 2ZW9A 1R00A 3SMQA 4AX8A 1XDUA 2OZVA 1XCJA 5LQNA 3SSNA 4PYMA 5E2AA 4RTQA 1VP9A 2AOUB 5CUQA 5DRTA 4DM3A 4LWPA 1JG3A 2JH8A 4C05A 3OZTA 5E8RA 3G7UA 3KQVA 3OU7A 3OU6A 1ZKDA 4PCAA 4RSRA 3CBGA 4GF5A 1SUIA 3G5LA 3SM3A 4M38A 2I7CA 2YR0A 2ZCJA 3P9KA 3HA5A 1HMYA 3GIWA 4ER3A 2B2CA 2VS1A 5DT2A 4QDJA 1L3IA 4KRGA 1Y8CA 5GOZA 1VQ1A 1MJFA 1SG9A 4OA8A 3IEIA 3PB3A 4HGYA 2YX1A 3HA3A 4BP3A 1R6AA 3CC8A 3MTEA 3SSMA 5KYGA 3DLCA 4X60A 4PWYA 4DF3A 2FPOA 1AF7A 3CGGA 2GLUA 2IGTA 2ZBRA 4C07A 4ER5A 3BT7A 2GS9A 5K05A 5BXYA 3TKAA 4C04A 4FZVA 2OB2A 3KQOA 5GIPE 1AQIA 4QQKA 5EG5A 2YQZA 2CMHA 3EGEA 2NP7A 4LG1A 4BP1A 2UYOA 3EMBA 3ELDA 3QOWA 4HRAA 3KHKA 3KR9A 4PYOA 3HVIA 2IP2A 1P1BA 3EVDA 3FYCA 2G71A 2ZFUA 3LECA 3NVMB 2EJUA 1UFKA 4RTLA 2ZIGA 2ESRA 2IFTA 3G5TA 3GWZA 4PYKA 5EEHA 1YF3A 8MHTA 3KKZA 3P2IA 5DX8A 5C1IA 1NBHA 4E2XA 5K0GA 5FADA 5CIYA 3FPEA 3L8DA 2ZIEA 3BWBA 4RTRA 1YZ3A 3D2LA 2OY0A 3UJBA 2UYCA 2ZZMA 3G88A 4RTMA 3BGIA 2P3QA 2AN3A 1KPGA 2GAFA 3H2BA 2XYRA 3VC2A 4GUAA 1RJFA 1KR5A 2A14A 2P3OA 3LPMA 2OYRA 2IBSA 1JSXA 1KP9A 3VC1A 1TW3A 5HOQA 1V39A 1I9GA 1RJEA 1RI5A 2PBFA 5LQKA 2BR5A 2ZTHA 3B3JA 2KW5A 3CVOA 5DXJA 3HCFA 3GRUA 4BLUA 3LDGA 5KS2A 1NT2A 4XUEA 1WY7A 1SQFA 5C9ZA 2IH5A 3KR0A 4ZTBA 4HTFB 1EQAA 1JSZA 2WA1A 4QDKA 2PY6A 2P41A 1T43A 3BWMA 3G8BA 1X1CA 4LWOA 2QYOA 4POOA 3HCAA 3HNRA 5KQSA 2GB4A 2JG3A 1FP2A 3P8ZA 5CM2Z 2PXXA 5ICGA 1B42A 2EJTA 3OFKA 1NW5A 2O06A 1NW7A 3OE5A 5F2KA 5HEKA 4Z2YA 4CWAA 2IPXA 4EKGA 4PYQA 5GINE 2PKWA 2EFJA 1ZQ9A 5EC8A 2G72A 5FCDA 3DR5A 3MGGA 3HVJA 4MWZA 3A7EA 3LBYA 4C06A 1L3CA 3GU3A 3O4FA 4L7VA 2Y1WA 3R3HA 4WXHA 4X63A 2NP6A 1NBIA 3FYDA 3OPNA 3WSTA 4YUYA 5LR6A 3MAGA 1JTEA 4X1OA 5EMJA 3FUXA 4GC9A 4HTFA 5DSXA 3UZUA 4YUXA 3DMHA 1VE3A 1XXLA 3EGIA 4QVKA 2C7QA 4M37A 3BKWA 3NVKI 1ORHA 1BHJA 4FR0A 3TQSA 3BWYA 3P97A 5DPMA 1IXKA 1QYRA 1RI1A 1XDSA 2PT6A 2AVNA 2OKCA 2JJQA 3V8VA 3DXYA 3OCJA 4R8SA 2YXLA 5CCXA 5HIMA 3KQMA 3ME5A 2H00A 3P71T 3VSEA 2HMYB 1X1AA 4E2YA 2CL5A 2VZ9A 4HGZA 3RW9A 4H0NA 4DMGA 2P1DA 5ICCA 5LQRA 2ZZKA 4F85A 5JR3A 1FJXA 2N47A 1FBNA 3C0KA 5FWAA 2AOXA 5FHRA 3FTDA 3NJRA 3AY0A 2PXCA 3I58A 2PVCA 1Z3CA 3TKYA 4GQBA 5MHTA 1YUBA 4EQZA 4RTOA 2O05A 1IY9A 2EX4A 3B3FA 4FGZA 1DCTA 3LCUA 4M7RA 3T7RA 3X0DA 3A25A 3I5UA 1M0EA 4PYIA 2Q41A 1ZGJA 3GGDA 1ZHFA 3ELUA 3CJTA 3DOUA 1WZNA 3B3GA 1UWVA 2H1RA 2O0LA 2PX4A 3A7DA 3GXOA 3LX6A 1EG2A 3DUWA 4PYLA 1TW2A 3FZGA 3KQWA 4HH4A 1P91A 2AOTB 2FCAA 3E7PA 3EGVA 3FUWA 3LGAA 5EPEA 2C7RA 4R6WA 1VLMA 1R8XA 3UWPA 3NTVA 3HTXA 3SXJA 5LQCA 2GA9A 4HSGA 3M6VA 1I4WA 3ER9A 2XYQA 5CVVA 1AV6A 1FP1D 3M6UA 3DXZA 5T64A 3QV2A 3KQQA 5EMMA 5E2BA 3NW9A 5T6BA 4PCLA 3ELWA 4FSDA 4BY9E 2GPYA 2V7EA 3K0BA 3R9XB 4MTLA 2B9EA 2R3SA 3DXXA 3PS9A 1BOOA 3UA4A 1G60A 1JG2A 3UJ9A 4E2WA 1HNNA 1ORIA 2NXEA 3LDFA 3SVZA 2AN5A 2I9KA 2XYVA 3B7PA 3NDIA 2ZVJA 4G56A 4CXMA 2YTZA 1XCLA 2ONYA 2AOTA 2BM9A 3DULA 5K8VA 4KVZA 3DMFA 3GJYA 3MQ2A 4FT2A 3GDHA 4DZRA 1NW6A 4C03A 5LQAA 10MHA 1PRYA 5K0LA 3CJRA 2PV0A 3PFHA 1EIZA 3BUSA 3I64A 1H1DA 3MCTA 1R18A 2P3LA 3BXOA 3GO4A 5K01A 1UIRA 1VP3A 3EVBA 5F2OA 1JTFA 3M4XA 3T7SA 4CTJA 3EVZA 1DL5A 2FYTA 5CVEA 3OZSA 4X41A 3FUTA 1VIDA 4Y30A 3EVEA 4KIGA 4CKCA 5FHQA 5EIWA 3M6WA 2QRVB 3JWGA 1QAMA 4ER0A 2ZIFA 1JG1A 3AXTA 2ZBPA 1JR4A 4RTJA 5FWDA 5IH3A 1KPIA 3QOXA 3HCDA
chains in the Genus database with same CATH superfamily
2A1TS 1EGHA 2FQYA 1E3WA 4PLVA 2ZT8A 1GAXA 4DJ5X 4E0BA 1D4FA 1TA9A 1VMEA 2ODEA 4FZ5A 2QRQA 4US0R 5AJXA 2FK7A 3ZZ0A 5C8YA 2WHEA 4G6ZA 4DLBA 1BS2A 1PZXA 4NV3A 5I48A 4N9QA 3WL5A 1QGED 1TF7A 2LV8A 3GEDA 1AU9A 4LGVA 3WB9A 3BGDA 3GLVA 2ZRLA 3JYLA 3OMLA 5E1MA 4UTNA 1DKNA 2R1VB 4R54A 3NM5A 2BMWA 1A4UA 2GQ0A 4V0QA 1AV7A 2P62A 3BGVA 1SZDA 1PDOA 1NSFA 2DQSA 4GL2A 2OO3A 2P4EA 2AA3A 4N8DA 4V2UA 4YJFA 1E1QA 4RFSB 4IDOA 4J0KA 4BU0A 4DPLA 1JALA 1R4ZA 2YHUA 4LOAA 4X66B 1P1HA 1SG0A 3UHOA 3VKUA 4AWAA 4B2YA 4Q1AA 1CLEA 1WMBA 2AR9A 5GIOE 1W5AA 4OIMA 5KTNA 3LNCA 3V42A 1YBFA 5EOVA 1IMOA 2Z6UA 1QIMA 2HFJA 2Q2WA 4G1MB 1M7GA 4TZ0A 3C7KA 2YY7A 3EXFB 1EZ1A 1L4FA 2KLBA 2JCXA 2LBPA 4G5XA 3SOPA 2R6ZA 4IPTA 1SKUA 4M60A 4URHA 5LP6C 4Y2TA 4PGHA 2O1SA 4UTVA 1YZQA 1ZH6A 2BEVB 3JQAA 4TVBA 4X1KB 1A7AA 1ECCA 2P1ZA 3NWJA 3QJYA 3CRRA 4D0SA 3EOBI 3N2YA 1XP8A 4TMXA 4FFBA 4HXFB 4ND7A 1F3OA 5BYKA 2CBXA 2KJQA 3TAUA 4YCLA 3EXIA 3VPBA 2LD4A 1ZICA 4FIDA 3T5GA 2YIMA 2JDID 1QFZA 4PONA 4CR7A 4H4DA 3M82A 5ALQA 1O95C 3NXSA 4YO8A 1LXCA 1DGQA 1Y80A 1LVHA 2ILTA 2PZLA 2ZCUA 3PXDA 4K8RB 1I5OA 5J4VA 1PEAA 3IVXA 5A62A 4I1SA 1NURA 1NVUQ 1SCUB 3FPGA 3VR0A 3N5CA 2FUG6 1GSHA 3DL0A 