3GIWA

Crystal structure of a duf574 family protein (sav_2177) from streptomyces avermitilis ma-4680 at 1.45 a resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
262
structure length
262
Chain Sequence
RIDTESAHSARIYDYIIGGKDYYPADKEAGDAMSREWPALPVHMRANRDWMNRAVAHLAKEAGIRQFLDIGTGIPTSPNLHEIAQSVAPESRVVYVDNDPIVLTLSQGLLASTPEGRTAYVEADMLDPASILDAPELRDTLDLTRPVALTVIAIVHFVLDEDDAVGIVRRLLEPLPSGSYLAMSIGTAEFAPQEVGRVAREYAARNMPMRLRTHAEAEEFFEGLELVEPGIVQVHKWHPDAATADGIRDEDIAMYGAVARKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Rossmann-fold protein of unknown function (DUF574) (NP_823353.1) from Streptomyces avermitilis MA-4680 at 1.45 A resolution
rcsb
source organism Streptomyces avermitilis
molecule tags Unknown function
molecule keywords Protein of unknown function DUF574
total genus 84
structure length 262
sequence length 262
ec nomenclature
pdb deposition date 2009-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04672 Methyltransf_19 S-adenosyl methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3giwA00
5EQJB 4DF3A 1FJXA 3HA5A 3SXJA 1R8YA 2WA2A 5HEKA 1MHTA 1KYZA 5HILA 3R3HA 5T67A 1X19A 4E2XA 3TMAA 4E70A 1Z3CA 3FPJA 3A4TA 4EKGA 1M6YA 3MTIA 3JWHA 2OO3A 1G8SA 5KQSA 2NXNA 5EMMA 5BW4A 3HVHA 4CKEA 2B25A 4M38A 3KQYA 4ER3A 2JJQA 2PV0A 4PYMA 3DXZA 5DT2A 1O9GA 3T7RA 3OZSA 1JR4A 5DXJA 2P3QA 2P7IA 2CKDA 3HNRA 2XVMA 3NDIA 2UYOA 1TW3A 4E31A 3BXOA 2G71A 3KQWA 2O06A 5CUQA 1QZZA 1YFLA 2A14A 2EG5A 5EOVA 3HTXA 3MHTA 1VP9A 2UYHA 3B89A 3A26A 3DULA 3JWIA 3LECA 3VC1A 1B42A 5EMKA 1RJFA 3GDHA 4XUCA 5GM1A 2AVNA 4FSXA 3KQMA 3HVJA 3G8AA 3DH0A 3G89A 5DLYA 3UWPA 2HTEA 2AOXA 3BWCA 5CIYA 3SSNA 5F2NA 10MHA 2FK7A 1R6AA 4OBXA 1T43A 3A7DA 5CVUA 1NBHA 2VDWA 4M37A 4YUVA 3I53A 2ZSUA 3LBYA 1SQGA 2NXCA 2BZGA 3FZGA 2ZWVA 3PS9A 3ER8A 3SR4A 5LQCA 2FYTA 3HCAA 3LCCA 2ERCA 1NV8A 5F2OA 3G7UA 2PKWA 2IBTA 2O05A 3JWGA 3FTCA 4HSGA 4E33A 4OX9Y 1XXLA 3MCTA 5CVVA 1L3CA 3SSOA 2ZBRA 3I9FA 1UIRA 4P7GA 2Y1WA 3MERA 5FULA 4ISCA 1DL5A 1RI4A 4CTJA 5BXYA 5EIWA 2BH2A 2BR3A 2ZZMA 1FP2A 3P71T 4KDRA 2CMGA 2AOWA 3M6VA 3A27A 1P39A 4L7VA 4QPPA 1FBNA 3ER9A 1KPHA 3LBFA 3RIEA 3UJ8A 4IV0A 3KHKA 5FQNA 4GEKA 3KPUA 4LWOA 1QANA 4BP1A 3GRVA 3QOWA 1IY9A 4IWNA 5DXAA 1HMYA 2I62A 1P1CA 3QV2A 4C4AA 1XTPA 1YZHA 3C3YA 4GOLD 5HIMA 4R8RA 5FTWA 5DTQA 2AOTB 3FYCA 3GWZA 3ANXA 3FRHA 2G70A 2EX4A 4LECA 3R6TA 5LQJA 3R24A 1G8AA 4ATNA 5K0JA 2H11A 2P41A 5FHRA 1KHHA 1P91A 3OU2A 4YMHA 3NVKI 5FADA 4P7KA 3SSMA 3KR9A 3GCZA 1D2HA 3M6UA 3KQOA 1BHJA 3EMDA 1O9HA 4U7TB 3C6KA 2IP2A 1NV9A 4DQ0A 2P1DA 1L3IA 2YXEA 1WXXA 4PWYA 3V8VA 5DWQA 4DCMA 2IFTA 2P40A 4KIFA 5E9JA 4EVIA 2PX2A 2VS1A 2YVLA 3BWMA 3HEMA 3PFGA 4E32A 5HFJA 3KPVA 3LKDA 3EMBA 2UZ4A 1ORIA 2GPYA 2ZVJA 2HWKA 2ZBQA 1JG4A 2GAFA 2GB4A 2LD4A 1D2CA 2V74B 5CM2Z 3PVCA 5DM1A 4AZVA 5GOZA 2ZBPA 2PXAA 3DXXA 4PIMA 3G88A 2PGXA 2KW5A 4HC4A 4E2YA 2PSSA 3PB3A 4YV2A 2PWPA 2IH2A 2PT9A 3GGDA 3MCZA 4GOND 4H0NA 2HNKA 5EZSA 4CTKA 2ZFUA 4HGYA 1QAQA 1YB2A 1ZG3A 2ZTHA 3LCVB 5GIPE 5FHQA 1SG9A 3B5IA 4JXJA 2IH5A 5DRYA 3TPZA 4QTUB 5DM2A 3TM5A 1KPGA 3FUTA 3S68A 4XUDA 3VYWA 4F84A 4RTOA 1SVUA 4DCGA 2IBSA 5MHTA 3KQQA 3PFHA 2PX5A 4GBED 3A25A 3B3JA 3B3FA 2QYOA 4GOOD 3AXTA 3DLCA 3MGGA 3TR6A 2ONZA 2Q41A 4BLUA 4C08A 3E23A 2QRVA 3LDFA 3T7TA 4ER6A 4RTSA 1XCLA 4RTNA 9MHTA 3P2EA 5E8JA 3EVDA 3TKAA 1VE3A 5EVJA 2CMHA 3G2QA 4RVHA 3KQVA 2ESRA 3IHTA 4ZTBA 4YMGA 3HCFA 1BKYA 1TPYA 2C7PA 4RTPA 3FPEA 2ZZNA 3FRIA 5EMJA 2AN3A 5IKMA 3F4KA 3LPMA 5ERGB 2OXTA 1G6Q1 1M6EX 2BM9A 1RI1A 4RVFA 3EVCA 4CKCA 2AN5A 3EVFA 4OA5A 3BT7A 5KYGA 3HCEA 3HVKA 3PX2A 3TQSA 3LKZA 3FUVA 5DTRA 5FWAA 4AZWA 1EJ0A 2Z6UA 2XBMA 1TW2A 2P8JA 1NT2A 4PYNA 3RODA 2JH9A 3OE4A 3REOA 3C6MA 1L3BA 3FUWA 4PCAA 3UBTA 3DLIA 5E1MA 3HCBA 2V7EA 1ZGJA 2OB2A 5DSXA 5LQRA 2AZTA 4PYLA 4ER0A 1EJ6A 3LCUA 4V0QA 3EEOA 2C7RA 3PLAE 3MB5A 1XDZA 5K05A 3NDJA 2K4MA 3JWJA 5T64A 2N47A 2OB1A 1QAOA 1BC5A 3TFWA 2VDUE 3M70A 5K03A 1UWVA 4QQKA 2NP6A 1NKVA 3OFJA 3VC2A 1I4WA 3CCFA 4HTFA 3CJRA 1IXKA 5JR3A 1H1DA 1FP1D 3EVBA 4PGGA 5EZQA 3EGEA 4E2WA 4IKPA 2ZW9A 3KQTA 1SUSA 2PY6A 3DP7A 4GOMD 5FWDA 3KR0A 5E2BA 2H1RA 2JHAA 5E9WA 2ONYA 1RI2A 2IPXA 4GC5A 3EEYA 3P9IA 2GLUA 3TRKA 3G2OA 3KPJA 5CVEA 2BR4A 2AOTA 1AQIA 2WK1A 3DXYA 3FUUA 4PYIA 2PJDA 3HVIA 3KKZA 3UJAA 2VDVE 5E9QA 3QOXA 3THRA 2CL5A 4MWZA 3V97A 3OCJA 1R8XA 3L8DA 4P7FA 5CVJA 1FPQA 2PBFA 1V39A 4KW7A 2Y1XA 2ZIEA 3SX0A 2C7QA 3ELUA 1SKMA 3UFBA 1NBIA 5GINE 4PYOA 4AZTA 5CD1A 1NW3A 3BGIA 5BW5A 4GQBA 1X1AA 2P3LA 2XVAA 4M36A 3RW9A 1HNNA 5EIFA 2FK8A 3BGVA 4DKJA 2ZWAA 4PCLA 3UJ7A 3OU7A 3P97A 4RVDA 5K0LA 4DZRA 4MQ4A 2NP7A 2CWWA 2JHCA 4GF5A 5IH3A 1YFJA 4POOA 5K0EA 3NTVA 2O0LA 3K0BA 3NW9A 1Y8CA 2NXJA 4FS8A 5K8VA 4BY9E 3OU6A 4X1OA 2QY6A 1O54A 3LSTA 4EK9A 5GP1A 3Q87B 2FRXA 1KXZA 2EJTA 4PIPA 1BOOA 1JQDA 4QQNA 3ELWA 2GS9A 4EMSA 1KP9A 3KU1A 1XVAA 2WA1A 2AN4A 2PLWA 4AX8A 3GO4A 2E5WA 5CCBA 3PTAA 5EHGA 4YV0A 5ICEA 3GRUA 2IIPA 2YR0A 3E7PA 5EC8A 5GM2A 1M0EA 3EVZA 3FPGA 4Y2HA 2AOUA 3SMQA 4YUXA 3IEIA 5K09A 4GUAA 3M33A 5DPMA 4QDKA 2ZCJA 1VQ1A 3GJYA 3FPFA 3HM2A 3KQPA 4WVLA 5DX0A 1WY7A 3GIWA 3AJDA 3KQSA 5D1NA 4Z2YA 4PYJA 2PX4A 2AR0A 4RTMA 1EQAA 