3GIWA

Crystal structure of a duf574 family protein (sav_2177) from streptomyces avermitilis ma-4680 at 1.45 a resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
262
structure length
262
Chain Sequence
b'RIDTESAHSARIYDYIIGGKDYYPADKEAGDAMSREWPALPVHMRANRDWMNRAVAHLAKEAGIRQFLDIGTGIPTSPNLHEIAQSVAPESRVVYVDNDPIVLTLSQGLLASTPEGRTAYVEADMLDPASILDAPELRDTLDLTRPVALTVIAIVHFVLDEDDAVGIVRRLLEPLPSGSYLAMSIGTAEFAPQEVGRVAREYAARNMPMRLRTHAEAEEFFEGLELVEPGIVQVHKWHPDAATADGIRDEDIAMYGAVARKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein of unknown function DUF574
molecule tags Unknown function
source organism Streptomyces avermitilis
publication title Crystal structure of Rossmann-fold protein of unknown function (DUF574) (NP_823353.1) from Streptomyces avermitilis MA-4680 at 1.45 A resolution
rcsb
total genus 84
structure length 262
sequence length 262
ec nomenclature
pdb deposition date 2009-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04672 Methyltransf_19 S-adenosyl methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3giwA00
3SSMA 3EPPA 3SSOA 3X0DA 4YV1A 5EMMA 5ICCA 1ZG3A 3E05A 3KPWA 3MB5A 5FADA 5GOZA 2YXDA 1Z3CA 3IV6A 1WG8A 3GDHA 4QDJA 5DXJA 1YFJA 1YF3A 4X60A 3QOXA 2G71A 5T6BA 4MQ4A 2AR0A 5GM1A 5HIIA 5E9WA 1VPTA 2ONYA 3B3JA 4BLUA 3OPNA 4E70A 4CTJA 2PXCA 2QRVA 2HMYB 3K6RA 1ZHFA 2NNWB 2IH5A 3EVZA 5EZQA 9MHTA 3M6VA 1X1AA 2P7IA 2ZULA 5BW4A 3BZBA 2R6ZA 3GRVA 4GOLD 3RODA 1ORIA 4DM3A 2P3QA 2ZVJA 4PCLA 4RTKA 2PSSA 5DRTA 4E31A 3TKAA 2ESRA 2BR4A 3JWGA 4QVKA 5D1NA 5DTMA 3MAGA 2ZSUA 3KHKA 3SM3A 5F2NA 2EG5A 5FQNA 2ZBPA 1IY9A 4PNEA 4M37A 4FR0A 1UWVA 3JWIA 3UJ7A 1PJZA 2CMGA 4GOND 1H1DA 5E9QA 4E30A 5EGSA 3G2MA 3D2LA 4PONA 1QYRA 4ER3A 1N7IA 2ZZKA 3CJQA 1ORHA 2BR5A 3KR9A 5FULA 2DPMA 1XTPA 3GRYA 3UZUA 4EVIA 1O54A 4P7GA 4QQKA 1T43A 3FPGA 2AVDA 4LWPA 4E2ZA 3UJBA 3VYWA 2P1DA 4C03A 4KWCA 4KIFA 1JSXA 2B2CA 3BXOA 1SUSA 1G60A 3OCJA 1G55A 1VLMA 3FUWA 3P2KA 4RTRA 4RSRA 5T67A 2ZZMA 1N7JA 1P1BA 3DOUA 2ZWAA 3GU3A 4WXHA 4HTFB 1QANA 3FUXA 3E8SA 3I5UA 1IM8A 