4KR2A 2H2DA 2PO5A 3JYNA 5BQPA 4YUZA 5JSFA 1C9EA 4LYAA 2ZBDA 3L7OA 3MWYW 5G3ZA 1E1NA 2CL0X 2QJFA 4MGEA 1ZEMA 3NR2A 5TQ0B 3S2GA 1LTQA 4W9NC 3SLKA 1V2HE 4LYFA 1JQ3A 1PJ3A 4AL4A 3PFCA 1WDMA 3PFIA 1NU6A 3PUVA 2ZROA 5EERA 4CCWA 4FE7A 3RU7A 4AO8A 5TMDA 2I8AA 3NHMA 5LLTA 3DBHA 1IY1A 1KXZA 3O4JA 4AF6A 3K0KA 1L1QA 1FYVA 1GHTA 1Z47A 3M6AA 4LGYA 5KBYA 4LRTB 3S7TA 4OHPA 4QWWA 3TQTA 2BBTA 3KE9A 3NBZC 1BDMA 2PJRA 1P7YA 1YFKA 3ER6A 1XEXB 3VX4A 1ZD9A 4GXNA 1UEXC 2GN4A 4Q39A 2O2CA 1UBMS 3GPBA 3EUEA 1YHZA 5A9RA 1JXOA 2YJZA 4U6NA 2Q1XA 2PMFA 4HDRA 2GXSA 3S1SA 3O31A 3SX0A 1QJ4A 3IQXA 4LXQA 4HNVA 1Q74A 1Y3FE 1ZK4A 4F4UA 3K70C 4YUVA 4FGLA 2NSJA 4N40A 5BSFA 5T3UA 4N0QA 3I8OA 4Y2GA 4PO3X 2VBGA 1NN3A 2WZQA 4EB8A 4FFWA 2GPNA 1D9XA 4GX2A 3LP6A 2IXTA 1I2BA 2LR0A 4M36A 4YQEA 4G4GA 3W9UA 2FFAA 4EAAA 1W52X 1T2CA 2COUA 3ZG6A 2R00C 1AKEA 2RKBA 3OWXA 4ALJA 1PL0A 5KTYA 1X38A 2V5UA 3PRKE 2X58A 4D44A 3OX4A 1NUSA 4GX0A 4BQPA 3QPDA 2Q4TA 2VHVA 4BMCA 1BKSB 2JFVA 3ILSA 1C50A 1EK6A 1CW2B 2HQSA 2VDVE 4GRDA 1XNGA 1NA5A 2VLBA 4DANA 2JLXA 3EVGA 3EXEA 4AKTA 1XDDA 2Q0SA 1V4NA 1JDPA 2BFFA 4FYHA 4GVXA 4JP8A 3F6EX 3ESBA 4XJXA 2O52A 5KTMA 2PGOA 1UC9A 3LK7A 3F74A 4ZDWA 4G8BA 3DO8A 4CT4B 5H9WA 1KBQA 4JJIA 3VR3A 4LK3A 5BNFA 2FETA 4S1WA 4E31A 1CY8A 3E5RA 4F84A 2GD6A 2NUPB 3MTAA 3SHWA 3IKTA 5DF1A 4YCCA 1LDBA 2Q4DA 2YVUA 2DPLA 3C3EA 2JS7A 3H9EO 3LPCA 4IV0A 3WYFA 1YS4A 3ZJ4A 5JAMA 2DYKA 4IFBA 3BB4A 3LPLA 3BSSA 5CVUA 5M34A 3DDZX 4XWAA 2FZ5A 5T7BA 4I4TF 4E2ZA 3RSGA 4ENRA 1G66A 3AT1A 4DGQA 1RC8A 2YV4A 3Q87B 1V11A 4UM5A 3CIFA 3KFXA 1U81A 5HKKD 3F90A 5K0BA 2Z6AA 1E0AA 2PX6A 4W7HA 3EEOA 2HO5A 4N3GA 2O07A 3KPVA 1GZHB 4WNCA 3IIMA 5J2UB 4E32A 2BM8A 2GZ1A 2EL9A 3FLMA 3MHPA 4LRUA 4YEDA 3RTCA 2MTBA 4RH0A 1V5WA 4NYIR 2C2GA 4EEZA 1V5IA 1EWTA 1WUYA 1YRLA 3OMWA 4BC1A 1VI2A 5HXAA 4KUGA 4RK6A 3ANNA 1G8AA 1KYVA 5DIZA 3TKLA 3E5NA 4U1RA 1SOWA 2XD4A 4U00A 2E9SA 2WWRA 1YQUA 3ZK9A 4AK9A 4PLWA 5LN1A 2FKAA 4RVOA 2E4VA 2XNJA 5AXBA 4B7CA 3KE8A 2BISA 1GYRA 2CLIB 1YACA 1EDDA 3WGLA 1U98A 2QJTA 3MT7A 2I2CA 3F8TA 3JQ8B 5IJ0B 1KVRA 3EVFA 2AMFA 4JBNA 3A9TA 1P8AA 1Z2DA 4Y2HA 4AC9A 1OB5A 3P9IA 1YR2A 2JRLA 2VPPA 5F9MA 2PLAA 2FZEA 3OQPA 4L8YA 3K2EA 3F3YA 3ZWKA 5K0JA 2BH2A 1PO7A 5FV4A 2AQIA 1IN1A 1MQSA 2JKZA 2V59A 3AESB 4XWKA 2QR3A 2WF7A 1E1RA 5C51B 1NBMD 1SK8A 3ANXA 4WUVA 4ZVQA 3MD0A 1T1EA 3QYPA 4ID3A 5C18A 3ANMA 1WD7A 1WP9A 4AYXA 1I7NA 1N3IA 3KT8A 2HF9A 4RMGA 2FR1A 2CMFA 2B7BA 3QTLA 3MOSA 2HWWA 3WIUA 2VTBB 4AJ1A 2ZYAA 3ZK7A 1RTTA 2VXOA 5F73A 1N33B 5TARA 2H9AA 2D5LA 4ITVA 4OP2A 5LOVB 1XKTA 2BM0A 4CU5A 4IBOA 4ISBA 4K40A 3SC4A 1CHDA 5BSRA 1QIGA 1DEXA 1EWRA 1XLTA 2Q3EA 3EIXA 4B35A 4EB6A 3RHSA 3ZV6A 3UG7A 1LSSA 5K51A 1B76A 1OWOA 2Y93A 4A0SA 4ENQA 1CJMA 3C1AA 2PJDA 3SNKA 2GBPA 1NT4A 2G04A 3GLIA 5BRNA 4JXKA 1C9DB 2I2WA 3U61B 1GGNA 2PUVA 2VDNB 3L0BA 5HF8A 2AI3A 1IB6A 4RLFA 4TRRA 2IHKA 3GA7A 2VNKA 2FSPA 2CXNA 2VL7A 1FFXA 1O8CA 3GCWA 3GEPA 5ADWA 3FFAA 4IQGA 3BFPA 4PZZA 4BJ3A 3NASA 4KTVE 4M87A 3BCUA 4MIYA 3IH5A 4BFVA 3NTXA 4D74A 2BGKA 1NJSA 3ZBQA 3KEQA 3MTQA 2EBFX 3FZYA 4GIBA 1VKNA 1GRRA 1AZLA 1Y8CA 3KTAB 1QUEA 4JU8A 3DTYA 1Y48E 3OHMA 4XX0A 3T5PA 2GN9A 2IU4A 3A3PA 4XWWA 3DOHA 3VVMA 2NVWA 1K6MA 3BE5A 3QVGB 1W25A 5ED0A 5A71A 4DLVA 3FSEA 3R0JA 4PWYA 4WFKA 3T12A 5M7EA 1AA9A 1JF8A 1KY4A 1YDFA 1TEVA 1P4SA 2DJIA 2UVQA 5D6OA 2Q7DA 3WRYA 2VQSA 3UIEA 1X42A 3EYAA 2OPHA 1QPGA 4PHHA 4YRQA 5EG5A 1MFZA 1Z0UA 2H5LA 2PV7A 4L8WB 1ZMOA 5H3CA 2OK7A 3E9YA 3DYVA 5DGCA 3UNXA 2J3MA 4TMWA 2RBEA 4D9MA 3NHAA 1EGVB 1Z7EA 4B6OA 1MH9A 4I4LA 4WLNA 3RFTA 1JXQA 4F4FA 1JDUA 3H5OA 2QNRA 3PFNA 2AMLA 5EIXA 2AD5A 1PT7A 3G5TA 4ZRMA 4D99A 4WN9B 4G63A 4D7AA 1SQSA 1WW8A 4HAXA 4E2XA 5KQPA 1LK0A 3NBUA 1Z56C 5F77A 2ZIEA 2H2HA 3C3CA 1J5EB 3ZHUA 5IW8A 4HF7A 3IRVA 3KJEA 5AXAA 1PYDA 1F0NA 3KB2A 4B85A 2GAFA 1RXWA 1BE8A 3E3OA 1R0SA 3AW9A 4PBRA 2P3OA 4ODIA 3AHCA 3OC6A 4NBUA 3EARA 2QAIA 1DXOA 2RHWA 2HA4A 4FFVA 1KQNA 4EUSA 4MRVA 4CFZA 4C4ZA 2OG2A 3D02A 1PJRA 2C2HA 3H7AA 3GRUA 2L2QA 5DNAA 5CVCA 4CRWB 4JYMA 1TAUA 1OYYA 3CXRA 3PUWA 3W2FA 4OATA 2PMCA 3HB5X 1IOWA 2I29A 1PVOA 4NFYA 5A3SA 2V1XA 3MWEA 3HSSA 2WSIA 4EYOA 5LUAA 3IHKA 2NO0A 2J08A 4QATA 1P6UA 4FHEA 3ZHTA 3ACDA 4GP9A 4UDOA 1B1CA 1HDZA 1DI0A 3CPEA 1K7CA 2A86A 1AKMA 4GM0A 3W05A 4N7MA 1KVUA 4LWOA 4POOA 3GEHA 3HCAA 3KCNA 5D87A 2JH3A 2YOGA 4KPUB 2JL1A 3ZE1B 1TZ2A 4Q3EA 4TWRA 1N6OA 1HOXA 1GPAA 4EY6A 4DUZB 4YHHB 1Z4NA 2F62A 1SN7A 3W79A 2E18A 4CUKA 5TY0A 1YNOA 2JGDB 4HMQA 1XA3A 4MKFA 2XNDD 2WTNA 2C83A 2JLRA 4WXHA 2JCGA 3SSAA 4B87A 1MVNA 