2P3OA 2EFJA 1RJGA 2I9KA 4MHTA 4OBWA 2OKCA 2C7OA 3G2MA 1N2XA 4G56A 4X63A 1VBFA 3OZRA 3KPYA 4RYLA 1ZQ9A 3SM3A 1JG1A 1NW7A 3HA3A 3TM4A 2NXEA 1JQEA 5BP7A 3TLJA 1VLMA 4R6WA 3BKWA 2PX8A 1JG3A 1KR5A 3C3PA 2PXXA 2HR1A 2R3SA 3M6XA 2PT6A 4YUZA 5ICGA 3DTNA 2IH4A 2VP3A 3E8SA 5HIIA 1NW6A 4C04A 1KPIA 1XDUA 3GRRA 4A6EA 4OA8A 3AY0A 4RTJA 1DCTA 1AQJA 4Y30A 2JG3A 3E05A 4X41A 5H02A 3UJDA 2IGTA 4C03A 4YUWA 5EEHA 4KWCA 4RTQA 5DSTA 3NVMB 2Z6AA 3FPHA 5K0NA 3Q7EA 5CVDA 1I1NA 2O57A 2ORED 5DRTA 3H2BA 3BUSA 3GRZA 2DULA 4CXMA 3R9XB 1YZ3A 4PGHA 4LWPA 5B1SA 2XYQA 4FP9A 2ADMA 5E1BA 1YF3A 1ZHFA 3KR1A 4AUKA 3OZTA 4QPNA 5EHIA 5LSAA 1VP3A 5E2AA 3BGDA 4P58A 3GNLA 5K0CA 3AWIA 1VPTA 3P2IA 3HCDA 1EAMA 5FA5A 1JSXA 2QE6A 1XCJA 4C06A 3VSEA 4MTLA 3G8BA 2DPMA 3EVGA 5D1HA 3CBGA 1JTFA 3G2PA 3EVAA 3PX3A 4M7RA 3EGVA 1U2ZA 5LQAA 4EQZA 3K6RA 3DR5A 4HTFB 4F85A 2O07A 4HH4A 4R8SA 2YXDA 3CC8A 1JTEA 2AOVA 1UFKA 1X1BA 2YTZA 2F8LA 3AXSA 3B7PA 4RX1A 4R05A 3IV6A 5DM4A 3HP7A 5ICCA 1AV6A 2NYUA 5ICFA 4KDCA 3TOSA 5KVAA 2IDKA 5HZMA 4PONA 1F38A 3BWBA 1R18A 3KR2A 3NWEA 5E1OA 5JUWA 1MJFA 1SQFA 3LDUA 3O31A 5EKXA 5C1IA 4UOEA 7MHTA 3A7EA 3OE5A 4P7JA 2BR5A 4QTTB 1QYRA 4QVGA 4PNEA 3ERCA 2PXCA 3FTFA 1JG2A 3EVEA 2ZLBA 4C07A 3DOUA 3CKKA 3MQ2A 4X60A 3I5UA 5DX1A 3BKXA 3M4XA 2H00A 3GU3A 3WSTA 4DA4A 5DTMA 1N7JA 2PVCA 2AOUB 5HOQA 5FUBA 1VIDA 1INLA 1YUBA 4U7PB 4QDJA 1QAMA 2YQZA 5FCDA 5G02A 3HA7A 4RTKA 3LHDA 4NECA 4AZSA 5F2KA 5FA8A 3T0IA 4RTRA 5CCXA 2Z6QA 1X1DA 1NE2A 3M6WA 3UA4A 4C05A 2I7CA 2YXLA 4OQEA 1D2GA 4IV8A 4LG1A 4KVZA 5KQRA 5GIOE 4V0RA 4E30A 1ZKDA 2BM8A 2YUIA 3P2KA 3FTDA 5EMLA 1N7IA 2OBFA 3GRYA 3DUWA 3UJ6A 2B78A 4WXHA 4DMGA 3G5LA 4KRGA 4CWAA 3U81A 5EG5A 3UZUA 3P9KA 4GC9A 5K0FA 1JQ3A 4K6MA 3LDGA 1KYWA 3DMHA 4RSRA 4E2ZA 3SGLA 5GWXA 4O29A 5P8WA 4XCXA 3ORHA 2QRVB 1NW8A 2GA9A 4CKBA 4HGZA 1WS6A 5KS2A 2OYRA 1ORHA 4RTLA 5E1DA 4BLVA 3EGIA 5FQOA 4PYQA 4HRAA 5LQUA 5EEGA 5E8RA 4BP3A 2UYCA 3UA3A 1G60A 4ER5A 3DMFA 5HIJA 4YUYA 3NMUF 4B17A 1WXWA 2UYQA 4YV1A 4FZVA 5M5BA 3IYLW 5K0BA 4MIKA 3P9NA 3D2LA 2FCAA 3LX6A 5T6BA 3MTEA 3HCCA 3LGAA 3UJ9A 1IM8A 2P35A 3CJQA 3MAGA 3T7SA 5LQNA 2ZZKA 3P9CA 2R6ZA 2XYRA 3BZBA 3CGGA 4X61A 1NW5A 1Q0TA 3C0KA 1G38A 2OZVA 3GXOA 3FYDA 3LL7A 2OY0A 3DMGA 4PINA 1RJDA 3B3GA 4A6DA 3I58A 3THSA 5EKUA 1F3LA 1ZGAA 3ELYA 2FPOA 3ID6C 1WZNA 1VL5A 4FR0A 3R0QA 5C0OE 4EKIA 1XJ5A 2B3TA 1RJEA 4XUEA 1I9GA 5LQKA 4HG2A 4FT4A 1X1CA 3OFKA 3EPPA 2P7HA 3G5TA 4OQDA 2OPBA 2ZIGA 4ER7A 1Q0SA 2NNWB 5U4XA 3O7WA 2B2CA 4FSDA 2PWYA 2G1PA 3NJRA 3UJCA 1DUSA 4R6XA 3I64A 5LR6A 1WG8A 2IDJA 2JHPA 1XDSA 2JH8A 5DX8A 2HV9A 1EIZA 1KIAA 2I6GA 4F86A 2AS0A 4KIGA 5EGSA 4RV9A 8MHTA 1AF7A 1RI5A 2GH1A 1RI3A 3FTEA 2QM3A 3O4FA 1EG2A 2B9EA 3BWYA 2G8NA 5HIKA 3FUXA 1OR8A 2EJUA 3KPWA 1PJZA 1R00A 3UJBA 2HMYB 3SVZA 5C9ZA 1L1EA 4PYKA 3P8ZA 4RWZA 1P1BA 3NWBA 1G55A 2FHPA 4DM3A 4RVGA 1JSZA 2XYVA 1PRYA 5K01A 3CVOA 4FGZA 1SUIA 2ZIFA 1R74A 4FT2A 4BLWA 2ZULA 2YX1A 2VZ9A 2AVDA 2G72A 1L9KA 3CJTA 3OPNA 5DM0A 5K0GA 3ELDA 5EPEA 3TKYA 3X0DA 3ME5A 4QVKA 3PT9A
chains in the Genus database with same CATH superfamily
2RGUA 4NONA 5EXSA 4HMPA 1GUFA 2EFDB 3WP0A 5FR1A 3Q5DA 4Y6PA 5FOXA 5TSDA 1C0LA 1KVSA 2V7BA 3E61A 1DKOA 1O97D 3MN1A 4EYEA 1S2GA 3SHWA 1RXIA 5K0SA 4Q4AB 4Q48A 3C7DB 1SB8A 3AJRA 5B7GA 5EMMA 4TLEA 2ASVA 4CKEA 1GITA 4LJSA 5JJLA 2P9GA 3I1IA 4KSBA 1KH3A 1NUTA 1RWKA 1IEWA 2BE7A 1TQ6A 1BEEA 5DXJA 2G83A 1DV2A 2WP0A 3KHSA 4R7GA 4BV8A 3ZCTA 1NU6A 2J09A 2UYOA 4GYJA 4ND5A 4II2A 4PVCA 4R2LA 2VNJA 4D9IA 4JJEA 5F1KA 1U28C 5IDWA 2R1VB 4RACA 3W4KA 2NSDA 4WN9B 2LKCA 3OLQA 4KMRA 2C9CA 1BWQA 4GKAA 4H59A 1Q15A 2NZWA 3H8VA 2P5YA 1NQWA 4ZT7A 3SR3A 4MEAA 3FHJA 1JWBB 4LXIA 2A0WA 4FOOA 4H77A 2VNKA 1W96A 2ECFA 3BJIC 3A1EA 4KUGA 2FK7A 3D3EA 4TL7A 4NK4A 3AFHA 1T43A 1ZK2A 3ABZA 1QIEA 2VDWA 3A05A 3IKLA 3KZVA 3K9BA 3A36A 3JCZA 4P4LA 5EZ5A 1SQGA 2FN9A 2CYCA 3FGOA 3AO0B 1KYVA 3FJYA 4JBYA 1PL8A 1W5AA 4U4AA 5E7MA 2O8BB 4D81A 5J1TB 1R9MA 4J2OA 4IUDS 3TH5A 2P9FA 1UBGA 3FTCA 2A5FA 3O8NA 3KWFA 4CKZA 3LT0A 1L3CA 3GCWA 1USVA 3JRWA 4LXHA 5E4JA 5BMVF 3T1OA 2SHKA 3FF4A 4HEJA 1RI4A 3CZRA 2A2ZA 2VEDA 5EE3A 5AJYA 4F3RA 4KDRA 1TLTA 5ALXA 4NATA 1GZSA 4ETNA 1IZ9A 3LQQA 1J8YF 3NI2A 4W8OA 3UAXA 1BEUB 4F9GA 2A3NA 4KREA 1KSGA 2H51A 1W48A 2OAGA 4IIFA 4M22A 3SYMA 3F7TA 1H0HA 1CZRA 3LZDA 4GPZA 2AZ4A 2FX2A 3ONDA 4W1RA 4YIKA 3EXG1 2VJDA 1YBMA 3DLPX 3AL0C 1J1IA 4O2AF 1A8UA 2QZJA 4POAA 1GPH1 4WX2B 2KJQA 2CUKA 2Z95A 3KS9A 2IP1A 5E6RA 3OEEA 3GJXC 1LRKA 3R24A 1CF2O 3HKBA 4LOHA 2H11A 4RMJA 3WK9A 2QJWA 2IXTA 4PZUA 4N76A 3EXFA 4OHBA 2OV2A 4PSCA 1QX4A 2I99A 4TV8A 5KYKA 4JOBA 3EDCA 3PA8A 1NYRA 4YRCA 4AY4A 2FZVA 2IP2A 4WRRA 4PHTA 4WFQA 1OF1A 1A3CA 3HV0A 3CBQA 1GUDA 2CL0X 2IFTA 4UEOA 1PNRA 4HNUA 3TW8A 3AOGA 5AQEA 4DGQA 1U4OA 3TS1A 2B4YA 3IA2A 1KYYA 1QVAA 1OBVA 3Q3VA 4LKOA 4JLVA 1SUBA 1LVGA 5JNWA 3KXIA 5H80A 2ZBQA 1FTSA 3OWXA 1P0FA 2AFRA 2GSDA 1OAOA 3B6EA 3HGTA 2IE0A 2ZRJA 1LS1A 3P96A 2OYSA 4W9MC 5A9SA 1JFRA 2FKAA 2ZBPA 3COPA 3GRPA 2WIFA 1VG9B 4BMPB 1KVRA 2R00A 4KQEA 1CUZA 2X76A 4D1YA 2PU5A 3HDVA 3BK1A 4UUQA 2E21A 2H7XA 2ZQZA 5ELMA 1EP2B 1F8UA 1U3UA 4YI3A 3Q2IA 2FWBA 1VIMA 3AP1A 1KYXA 4ZV7A 