3CC8A 3NDIA 3NTVA 3LCUA 2PT9A 3PFGA 4GOOD 5HIMA 2FPOA 2JH8A 3LL7A 4LECA 1VP3A 2PKWA 3G7UA 3KR0A 4GQBA 3A4TA 4WVLA 3V8VA 1P39A 4A6EA 1BKYA 4E32A 1PRYA 1RI2A 4PYJA 1JR4A 5LQAA 2JG3A 4YUZA 3RIEA 3HCBA 4RVFA 5C0OE 3P2EA 2F8LA 1JG4A 4CWAA 5C1IA 2WA1A 3G5TA 3DTNA 4M36A 5ICGA 1XCJA 4ZTBA 3LDUA 3BUSA 2GH1A 4FGZA 1I9GA 2GB4A 3HA5A 4F84A 3G2QA 3MGGA 3HTXA 5T64A 1HNNA 5MHTA 2YQZA 2FCAA 3TR6A 3FTFA 3G2PA 4PGHA 4ER6A 1X19A 3O7WA 1MHTA 2OYRA 2CKDA 1EAMA 1OR8A 1YZ3A 5E1DA 5HOQA 2ZW9A 3BWBA 1R8YA 4KVZA 2EFJA 2EJUA 1EJ6A 2AOWA 4IV8A 4DZRA 3UBTA 4GUAA 5FHRA 1TW3A 3R3HA 4F85A 5DX1A 2G70A 4M38A 1U2ZA 3DMGA 3FPEA 3PVCA 5DRYA 5DTRA 4CTKA 4CKBA 2G1PA 3DH0A 3A27A 4R8RA 3ELUA 3TM5A 1JG2A 1X1BA 4R6WA 4C07A 2IDKA 1SVUA 1NV9A 3MCTA 1KPHA 4PYIA 3G8BA 4BLVA 2Z6AA 3ORHA 3FRIA 2OY0A 3NWEA 4DKJA 2NXNA 4HGYA 2WK1A 5DLYA 3GGDA 2IH4A 3OE4A 4C4AA 5HFJA 2Z6QA 4X1OA 2OO3A 4GC9A 3ID6C 3HCFA 5LQNA 1R74A 1YZHA 4AZVA 2I62A 2AN5A 3JWJA 1TW2A 1JQDA 1VE3A 1KPIA 2FK7A 3LPMA 3HCCA 1L3CA 3E7PA 1Q0TA 3CJTA 5EIWA 1RJDA 3HVIA 2BM9A 3GWZA 2OKCA 3C3YA 5E2BA 5E9JA 5HZMA 2NP7A 4YUWA 4IWNA 3RW9A 5EQJB 3EVAA 1X1DA 2YXLA 4P7JA 4OQEA 1DCTA 1XJ5A 5CVUA 5D1HA 5FTWA 3DLIA 3E23A 3MCZA 3SSNA 1KR5A 2YXEA 3EVBA 4GC5A 5CVEA 5CCXA 2H11A 2B3TA 3EGEA 3A26A 2YR0A 1P91A 2IPXA 2IP2A 4EK9A 3Q87B 3EVEA 3VC2A 3KQYA 4MWZA 2P40A 3MTEA 4DF3A 1EIZA 4PIPA 4RTPA 1NW5A 2UYOA 3Q7EA 3TFWA 5EMJA 4R05A 7MHTA 2IBTA 1YB2A 5EC8A 4RTMA 3PTAA 1NW3A 1RI1A 2EX4A 5K0CA 2P41A 3R24A 2H1RA 3FYDA 3VC1A 2FHPA 4POOA 3UJ8A 2C7QA 4MIKA 1SKMA 3A7DA 4Z2YA 3JWHA 4LWOA 4X63A 3HVKA 3KR2A 3OU6A 3ME5A 5HIKA 1JTEA 2AN3A 3G89A 4X61A 4GEKA 5GM2A 3ELDA 4BP3A 1V39A 3C0KA 2P7HA 2PX5A 4PYQA 2OZVA 1NW7A 3QOWA 1YUBA 2IDJA 1JG3A 3DUWA 4HG2A 4P58A 1JTFA 3THSA 2IBSA 2OB2A 4QTTB 5IKMA 3UA4A 2PX4A 5E1BA 3O4FA 1TPYA 4PYNA 5DM1A 1AQJA 3BKWA 4BY9E 2O57A 4AX8A 3EMDA 4YMGA 3KPYA 4Y2HA 1VBFA 3OZRA 5EMKA 5E2AA 4RTSA 1RI5A 4F86A 2UYHA 2ADMA 1N2XA 5HEKA 1NKVA 1UIRA 2Y1WA 4L7VA 3PS9A 3FPJA 2A14A 4XCXA 3KPUA 3TLJA 4OBXA 2PVCA 2Q41A 3HVJA 4V0QA 3SXJA 3UJ6A 3AWIA 