3VO2A 1N2JA 3T1TA 4KR7A 1M6VB 3DXFA 4AKSA 4JI0B 4HTFA 5ETJA 3UZUA 4QUGA 1DINA 5K6RA 2WE7A 2H9YA 3HB7A 5J23A 4M37A 2MR5A 4JIMA 3S2UA 5KIAA 5EPUA 5LKAA 1AKWA 4G5SA 2QQ0A 5B1EA 3ASZA 4X91A 3FE2A 3QNWA 2OKCA 4NLLA 1JFLA 5FL7D 5G1NA 4D9KA 5ALTA 5HZGA 1RBMA 2QN8A 3OMXA 4LA4A 1GU1A 4Y6GB 2XQJA 3N2GA 3OCUA 5CCXA 4Q3OA 1IBLB 2XNHA 1BCSA 1F8GA 1NVFA 4CODB 2H1WA 2ZRJA 1LDEA 3DAPA 1RMTA 2GHTA 3G6WA 2ZZKA 1QHHB 1YOVB 2B7CA 2PFGA 3OEWA 2N47A 1FBNA 4F85A 4OQLA 2NQ8A 2CXHA 4PSUA 4RESA 3CNOA 3IPAA 1E5XA 1H6CA 4AURA 2IOHA 2GYWA 2X7JA 1NZJA 1AN9A 4BFTA 1K75A 1AQNA 4RTOA 1ZINA 2H1VA 3TIFA 2DTEA 4ZGBA 2AXQA 2GXQA 1U8UA 2IYWA 3I42A 3G7NA 2Z8ZA 1ZHFA 5C7LO 2Q8PA 4R2LA 4DEXA 4X6LA 2JK0A 4R1LA 1TW2A 2XUDA 4MITA 2HO4A 4YI3A 2P6NA 5KYUA 3EEBA 3RSOA 1VHDA 5CM9C 3A1UA 1EB9A 1HPLA 4JI6B 4NKRA 4QM7A 2FOXA 4GM4A 4H1HA 2Q62A 3M6VA 4KG7A 4IJMA 4D8UA 5JAOA 4GSLA 4TL7A 1IJEA 1G3IA 5CVVA 5BVHA 2I4TA 3UANA 1R5BA 3UY4A 5H1YA 1RYEA 2OXCA 1JWBB 1LC3A 1Z06A 3PUJA 2ZT6A 1L9XA 1BOOA 2GAIA 3HXLA 3O4VA 3UA4A 1N1EA 3D7KA 1WB9A 1RJWA 2WFZA 4W6QA 3LHIA 3NBQA 5ED4A 1GR0A 2ZAGA 3U31A 3WNQA 5JAZA 1BWPA 2Y0DA 3HK2A 2EW8A 1ENPA 3DULA 2F3SA 4UM9D 2C9DA 5KYXA 1V1MA 1NW6A 1J56A 1W5EA 2YXBA 2A33A 3KZVA 3H42B 3OZVA 5BYAA 3OTWA 2VDJA 1DMSA 2H5JA 4L9SA 2GUGA 4I3FA 1PR9A 2H0RA 3JALA 4HN2A 4TXLA 3B3QA 1WPGA 5FR2A 4ZHSA 2XUPA 1JTFA 1DWPA 4X6UA 5AW2A 3RTDA 4PFQA 4Q1BA 3IAEA 1F51E 4OVKA 4OI0A 2C0QA 2F6RA 2NSYA 4LBYA 4AX4A 2NAPA 3K71B 1DWOA 3RFFA 4CQMD 5IKPA 4N12A 4XLLA 1W35A 2BFOA 1GAQA 1WMDA 2GJ9A 3M6WA 1L5YA 3MWLA 3SMVA 1JSCA 1LTKA 2ZSAA 3CX4A 3DKRA 2GR9A 2B8EA 3K0HA 3KP1A 4PTZA 5DYYA 4C1BA 4RTJA 2XRFA 1CRZA 1Z35A 1ORDA 2H1CA 4LY9A 1KKLA 2QTTA 1SU4A 2V7BA 1QLHA 4FC7A 1W5FA 1XZBA 4GRAA 4MUFA 5D00A 3VNBA 1WIWA 5CDSA 5K7SA 4BMDA 5C4GB 1DIOB 1QVVA 1CWUA 4ZV9A 4Q4AA 4BMOB 2BHTA 4OQYA 4PSCA 1N5IA 4DG9A 3FRIA 1ZGGA 4RAQA 4YAWA 1ZK2A 2B3TA 3P0EA 4B74A 4TM8A 2OLEA 4GW3A 2B78A 2VKQA 1N2EA 3T61A 4EY8A 4I1YA 4D3DA 3TAXA 2W00A 1R3UA 2YIDA 3OH8A 4R1PA 4UE6A 4EMTA 1UK8A 2GUWA 2XUGA 1P2DA 1N32B 4DB2A 1X1BA 1E6UA 1QUFA 3RK1A 1NV8A 3Q0TA 1YBHA 4ACAA 3IOEA 2AHOA 1GUBA 1Q0SA 2R4UA 1TVKA 1QXSA 1R27A 2CFIA 4U8HA 5HQ3A 1LDGA 2QUAA 1YKSA 3ZDXB 3MWDB 3O21A 5L7TA 1RZRA 1KYZA 1NULA 1SBNE 1VLLA 3L04A 4EKEA 2XMRA 2DVMA 5ER6A 3WFJA 3SD7A 3LIPA 2DB3A 1EP1B 3AEQB 4HUQB 2QRKA 1KBOA 3P19A 1MOSA 1QANA 4GPD1 5HILA 4HNTA 2W48A 1TT5B 3H11B 4F3CA 4IHJF 5KO2A 4EVSA 3CH4B 5DM1A 4ZDJA 3HWRA 1LI5A 2PA0A 5A02A 2RGWA 5DCYA 2CBZA 3I04M 3L6DA 3LTEA 1SZPA 4AVYA 1R2QA 4RA6A 2AJCA 4X8MA 2AI2A 3AHIA 1ZOOA 1RQLA 3LGXA 1NYTA 1DAPA 2ZULA 1LBQA 3BS4A 4F3RA 1DADA 2ZUSA 3LVRE 4QXRA 3VU3A 2LP4Y 2Y4OA 4HAZA 3U4DA 3MC1A 1D09A 1E0KA 1EJ6A 1YRQA 1J23A 4H7EA 4NI5A 3WDSA 1KZ9A 1ULAA 3TLXA 4H27A 3WYEA 4B79A 4BZPA 4M8SA 4P7KA 2COKA 3TOVA 2YHBA 3H65A 3T94A 2OZKA 3FOZA 3T3IA 3AX6A 3OIVA 2IUFA 1ORWA 3OZBA 1I33A 1VE1A 1VLQA 1YQQA 2JJ2A 4XPZA 2XJ9A 1ID8A 5ALRA 3PXCX 3ZS9A 5REQB 4JJGA 1WHSB 4I5GA 2WP0A 4UZSA 3RVMA 4CM7A 1KAGA 2NVUA 2RCNA 3E9EA 4JB0A 4RENA 4R3NA 4MVJF 3ZNNA 4MR8B 4PC3A 2QE7A 2ZAOA 4S1NA 1COZA 3EBOA 3I6ZA 4D98A 3THXA 4AU1A 5FUVA 2I1QA 1JKJB 1X1SA 4MW7A 1II9A 2UYQA 4G0ZA 4JWKA 5FUXA 3F4BA 1RI4A 3DNPA 3WWCA 3Q4GA 2A57A 1MW9X 4A73A 3L77A 3URKA 3V97A 1P3DA 3MT8A 2ONZA 3C48A 3O82A 5EZYB 1D5CA 1E1CB 3UH1A 1G7TA 1QH8A 1RKQA 1U7ZA 2C5SA 4KIFA 4YAKA 1ZLYA 3JV7A 2O9JA 2BEVA 1J5XA 3JQAB 3DBHB 4IEFB 3PDIA 1KYWA 4ZREA 1EVJA 2ADOA 2YY5A 2WINI 5LZ9A 1Y3BE 4DQ0A 1IHYA 1M1UA 4YV0A 1RIFA 3SC2B 3G5AA 2B6HA 5LNK1 3KQHA 2Z2XA 4KJZA 3V1UA 2PUFA 3U7GA 5F5LA 2PL3A 5K0SA 1HG0A 2VAVA 3BQ9A 3VVBA 3OIYA 3PJGA 2PYIA 2FMTA 3ADDA 3QHQA 4W1PA 2W42A 5EXTA 2I34A 3U7QB 2NZ2A 1NBWB 4LSWA 1GR1A 3BZWA 3JD3A 4NBNA 1OX4A 1XRMA 1T8WA 4Q3CA 2D2EA 2JI6A 5KMGB 1KE1A 3GBVA 1P2GA 2WLSA 1DQNA 3ONEA 4KQ2A 1JUDA 3RS3A 3SYLA 1BMFD 4FOTA 4QGAA 4PZ0A 2YXEA 2OR3A 5BXQC 1XHEA 1YTUA 4YP1A 1Z62A 5TQ0A 3GLGE 3HCRA 4LEIA 1J09A 2B1GA 3D8NA 2JIZA 1H23A 3E7FA 3NFYA 3W5IA 1CEYA 3HHEA 1E9DA 3A6GA 4LHSA 2VN8A 2NX2A 3C4QA 4Q1CA 3EUFA 5E3JA 1GZ4A 1KEUA 2WAYA 3D2BA 2XMDA 3DVAB 1BGVA 2GWHA 3NHUA 2A4KA 4NBSA 2XKAA 4B3DA 2D3WA 5GM1A 5KOJA 3REOA 3RWOA 3IXMA 3MB8A 4KNVA 3IO5A 1DARA 1E3EA 1O03A 4EYGA 2HSJA 4DNOA 4Q00A 2RHHA 1DKOA 1XTTA 4KXVA 2H63A 2WVHA 4EITA 5A4IS 4HGPA 1E98A 1GGMA 1LDYA 4K2AA 2YUTA 3T15A 1TTQB 3GIDA 2F9FA 4IXDA 4X3OA 5D2CA 1V1RA 3TIXB 3TRJA 5EUQB 1ORRA 1V8ZA 3V4ZA 5J47A 1CVIA 2Q29A 5FO1A 2FZGA 1ZBQA 2KHZA 3HBJA 1I3LA 3E81A 4BOYA 2P8SA 5ALWA 3C74A 5LXTA 3FBGA 4D9FA 3E1SA 1BMFA 1RAHA 4OBBA 1AQLA 