1G5PA 4EO9A 3L1UA 4QM6A 3C7KA 3FYHA 5FP0A 5C52B 2PLNA 3WLIA 3B5IA 3PWKA 2FQXA 5AO9A 2YN0A 4WOKA 5ARCA 3CUEF 2MDTA 3JXEA 3K5HA 4FX5A 2GJSA 4U7DA 1L2TA 4QHTA 3PXUA 2C7BA 2P9JA 1E7YA 4OL0A 1DAGA 5JZVA 3DZDA 3MINB 4OYYA 5TS2A 2DQ4A 4Z4CA 5FNVF 1U7ZA 4HYTA 3DLCA 3JYQA 1OROA 2QAJA 3OTQA 1CUFA 4LC9A 1J2RA 4TZKA 3ESCA 4CF4A 4M1YA 4G86A 2EZ8A 3P2EA 2RGCA 2NO1A 4ZT6A 1V11B 5FPQA 4GKBA 5H0IA 3NUQA 3NKLA 3PGJA 3RASA 3VAZA 1BGWA 1E5VA 1DWUA 3PQEA 3NT2A 4JUAA 1TKBA 4MRSA 4PXYA 1TPYA 4Q3CA 1SFRA 2DXIA 4G0UA 1AXRA 1DIOB 3L7YA 5EMJA 2YKGA 4ZTZB 5GVSA 4TYMA 4RZIA 5A0FA 2ZBDA 1WZEA 4PFSA 3G1WA 4L9WA 3RC9A 1N6NA 4I36A 5JAPA 1ZGGA 1FEZA 1LLCA 4E5UA 2V59A 4CBVA 4RETA 2P1RA 2PZKA 3B12A 3RVMA 4DLBA 4B34A 1S8OA 4BX3A 2JEZA 2A0KA 3F3YA 1EJ0A 4ZMBA 1WNTA 1W0KD 3E6AA 3O8OB 1F8XA 3DAHA 3LLSA 1T4MA 2ERXA 1L3BA 5C8YB 4NSNA 1ATIA 3JS5A 2EU8A 1WXFA 1DQZA 3RYIB 2JGMA 4TQAA 2GYWA 4YDHB 1XR3A 5BR8B 4BIIA 4LXGA 5EWLB 4PG8A 4V0MA 1AB5A 2N46A 3UTDA 1H8HA 4N49A 3C24A 3MB5A 4E5YA 5K05A 1XVLA 1ATZA 13PKA 4EATA 2L18A 4EYGA 2PL1A 2Q2OA 3R3ZA 4NULA 1PR9A 1EFKA 4P2BA 4XEHA 3TFWA 2FH5B 5TARA 1PS8A 5KIAA 2AFHB 3G9ZA 2PN1A 2PYZA 3ET5A 4EUEA 1HQKA 3KAKA 1H1DA 4DSOA 2QI9C 5EZQA 1PJLA 1RKUA 4B48A 4Y2RA 1GKUB 1Y4SA 4IKPA 4OREX 2FFAA 3WGHA 3FWZA 4D0LB 4XYGA 2WJWA 2AMLA 5KTYA 5KQGA 1U8FO 1VGRA 4BEVA 1PNOA 1JU3A 4GC5A 2IU3A 4HDKB 1CUEA 1K9VF 4PYIA 1RKXA 1PR5A 4QUKA 4RL4A 3V4SA 1TQ4A 3UJAA 3WLTA 1YV9A 3EZ2A 1G5RA 4A3SA 3CUKA 4I9GA 3IVGA 2Z08A 1E8DA 3B6ZA 4R41A 1Z25A 1R5JA 1GFSA 1EUCB 2FTKE 2AZDA 3WJAA 3QH4A 2P9CA 4K9OA 4OGWA 2PUFA 2P5SA 3EMVA 3GF4A 3IJRA 4J0EA 2A1UA 4AZTA 4JJIA 5JXWA 3VGPA 5REQA 2LDBA 1YAHA 2ZYVX 4Y0VA 4OJTA 2IQ5A 3DPSA 3F47A 2VNAA 4PBTA 2OHJA 4IMJB 3K6SA 4EFKA 2QORA 2QRHA 3L7JA 3MSXA 1SBQA 1L7XA 3OQ6A 3QE2A 4P33A 5IN5A 3U7IA 3OEHD 4ZV4A 3R20A 5BN4A 5DEOA 4I9NA 3ZLJA 5H82A 2BHNA 1A8QA 3FOCA 4JH0A 4G0QA 4EARA 5K8VA 2JVJA 3UJNA 5FPPA 1SELA 4NV1A 2IZ6A 1HDEA 2YVAA 4KITB 3TBFA 5KB3A 1NR5A 3KJIA 8ABPA 4JLSA 2ZIXA 2JD2A 4KL8S 4O4JF 2EW2A 4C0QC 4LX0A 2P0YA 1IN8A 5DH9A 4AX8A 1GARA 2RCYA 3ET4A 3A1SA 1W4AA 4YV0A 1ZJJA 5JO9A 4D9GA 3JR7A 3NKVA 1QUEA 2QGFA 2W6ID 4QDUA 2M6LA 3B1ZA 1F14A 3IP3A 3KTDA 4LZLA 1OWPA 2B30A 3EVTA 5T3UA 1SVNA 2PFGA 5KDLA 1W88A 4A91A 3JVVA 4GUAA 5FPYA 3S70A 3HJBA 4JITA 3IVAA 1YRBA 4TMZA 4MWSA 3RVKA 5JD6A 2QVGA 1NVUQ 3RUHA 1EQAA 4G26A 3VR5A 4F2HA 1FS4A 3GUHA 4OBWA 5BSWA 1AGNA 1N2XA 4QREA 4X63A 2FOIA 2VPPA 1VBKA 4KXNA 2X9QA 4DB2A 1U65A 3U4CA 2HU5A 1XPJA 2X9LA 3IURA 2G63A 3O1IC 2HA6A 2WZBA 4PC2A 4E3ZA 1CUSA 2DRIA 1RRMA 2VPIA 2W2LA 3RWOA 1Q16A 1ISGA 2F1KA 2VHXA 2FP4A 4OGLA 1TO2E 2X4LA 4ZRDA 4AK9A 1PEDA 4FN5A 1T2UA 2R9VA 4J0HA 4DLUA 2GNOA 4OH7A 3DDCA 3KBOA 1PJAA 4J0DA 1R0YA 4BO5A 1XDWA 2XCLA 3GT0A 3BFKA 3MLEA 5L51A 1U8YA 3NATA 3H11A 4MUJA 4QYSA 4A2CA 4M9XA 1OLOA 1OLSA 3BD9A 4HDNA 4PHGA 3R9XB 2XMPA 5C8VA 1Q12A 4KK4A 1X1EA 2NQ8A 3KETA 2XUAA 3BCUA 1QGUB 2ADMA 5J2TF 3IUYA 4ZP1A 3KR1A 1C7ZA 1ZIXA 5CDGA 3PPVA 2YOGA 1T2DA 2QE7D 3WRYA 4E5DA 1D5CA 5BQ3A 1U8TA 1FNSA 2FUKA 4M53A 4R1UA 1Y8ZA 1TT7A 4IWXA 3P2IA 3UMCA 3ST7A 5HQ3B 3HNPA 3KB1A 4BVFA 2ZPAA 3KEOA 1S7CA 1EWYA 2XE8A 2YMPA 3HY6A 2GN9A 3S5JA 4IS2A 5HIAA 3DHEA 1R15A 5GVRA 1UEXC 2IS6A 2NO6A 2G9ZA 4OB7A 4OLFA 5CX1B 2BIFA 3V1MA 4KHPB 4FYVA 4JT2A 2I4IA 1WKBA 2LGJA 2WSYB 2ZRHA 4LOLA 4W6ZA 2O1SA 5KAMA 2BI8A 2G67A 1DMRA 4CDRA 1ZM2A 2NYUA 2UXDB 4V3CA 2C1ZA 2HJHA 2YNMC 1T13A 1ONBA 1O6GA 2ODBA 3H4TA 4XB2A 3SZUA 1KRWA 1RD4A 3BXPA 5TQVA 1XWWA 1MZPA 6Q21A 4XVCA 1QYRA 3A4VA 3RSGA 2BGMA 4LY9A 3TJMA 2V4UA 5HBGA 3FW1A 2O3TA 4C01A 2FKNA 4G07A 3OCZA 1JUDA 3L0YA 4V2IA 4X60A 3VR6D 2XKKA 3KYCB 2WJZB 4XSGA 1T1EA 3GYGA 1N8KA 3JASB 1X9GA 1FLAA 4B2YA 1KMIY 1NOIA 1C7JA 3MFYA 4UREA 3R8CA 2RE8A 3EIQA 4HDRA 4UCFA 2GJ9A 3MWYW 1H2WA 1WXHA 4YAOA 1DWOA 1NNI1 5FORA 3UM9A 3ZNPA 4F5WA 5EJ6A 3HDHA 2C9YA 4INZA 1EWKA 4N39A 4U2KA 3ZWAA 4B5KA 3SHQA 2YXLA 2D2EA 2JI8A 3FOFC 5A9TA 2BFAA 1DAFA 2NUTB 3EISA 3ZBTA 2HTFA 2FPXA 2VN8A 3ZHXA 4YR7A 2ZBGA 1A71A 2H2WA 1E2DA 2CF5A 2ZUUA 2CFCA 4XIGS 1FVOA 2YFQA 3ADPA 1H93A 3ORRA 3U19A 3IP7A 1DMSA 2GCPA 2JJ1D 3IOYA 3VC7A 3SGLA 4EO4A 4BQSA 1NW8A 4QQRA 5FH9A 5FJJA 5H7XA 4JB0A 2YS6A 1WCIB 5EXXA 4WKNA 2NTEA 4X6XA 1NASA 2JLYA 5CLHA 1FQJA 4FBLA 2YYSA 4X3CA 2H48A 4X64B 1W30A 3DMFA 4D9JA 5HFAA 4RMNA 4MS3B 4BC1A 5K0BA 2WLTA 4EABA 1QGAA 2FR8A 4ZAWA 3M5WA 4LJ5A 3W5AA 3AM1A 1DIBA 3RKSA 3PDIB 3AF5A 3EFHA 4GR5A 4R40A 1DCKA 2R8ZA 3T1HB 5LOVA 2BGGA 3TIFA 4N8SA 1G38A 3E5MA 2QLLA 3K3PA 1ZH8A 4EDFA 1FSGA 5C4MA 2O8EA 5JYBA 2ZRQA 1DELA 2RGDA 2FMFA 2XR1A 2A30A 4KACA 1EX6A 3JQ7B 4TS9A 3LS2A 3C8HA 2ORIA 4YXWD 3I32A 4F71A 3REQB 3ASYA 1PBNA 1YMVA 1K5DA 3EJWA 4IS3A 4FDVA 2WHEA 4DREA 4M1MA 2WYWA 5H5JA 3DAPA 3A6GA 3O26A 4BQQA 1RHMA 4X84A 3RJ9A 5T4FA 4TXMA 3G1UA 2V45A 4LF4B 2YWRA 2EEZA 1WR8A 1KMCA 5A1JA 4DNOA 3EGXA 5JSFA 1BHSA 4FWIB 5I7FA 4BNUA 2VRBA 1JEYB 2AEFA 2CDBA 3DMYA 3R3JA 3ANLA 4F38A 3NH9A 4H1UA 3THXB 1GGHA 2FW6A 4P22A 2IIQA 3AMVA 5BSTA 2GN8A 5DU2A 5MF6A 2W4MA 3C3DA 5LZ8A 2MYPA 3MJSA 3W8DA 3RVOA 2MWMA 3TLZA 4F4FA 5H83A 4R8VA 2PGDA 4GOXA 2HU2A 3HL0A 1JQBA 2Z8ZA 3WK6A 2GFHA 1Q77A 4M8IA 5MN6A 1WHTB 5HP4A 2O7RA 1TF5A 