3LDGA 3SVZA 3UA3A 2Z6UA 1L3BA 1O9HA 2ZIEA 1L9KA 3LBFA 3TOSA 1VQ1A 1EG2A 2AOUA 5EMLA 4GOMD 3HNRA 3P8ZA 3T7SA 3TMAA 3P9IA 4FT4A 3P9NA 2QYOA 1I1NA 3T7RA 2LD4A 3A25A 3IEIA 3G5LA 2C7OA 5GIPE 1QAOA 4ATNA 3C6KA 3ELYA 3PLAE 3GIWA 3LECA 3BGIA 4RVGA 2PWYA 3OU2A 3MHTA 2XYQA 3KQPA 3OFJA 4PYKA 3HVHA 3LBYA 3NDJA 5K8VA 4FT2A 4Y30A 5F2OA 4GF5A 5KQSA 3T7TA 5K01A 1AV6A 4BLWA 1DUSA 5FWAA 4HGZA 1Q0SA 4CXMA 2VDWA 1VP9A 4CKCA 2P8JA 3LKZA 2FYTA 3DULA 2AOXA 2VZ9A 4E33A 2E5WA 2HTEA 4OA5A 2XVMA 3GO4A 4M7RA 2AOTB 5EEGA 1WS6A 5ERGB 4YV0A 2CWWA 5EVJA 5K09A 5LQKA 1O9GA 3GRRA 4FP9A 4RX1A 2IIPA 2HV9A 3THRA 2O06A 2QY6A 3BWCA 3CJRA 5GWXA 4DQ0A 5LQRA 1M0EA 3SR4A 3PX2A 4C05A 2GAFA 5BP7A 3TM4A 3DP7A 2NXJA 3I58A 1M6EX 3DXZA 3KQMA 3UJAA 4RTJA 2OXTA 2H00A 1QAQA 4PINA 4PIMA 2V7EA 3M6WA 1M6YA 5B1SA 1NBHA 5K03A 1RI4A 4RTQA 3B7PA 4C04A 5H02A 3KQWA 5FA8A 1KYZA 1FPQA 5EZSA 4AZWA 3EVCA 4FSXA 5DSTA 5BW5A 2AOVA 2HNKA 3FTCA 4K6MA 3DXYA 3LCCA 3I64A 2YTZA 3CGGA 1VIDA 3PFHA 4HTFA 5CUQA 2IGTA 3O31A 2I7CA 5LQJA 3P2IA 3HA3A 2ZWVA 3G88A 3OFKA 2GPYA 2PWPA 1XDUA 3BWMA 4P7KA 2AOTA 3H2BA 2P3LA 3BGVA 1R18A 2FRXA 2VDUE 4O29A 5K0GA 1I4WA 2PT6A 3P9KA 3P97A 3R0QA 4H0NA 4KDCA 4PWYA 3NMUF 4RV9A 4PYMA 1L3IA 3UFBA 3MTIA 2P35A 5LQCA 3I9FA 5EOVA 5IH3A 2NYUA 4LG1A 2XVAA 3U81A 2IH2A 5EG5A 4RYLA 4OQDA 1D2GA 3FRHA 3UWPA 2OBFA 2YX1A 1EJ0A 3SMQA 4A6DA 4AZTA 1XXLA 4ER0A 4EQZA 3ERCA 5DWQA 5DXAA 1X1CA 5CD1A 5EPEA 1FP2A 3DMFA 5FQOA 5K0EA 3R9XB 3HM2A 2BM8A 5U4XA 4P7FA 3ER9A 2Y1XA 3GCZA 3CCFA 3DMHA 3FUVA 3LX6A 3OZSA 3K0BA 4DA4A 4YV2A 1BC5A 3KPVA 5KS2A 1XDSA 5KVAA 3LCVB 1R6AA 3OE5A 2CL5A 3OU7A 1ZKDA 3B5IA 3AXTA 1ZGAA 1JG1A 1RJEA 2IFTA 4X41A 2ZFUA 3EGVA 5DX8A 4RWZA 4PGGA 1WY7A 3HCDA 4DCMA 5C9ZA 5HILA 4PYLA 2C7RA 2N47A 1XDZA 4HH4A 4HC4A 4AZSA 5ICEA 2HR1A 2PGXA 5EHIA 1F38A 1NE2A 4HSGA 3NWBA 5K0LA 5BXYA 4KDRA 3GJYA 2PJDA 3UJDA 1UFKA 1NW6A 3SGLA 2PX8A 3NJRA 4E2XA 2PX2A 5ICFA 4FSDA 4KW7A 4BP1A 1QZZA 2YVLA 5DM2A 4IKPA 3TRKA 1D2HA 3KQVA 3HP7A 3A7EA 3ELWA 4OX9Y 2O05A 1R00A 2HWKA 1RI3A 2XBMA 2B9EA 2ERCA 2OPBA 2WA2A 5G02A 