3DM9B 1GZUA 3D6MA 3KS9A 1HMPA 3IBCA 2AYYA 1VRCA 2RHJA 3IPLA 2C9YA 3K92A 1TQHA 4CUZA 4Z4IA 4KFUA 5COBA 1E18A 1PR5A 2BFEB 1IDN1 1I3KA 1WB6A 2Z4SA 4LPKA 4Z2AA 1Q83A 1BFKA 4RW0A 4BLPA 2R97A 2EEZA 4C88A 3LA8A 3VPCA 3IE1A 2XVMA 4RK7A 2X42A 2CJWB 4P5EA 1VIAA 2GBLA 4MRMA 2ZVQX 5U1PA 3E3NA 4GNKA 2HK8A 1KI2A 3A4LA 2XNDA 2DFNA 4JT8A 3WWEA 1CUEA 3SU8A 4DBZA 3IP8A 1N1DA 4RZQA 2WHYA 4FBGA 4TGLA 3SDBA 1KNXA 5DNCA 2BSQA 1U31A 4PG4A 4BLWA 4OBWA 4XUDA 4O59O 1AK2A 1R4MB 1ZP6A 2QTVA 2VUHB 3EGOA 1EK5A 5DLPA 5HBGA 3VZSA 1AMUA 4NMLA 1OOEA 1AE1A 2QT1A 1KJNA 2P65A 3JQFA 1M1YB 2HF7A 3V4OA 5ALKA 3WLRA 4LTDA 3M4JA 3U3ZA 3RDPA 2W4QA 2V58A 1R4NA 3RREA 2ZM6B 2BEJA 4BWYA 3QY9A 1XCOA 2R6HA 5JLJA 3KWFA 2ZKLA 5EJMA 4I50A 4O2BF 2NU8B 2VDOB 3ZCRA 4C4TA 4F9EA 4UUBA 3C4JA 2EG9A 3ABZA 4Q7QA 4AKIA 1Z73A 1DXYA 4GI1A 1RRGA 4IF6A 3SXPA 4ZMBA 9GPBA 4YBRA 2I1VB 1SHTX 1MX9A 2IF2A 3TSCA 1U7UA 2RBGA 4KWIA 3WTCA 4DIEA 5I5EA 2EJWA 1JQDA 2A58A 3HSKA 2R2AA 3QI7A 2ZWAA 5CFOA 2N3ZA 3K9FC 3WC4A 1YVPA 2JAXA 4HPXB 1Z4LA 2ZU0C 3MFYA 2BGIA 3ZYZA 4B80A 4F38A 3N3BC 5BNTA 3SMQA 2XQFA 1HEYA 4GZ6A 3ZVNA 2CHUA 2C3OA 2ZJ6A 3KKQA 2ZDQA 5DWDA 2H54A 4AB1A 4AP9A 1YO6A 4EECA 5LP6A 1Z2PX 4ON9A 1M5TA 1T8UA 4D3XA 1NJ5A 2AOUB 5L3ZA 2JD1A 1K27A 3GARA 3DC7A 3LUPA 4ZCQA 3CZCA 3F2VA 2JH8A 1O94A 1U2DC 4ETWA 1GPLA 5A5DA 1IFXA 5BYJA 3RT1A 4BN4A 1GPJA 3O0DA 4LXUA 1VMKA 4GS5A 2Q9BA 2OO5C 4YAFA 3GLIB 2JBWA 1MB2A 1V8FA 3IB6A 3FCSB 4GR9A 4AMGA 3ADKA 3RVOA 2FR8A 2UZ3A 3C8HA 3L0CA 3MEQA 4RZXA 3WK9A 1JQKA 1DKLA 1SAYA 2WP8J 4IQ8A 4K7JA 2OP1A 5F7OA 3AVVA 1K2VN 2Q1YA 3KYCB 2ZBUA 2O48X 2ZPUA 3EGWA 4B47A 1N0HA 3L84A 1MB0A 1MJFA 3P94A 3KETA 4J1NA 4XARA 2ZYUX 5JQGF 4QU0A 4ES6A 4A0RA 5BV0A 1UPCA 1OYVA 3ZDQA 2WUDA 5ENZA 4Z0NA 2BP7A 1FDWA 3F46A 4AJNA 1VB5A 2Q4RA 1ZVKA 3WNVA 4BJHB 3I5AA 4LVUA 1K9VF 4QFDA 1AY0A 4DY6A 1JEDA 1CR1A 5JXIA 1TIBA 2O8VA 1AQIA 3FPBA 2H1IA 2YQZA 2MMGA 3RRXA 5EL0A 1PSDA 1HZZA 3B2QA 2DECA 3QFCA 2D2VA 4Q12A 3M89A 3VPAA 4DABA 6GPBA 4NXMB 1X8KA 1JHOA 2A6PA 3L0IB 3ZDZB 5JQGA 1NYLA 1YE8A 3Q7RA 1XD8A 4YJ3F 2DT8A 2ZFUA 4B6QA 5CFQA 4EPWA 3IT2A 3FMIA 3C3BA 4BBJA 4BJ1A 2XITA 3EOAI 3KKZA 3LXMA 5DISB 3RFUA 3JAWB 5J3JA 1HDXA 4TS4A 4PC6A 2VJMB 1T5TA 5BR8B 1H22A 3VKFA 4HQRA 3OPYB 2AQHA 2GCOA 3WLIA 4MUBA 3ZDCA 3PF8A 4H7KA 2OYRA 5IKOA 1FNNA 1FC0A 5J2TA 1M1NA 1UAAA 2PEYA 4RQUA 4NZZA 1JR6A 4U2BA 4JYAB 1DIRA 1WO8A 5L3VA 2J4DA 2PWBA 4RLHA 3KOWA 3P0HA 3TQHA 4DYVA 4KMOA 4PLYA 1GO2A 4EX6A 1DRWA 1PEDA 1WULS 4BS9A 1G64A 1DAMA 4ZVPA 3ZVMA 5HX7A 2NW6A 3RTAA 3H84A 5E6SB 2A9KA 2VWPA 3WJ7A 2L19A 3LJKA 4EW3A 3B5EA 2BF7A 1UH5A 1F4VA 2B4KA 5JXJA 5HGXA 5GJCA 3PFWO 3WKBA 3CKMA 1E9AA 4J7XA 4YQZA 3U37A 3WAKA 3S8EA 2WB4A 1BJTA 2YIJA 1NVVR 5A2QA 3L92A 2FW6A 4A4DA 1H0HA 3HNRA 1VM6A 3D0OA 1IUKA 3HLYA 5FPPA 4RJKA 2OHIA 5BUZA 3CHYA 4KX5A 1MOQA 1NW5A 3ESDA 1DRJA 2HJRA 4LE1A 2IPXA 2R1TB 4KIUA 4TLBA 1J07A 1H8HD 3BJIC 3OLVA 1Z5OA 2JGAA 3JQ8A 1M2GA 3PC8A 1SKYB 2ECKA 4PTYA 5EC8A 3SS8A 3U0VA 3ZLBA 2JCVA 4I81A 3TINA 3W9YA 3CR3C 1J70A 2J45A 3LFTA 2Y0CA 1I1QB 5ALNA 1CY4A 5EQTA 4D41A 1H0RA 3BJEA 3PQ7A 4TXNA 4WNAB 4HRYA 3RYCB 4QXPA 1YI0A 4YUYA 5DGHA 4DJEC 5LR6A 3L8GA 2ZRNA 3GGGA 2BRUA 4CKYA 2QQ5A 3BE4A 1Z4PX 3K09A 4N3AA 1CY1A 4RVUA 3GB9A 3Q8WA 3BWYA 4Y0AA 3TQSA 4LZOA 3EPKA 3OF5A 3S40A 2JJQA 2Q1TA 3OCXA 4IAOA 5JLAA 3W8RA 1WXIA 3I4CA 1ZIDA 5AVJA 3MW8A 4J3JA 1Q14A 5BN5A 2PLRA 1ISIA 2CNWD 2EDAA 4QECA 2I1LA 2CL5A 5B6PA 2MYNA 2YOHA 1KP3A 1HDOA 4KDFA 4YI5A 4H2DA 3PUHA 4DJFC 3OLQA 4L74A 3UHPA 4Z4QA 1LX6A 1XTVA 1VLZA 3RSLA 5C1BA 1DOZA 1LTHR 1R6VA 3ZE2B 4NCIA 4EQZA 2IYEA 2M9MA 4JBIA 4UTXA 2AUTA 5AT1A 3T41A 4CLEA 1GFWA 5IJ0A 3USZA 4RY2A 2UXBB 3A04A 2Q41A 2GHQA 5AKJA 3DOUA 2AUMA 2R87A 1XE3A 1YT5A 2CN1A 3A1WA 3D4OA 2DPYA 3W06A 1BGWA 2VK1A 4DNPA 4IMIB 3COJA 1O0CA 3WBJA 3IXQA 3R6GA 3ZU4A 2XYGA 3DGFC 2GM4A 2DWPA 1ZSVA 2FEXA 2A8YA 1A8UA 2PRYA 2Q5OA 3TLZA 4ZYLA 3ZS8A 4PRZA 2HGSA 3G23A 3FNBA 4C0WA 2EW1A 1UP6A 2Z5GA 4OFBA 1C0EA 3NC4A 4B40A 4ITRC 4BB5A 5FTLA 1SBCA 1JG6A 5ANRB 2E4YA 4UCXA 4ZEOA 3HJFA 5B3AA 2R25B 1VOTA 1JG2A 4E2WA 3OVMA 5L4NA 4RC9A 2Q7OE 2WTMA 4JVSB 4LOLA 4Q4LA 3IQDB 5J4YA 3DB1A 1BWSA 1TF5A 2E87A 4MKZA 4QL3A 4Q21A 1L5QA 2H6EA 1AKUA 1EXDA 1MR3F 4IGFA 4R9UC 1A5ZA 2X0JA 3K1YA 4BZZA 2JEYA 2GM9A 3KTOA 4BWVA 2IS2A 3H9JA 4P3OA 2E37A 3PC7A 2WE8A 2F1OA 4OBEA 5AQ1A 4DR2B 2DCMA 2VUTA 1KK3A 2XB8A 2FG7C 2PV0A 4MWBA 5K9ZA 2AK3A 2FR0A 4CCAA 3AUAA 1YGPA 3N2KB 2RKOA 4M1EA 4CV3A 1PR6A 5C3MA 3M4XA 3OTHA 2JFFA 3LP5A 4Q9AA 3ZWAA 3D6UA 4H1UA 3R9XA 3D3QA 3UGQA 5TF4A 4R9RA 1KZ6A 2HHLA 