3EDRA 1JQLB 3RSQA 4EA7A 1AZTA 2C4UA 1G5TA 2Y1EA 3HA5A 2DBZA 3ANSA 4HGOA 1ENPA 2FNAA 3KZCA 2HW8A 4Y7CA 4REOA 2E4ZA 2VBCA 1VG0B 1KKLA 1YZLA 2W2OA 4TX1A 1WEHA 3CIOA 4ZFNA 4OXRA 2XMGA 1YFJA 1H3NA 1VKOA 5KTOA 4QHYA 3F67A 1RPZA 1GQFA 1C9YA 2Q9UA 3EODA 2I8LA 3ADKA 3VX4A 4CV1A 2JFVA 3M34A 4K0RA 4B3BA 4UHHA 3GJSA 4HWOA 3DJFA 2OMKA 5DZSA 5HMLA 1C9EA 1XTSA 1M2VA 2QD5A 4L9AA 4NOJA 4INAA 3VR2D 2P5TB 5I8PA 2A7XA 3DCNA 4C20A 1K88A 3TQIA 3JQDA 3JWIA 1H65A 1X9HA 4M3NA 1YHNA 4DY4A 4YVFA 3AVVA 4NJEA 5E3IA 1HWYA 1IVYA 5GM1A 3VJRA 4TTSA 3W3AD 2IZ1A 1NPYA 2GEVA 3QXXA 4Q19A 4DYHA 3GLGE 1QDLB 1ZEMA 2DHRA 1Y3DE 2D2VA 1AHHA 5LDDC 5JCPA 2I6TA 1K7YA 3I05A 4JMPA 4JK3A 4BMZA 1JH9A 1NF8A 2P9QA 3JQEA 3KHUA 3N2GB 2M6SA 4U02A 3LBYA 4WNCA 5ADWA 2F48A 3NAMA 4L4ZA 5SYMA 4AO8A 2H2IA 1SOMA 3R8FA 2G17A 3B7WA 1Y4ZA 4HQNA 2QJRA 5FWNA 5JASA 2PKWA 2WV9A 1SPBS 2R00C 2DUUA 4YONB 1GCUA 2Q9CA 3MCTA 2VYQA 3HSKA 4NENA 3THXA 5LC1A 2JCBA 1YRHA 1PUJA 1WMDA 1YC2A 3QUTA 5C32A 1H2FA 5EIWA 3NLLA 3SHOA 2E4XA 3D4OA 4M2LA 1CERA 3ITDA 4IJVA 1UDBA 3LM8A 3ZDDA 4Q3AA 2AI1A 2EFCB 3LBFA 3CF0A 4I50F 4M0FA 3PFBA 4MQEA 2AJDA 2QTBA 1LDEA 4GEKA 1BVUA 1MOZA 3HBNA 2OZLA 4TQGA 4IINA 3IEXA 4IWNA 5E6RB 2XZLA 2J9ZB 3PITA 2EX0A 4LYAA 2GZDA 2QXTA 2XA9A 2IYNA 3Q0EA 3RAEC 4QA9A 3KELA 2J3HA 4LZPA 1EUDB 2RGBA 5FTMA 4KPYA 4MPDA 3OQVA 3NBAA 4QDXA 4C7XA 4Q47A 4FIDA 1U3FA 4NP6A 5LYJF 3AHEA 1LVUA 1O3YA 2YYAA 3AILA 3CVVA 3U4QA 4YMHA 1QQ7A 1H3EA 1HETA 3VKVA 2IOYA 1Y80A 2Q9BA 1M9NA 3CZAA 4NZOA 4ZOLF 2RK3A 2Y1DA 4IW3B 4M89A 3LK7A 5AW0A 4DMMA 3ZJTA 1YQDA 5JARA 5KYXA 4WTOA 1KO7A 3LUKA 1Z4QA 2XTJA 5EE0A 4YRPA 1P1JA 2BE9A 3WKAA 1NBMD 2L0XA 2PKRA 3IAS1 4KIFA 2F62A 3MELA 2RH8A 5KTRA 1DEXA 3ASVA 3VC3A 5ADUS 1LDMA 4J3JA 4CG0A 1CUWA 4E32A 2GYVA 5KSZA 3EF3A 4CLRA 4NIMA 4LBZA 4XDZA 3WNDA 4ALLA 3L93A 4DQDA 5IANA 1OLXA 1NM5C 1W1WA 1Y34E 3IEPA 1SNYA 2ZYSA 2GAFA 3T6KA 4CKXA 1EVJA 1M54A 5IVPA 4K1XA 4GRAA 1CU1A 2BKLA 3J81A 4JUIA 3ZY3A 3O93A 4PIMA 2XNHA 5SY6A 1SVMA 2JFHA 2KW5A 3E9NA 3ONNA 3ROKA 5ICMA 1SURA 6PFKA 2BHRA 1HDOA 1AA9A 1JNXX 2DAPA 4AC9A 5AM2A 2JA2A 3NT5A 1PQPA 1JNYA 1NUUA 3ICEA 1M5UA 3FKSA 2VHZA 1Z35A 2ROQA 3WO0A 1M1YB 4HN2A 4QOEA 2GEBA 1KR2A 1VL1A 2QJTA 2W6PA 4KAFA 2OFPA 4ZAVA 1X77A 4G89A 4OV6B 5A05A 4DQKA 4G5YA 3KT6A 5EJEA 1YKFA 3LJKA 3TO5A 4HAIA 2Q7OE 4BL5A 4CODB 4GD3Q 4IG4A 1YTLA 1XV5A 3RFXA 3WYEA 1CZUA 1ORDA 4RHUA 1KY2A 2FSGA 4PY2A 2XX3A 4HWRA 1ICIA 1LXCA 1WCXA 1Z8NA 2QT1A 3NNDA 1L5GB 3TLEA 1RYZA 4AMUA 2Z1NA 1ZYUA 4A2PA 4Y2QA 4WJZA 1Q7TA 2H9YA 4DN6A 1L5SA 3ZTYA 4DEVA 1JN0A 3T7TA 1IBSA 3WGLA 5I9LA 5A9RA 4BN5A 1VRCA 1W59A 3P5BA 1H5UA 1LPBB 3HHEA 4E13A 4BGIA 1X92A 5TDHA 2CLFB 4B8YA 2PZBA 3E1GA 4UD2A 2J3LA 4OJYA 1PT6A 1Y1RA 2GD1O 1NJ8A 2ZTMA 4GLBA 3HCFA 1E98A 4AN0A 1JDUA 1P2UA 4O4LB 1CP2A 1U1FA 4RGQA 2JATA 3FG9A 4WUVA 4X7RA 1FYFA 3BHJA 3CRMA 4XX0A 2QL6A 4A1OA 1H69A 2OGWA 1AQ6A 1RQNA 2L19A 1WMBA 3E4CA 4G5HA 1Q3TA 1CQJA 8AT1A 5ED4A 1Z4NA 2GHRA 4U9UA 2I3BA 2NUBA 1I7NA 5H3LA 3S2IA 3COVA 1I94B 2AK2A 2I34A 3O9VA 4EJSC 2WJYA 1KJJA 4YT4A 1BWRA 2ONCA 3LQ4A 1O97C 5HFNA 2BFFB 1XCPA 4YP1A 3C6MA 3DHWC 1IB6A 5AM4A 2HMAA 4WASA 3M9XA 2C5LA 2XTAA 4REQB 1BA3A 3Q6MA 1M74A 2CV0A 1FVHA 1FCJA 1UBFA 1MAVA 1DO0A 2MHCA 3BQ9A 3E5HA 1S1CA 4M8LA 4UDOA 1BG6A 4KO8A 3CRQA 3F9CA 4V0SA 4WZZA 1QFJA 1ORVA 1IWPB 2HLNA 2OMEA 4F06A 2NUPA 3AUJB 2TYSB 4CGYA 1VGVA 2GN4A 1QAOA 1COWA 2A9VA 3M70A 2CNWA 2OL4A 4IJ5A 4P35A 4AUEA 2VRWA 2GSWA 4UBOA 2DCUA 5U9CA 2ZT6A 4B3SB 1EHYA 2EDAA 3EVBA 2HNBA 1SBNE 2VUSA 3LQRA 3P4XA 1ISSA 1IWBB 2P2DA 2CCGA 3U4DA 4OPMA 1VJ5A 1I7LA 2XUOA 1KI6B 3TRKA 2H0QA 2YC4C 2HFKA 4QXRA 4H7EA 5BUZA 3ULKA 3DHVA 3GJ3A 3KALA 3BORA 4DILA 1X80A 3D0OA 2RJNA 5A1TA 1JB1A 2HNAA 1DOAA 4I4TB 2G0NA 3AYXB 3INYA 4FFLA 2WJ6A 4DWVA 5KNCD 4UNQA 4F46A 2QUHA 4MVJD 5IC4A 3ELUA 5J3JA 4AULA 2J3KA 1V5GA 2JVKA 4HAOA 4NEQA 5EIFA 2FK8A 3C3AA 3C3CA 4M8SA 4B35A 2QRPA 1R0ZA 3O7MA 1P81A 1RZVA 5I48A 3PDJA 3V42A 4TXJA 1T10A 3PUWA 3TR5A 5AT1A 3FSRA 1YQGA 4TWAA 4FHZA 1XE3A 2J6BA 4W5OA 2ZUCA 1FXUA 4J94A 2D2XA 2LVBA 1X8LA 2QQEA 1E8MA 3O84A 1X7WB 4B3RB 4F9EA 1F2VA 5EINA 4RY8A 3BIOA 1TYBE 4CEHB 4HXGA 1GG5A 1KP9A 1UDCA 2PLWA 2RK6A 4IQ4A 2B61A 4E3WA 3EZ9A 1KQOA 1WF6A 3MMSA 1K8XB 4K05A 3LCJA 3KTOA 5BVGB 2ISSD 4FGUA 2H06A 1SBIA 3H9EO 3EEBA 1L7PA 2AOUA 3SMQA 4Q02A 1RPJA 1EP1B 2Z8YA 5K09A 1OTHA 3KSZO 2P67A 4WAUA 3AWDA 1D09A 4TT3D 2IPMA 1Q11A 4IHQA 3WGMA 3SS9X 1QCYA 1NKSA 2RGGA 2C61A 1SVOA 3LX5A 4XE5A 3T7KA 1W5TA 3LHIA 4GMFA 4PYJA 3W8RA 1DKNA 1RPAA 1E9FA 1RJGA 5BSVA 2XCQA 4HWKA 2I1QA 3MAJA 3TE6A 1J8QA 4PEVA 2G3YA 4YO7A 4MUKA 3CEJA 4V0OA 3V2UA 4IH4A 4YMSA 3P20A 5GGXA 4CM7A 5C1OA 4ESEA 1R8QA 3LRTA 2P77A 4QJ5A 3PEEA 3TI9A 3C5WP 3RSSA 5C8XA 5C37A 1ISFA 2NVUA 5D3MB 3GDWA 2WT4A 1F1BA 4PX5A 1FJGB 1XZGA 3IE2A 3ICQB 2I2BA 1KPIA 3GRRA 1LPAB 2H4JA 2OK8A 1LUAA 1KOJA 2QM8A 3AY0A 4QWWA 4TS4A 4WOBA 1ZI6A 3TXYA 2QSUA 3E05A 4I5GA 4X41A 4KODA 3ZHRA 2XTNA 1YJ5A 4E03A 1LDGA 4JASB 3GFVA 1P33A 3RS4A 4RTQA 5EQTA 4D4LA 5LMNB 5BV8A 4RIFA 5LNK6 1BJKA 2ORED 5J4YA 1ZS9A 2ATXA 4N5HX 3T0GA 3HG7A 2ZRDA 1E7SA 3DB1A 3GRZA 3P2YA 5BOSB 1B8PA 4MRMA 2UXBB 1BWSA 2Q3JA 4FFNA 1E2FA 3PUIA 2Q3DA 1KAHA 2WHYA 3O4IA 3CMCO 4HPWA 1YF3A 4J43A 4Q0MA 1CUIA 4P6VF 1Z5ZA 1CQIB 3AUTA 3PQCA 1OX6A 1U8EA 1P9NA 5JPCA 3PFNA 4QPCA 1H4TA 4Q1VA 2CHQA 5EP4A 5A7HA 2V5VA 1K27A 2NU8A 4XVRA 2WWYA 5CYFA 2F1JA 1A5SB 4OP1A 2QZ4A 4TL8A 4MS4A 4EPYA 5ALJA 2XDQA 1EXMA 3GP5A 5P21A 1N6LA 3COJA 3PTZA 4DLSA 4K9LA 4HTFB 4ZCQA 4FD3A 5C1PA 2J4DA 2Y9PB 2YXDA 2A4MA 2OHIA 2YTZA 3ED5A 4I5EA 2YV4A 4R05A 3CZ4A 4FFPA 4W7SA 5ICFA 4BLPA 1N9KA 3DBRB 3TOSA 2VJCA 8LDHA 2JFXA 1FMJA 1XMQB 4COOA 4L5AA 3RV4A 3H5OA 2J9XB 5AK5A 1WB4A 2B1JA 3A7EA 3NONA 1BS9A 3CX6A 2DR3A 2OSBA 5DBIA 1ID8A 4QT4A 3PQ8A 4M0CA 4R01A 2W2QA 4BQPA 1UCFA 4X0EA 2VSQA 3FTPA 4NCJA 3GB9A 3MXTA 5IJAA 2C9MA 5I9BA 3PQDA 4BFUA 2PK3A 4M8NE 4QDJA 3AEXA 3KCQA 4QWMA 4RENA 5JW6A 3R4CA 1FZTA 3CR8A 3VSDA 3RE1A 1TQ8A 2Z6QA 4WNIA 2HU8A 2WSMA 1YVDA 1G8MA 1SVSA 3KDPA 1BE8A 5JJ5A 3KDAA 2YW9A 1M5TA 2G1JA 2LKDA 4R0MA 1U63A 5TMBA 3C5CA 2IE8A 1DTWB 1MV8A 5A4FS 5BV2P 3CVYA 3V4LA 3ZXUB 1EI9A 1TEXA 3MXOA 1QVZA 3PV0A 3AVWA 1P6XA 3ZNQA 2F4VB 4B81A 3LDGA 1NLUA 3ROGA 1K9SA 1PR1A 1RACA 3OA2A 1E7MA 4P36A 1MLDA 1C1DA 1YS7A 2QRVB 5G0SA 3S2YA 2RGNA 1T5HX 4QBIA 4AJJA 4C1NA 4TKVB 4CKBA 1WMAA 1PP4A 1C29B 3SJAA 3TZQA 1WHTA 1YE8A 3BXFA 5KVVA 1CZNA 1WEKA 1J2EA 1EH5A 4RLHA 4JOQA 5E8RA 2X1VA 3O03A 2P6NA 2ANBA 2XVZA 3B48A 1ZN8A 5D85A 4ENUA 2HLHA 3IYLW 4K86A 1K1EA 4GMKA 3EARA 4GWGA 1WSBA 2QAGA 3DYVA 4KB5A 4MOWA 5JLJA 2DWCA 5LQNA 4S12A 3SX4A 2ADFA 4QPJC 1NLZA 3OFSA 5C3UA 4B80A 3NJ4A 4Q9AA 4AW9A 4JSRA 2ZWPA 3SP1A 4ZO4A 2EBHX 2A92A 4OXKA 2C2YA 4O8CA 1WP4A 5BNWA 4J0CA 4A6DA 3BEOA 3DAYA 3EXFB 4HO1X 2O8VA 3IXLA 4Q3KA 4IOLA 3S1AB 1FP4A 3JARB 5ICSA 3GT3A 1GQYA 2W0MA 2ZYHA 4O2AB 1BS1A 1FE8A 4XQ0A 3SVTA 1MRSA 4RXTA 3GPIA 1TD1A 1XQVA 4FIZA 4JBHA 1TJ4A 1J7JA 5BO5A 4UE6A 3UY4A 1M5RA 3ZJVA 1A8HA 1DGQA 2XB8A 1D2NA 5TF0A 3S2ZA 3MIZA 4ERNA 1DAEA 2H3HA 3E9DA 1EMDA 1N4DA 2COEA 1ZK4A 2EFHB 1GGFA 1NNLA 2JCXA 1YB6A 3NTOA 3OIVA 1AUOA 1DQPA 3FPLA 1NM5A 3VPXA 5K8CA 1EFCA 1NAHA 4C6TB 1EG2A 3FDIA 1C7EA 3QUSA 2BMEA 1XYGA 3PUKA 4Q5IA 4EKEA 1U0BB 1R00A 3SCZA 1OC2A 1JW9B 4UEWA 3LGSA 1FL9A 1JWAB 3TCKA 2PM8A 5C9ZA 1K66A 3Q15C 4MROA 4X66B 2FHPA 5ESRA 4PXSA 5BRJA 5LWHA 2C59A 1SEPA 1AO3A 2JJYA 2BD0A 2VDMB 4L2IB 3O6VA 4D6YA 2YX1A 2NZXA 4PNPA 1AUVA 1UKYA 1XCBA 3CE6A 4BJ3A 1B73A 2XNDD 4BTEA 2GVZC 3OPNA 4DBVO 1V1RB 1G21E 1SKBA 1IPFA 1YOBA 4I6GA 2OO5C 3ETDA 1OV6A 4UTZA 4LISA 1PYOA 1V9LA 4PAWA 1JB9A 4N0MA 1OX4B 1WUYA 2O2EA 3A28A 3L07A 4E2XA 4EPVA 3GUYA 5D86A 2XUQA 3IJPA 3PVSA 2MINB 3SXUB 2WYHA 4Y2SA 1Z0AA 1ZIOA 3K15A 4K8OA 5ALHA 4MVJH 2QG9A 3P9PA 3QLUA 1PWXA 3L1KA 4ARBA 4KPEC 4I8XA 3R6LA 2GDZA 4PO3X 1RSZA 2C8VA 4O4HF 1BU5A 3TVTA 1R4NB 2ZVPX 4YREA 1VLVA 3C8ZA 1WBBA 3SHVA 3FJ1A 4OYHA 3BXOA 4PVDA 1WE2A 3DUFA 5CX1A 1GGEA 2A14A 4UKDA 5HNKA 3D7SA 3NEYA 1AGPA 2Z0MA 2R8OA 1IOWA 4KO3S 1NDUA 5EXEA 3YASA 5FWXA 4ASUA 4FFRA 2EFEB 1JYSA 1E6MA 4IEEA 1V8ZA 2F7SA 4LF6B 4N0DA 3TCNA 4CQMB 2AG6A 5KMGA 2NSHA 1Z2PX 1DRKA 2MSNA 5GV7A 3O90A 5FLKA 3FHLA 1HDIA 2XUDA 4MA0A 1P6QA 2Q1WA 2QHXA 3RVDA 1CFJA 4XLLA 1JLMA 3C1TA 3CEPB 3O8OA 2R44A 3QBVA 4NENB 2ZJ6A 4S2UA 1GGJA 1Y63A 1YIOA 2QX6A 3CB4A 5EXTA 3V00A 3ZJ5A 4MDEA 2ST1A 1JFFA 1XD2A 5ADHA 1G66A 1NGSA 4EQ6B 1CYDA 2GZHA 1LDBA 3A4MA 2ERCA 4C0LA 1E2HA 3ILXA 1P4RA 3WKEA 3GBVA 2IUSA 5KYNA 2POQX 2HF9A 1G4AE 3EMKA 3SSOA 3LA6A 4BJHB 1O95C 4MQEB 5HPYB 5CTJA 4JQCA 1KY4A 5FULA 2MSCB 4D3SA 1FXWA 2FMXA 3CT6A 2H65A 5DK6A 1P73A 3TRFA 1R9JA 4ENVA 3OFND 2VP6A 5KSOA 5DE3A 3M1YA 1ZBQA 1QQ6A 3ADCA 2FE4A 4FMCF 2IXFA 3G2JA 1Z62A 4MQUA 1IFXA 3OJLA 5IDQA 4DIKA 3JQ9C 5FQNA 2Y3IA 5C1BA 1QHFA 1GTVA 2JAHA 1XN4A 1IMJA 3S7TA 3KKQA 3HU5A 4RJLA 3GH3A 1SKQA 4AKHA 4AY3A 3WL8A 5F35A 2DFDA 4F2PA 2FPGB 1QYVA 1YZHA 4RKFA 2PA3A 2O9JA 2V7QD 2B4QA 4M1OA 4R8RA 3WRVA 4ZHQA 3UMSA 4CKWA 5EFZA 3VNUA 3DZ8A 2VQ3A 3IDSA 3RTGA 3L41A 4MP6A 2XNSA 1UODA 4LHXA 4OYRA 1YSCA 2X5JO 2AUNA 5JCOA 3QLVA 4NEGA 1QB8A 3R6TA 5CA0A 4MDFA 3P2JA 2P41A 3R0JA 3UATA 1VKJA 3WLPA 4RL6A 2PL9A 5I8ZA 3ADDA 4UU8A 4P9NA 3IE1A 4JIGA 2Y0EA 1Y82A 1NJFA 5DGCA 4DMFA 3FOAA 1T2EA 1ZX1A 4TMVA 1L5HB 2ZRFA 1Y81A 4EPRA 1WXXA 1MIHA 1DAOA 3QU9A 1OA0A 1Q44A 2PMWB 4RKWA 1VYTA 2J41A 2IUFA 4RSHA 4XVQA 1W25A 3GGSA 1EVLA 3PFGA 4RFLA 5D01A 5HFJA 2B1IA 1JXAA 1PYDA 2FPPB 3DQQA 3TSWA 1XVIA 1ENZA 3BMOA 4HN9A 3FM9A 1Z4IA 2GB4A 4H27A 4GU5A 5KNDA 3KBBA 4KSCA 3GLRA 5BW6B 1G3QA 2HPZA 2NGRA 4BCCA 3TDKA 2E1RA 2YQ4A 2P6OA 2GJ8A 1MDFA 1C8BA 3KVRA 4KN6A 5FDFA 1JFFB 1XD2B 2HADA 3HP1A 2QENA 1BFKA 1Z5UA 3ZKWA 4GOND 5AVOA 4YP7A 2YWFA 2AT1A 1ILEA 2P68A 2PRSA 4FFSA 3OECA 1GEEA 3HJUA 1AKVA 4KEAA 4TMYA 2GPNA 1RZUA 3CF4G 4XSHA 5K3AA 1RU3A 4UNRA 1DEAA 2D0IA 2YFKA 4WZAA 5DBFA 5FHQA 3UKJA 4CVNA 1CUJA 1HA3A 3QF4A 1UAGA 2Q5HA 5DGDA 5L3SA 2FSHA 4IO0A 4L8GA 1QG6A 4XUDA 1EJ2A 5FKJA 3U4IA 5MGBA 1QZTA 1QC5A 3LUJA 4LTMA 4RF4A 3HVUA 4Y1RA 2IKQA 3A25A 3DOIA 5J40A 3R3VA 4F8JA 3HUDA 1YO6A 5ADVA 4ZYYA 1TUGA 5F1OA 1EE1A 3ANYB 3W8NA 2F6RA 2JC3A 2O3SA 3AR3A 3T0FA 3GLGB 2HX1A 4OLJA 5BWCA 2O6LA 1O94A 3RF7A 5DBOA 5EMHA 3VSCA 1FYDA 3IILA 4BO7A 2BHLA 2VQDA 1WDTA 3OOEA 5TQ0B 4RVHA 1J42A 4EG1A 1PV1A 4JL8A 3IHTA 5BWMA 2I76A 3E2IA 4M9UA 4MLPA 3AFNA 3JYHA 3K1YA 4XGRA 4U7WA 2AN3A 