4B82A 4LF4B 5C35A 2Q9CA 4FYIA 3NORA 2YJTD 1SD1A 3FXAA 3ZHZA 4KKXB 1C9NA 3L7IA 2SECE 4AY6A 2YMLA 1Y8ZA 2BDUA 3TFOA 2WJ3A 2D5IA 1OXBB 3C39A 2ECOA 3LQ4A 4KQGA 2FRXA 4P5PA 1JR2A 3HS3A 1Y9ZA 4R1NA 5BRAA 4LNUB 4UCQA 2HDHA 4MB6A 1WLYA 4B6PA 1C29B 4D6XA 2XV1A 2YWEA 5CGQB 4YJ2F 3FWZA 3GCZA 1AUPA 4I6JA 2EWMA 5CT5A 3NALA 3ZU6A 2FQ1A 1PNTA 2DCUA 2XODA 3ZE9A 2DQKA 2IV7A 2W2LD 3K1ZA 4EVQA 2IH2A 4JEUA 5GY7A 2HV9A 3RYHB 3HR7A 3EE6A 1N2CE 4LQDA 1DBIA 3JXEA 3VBCA 4FFRA 2PBLA 4EUFA 1R15A 2HQRA 1PIWA 2VXBA 3PEEA 5HJEA 2OECA 5FF9A 3BIWA 4P3NA 1WPQA 4EENA 2K4MA 4RF5A 4KOEC 1S3IA 1O96A 3CVJA 5ERGB 3L6EA 3RIYA 3LKDA 3KD3A 3DHNA 3DTTA 5LYJB 4H4CA 1S2NA 2D74A 1P1RA 1RWKA 2MSLA 3ESZA 2PUTA 3RUAA 5KMGA 2RSLA 4MCIA 1GQOA 1OASA 2ES4A 4HZIA 4U5QA 3R5FA 3PE6A 1BU8A 1ETHA 1XZGA 4IG4A 2BI8A 3F5MA 5IMBA 3V6LA 3ZWPA 4KPEC 5AXDA 4HNGA 4BQQA 3E8XA 1ZX1A 1RP1A 4Z1OA 2JLYA 2W58A 3EIQA 2HU8A 3A6JA 1ZN7A 5C7OO 4G8JA 2UYHA 1KOJA 2Z3ZA 1QYDA 3E5HA 3FOWA 4LYDA 5D1NA 5K3SA 1FRFS 4Z7NB 2AT1A 2P9QA 4NS1A 5F35A 4A8JA 1CDDA 1XXHE 2NU9A 1U2RA 3W2IA 4CDGA 1Y4ZA 3FMGA 3KZXA 4LN1A 5AWFC 1TTPB 3VNVA 3O90A 3LRXA 4E09A 1ZOIA 2X5OA 2CFOA 1ECPA 2YYYA 3QELB 4G37A 4QOJA 4KGZA 5HUJA 1S2OA 3DP7A 3Q9NA 1WSDA 3HWWA 3S70A 3MTBA 1LLCA 3GJRA 2GRJA 2FX2A 4J75A 4A0HA 4YT2A 5JARA 3HYNA 3TTTA 2BZ0A 2GFIA 1TC2A 3PLRA 4ER6A 1U2ZA 3DF7A 3CNHA 2JA1A 2AI1A 2W6MA 1RLTA 3X1MA 4BJ6A 3R5XA 2Y1FA 1BN6A 2FW8A 1RAAA 3MFQA 4GLFA 1L0BA 1T35A 4IQ4A 3LCMA 5L7WA 2QDXA 3HXOA 5HKLA 2DWQA 1HYBA 2DHDA 4DJTA 1IVNA 5IT4A 3UICA 2NTEA 3HJHA 4YJHA 3NT4A 1U0GA 4ZT5A 1HYGA 2I2AA 2PNJA 1J24A 1PZEA 2GYYA 2QTGA 2XEXA 3LWDA 5TT0A 3RV4A 5K6AA 2NVOA 4FFBB 4RQBA 3BE8A 4EHKA 3FYUA 1J8DA 1IG3A 4Z4CA 1P45A 2Z3WA 3E61A 3Q9SA 3U44A 1S5PA 5CH5A 5EAIA 5D3MA 1PK9A 4UULA 2R6FA 4OBXA 3WGNA 1A98A 4FCCA 3SGLA 3S0JA 4DBLE 4MJ3A 2JC3A 1VDZA 4J76A 3TW4A 4EGAA 821PA 2GN0A 1NBMA 3FB1A 4KAJA 2PD4A 5KCZA 4TTJA 2XCIA 4LWQA 4RJLA 3RRNA 2DBZA 1AQ6A 1M8JA 5HIIA 2HBZA 4TSRA 2IK8A 3A0RB 4R84A 5AW3A 4R8VA 2R96A 4FW9A 3QYFA 2YS6A 1HUQA 3P7MA 2HWKA 3DE1X 4GVPA 1KYIA 2XX3A 3A9CA 3O1JC 4CM9D 5JRJA 5BOVA 4EPRA 2P40A 2CLFB 4OHFA 3KPYA 4WFQA 5CG2A 2IYPA 1FMCA 4XDZA 1QVWA 2Z6VA 4FMCF 4ZT4A 3SQDA 2O19A 3IQGX 4CNBA 3TF5A 3GH1A 1M0TA 2PGLA 1XJQA 2EKBA 2XUZA 4KX3A 4JC5A 4ZAXA 1WZUA 5CEEA 5BVGA 4K81B 4S1TA 1XVLA 2GN1A 1IHDA 4GOND 5DI9A 3RC7A 1F8UA 4BLRA 4GYJA 2ZJZA 2WHQA 1HE1C 4MARA 1ISRA 1UDRA 4IQFA 1RKXA 1L5MA 3PNSA 3GJ3A 1OBFO 4DL9A 4MI9A 3IBTA 3UJAA 4TQAA 4YYEA 4WA7A 1CY0A 3KOXA 5LDHA 3FCCA 1R5NA 2DFPA 3QEMB 1VPWA 2HF2A 4URVR 5HKKA 1DAKA 2KLHA 1H1TA 3G2MA 4O2RA 2EG5A 3O83A 4TUYA 5D6NA 5DW3A 3TRFA 3YASA 4DT1A 3UWMA 4EPYA 5B4TA 3Q8XB 1P9RA 5HS4A 1X8LA 1YC2A 2GMWA 3MAJA 4KJXA 2YZ7A 3UEOA 4AJLA 5JZMA 1DKRA 5FPKA 3LQRA 3G0GA 2DPMA 5G02A 1JEAA 4ZHQF 1MHTA 4M9RA 1HTWA 2XXBA 2BF4A 3NU1A 4L0MA 3K9NA 3TVDA 5DN9A 2XGSA 1SUPA 2C95A 3G9TA 1QHYA 1QHIA 3FMVA 1DKQA 3HRHA 1BJKA 5IDYA 4N3BA 2C2BA 3VHXA 1C81A 4PGMA 2OC4A 1ZA2A 4IIXA 5ERYA 2W6ID 4Z1MA 2NXCA 1NG9A 4KE8A 4R7ZA 2HHCA 4MQ6A 1B6GA 1OI7A 1ZM9A 1DX4A 4DA4A 4M8LA 3BFJA 2YWDA 1BHO1 2D6FA 4RD4A 3GR6A 4KKVA 3T0FA 2DWUA 3PQCA 1HLDA 1I7PA 4AWXA 4ZI7F 1UBLS 4LRQA 3V6MA 3ONFA 2J3EA 4MV6A 5IF3A 1ZUIA 2HBYA 3N74A 2VHXA 1AC5A 4WLEA 5H9VA 5H3HA 2ZJ8A 2DY0A 3A6KA 1NMXA 5F33A 5GQSA 4CEHB 3EQ6A 4KPUA 1LK7A 3JQQA 3M6XA 4F2WA 3NLLA 5U4XA 4ZJYA 9MHTA 1TZCA 1EA7A 4Q6BA 5B4VA 1RI2A 3O93A 5CTAA 4MV0A 1XBTA 4CU2A 1YB4A 3WLQA 3DW3X 4XYEA 3NVDA 3KSRA 1VYVA 4HNAA 4DSAA 4M83A 5IJWA 1WSBA 3PQEA 1FIUA 1CRWG 2DQYA 1U9YA 1IZYA 4GLOA 1Z26A 2DKNA 5DXFA 1N9KA 4C29A 3DYIA 2C78A 1S8AA 3PR3A 4AG3A 2VTBA 1ZVVA 3WL4A 2ICAA 1ZGHA 4PM4A 3K32A 3ZCUA 2VZEA 1YR6A 2C4KA 1G20E 1MORA 1PJ8A 2HADA 4OUDA 5TS2A 4UMEA 1GDTA 5JDIA 2OB1A 3QUQA 4KQCA 4DDTA 3OT4A 1CNEA 2Y9PB 3R09A 4MWOA 1YB5A 4II2A 3W3AH 2IQ5A 4AJJA 5HQ3B 3KQSA 1EFKA 2J9RA 2AXEA 2QYSA 3IMGA 2PH7A 2A92A 4Q4HA 4B3XA 3NOOA 1F1BA 3HP4A 2H4HA 2Y99A 3NV9A 2GEUA 4UFPA 1UPUA 4J0JA 1Q20A 1VKHA 2P91A 2P5SA 4REQB 2QLMA 3TZKA 3T99A 1BFUA 3V32A 4D6PA 4MUYA 3TNYA 1TFUA 3AKCA 2K7ZA 1CY6A 2YY6A 5E6UA 5J43A 5JZOA 2VDUE 4P6VF 4D8XA 2G8NA 3A6PC 1Q0UA 1G2OA 3U5TA 4ND5A 2NUTA 5IX8A 1AZSC 2FEWB 2Y4NA 5I8PA 1AURA 3IQEA 3KLMX 4PPFA 5E2AA 2VG8A 4EM6A 3UBMA 2QXTA 4CI9A 1JAZA 4HGOA 3RC8A 4D25A 2JLCA 4QGBA 3FKSD 1H1LB 1ODCA 1OA1A 3KTAA 4MKGA 1MC5A 1EP3B 3UV7A 2YASA 1NRWA 1TCVA 1L7AA 4PFKA 4H1WA 3OQNA 1HT3A 3G7UA 3MUEA 5GTDA 1VCIA 2A3RA 1KH3A 3QVGA 1H2RS 1WF3A 1N9ZA 2AC7A 2VSQA 3C6QA 1PJSA 2WU0A 5FBLB 3RLIA 4MEBA 1GQQA 1TU3A 3DMDA 