1OIVA 2Q6IA 5DK4A 5EJGA 1VJCA 2I7VA 3N8GA 5ALKA 1QP0A 3BXEA 3I8XA 1OGYA 2FMKA 4XM1A 1HBJA 2WD8A 3ENZA 4UNIA 2QPLA 5LKAA 2BUBA 2GT1A 2UVDA 1D0VA 3BWXA 4LHYA 3SBXA 1XJWA 1PU2A 2RHMA 2O8FB 3W7VA 2EEPA 1VHQA 3KZOA 4MVJM 1XTZA 4N4AA 4RNDB 5LYJA 3FFTA 4MYUA 4PYNA 3OE4A 3EXG2 3AEKA 2AJTA 3KAQA 3MJEA 4DRXA 2VL7A 1JG7A 5A3SA 1DO2A 2B1QA 1ULHA 3B7GA 4TKUA 1I4TD 1JEAA 2IOHA 1YT5A 2O3QA 4IVNA 2IYTA 1U1IA 3BA1A 1T6YA 1P9WA 3AU9A 2AZTA 2XSZD 5H68A 5FYQA 1G5IA 1M8KA 1HK7A 3OIWA 5FTJA 1X13A 1SVWA 3QY0A 4N48A 1DC6A 1N5RA 4MIYA 1MIOA 1Y7LA 4LYEA 3DR3A 3P9YA 1WXGA 3A1UA 1NKVA 1MC5A 1S3SA 2JASA 3DL7A 2ZS8A 4G37A 4HL6A 1GAJA 4F6RB 5JCXA 2DMRA 3SFVA 5A5VA 3J7AC 3T4EA 2F3RA 4KIJA 1FP1D 1WU8A 2JJ2D 2XMBA 4JP1A 1NX9A 2XOXA 3EGEA 3JSAA 4FNGA 3LUHA 4JMLA 4XAQA 3WTCA 1VMEA 5AXDA 4TM8A 3VU0A 1M33A 5JI3E 3X2EA 1OFTA 2X41A 2WKSA 3EA4A 3EEYA 4C7KA 4G5SA 3KPJA 4OHWA 5GONA 2AOTA 2QL5A 1WULS 3LNCA 5AW8A 2RAVA 5EJ4A 1GRVA 3HVIA 5K3FA 3RHTA 1POWA 2XPCA 4COKA 2CT8A 1E2NA 4I6JA 1A04A 1E61A 1JSCA 2IYSA 1MX3A 3FDJA 1TVCA 2RHTA 3PHLA 4ZQHA 3ZCRA 4G41A 1NLYA 1L8OA 1V39A 1WF3A 4EA6A 2YICA 3KV3O 1KDOA 4V0ME 3WIUA 2ODPA 3T5DA 5HK9A 1M6NA 2KB0A 2FXIA 1C5KA 4LAFA 4QBHA 5DNAA 1JJIA 2VAPA 3DGEC 3MHPA 2BDUA 4UTVA 4MVYA 1L7MA 2IWRA 4FGLA 1PFQA 2CXTA 2OP0A 5IH3A 2WAAA 1IYZA 3EC7A 1H23A 2NUTA 4BFXA 1M1NB 1XZ8A 1DG1G 3D1JA 3PK0A 4GKVA 3E9CA 3OU6A 3ZQ4A 4NS1A 1JHPA 1V8FA 1T9HA 1UOOA 3QBTA 3R3UA 4GKJB 1XHEA 2X8WA 4KGXA 2HWXA 3ORQA 2V65A 4YJFA 3DOJA 4OSEA 4HDSA 5CR9A 5L3QB 2PSFA 1UAYA 1GT91 4J9VA 2HEGA 4LYDA 4PNHA 3VPCA 1Z5WA 2W00A 2CCKA 1DTSA 3NHFA 5M2QA 4LGMA 1A0OA 2C1XA 2G04A 3ZIUA 4FYJA 4INPA 1VFNA 3OTHA 2ZIAA 5J2TB 1YVUA 2HA2A 3GGOA 4RA6A 3OZDA 2CLMB 1UQRA 2XYPA 2WZQA 1XL0A 2D62A 1P7PA 4BDSA 4M9SA 2WWHA 2X8BA 5JFTA 3VVCA 1HOTA 3AR7A 4R1SA 1BW9B 2OKCA 5TPZA 2CCJA 1HDZA 2GCOB 3HJTA 3N2NA 3QXJA 4JU9A 1QVVA 4Z2AA 1OXKB 1MVOA 1SVKA 4G9GA 4EUKA 1OJLA 3OOYA 1RQPA 3UHPA 4KBGA 2PU7A 3U5ZB 1KAMA 1UBTS 4ZEVA 2VK1A 1VBNA 2JAOA 3K0HA 4DJTA 4WBNB 1U4SA 1WZUA 3GVPA 3AEYA 4Z7JA 3K94A 1T25A 2ZG6A 3QEMB 5K6TA 4CDMA 2B34A 4F4IA 5C7YA 5HKBA 2ZJ0A 2PLAA 4GL4A 3L7BA 4HOYA 1NR7A 2JCSA 2VPTA 4B84A 4ZDJA 1HDRA 2IH4A 2IC5A 4V1CA 1VSVA 4ETIA 4BE4A 1Q7CA 2XDAA 4OU5A 4H6XA 3UH0A 1LTQA 3MTAA 3BIXA 4AJIA 1KEZA 3HXPA 3CB2A 3GYBA 3BSSA 2IGTA 4WLOA 5CJPA 4CG3A 4RVOA 4KWCA 4GYKA 1NW9B 5J4HA 4OFBA 3KWLA 4HAWA 4R1MA 3O9MA 2I03A 5K0NA 5GV8A 2HN9A 5FBKA 1CJUC 2WMNB 4GXQA 3IKTA 1S9DA 4D43A 2X0JA 4V39A 4IXWA 1A4RA 5EJ9A 2WNHA 1ISHA 2AD1A 4GECA 4TROA 5LYYA 3SZMA 5KMGB 5LD2C 3MYRA 3MTGA 3AESB 5E1BA 4B6JA 4FYPA 2RGNC 1FNNA 3NPAA 2PUVA 2ZB8A 1U5BB 3B1KA 1E3SA 2QLTA 3BHNA 3OOSA 2GNPA 4W5QA 3NP9A 4R31A 1P62B 3UJ3X 3GGJA 1I0IA 3WJ1A 4DADA 4BVKA 2CEAA 2Y77A 1IIRA 1R88A 4HDMB 4XSVA 2ZI9A 2IV2X 4DLTA 2Z57A 2AXEA 2JGFA 1I10A 2QE6A 2QMYA 3J7TA 3I83A 2ACEA 3FMVA 1G5HA 2BI4A 4HZUA 4ML3A 3ZG6A 4HQOA 2DTEA 3AVYA 1U7DA 1GU0A 1I2BA 2RBEA 3AHGA 4JUFA 1N6HA 5BWOA 2UAGA 2ZAIA 1U2ZA 2H1HA 3EGOA 3VYTB 4PIVA 1Y8RB 2ZYDA 3ABSB 1B6RA 1JDZA 3QSGA 3UGKA 3H65A 4DG8A 4PZZA 5H4GA 3AVUA 1UDAA 1UFKA 2WF7A 1TA0A 4QOIA 4RYDA 1TQHA 3UXYA 1Q0LA 4F3NA 3IR7A 5IAOA 3I92A 3W04A 3I52A 1HE4A 1NQTA 4CM4B 2R8BA 2P27A 5CMLA 5IBQA 2IHKA 1MXFA 3DPIA 3LKVA 5JAMA 2NSYA 4P7JA 2OKGA 2OZKA 1BVRA 1U02A 3IBSA 5TV2A 5EE9A 1JDNA 2WF8A 2QTZA 2B20A 2RI1A 1F1JA 1L5OA 1BHO1 1NVTA 5ABPA 3DE5X 1IB0A 1N7JA 2ZT7A 4LYFA 3FVTA 4FZRA 3ZDCA 2JGDA 2WJHA 1GUZA 1QAMA 3FNHA 5DYGA 1TNDA 2A9FA 1EU1A 3QMVA 1BD3A 5EJMA 4PM4A 3S8YA 1QFSA 2J31A 2NXWA 2XGGA 3G49A 4RTRA 1LD3A 2C97A 2WYIA 1X1DA 5BQOA 4UHCA 4CL2A 3IEVA 5GZ1A 3F5MA 3LT5A 4PZ0A 4EG5A 3L40A 5AKEA 3BMCB 2RGRA 2BGWA 4I46A 4HRVA 3WYBA 4XQCA 2YUIA 3AJEA 4JT4A 5EMLA 3COSA 4CKBB 2OBFA 1T91A 1DJOA 3GRYA 3C7CB 2C5HA 4HR7A 3UH1A 3G5LA 1M34B 3JQFA 5EG5A 1WDKA 5J63A 3ZOZA 3VKUA 4CCSA 5BQ5A 4DYDA 4M6WB 2ZRCA 5FOUA 3OA0A 5IWAB 1RLMA 2HRCA 1DPGA 4XTRA 1UK9A 5KKAA 5P8WA 4RHEA 3C4QA 5ILGA 4LZNA 4IUCS 3R6WA 1ECCA 2Y4NA 4RTLA 2QAGB 4EAAA 1T29A 2W98A 3IBCA 1H66A 4HRAA 3NTQA 1I4EB 2UYCA 1GTZA 2WIJA 1RXSA 1V2GA 2KHZA 3SQDA 4R71A 3ONVA 2VJLA 4ITUA 2RDMA 2PS9A 3KZNA 1BXKA 2YHSA 1NQ5A 5AMXA 3EXEA 1U11A 1UAAA 4OYLA 4IQ0A 2WC1A 5TY0A 1C3JA 2XB6A 3RRXA 3CGGA 3HLYA 1M6VB 4X61A 2C2BA 4CM3A 3F6YA 4MMZB 4F1JA 3SEAA 4CEJB 1E2PA 3GXOA 3VA7A 1RJDA 1G291 2HZ7A 2XQFA 2R85A 2B8TA 1ZGAA 4ICIA 5C0OE 1XN1A 3ZDEA 2B8JA 3QJ5A 1QSGA 1JR3A 4XUEA 4E51A 1QO0D 4F45A 1ZR2A 1KOLA 1MA3A 1GL7A 4FT4A 3OFKA 5LQKA 1TM5E 2OPBA 3OWHA 1YDWA 3RAPR 5AK6A 1UBCA 2XWJI 3I37X 4FZJA 5B4UA 1N4AA 3S2UA 4QQ8A 4Y3UA 3ZXXA 1DU4A 3ND5A 4C14A 2I1VB 3LW7A 1MN6A 2JHPA 1XDSA 3P27A 2X8LA 2F4NA 3I5MA 1QV7A 4TWJA 3MWEB 1BYIA 2BFEA 2Z3ZA 4A6PA 2F43A 2NAFA 1BX3A 3SX2A 3FCUB 1NHGA 4U7GA 1VCNA 3KSDO 3BWYA 2FJPA 5DNWA 4NCHA 4KG7A 5GIPE 2VQ6A 4RNCA 2LCIA 4RORA 3KXLA 3EIEA 2XE6A 1K2WA 4YPFA 3L0PA 1HI9A 2I2DA 1HLDA 1N2BA 2PD4A 1HQYE 1MO6A 3LF2A 4YH1A 4DG5A 1I01A 4D3YA 3PC6A 1KKMA 1PRYA 2HCJB 5BN1A 4LF7B 3TZCA 4BFYA 2AI2A 1C9NA 3D1VA 2AVDA 1BMTA 3CWCA 4GX2A 4Q18A 1XLTA 3T4PA 3ME5A 5HUQA 1H0SA 2FSPA 3PT9A 2FEWB 5AIAA 2WKRA 5JQGA 2JFFA 5HW0A 1UC9A 1TTHA 2WA2A 2V97A 3L9WA 2FZWA 5HEKA 2DQZA 2OR3A 4LOAA 3RUCA 3W2GA 1MJHA 1YQEA 2EYQA 2H9AA 2NUPB 1BXGB 2B9VA 2XXAA 3UYLA 2WYUA 3OZXA 1TM1E 1IRXA 3G23A 1QK4A 5BMVA 3IC5A 4FQ7A 4QDZA 4Z4FA 1MAHA 2GBLC 2JEOA 1AV7A 1C9MA 3KT0A 3FYTA 3DL0A 3DXZA 3LDAA 4MVJP 3DE7X 5B7PA 2JPDA 1TKCA 4RXMA 2AJCA 2W6QA 1E79D 4K6GA 1KORA 3ZIAD 2V55B 1QZZA 4AX4A 2ACKA 3B9BA 4NE7A 3PD1A 1VP9A 2C5AA 3JAWA 3OG9A 4LVOA 3A6LA 4RDIA 5AH0A 4LYJA 4N6NA 5FYDA 2Y67A 3T5TA 4B2PA 3PHHA 2DBRA 4K87A 5GZ3A 1PF7E 4FUTA 1NMEA 3AUAA 2D1FA 4CLHA 3HCRA 2AOXA 3NT4A 4TWBA 4WKBA 4QG3A 1JAXA 1GGNA 3L8EA 2FE1A 1R6AA 1U9IC 2DF8A 3DFZA 3A7DA 4YUVA 2A9JA 4ZCTA 2ZSUA 1T4DA 3PU6A 2A1IA 1DAHA 1XX6A 4OJMX 1LF0A 1SN7A 1QYXA 2QN8A 3LC0A 5JAQA 1SZJG 4F96A 3I5YA 4BE7B 5J59A 3W2FA 1II0A 1MH1A 2GILA 2J30A 3O73A 4PAGA 3DCIA 4BEJA 1SC3A 1STOA 2IYEA 2PUTA 3HUFA 3O9ZA 3I9FA 1VGQA 2OD7A 3M49A 3T5BA 1BXZA 3BXZA 2ETVA 3JQFC 4U2GA 5YASA 3TVYA 3NANA 1X7WA 1QH9A 2OCBA 1H42A 3NETA 2YV2A 3DMPA 1ODIA 4OHYA 1DX9A 3L1JA 3P71T 2AOWA 5G3ZA 2EP7A 2VWGA 3KM0A 4G67A 1UZLA 3D3KA 3WWCA 1OAOC 1TFUA 2G5PA 3JD1A 2G06A 3F2IA 1FX0A 3ELBA 3CW9A 2EX1A 1AHNA 1Q19A 3QBJA 2HSZA 2HBRA 4Y1RB 2ZBUA 4HVLA 2QBYA 4WNAA 2OQIA 4GOLD 4NAHA 5FBRB 1GZDA 4UOZA 2LIPA 2JARA 2Z09A 3ACBA 4RPCA 4YGXB 1Q57A 2Z5LA 5ALIA 4BFLA 2OHOA 3EPLA 3IJEB 3G5MA 4ZQGA 2W6IA 1DQRA 2XTZA 3H42B 4G1VA 2HPAA 4JYPA 1G8AA 1CT9A 3KZMA 4ARZA 2QW8A 3FPAA 2LNDA 4EF6A 3SIWA 4TXNA 1CG6A 2OBLA 3KR9A 4GZMA 4I1RA 3HA2A 4TQ9A 2PBLA 4Z4QA 2UZ1A 2D2IA 4YPVA 1ZITA 1NV9A 3TL2A 2IOFA 5BSRA 2BRUA 2FPLA 3EY4A 4NZYA 1E1LA 4US1R 3ZI4A 3CWZA 1SH7A 1TUBA 2X3UA 3F5DA 3P7MA 4QXAA 1GKYA 3C6QA 5F78A 1U1DA 3LDHA 3HB9A 2J0EA 5F7OA 4EY3A 4E5PA 4R2XA 5I5EA 1WLSA 4HADA 4G2NA 4CM1A 2QY9A 3TQQA 2V1UA 5JJBA 4YA6A 4CF7A 1USGA 4CEHA 3WTBA 4J9UE 2ZXUA 2O7NA 4UHKA 5BW8A 1R16A 3IAXA 4FMBB 4GOJA 1L7VC 2DE0X 1KK3A 4TN5A 3VTKA 4MKXA 1IY1A 1G7SA 2IY7A 3TD2A 1YVRA 1K6MA 2FW9A 1K4MA 2I4TA 1P1HA 2Z5GA 4NV3A 1TCVA 2QSZA 3T1VA 4DLRA 1J07A 2LRHA 3DVQX 1T0HB 1KH1A 1UP7A 4CFSA 5I4KA 4LGCA 4A03A 3L7LA 1W6RA 3TBHA 1OT3A 2H5IA 3ECAA 4A2QA 2ONJA 3FFAA 2DTXA 2YCLA 1GDHA 4WW0A 2QNIA 5FBHA 3WMRA 4LN1A 4BNGA 1VG8A 4JJ8A 5H4HA 3UMGA 5KREA 2OSVA 2IS2A 5KYWA 5L7WA 2IHBA 5C34B 3WLAA 2ZI5A 4GI3A 4NL4H 2C4TA 3T9CA 1I6MA 1P2FA 2H1VA 4O2BB 4UAGA 1TGYA 4KHZA 4NY1A 5BNFA 4C08A 4XFKA 1ZVMA 3F98A 4Q7QA 4MV0A 1IN6A 3C6YA 3D3WB 3N53A 4MEBA 4F5DA 5K0TA 1KVQA 5LA6A 4NYIR 4A0SA 3GLIB 5FOTA 2Q0SA 3W5SA 4YIHA 2V0GA 5HMMA 4XJXA 4E46A 2W90A 1N1DA 1HMPA 4F56A 5D7NA 4ZZ3A 4EG0A 3F4KA 1FRZA 3LPMA 3QPDA 4E5SA 1RI1A 2VPYA 3ZGYA 3ZWQA 5IK2D 2DT8A 4EAQA 1KE2A 5BV0A 3NRJA 1RWQA 2LWIA 3HCEA 9LDBA 3N2LA 1BMFD 1HFEL 1KJIA 3TW6A 3RNLA 2R65A 1WOYA 1QGDA 3BM5A 3IHKA 2QL7A 4DR4B 1T3TA 4CMHA 3LPAA 3KX2A 2FZCA 1GL3A 2PL5A 5J58A 5CDHA 2OCPA 3C15C 4KQ1A 5K0ZA 5KOJA 1Z73A 1RVV1 1YZUA 3OT1A 1PGQA 1RRGA 1A4IA 3BDIA 3L7OA 3TW0A 3VR0A 1F20A 4ER0A 3T12A 1E9AA 5L9AA 2NU8B 4JXZA 3DC2A 1GTJ1 5IXJA 3Q1KA 1A9OA 2WR8A 3PNYA 3JWJA 3KKKA 4GQIA 1GSIA 2VDUE 2WQ6A 3T3IA 3K0CA 1UWVA 3WGZA 5CLJA 5HZHA 3EG9A 4JQOA 4ZCMA 2BP7B 4HVAA 3I9OA 4DC1A 1N33B 3T38A 2YFYA 1NXSA 3PPIA 3TTUA 4Z3KA 4JYMA 4J1TA 3WRYC 4B7ZA 2XF8A 5CNKA 3Q8LA 1M2VB 4BX9A 1IY2A 1AB6A 2W2XA 4BV3A 5BNIA 2IEIA 2XA2A 2BM0A 1GRRA 3WGIA 1C8KA 2R48A 2V0NA 2CN1A 1FPMA 2QVCA 3LVFO 2Z1DA 5I45A 4G5XA 5JZMA 4YRQA 4OKNA 2C03A 2ZPUA 1NQOA 3QUQA 4S2EA 3ZJ4A 5KNCH 3VKGA 4H08A 4BVAA 1V1MA 2NU6B 3CLTC 4J49A 2L82A 4M88A 4NH4A 1ZSVA 2HIHA 3CRRA 3GCXA 4QD3A 2C7QA 1RDFA 1X7YB 3M8KA 4PYOA 3ZDYB 4JOCA 5HVNA 4FBGA 4CU5A 5JZBA 2DBQA 4EL5A 3UUFA 5KYXB 4KAJA 3QVSA 4DKJA 4RDHA 5GADl 1DIRA 1UKEA 1ZU5A 1P5FA 2BGJA 2XKJE 3GFSA 3N74A 4IYRA 1FTNA 4J0FA 4RMIA 3K9NA 4X90A 5U4QA 2C9ZA 3RU3A 2RHOA 2XYHA 4IMPA 2CFRA 1NLFA 3JD2A 3RYFA 5AVVA 1FYEA 1SU8A 5DXFA 2H07A 3EJ6A 1UKVY 3FB4A 1I36A 3NHWA 4KRYA 4UJ3A 3DDSA 4IZ6A 2R4UA 2DFPA 3KQLA 4JJKA 4LHWA 4M6WA 2EWVA 3BD7A 1PJ3A 4HDCA 1J2YA 4IIUA 2OV1A 3K30A 1UJMA 4P3XA 3GO4A 2ZQ5A 3HGMA 1AF4A 1BCRB 4OJKA 4UVHA 4JI0B 1TD9A 3DMRA 1CJBA 3R41A 3ES9A 3H16A 1NQUA 3HKEA 3K72B 1JECA 3RBXA 2CV1A 2I1WA 4BMDA 2RJ3A 4R1LA 1YJAA 4NXMB 4OMFG 3AZPA 3FPGA 4EHDA 5F64A 4HAYA 1NI3A 4MW1A 1XP8A 2GO7A 2C99A 3MPUA 1ZBDA 1ZC4A 3ZKAA 3KJHA 1EK5A 1EUDA 2P6UA 3H9QA 4QDKA 5GJWC 3HRKA 4L28A 3KQPA 3W9BA 2M6KA 1WY7A 1ZW1A 1EFUA 5AUQA 2BHSA 4ARAA 2JRLA 3BFJA 1HDYA 2DG2A 2FDRA 1XQ9A 3DFFA 3K6JA 2I9KA 2C7OA 2GA8A 1ESZA 1V1RA 1N8SA 3SC4A 1E1CB 1MG0A 4ZYZA 1O95D 4K6HA 1PFWA 4BRUA 2QPAA 2IYZA 1LZKA 4MGIR 1Z4LA 5FJIA 4TVOA 4QUAA 5LLTA 4FDLA 4RBNA 2ECOA 1SHLA 5SZJA 4L3WA 4ZVVA 1YGPA 3PL1A 4IDBA 5A3QA 1MB3A 1GPWB 3LX4A 3DA8A 4MJ7A 3X1MA 2VP3A 3FMOB 3LT1A 3IERA 2Q62A 5FOVA 3EPRA 1EGMB 2NTYC 2D5IA 3PHGA 4OXIA 2YL2A 2CXSA 2VSXA 4YRJA 2BELA 4O33A 4URHA 4LE2A 3M3DA 2PVSA 3PPYA 5DSTA 3NVMB 4WEQA 4C9BA 4I19A 1N34B 1LDNA 3GARA 1XU4A 2FG5A 3JAKA 3MWEA 4DEYA 4DVJA 1CY4A 1H2BA 1T2AA 2BGTA 2PL3A 4KTTE 1GUAA 2HLPA 4HQLA 3BUSA 2WSSD 4F1KA 4NG5A 4EHIA 3BWVA 4OD0A 5A4IS 3DTVB 4H6VA 1TZJA 1L5MA 3TPCA 4HLUC 4W5JA 3MWFA 1E58A 2M9MA 4R51A 3F4LA 1EVEA 4D9MA 1FUUA 3DE6X 1T5OA 3NIWA 3CUYA 1VHWA 1ZESA 1UWLA 1FFSA 1V37A 2LP4Y 2I78A 2QYTA 4TMKA 4ZA2A 3RU7A 2WTUA 3N75A 3KSUA 