3ZKWA 3GIWA 3MAAC 3I39X 4KRGA 4C01A 3BDAA 1T0IA 4QRHA 1RC1A 3IEIA 1CKEA 4NPAA 1QPBA 4MS4B 2JZNA 2WJPA 4OKSA 4YONB 3TYXA 4AXXA 3QVUA 3BIOA 3QU4A 3U4QB 1VJ5A 3V48A 3VHQA 3L0OA 2UUBB 3KUKA 2CXSA 2LGJA 1QO7A 3TKAA 3C15C 1KRWA 4AQ7A 3SYRA 1G291 1CUVA 3EDYA 1DEHA 3V8PA 1TMYA 3PUIA 2CMHA 2G17A 2UZ1A 1U0JA 4YMWA 4DCTA 3EMBA 1T36A 5JY6A 4P0TA 4TMYA 5GGXA 4GR4A 3AFMA 3MN1A 5FI3A 2CHQA 1USGA 1JKFA 3OTIA 3V8RA 1M0SA 3N8DA 3DZKA 4KQJA 1A76A 2QVCA 4C7MA 3KXLA 4ME6A 2EKPA 3K1JA 1L7QA 1UC5B 2O8CA 4OHCA 2ZRKA 3FVVA 5BPHA 2FPWA 1FFGA 1WM1A 3NHRA 2QAGA 3DBLB 1IONA 4FU0A 2JJ2D 3DMYA 1CUFA 2V55B 5FEMA 5JS2A 4QU5A 1ULTA 3D7SA 4U6QA 5LJLA 4HAYA 4PV7A 5CNMA 2CFCA 1GVHA 4Q4CA 2HUNA 3PXGA 1JKXA 5HOQA 2KQUA 4R51A 2CV2A 4Y6OA 1QH1A 1JBEA 5ELMA 5CXQA 1DLIA 1OX6A 2OSVA 3DOIA 5JR3A 3HU2A 4WJLA 2FX5A 1H0SA 2Q1SA 1W46A 3KOYA 1K3TA 1OKKD 4W99A 3VZRA 4EHAA 4XUEA 5KSPA 3CZMA 3NIDB 4IEIA 1E61A 1TEXA 4MW6A 2QX8A 1CDZA 1NC1A 5CLQA 3RKSA 4ARCA 2IY8A 1UMDA 3CKYA 1BVHA 3ZKAA 3E18A 4DC0A 3R3JA 1K97A 1FXWF 4EF4A 1VYTA 3EC7A 4PR3A 1EQAA 1GRCA 1UBRS 5EZ5A 5DK4A 2GT1A 2W8ZA 4MVXA 2PZJA 2FQXA 4P2BA 5ERXA 4W7SA 3HPQA 3O3NB 4FNOA 3G0DA 4OKIA 4JS0A 4HSEA 4H15A 4YCMA 1FP2A 3QEJA 1G16A 4LJ6A 1KKMA 1NATA 1W49A 3N05A 5F2KA 1CVRA 1UBTS 2P77A 4YRBA 3LI2A 3LKVA 4NH4A 3DDOA 1AXEA 4TWZA 4N6GA 1PV2A 2Y2VA 4XB6B 1DJPA 1NFFA 4QEKA 2D3TA 1OIVA 4I1UA 2ISSD 3AK4A 3GU3A 2BGTA 3ICCA 2WYOA 5F1OA 4AUNA 3V4FA 3DLPX 3ZQ6A 1Q17A 1QGYA 4PC1A 1FXUA 1IJKA 1WSWA 1T3GA 2B5OA 2IW3A 3OEED 4MV1A 4S2EA 4CMIB 2EJBA 1F7VA 1T9AA 3M4YA 3KUXA 1Q7GA 1YE3A 3RBZA 3FKJA 1GFIA 4DLAA 4NZYA 2H29A 4R0NA 4YDHB 3KFLA 1XU9A 2ODNA 3JRWA 5CFLA 2CXTA 2H8KA 5FIUA 2IIBA 1U0RA 4KH1A 5BWCA 2YJNA 1Z7BA 4MQLA 1X1AA 3FH0A 5AUOB 2PMKA 3DFZA 2XCOA 4H0NA 5DEOA 3FYUC 4J7CA 1LCIA 4O6VA 5ECGC 3C0KA 3VJLA 3I2KA 2QVZX 5CDTA 4UBMA 1Y5MA 3K8OE 1IVSA 1BYUA 1I80A 1P4RA 1WAMA 1Y9DA 2Z2YA 4YAOA 4YC7A 4PSAA 1MO4A 5CP8A 2OESA 4AJEA 1IWBB 1Y4UA 4MYCA 2WQ6A 4NU8X 4JUBA 2F64A 2DZDA 1EK2A 3D6NB 4N39A 2D4HA 1T0HB 3PHIA 1AS2A 2FP4A 5JO9A 4GE0A 2RJNA 1FTNA 4HWGA 3ZD9A 4DAOA 1LA2A 2L17A 2O7NA 3MJFA 2JFOA 4V3BA 3U1TA 3NG1A 1PR1A 1S0UA 3UXEA 5JZBA 1POWA 3PEUA 3ASYA 3PDCA 3ZHBA 5FNZA 1OZAA 4IOLA 4L6IA 1RHMA 2LUOA 2XTZA 2A9RA 4MO2A 1K2WA 4F2PA 1EVIA 4I14A 3HKBA 1NJFA 1SIBE 4NJMB 5JSZB 2B82A 2WIBA 2BFMA 3OA0A 3F5QA 3M4ZA 2C2XA 4RNDB 4PZPA 5AI9A 4YT5A 3UQYS 4CDNA 3KXDA 4CMBA 5A0TA 3U4IA 1OAOA 4C3OB 3DAOA 4G5OA 4HNSA 1CHNA 1UKVY 4N0DA 5CEFA 4OHKA 2A1IA 5SYAA 3CY6A 2B8TA 3R3WA 1ITZA 4P98A 3NP7A 4MINA 3CUUA 3PRJA 4S2UA 2VOEA 4YY3B 3U3KA 4ZAVA 3SDSA 3A2KA 2O8BB 4QQ8A 1JFFA 2Z56A 2AOTA 1ZNZA 4MQFA 1WCWA 2G77B 4PLCA 5BN5B 4LHYA 4ND6A 2IHZA 4CL0A 4CIDA 4NYJR 3W4IA 1P77A 1WSAA 3JQGB 3CJRA 3IEPA 4D4LA 5GMOA 4KR6A 1XTSA 2E4AA 1NRIA 2INGX 2YIVX 1GD1O 4QFCA 3SOZA 5CXUA 5AM3A 3I52A 2OMKA 4ALNA 1UIRA 2XE4A 4FNMA 1T5BA 1XF1A 5CR9A 2X8JB 5F2OA 3RVSA 1N92A 3ZWDA 2QKYA 1A72A 1Y6QA 3T1HB 3ETGA 5CYOA 2Q5JA 2IKSA 2ZE8A 2OWDA 3FVWA 1QAMA 4B46A 1W36D 3GLFB 2ZIXB 4B4VA 3RGWS 3W8NA 4KSYA 2DFVA 3L4SO 5IH3A 1KPIA 2OCDA 1NN1A 1U8XX 1EJBA 4YWJA 4AF7A 4NL4H 2Q46A 2G07A 3PDWA 2OV3A 2FMUA 2X4DA 4HPJB 4AF8A 4UNPA 2VK8A 5CVDA 1DIBA 3T0IA 3IKVA 1M1NB 2D06A 4CTNA 3PG5A 4UUNA 2IP4A 2P35A 4RJ2A 3WIEA 1CFJA 1KWKA 2XA1A 1HLGA 1NP3A 3A6LA 4K26A 3JWIA 5KNDH 2ZZNA 4LMBA 4FEGA 1OT3A 3QTTA 1LWOA 2FPMA 2DUNA 3H0KA 4S35A 2AZTA 3IXLA 1ZK0A 3LYHA 3I30X 3B9RA 4WESA 5BORA 1LJUA 4DIUA 1UBJS 2K5UA 1UWLA 2AXNA 2E82A 3IUSA 2QVBA 3JWHA 4B84A 4KHZA 1AGYA 2ZWVA 1ZY2A 2HMWA 2ZUBA 3E22A 3HUDA 5BN3B 1FZQA 1LB1B 4WLVA 1Z36A 1TMGE 1AHPA 1YDEA 1FYXA 1HDIA 2P9ZA 1GRNA 3OG9A 1SMKA 4H59A 4NR0A 4G0VA 5D8DA 2C42A 2I62A 4KN8A 2DSTA 3TXAA 4J49A 1L7DA 3FTCA 4NFHA 2Z2KA 4JYBA 4PNEA 4IDHA 4RMHA 1BCRB 2WT8A 1CZKA 3UUEA 4ARSA 3ITKA 4X3PA 1OFIA 1ADYA 1XLVA 2VTVA 5EE1A 3SYKA 4JH0A 2XKBA 4IV8A 1XROA 3N2KA 4LJAA 4OLHA 4OYHA 6REQA 3COPA 4LY6A 5F2NA 3OPYA 1UFOA 1Z7WA 1HETA 1BSVA 3WK5A 3WL6A 2H52A 3H9BA 3HB9A 5DM2A 2EIXA 2DULA 2P2LA 3LBAA 4CT0A 1QAQA 5BT8A 2GWRA 3DVQX 3GUCA 4HX5A 1X0VA 1DDOA 1RWNA 2FPGB 2CCJA 3U2QA 4AY4A 3SZOA 4BRWA 4NCKA 3WB0A 4IIFA 3RU2A 2BCJQ 5DLDA 1Z82A 5TS3A 1XNQB 1NXVA 2DE0X 4Z7JA 4O4LB 4B8ZA 5JI2E 4YVFA 5D85A 1GZ3A 1E9BA 3LUDA 3WK4A 4QEZA 2P79A 3BK2A 5KQRA 1I0ZA 4LJ4A 1IDOA 2TRSB 2NV2B 4RPHA 2EEPA 2RHTA 1VRVA 2WZDA 3BAFA 3KFVA 4FMDF 3ITDA 5AJWA 2OYSA 5EXEA 3TPZA 3EIOA 2AQKA 2M1ZA 4A2WA 2YFKA 1EWQA 3GQVA 1SCJA 3OD5A 3VO9A 1IZ0A 2J5QA 3NWEA 3I32A 2E6KA 3DBIA 2B5WA 1RM5A 3MT9A 1SULA 2GGSA 3EEYA 4YJ3A 2AS0A 3VH2A 1P7VA 3GMTA 4B33A 5JEEA 5ALZA 3QXXA 1SELA 1U9CA 3R44A 4OV6B 5I01A 1NMQA 2W2LA 3K5IA 3RB8A 2IDKA 1O96B 2GEJA 2QUZA 3CEMA 1RPJA 3UV3A 4O1IA 2ROQA 2EXXA 3IEXA 1QB8A 3QKIA 3B1ZA 5CX1B 3IO3A 3DKVA 4M1TA 3ETDA 1L5GB 2H85A 4I5EA 4W9MC 2UZAA 4C0KA 1MXHA 3WGZA 4ZZIA 1ZYUA 1RM0A 4ZODA 5GZ6A 2JGEA 3PI6A 1D1QA 3P1JA 4R41A 4L28A 5K6TA 4UNNA 3TW0A 2GZ2A 2OGUA 3N2EA 1RWXA 1K6IA 1VE5A 2B2NA 2AOUA 3N2LA 1TJNA 2BRUC 4LJKA 4UXIA 5IMSA 1CIJA 3UAGA 3DOFA 3HR4A 1EZZA 2IVFA 4EWLA 1VL0A 4QPNA 4V0MA 5FDFA 2ZI6A 5JDIC 3SQWA 2FXIA 3EDMA 3ZD6A 3ES9A 4PGFA 2HLHA 2PL5A 3MJRA 5SYMA 3VVCA 1P9LA 4DMHA 1LV7A 5L6MB 1N2ZA 1M74A 2B99A 4UHHA 4ZOLA 1LZKA 1W94A 1M75A 2OP0A 1CB7A 2ORVA 3K6RA 3KZ1E 4BASA 4Z4FA 4RACA 4BNFA 5DN6D 2HR1A 4FGSA 1JT2A 2WJAA 3E2PA 3PC8C 3F97A 5AVZA 1VBKA 1Q1NA 1ZM4A 4GM1A 1KIAA 3P2YA 3UK6A 4FHFA 1I10A 3LQQA 3P26A 3M5CA 3PNKA 1TAQA 2BTQB 3K2BA 3ZCSA 1JXMA 1CEQA 4P4TA 2IGBA 2MJLA 1TUGA 4R8KA 2Y0BA 5A5GA 2VHYA 3EWAA 5CLFA 3ABIA 1L4NA 1P1FA 3R7BA 3SYNA 4QNNA 2MINA 1W88A 3BXFA 2X5XA 1RADA 4AZ3B 4QDXA 4AG6A 3DEAA 2BBWA 1IEVA 1VPEA 5DTQA 4XCVA 4TRMA 3R6WA 4F60A 1RR6A 3Q0IA 4NJEB 4WWHA 2R5FA 1N5JA 1C1DA 2VCHA 3BE6A 2HF8A 1DV2A 3GL9A 4IIEA 4HYYA 4CNQA 1NNI1 1BRTA 4O2BA 4RHYA 3E3AA 4NECA 3RSQA 1RM3A 4Y0VA 3TOZA 3X1JA 1MX3A 4QOHA 2A30A 3MSXA 3MZ0A 1FVXA 4YECA 4YMSA 2JLVA 3ZH2A 2J1LA 4BKQA 4E7PA 1HE5A 1V9CA 1KDYA 3W7AA 4EJSB 1RZ3A 1Y81A 1HXHA 1KIFA 1T5LA 4IKEA 2IHBA 4IR7A 2CLKB 5A3VA 3KD2A 2Y1LA 4MV3A 3UFXB 2NO5A 2BJHA 4L3VA 5EKTA 3WVNA 3WIVA 2GM3A 4RCZA 1KU0A 1PTKA 3WYNA 5AW9A 3PT9A 1YU6A 4IDCA 5J2TB 1SURA 1RP7A 3FCYA 1JIKA 4PW0A 3H7IA 3ZR4B 1AGPA 2EZUA 3JVVA 1QQBA 4DLKA 4B7AA 4B7XA 3I05A 1H4TA 4P33A 3SZRA 2BPOA 1JYFA 1PGNA 1GNVA 2HA3A 2OXFA 4AZWA 4XYLA 1TUBB 4BV8A 1UANA 5HKBA 4UARA 1NKVA 3GRYA 3K9WA 5JSQA 2C9CA 2RG7A 2O2GA 2VJNA 3FETA 4ZP1A 5IAGA 1E6EA 2UDPA 5K0NA 4J0HA 4NDAA 1BQ3A 4NMMA 4DMLA 1ZNYA 5JWRA 2WTXA 5P8WA 3ZXSA 4JV5B 1UF9A 4RZ3A 1N6NA 4A6DA 3COSA 1PW5A 1X7DA 3W8DA 1I2ZA 1ZXLA 2NU7B 5BV8A 1P0CA 1JFFB 2ZRAA 5GV8A 5LUBA 5ICEA 2RJ3A 2UAGA 1GITA 3CPHA 3GFBA 5K0FA 4Q3BA 4A1OA 1EFRA 2QWXA 4UW9A 1DX6A 1NXOA 1T2NA 1PP4A 1YQXA 1TX4B 2QAGB 4O33A 5AKXA 1K68A 2XUAA 3ORQA 1X92A 5LZ7A 1PT6A 1KJ8A 4F4HA 3QKSB 1OV4A 4H3VA 1YDHA 1ICEA 1R0WA 3MMXA 2ID9A 1WU7A 1PZNA 2WU4A 4KAAA 5L40A 1SC4A 1DB3A 1QFMA 1RTKA 4XIJA 3UK0A 5LB2A 3EAFA 2C97A 1IN4A 1G3RA 3AVQA 2C8JA 4MCHA 4DQUA 1EHCA 1XMPA 2CFRA 3A1CA 1X0XA 4GI5A 4OJMX 2DLNA 2O23A 3VOTA 4WVLA 4JJZA 1O77A 1GTZA 4X7RA 4O2AF 4LHZA 1JU9A 2IKQA 2YN2A 1PYGA 4LVNA 2P2CA 1KSFX 2G36A 1T24A 1NC3A 3FPCA 3I3SR 4L4ZA 4QX6A 3DFUA 4TTAA 4AN1A 1ODSA 1O0SA 3USES 1W4LA 2EOAA 5I9MA 3NDBB 4AJIA 2OVFA 3NOQA 1C4WA 1W6RA 3KQTA 4KL8S 4QUJA 2REXB 5LP6B 3AFNA 2WB2A 3PNVA 2ZKIA 3SLRA 4ZTZB 3AR3A 3CZ9A 1Z17A 3RIGA 1QVRA 1C9KA 2GETA 1GJRA 1CC1S 1YRYE 3NTUA 2QSUA 4V24A 4AJ4A 1NPTO 1U0FA 2QLBA 3KL4A 2LCFA 1WXGA 5LBTA 2IHUA 1KH2A 1IHUA 3HRKA 3SJBA 3CNBA 3MXOA 4UEWA 1DG1G 3GPCA 4Z9FA 1P33A 1YI8A 1TM1E 4TV9F 3R0IA 5ABPA 5AW6A 3IBFA 3KX2A 3S81A 4JP5A 1WTAA 4LWPA 3KTDA 3TJMA 3GPIA 5FBRB 5LZ8A 5BQFA 2EWWA 2QMEA 1XPJA 2HBQA 2XYHA 2VNAA 1XCBA 3FNGA 3VNQA 4ETIA 3VR5H 5AI5A 1XZCA 4XD7A 3VTFA 5LKRA 2FWBA 1YR1A 3I9LA 3EBPA 5AI6A 4CETA 1QRSA 1A2QA 1NXSA 2VS1A 4FI3F 4C5CA 4I5FA 1ZESA 2VYVD 1JJIA 4QDJA 1ZWLA 2IE8A 3KZMA 4QREA 3EEQA 3JX9A 4MOWA 5ADVA 1EGQA 4LPSA 5DH9A 4MUIA 3M3PA 4N76A 2RARA 3UAYA 3WGQA 4KE7A 5JQGB 3VSCA 4OQMA 4KWHA 3U44B 4C07A 4ER5A 2PQ2A 5JVDF 2Z1MA 5HOEA 5DT9A 4UMFA 2Q0XA 4EY4A 4KLZA 2GZSA 3KQOA 4CLRA 4IHQA 4KOAA 5ALDA 3IR5A 3CQ9A 3EGEA 4LG1A 5ALHA 4MVJA 3OOHA 3THOA 5EPOA 2XJ4A 4IVRA 1B3RA 2P9GA 1NR7A 3T8YA 2B1JA 2PAAA 1E9CA 1CS0A 2KBFA 6ADHA 1QONA 3IIEA 4BO4A 3FI0A 5HF9A 4JBLA 1XEWY 3ICVA 1OFUA 1O94D 2Z5LA 4QAJA 5DYIA 5C1IA 2FPPB 1T6YA 1BHQ1 1UKAA 2A9VA 4NBLA 4QQRA 3UPDA 3BWBA 5JI3E 1E6KA 2HCBA 4QVIA 1LZLA 1WV1A 5KDDA 3UK7A 2ZZMA 2ZR0A 2PH5A 2R9VA 3D8TA 1J2YA 2YZMA 2BMJA 4J94A 4RH1A 4OLBA 1MD9A 5TGTA 1HFKA 3O1LA 3O73A 4GL4A 4DRXA 1MQ8B 1EZ4A 1FK8A 2IYFA 2QTMA 2WAMA 1TYBE 1U0HC 3A1TA 2IYLD 3IILA 3OCVA 4JKOA 1IHPA 1ZAYA 3QA3E 4G86A 5K3DA 1Z9BA 1XD9A 2NZJA 1CIPA 1VKJA 3BHIA 3CVOA 3JSAA 4OFZA 5EE0A 5ES4B 1JEYA 2HJVA 5CBPA 1ECFA 4QHTA 3K53A 3HU3A 2GFQA 3PQ5A 4JC0A 4EMBA 2FZCA 1YJXA 1PZFA 2AUNA 2QNBA 3A1DA 1RXYA 2V5VA 4W82A 5F52A 1EESA 1NQUA 1H4SA 4YAEA 4UD2A 3V1TC 3I9OA 5K3OA 3KB6A 2VTEA 3L8FA 2CHEA 1BVUA 4ZOLB 1DELA 5G2OA 3D8HA 1E7SA 4JP3A 2C77A 2XOKA 2Y67A 4D1YA 3RRFA 4KQXA 3P4YA 1QP4A 3K1AA 4FX2A 1E9VA 1JLRA 2FR8C 1QC5B 2PXXA 2GHRA 3CR8A 4AIRA 