4GXRA 4D7AA 4NAUA 2C4HA 2P4UA 3AEQA 5LZ7A 1GNTA 5F52A 5G0WA 3WYNA 2C96A 4IIGA 4W63A 3N6RA 2LW7A 3G8BA 4C5BA 4B6RA 5IZCC 2D3WA 2EW1A 3N6XA 3WLOA 4C29A 1ISRA 4FVTA 4F85A 4QYMA 5DN6A 2XXAB 3K92A 4CL8A 2QT0A 2QWXA 1W75A 2AOVA 1DXHA 1GPUA 5HF6A 3U4AA 4BRZA 3IR5A 3IV6A 1GFWA 2D1SA 2C5EA 3BB1A 3FPBA 1USKA 3MGAA 3FDFA 4FKZA 3ZGOA 4D5EA 1K7CA 4TMXA 3OFVA 2HDWA 2WWVD 4UAJA 5E1OA 2H6EA 4UPVA 1F06A 5C1IA 1B16A 5C5EA 2Q0XA 2WFZA 4CIDA 3WWEA 621PA 3IB6A 1Z6PA 1FTGA 2PXCA 1OZAA 2VPQA 1OOEA 3A3PA 3FLBA 4MVWA 4F3CA 2YNMD 4ZHQB 4XPIA 4E5NA 2ODTX 2QW1A 3AH8A 3ZDAA 2EP5A 2BBTA 3H1AA 4BO2A 3VPGA 2YMMA 3WSTA 4XR4A 3D0RA 3DJYA 2A3RA 3H1EA 1L5NA 3B13B 4ZYWA 2VWQA 1BXRA 1SHKA 1OTYA 1H8HD 4MGHA 4D8VA 4CR8A 1E9EA 2EATA 3EAFA 1HEUA 1WV1A 4P86A 3WZ2A 2HF8A 5IX8A 3NEPX 4V02A 1DJNA 4OQEA 4JXKA 1XJ0A 2XNJA 3A3YA 3P2MA 3TEJA 3ZWPA 5JO0A 4NCAA 1PT8A 2W5UA 3B1VA 3CW2A 4ODIA 1N92A 4DV1B 2WSIA 2PMFA 5G3YA 3TOVA 1AKUA 3A6EA 3DQPA 4HFMA 1CS4C 1LBQA 1J9EA 5LP6F 2JVIA 1JXQA 2XNCA 4RPKA 4ZOCA 2P30A 1TJYA 3MEQA 1A5AB 3BH7A 4PAMA 3WIOA 1K8QA 2P90A 5AI6A 1HNWB 4PX3A 4YAJA 3HYRA 3W8EA 1Q7BA 1XZFA 4NI5A 3L0SA 1JDBC 3VRHA 5JNSA 1YACA 5HUJA 2Q6KA 3H2IA 3HR7A 4OUKX 3V7WA 3WIBA 4CHGA 4DUPA 4KR6A 4C6SA 1IATA 1EVYA 2ZSFA 3LUBA 1OB5A 4GX5A 4QVIA 4JEIA 3KEGA 1TRKA 2PQ0A 3BC1A 2HDOA 4EL0A 2UYQA 1NPTO 4YJ3F 2OAQ1 1GXSA 3SICE 5B6IA 3BMNA 3WZLA 2BCEA 1TCAA 2PX3A 4ARUA 3ZW7A 3VU9A 1X7ZA 2XYRA 5G4KB 1BQ4A 1TM3E 1LLDA 1A8PA 4R4JA 4YCBA 2R1TB 3ZE7A 4CZ2A 4D0RA 2OZVA 1UM8A 3SVLA 3DEHA 3B60A 1ZXXA 3LRPA 4K2HA 1MRZA 2PTGA 2V6IA 2YOFA 4GHWA 1WZNA 2SKEA 2ZYWX 3C87A 1G8GA 3ZZMA 4EKIA 1LGYA 4UBKA 4RK6A 2HJGA 2MYUA 4DJ5X 2UVPB 4X93A 4YB8A 3KD3A 4O3FA 2ZJFA 1UJ5A 4MKIA 4OQDA 1HR0B 1Q0SA 1OASA 3NBYC 4IJWA 5A03A 2J48A 1U8XX 4HYYA 2PWYA 1I14A 5EPUA 3TD6A 4X7PA 2PV7A 3RAFC 1OJ7A 4EJ2A 1ULUA 4BXOA 3ZUGA 4MVJI 3R5XA 2Z2YA 3I28A 2PRYA 1B2LA 5ITWA 3I6IA 2ZETA 2O20A 1VSUA 2P65A 3SJCA 1JLLA 1KFKB 2PMBA 1Z26A 3Q0TA 2I8CA 1O6CA 1WUKS 1XKQA 2AHOA 4X85A 2EJUA 4AJLA 4ZC8A 4JHLA 1SBYA 4DIFA 1U04A 1G55A 3OBBA 3WV5A 1KEVA 3OZCA 2CVQA 5KWIA 4CIAA 4R84A 1Z6TA 4UMVA 2CJFA 2RAFA 2XYVA 4M1ZA 1AD2A 4YAGA 4FOPA 4BZQA 2HCBA 2ADOA 2H1LA 1ZMOA 2X1HA 2N3ZA 2WTNA 2X5XA 1CC1S 3NU1A 5IVHA 1ZVVA 1O96B 1RM5A 1YH3A 5JS6A 1KF0A 2W2LD 4BO1A 1TJ3A 2W8ZA 4BZWA 4QVKA 1X42A 1HGXA 3QU7A 2CDCA 1V25A 2OM2A 4AG3A 3LK6A 1DHTA 4QTXA 3OFNA 4G1MB 1U98A 5I9NA 3NORA 1US8A 3T3EA 4E4RA 3JYNA 2JGKA 2NTJA 3MTIA 5IYZF 3EDQA 4JZKA 3RK4A 3IALA 1MJGM 4CNBA 3IDFA 3WDLA 1LS6A 3W6NA 1LV8A 2XE7A 4M38A 1EA5A 1G64A 4F4DA 5KSYA 1JAHA 1EWRA 2Q3LA 5DT2A 2XQIA 3T7RA 5JSZB 2VZEA 3KKPA 1C1XB 2V7QA 3ISVA 2P2ZA 5FRDA 5ALZA 4UM9B 1TW3A 3KQWA 1GPBA 3OQBA 3RG8A 3DCYA 1SCUB 3T52A 4B43A 3QLEA 4RF2A 1ZJYA 4WXMA 2I67A 4FC7A 1CUGA 1E1QD 1LWOA 3TSOA 3VC1A 5ALMA 5JPIA 3QXHA 1DKLA 2AVNA 2DWUA 4D3FA 5IULC 1KO4A 2BEKA 2CXNA 4B74A 3DS8A 2UUPA 2EBWA 1OZHA 1Y1KE 1KJNA 1XZEA 2D74A 2NNLD 4Q82A 3E22A 2HDNB 3NALA 3ACDA 4EFDA 5KX5B 4OBXA 2DLDA 1KQNA 3PFKA 3RSHA 1ESDA 2GPSA 1PSZA 2CJXA 2QRNA 2R79A 2UYYA 4OFZA 1GN9A 2BZGA 1CUHA 3WC4A 3SR4A 3LCCA 4KO2S 4UC0A 4PANA 4C4XA 4E33A 1M67A 1X1RA 3HB0A 4LBYA 3IQEA 5CVVA 2EKZA 1EZ1A 5DGHA 5JS2A 5I9IA 3GEPA 1JFTA 4I81A 1Z0DA 4NE2A 4K81B 3WBFA 1HNZB 4Y2UA 3WXMA 3L4BC 4GQAA 2HYDA 5CFOA 3QUBA 5J4VA 3GL9A 2WJJA 3P19A 2RHGB 3W4JA 1JU9A 1Q5PA 3HDYA 3NIFB 4QFDA 1FYVA 2O7QA 3D3JA 4GIBA 4GXTA 4WGGA 4EYQA 1HTTA 1Y89A 2R87A 4QU0A 2B1GA 2G1KA 3ZS9A 4DIEA 5G40A 3O5AA 2ZSDA 4LK3A 1G3IA 3ECCA 3K71B 2AOTB 4R7ZA 5H70A 4U8GA 1V43A 4EJ6A 3GN1A 4WQMA 3K35A 1KFBB 1NDQA 5LQJA 3UPTA 3IQZA 2WM2A 3HYCA 3EYWA 4LF8B 4C88A 4LYYA 5BWLA 3HUEA 1IBKB 1BQ3A 3ZWKA 3KZXA 3D5QA 4AU1A 4ZVMA 3KQOA 2GD6A 1C0PA 4U7TB 5B1EA 1NVVQ 4IRMA 1X1TA 2B37A 3ADOA 4DQ0A 1B1CA 1T4BA 3VUFA 3CXRA 3ESQA 1FRVA 4QGBA 4RHXA 3HXTA 5CDTA 4F3KA 5ILQA 4X7BA 3A1VA 4TM7A 2QLMA 1ELOA 1P60A 1L7DA 2N75A 4GI5A 4B31A 5C5IA 4KWHA 4AI6A 1QGOA 2RONA 2TS1A 1PDOA 2WPNA 5HHTA 4HAUA 2B8WA 1DIHA 3M6FA 3DMDA 3RU2A 1JVNA 2PE5A 1PR0A 4L7QA 4ED9A 2CXUA 4DRXB 1FYXA 4X6YA 2EQAA 2VJQA 3G9UA 5A02A 1XCMA 3RJTA 3U80A 4U2EA 5GOZA 2F55A 1E5DA 4FM9A 3H17A 5EIBD 2J3DA 3KVVA 3PDHA 2TMKA 3EZFA 4Y9RA 3W0LB 3PB3A 4BU0A 1KY3A 5JZSA 4LDPA 4Z1MA 3V55A 4YLEA 1HFJA 4KLAA 4E14A 1EUCA 4JX9A 3DTVA 4BMNA 3BB4A 1CR6A 2AHRA 5EZYF 3R7SA 3W9UA 2W42A 1XTUA 2GBPA 1EUQA 4M55A 3MTQA 3ZV4A 4K9SA 2HQOA 3V2HA 3BMCA 2BF7A 4Q9NA 1JP7A 1PFVA 2VUTA 1XTBA 4JXJA 4MI6A 4KZKA 4QYWA 5DRYA 4ETWA 5I3CA 1JR6A 3KQQA 4Q6WA 4C22A 4YMTA 3DLAA 5KVCA 1L1RA 3OCVA 4WDRA 3WYGA 2BEWA 5F5NA 1H6BA 2NVOA 4M46A 1PVDA 2KLBA 4BLSA 2JL1A 4MQFA 5IVIA 2JB9A 2ZJ5A 5IYZA 5JYEA 1Y8QB 2HQ1A 3OT4A 1VE3A 3C70A 3QK7A 4ME6A 3UW1A 3A70A 5EVJA 3MQ4A 1U2PA 1GA6A 5L53A 1BVHA 4X45A 4OMUA 3LX8A 2I4RA 3OQJA 2ASEA 2XJ4A 1NG1A 2BTQA 3GGGA 3D0QA 5IPFA 3K31A 5JS8A 4D0NA 3N0TA 3AT1A 2P8SA 3OJXA 4B8WA 1LK0A 5ITZB 4QFCA 4MDHA 2EGHA 1SC9A 5AKXA 1M6EX 2BM9A 5BMVB 1TK3A 3OTWA 1DI0A 3EVFA 3HV2A 1OVGA 3BT7A 5KWJA 1CIPA 3MSCA 4HS9A 1YGYA 2H08A 4CIWA 3FUVA 5DTRA 1HDCA 2J85A 1CY0A 1LLFA 3PUVA 4U7JA 1TW2A 3V9PA 4CF6A 4JBLA 5AW7A 1G21B 4B3CA 1E92A 4AJEA 5IMSA 4I6EA 4GMGA 4YP6A 3A0UA 3PGMA 1P19A