5E38A 4ZYTA 1QVAA 1NDQA 2WZCA 2OO5A 2PKWA 2Z83A 3E0QA 4OI1A 4PS0A 5EKSA 1FZTA 3BULA 5CFZA 4DWOA 1QQAA 1C1YA 1WVMA 2CNNA 4F21A 2QRLA 1VCMA 8OHMA 4G5YA 5EVCA 4ZTUB 1PKXA 1W88B 3F7TA 3QUAA 1T8RA 3K6JA 4KXUA 1MB3A 4WV3A 3FYDA 4X63A 3TD6A 3GLKA 2R7NA 3NYQA 4U63A 2TSYB 1E58A 3D6FA 1NDUA 2H2FA 3FIJA 3GUUA 3JAMA 4GPTA 4TLAA 3QUTA 5G3YA 4B6RA 3HCNA 3DE0X 3UB4A 5A1JA 1ORHA 2W2QA 2EF0A 3TGLA 2FLWA 4JI1B 3PNBA 5I9BA 3NHFA 4UVGA 1X3LA 4LDAA 4RQTA 4GZ5A 1RIIA 2XCQA 2V4ZA 3PF9A 4V0KA 5JY1A 1T1SA 2A1UA 2NU7A 3AR2A 2JGFA 1PTJA 3FNEA 4FGKA 4F0JA 5KYUB 4RELA 3VSEA 1LBEA 3JQ7B 5TLSA 4AIIA 4Z4EA 3G1TA 4BN5A 2Y1EA 4E2YA 3KEGA 4KPFC 2BY4A 4RV4A 2RH4A 1QV9A 2P5YA 4PN3A 4UQOA 1Q16A 1CZRA 3V8MA 5ITZB 1N1GA 3C3AA 2XCUA 2AFHA 1GCUA 1ZFNA 2IPMA 1QP8A 3JQFC 4MUAA 3G85A 3I5UA 2V7VA 2JBHA 3T5DA 3X0DA 1UPAA 3R6LA 4Y18A 4BFZA 3DOEA 3NX4A 2DHCA 2FPSA 5H59A 4KQ1A 3WNBA 1A1VA 1WZNA 1XXHA 2CF6A 1HA3A 2O7SA 3W5SA 4ARBA 3IT1A 3PVZA 1NF3A 1ZOPA 5CFRA 4WKOA 2OCIA 2ZK7A 1KAMA 4A8TA 4AUMA 4EDHA 2F1RA 4HSGA 1EDOA 4HDAA 4L9WA 4GSKA 2OBNA 3QLUC 3K0EA 1IBMB 5EWJB 4EHLA 2HRDA 2G6TA 3BK7A 4WBNB 5IVPA 1H8HA 4TUYF 4BU1A 2OAEA 1QYIA 1EPUA 3SXUB 3E84A 2H16A 3AZQA 4NRDA 1JE1A 4PZ9A 3OFSA 3SFTA 4MGHA 4F4DA 5CB4B 1ZIPA 9LDTA 3K72B 3O91A 3V7UA 2EBUA 2PGJA 4MUXA 1M83A 3PD1A 3AUKA 4EBBA 3H1GA 1QG2A 2V9PA 4RBNA 1SBYA 4M86A 13PKA 1XZDA 1CNFA 4M9XA 5DKFA 6LDHA 3AR5A 5IPFA 1DDIA 1QHGA 5JDCC 4AUEA 3KSDO 4R2HA 4UJ5A 5ISMA 4U3JB 4GKAA 1SK9A 3K9LA 3F5FA 2CXRA 3B6MA 4ZAYA 5FJJA 1SC6A 2J33A 1Z2CA 3EVZA 4ARAA 2C5HA 1WEHA 5CVEA 3IUMA 4P3KA 2GERA 5TX7A 5CT4A 4R69A 3TEFA 4HAWA 3ENQA 4Z8YA 3RT7A 4M0CA 2PLFA 2WIFA 2ZIFA 4RKQA 5K3FB 4BGUA 2COEA 2H0QA 5LP6F 4OSEA 1CJTC 3V2IA 4B2PA 5KYYB 1NIJA 4QUBA 2PJUA 1E6CA 5AO9A 4ZVTA 4HCJA 4MVWA 4RQAA 4XSVA 1MRNA 2I65A 4DY4A 1E7MA 2W0MA 3ASUA 3MBOA 3PE4A 2IH4A 5LLSA 4DCSA 1A2BA 1MQAA 1N7IA 5LD2B 4TV8F 4P58A 1RSZA 1TYDE 3TL2A 3V55A 1VJCA 3CBQA 3DPUA 5TGDA 2J3JA 1JW9B 1G38A 5I8ZA 3OY7A 1IQUA 1M6YA 2P4HX 4Q37A 3LBHA 1NTOA 3OEEA 1WXFA 3IVMA 5LVAA 5EHQA 1RHKA 4YMLA 5A7HA 3FSJX 5K8UA 2ZIAA 3CT4A 4AD8A 2XLBA 3WKDA 2JGNA 3F4KA 1C30A 1HE8B 3OU2A 1N2XA 3TCXB 3TD2A 2GTHA 5IK2A 3P2JA 4HYTA 2H4WA 3NEYA 3OE7A 4DQDA 1Z6PA 3ICEA 2CXOA 1R10A 3VR2A 3IP3A 3I62A 3B38A 3FAKA 2GPJA 621PA 1WBJB 2IBTA 2QN7A 3SVTA 3B6EA 3AJAA 3R7LA 1G5FA 3Q41A 4G85A 3MJVA 3WFZA 2H4JA 3I92A 3VI4B 3U1BA 2FXVA 2OYCA 2QMYA 3W1WA 1WDWB 3SN6A 3CLSD 2WD7B 2ZR9A 3E3LA 3VV2A 1T2EA 4NE2A 2EQAA 4FZ3A 1FMTA 1V7QA 3DV0A 4TT3A 2QE6A 2H5IA 4LBVA 3U3OA 1WKVA 1QRDA 3AJ9A 3GNLA 5DHPA 4S04A 4OJQA 2X0KA 1ZH4A 3JWPA 2I8CA 4KBGA 4PZYA 1HE4A 1PUJA 3ILVA 3ORHA 5DB4A 1U1EA 1UR5A 3JQDA 3M5PA 3RIXA 3W78A 2E1RA 4YQFA 1P2VA 3PITA 4B32A 2R7AA 2GCIA 3CT6A 5F4BA 3VNAA 5AVRA 1RYMA 3D5QA 2BWJA 3BBPA 4LTNA 1UDCA 2C1XA 3NO4A 4F3TA 1CTQA 1TYAE 3WK7A 5E4YA 3KT6A 4K03A 3V7YA 2E1PA 1ZG3A 1RKUA 1D1PA 1L1RA 4FLEA 4LYHA 1FDSA 1ZI9A 3LUGA 1LLFA 2CUTA 2I4IA 4Y2UA 4C08A 3I61A 1FW6A 4CMGA 1L7RA 4FYJA 4XX0B 5G0WA 2Q6LA 4CTKA 3F67A 4Q9LA 4DLZA 1VJDA 5K99A 3ICWA 1Q7TA 4H16A 3VA7A 4DKJA 4ETNA 1RHUA 3ANYB 4UVDA 4D9GA 4XJVA 2VTDA 2BGWA 2HY7A 3MB5A 4J0DA 1UPFA 2WFLA 3SWWA 1N6PA 3SKVA 1I2AA 3T54A 2I71A 2UVPA 2C7GA 1PQYA 3OQ6A 4M4SA 4L5CA 3AUYA 1VIYA 5B58C 1TE2A 4M0FA 2O3RA 4D80A 5L4SA 2W8BB 2GILA 1AXGA 4MZXA 2HJWA 2IYQA 5CH8A 5DNEA 1K63A 4A82A 1DJQA 2W2VA 2Z95A 2G9UA 3ET5A 1EXVA 3IL2A 4B6JA 4W63A 1IXRC 1G2PA 4UM7A 4ZRNA 3GZTB 3HL0A 1KO7A 2D7CA 3P9YA 4O1MA 1ODJA 5CX1A 5EHIA 2O5VA 4YRNA 1PS0A 4KO3S 5KKCA 1ZJ4A 2F2TA 4WIAA 2YV3A 3UAZA 1QS0B 2C57A 3BX1A 3MYRA 3PFGA 1OMOA 5SY9A 2AFHB 4HWRA 3STUA 1O9HA 1U1GA 3D8RA 1D4OA 3DLIA 3GK3A 4IZOA 1O4WA 1SRQA 1T5DX 2RH8A 4BLSA 2O0MA 1KZGB 3S27A 1OXUA 2BDEA 1WD5A 4KO4S 4EG7A 1C0KA 1RZVA 2ZYVX 1GL9B 4TV8B 4YASA 1UJMA 2CNDA 4DQLA 2FGKA 4X71A 2J8ZA 3IA2A 1IOZA 3FKSA 3E03A 1ZIYA 4L85A 4R05A 5GWXA 2A35A 4W5NA 4DT1B 1PWXA 4RKEA 2FG6C 2O7QA 2OQIA 2XVZA 4EX7A 4EVIA 5JAPA 1CEXA 5AVKA 5ELLA 3T06B 1DHTA 2JI8A 1S9HA 1OI2A 3AY7A 2L0XA 3HI4A 4NZNA 4ZCSA 3PPYA 4BFXA 1G3UA 3ZXXA 1NNSA 3A4TA 1ST3A 1NUPA 2O2XA 3FWHA 4JJ8A 4Q4DA 1LI4A 4OXQA 2FPIA 1F9EA 3ZNOA 4AMUA 4CKBA 4YALA 5K45A 1G5QA 4RIGA 5DJ5A 4AZVA 1EBUA 3CRNA 4Y8VA 2W2PA 4TYPA 1ZN9A 2C5LA 3FUUA 3HSYA 1JQJC 2PT9A 3E6AA 4C4AA 5BV2P 2IZ0A 4EYQA 4KNYA 3R2JA 3KB1A 1SEPA 4HS9A 3ZU3A 3A26A 3IMEA 5THXA 1BKDR 3OJFA 4KVAA 4C4YA 2UU9B 2DH5A 4CKEA 1TCUA 4XQGA 3BWCA 4Q3NA 4X97A 3QVWA 3DE5X 3IELA 2ZYIA 1N7JA 3P32A 4QYIA 1F2UA 2OFPA 3H99A 4Q6WA 4UBNA 4TPKA 2O1EA 1YVEI 3IVRA 5ITWA 1QTNA 4ZICA 4PSKA