4DCGA 5DSXA 5CVJA 5K0BA 2BH2A 1DL5A 1WXWA 2PBFA 1KHHA 1JQEA 3FTDA 4NECA 3PT9A 4QPNA 2K4MA 5FA5A 1D2CA 1WXXA 4YUVA 2JHAA 3TQSA 5EIFA 2UZ4A 3M6UA 3M6XA 1VL5A 2ZIFA 3MQ2A 3DLCA 1KYWA 1G38A 2ORED 2ZBRA 2KW5A 3BKXA 4U7TB 2QM3A 2QRVB 1IXKA 4B17A 3EEYA 2B78A 4ER5A 4FS8A 4XUCA 3FUUA 1G8SA 3LDFA 1P1CA 2ZZNA 5EKUA 1Y8CA 2BZGA 5DTQA 3REOA 3IYLW 5EHGA 2PXXA 3ER8A 2VDVE 1SUIA 2CMHA 1FP1D 2PV0A 2ZIGA 3F4KA 4MTLA 3TPZA 2JHCA 3UJ9A 3BT7A 2C7PA 1BHJA 5GP1A 5E1OA 2UYQA 3HCAA 4HRAA 3SX0A 5LQUA 2ZLBA 3ANXA 4QPPA 3LSTA 3M70A 4OA8A 4U7PB 4FZVA 3AJDA 10MHA 3CBGA 4RVDA 2I9KA 3GRZA 4XUEA 5DT2A 8MHTA 1G6Q1 2DULA 2ZCJA 3FTEA 2G72A 4KIGA 4E2YA 5K05A 2GS9A 4R8SA 2GA9A 4JXJA 3BWYA 3HCEA 4AUKA 2GLUA 4YMHA 3KKZA 2AN4A 4G56A 5JUWA 4C08A 4EKIA 3B89A 2VP3A 3I53A 5KYGA 5E8JA 5HIJA 3LHDA 5CIYA 1YFLA 3OZTA 1NT2A 2AZTA 2P3OA 3CVOA 4YUYA 3WSTA 5P8WA 1JQ3A 3R6TA 3C6MA 1AF7A 2G8NA 4UOEA 2YUIA 2QE6A 5CM2Z 2B25A 1JSZA 2ZTHA 3C3PA 5K0FA 3AXSA 3GXOA 4RTOA 2BR3A 3EVDA 4V0RA 1WZNA 4C06A 2PLWA 2NP6A 4YUXA 1KIAA 2O0LA 2PY6A 3KR1A 5E1MA 4CKEA 3FZGA 3KQOA 1NW8A 4ISCA 3GNLA 1RJFA 3B3FA 2AOUB 3FPHA 4E2WA 3KPJA 3NW9A 3G2OA 1F3LA 4PCAA 4GBED 3VSEA 1FJXA 5CCBA 2ONZA 4RTNA 1NBIA 3HEMA 3FUTA 3EVGA 3CKKA 1NV8A 2JHPA 3PX3A 2VS1A 3FPFA 3M4XA 3DXXA 1EQAA 1HMYA 3PB3A 3DR5A 1SQFA 3EVFA 3KQSA 2NXEA 5M5BA 3EEOA 4KRGA 3EGIA 4XUDA 3GRUA 5FUBA 4EMSA 2EJTA 3V97A 4ER7A 1INLA 4RTLA 3NVKI 3EMBA 5FCDA 3S68A 1SG9A 2OB1A 2NXCA 3KU1A 3BGDA 1QAMA 4QQNA 1ZQ9A 2XYRA 3LGAA 3M33A 3P71T 2V74B 1MJFA 3L8DA 1BOOA 3T0IA 3AY0A 5KQRA 3NVMB 5K0JA 5LSAA 1G8AA 5GIOE 4IV0A 1L1EA 4PYOA 2AVNA 3B3GA 3UJCA 1AQIA 2PXAA 3G8AA 3P9CA 5DM0A 1XCLA 2AS0A 2FK8A 1XVAA 3KQQA 4R6XA 1B42A 3IHTA 4QVGA 4QDKA 4OBWA 1ZGJA 3HA7A 5JR3A 2UYCA 5EEHA 5K0NA 1KPGA 4MHTA 5LR6A 4EKGA 4RVHA 5FWDA 4DMGA 1KP9A 5DM4A 2I6GA 3MERA 3FYCA 4QTUB 5CVDA 5F2KA 2JJQA 5E8RA 5EKXA 5DPMA 5GINE 3LKDA 5CVVA 1R8XA 1RJGA 2R3SA 5FHQA 2JH9A 3QV2A 2XYVA 2O07A 1SQGA 1FBNA 1KXZA 5DX0A 3TKYA 2ZBQA 3KQTA
chains in the Genus database with same CATH superfamily
1IVYA 1YGPA 3LGSA 3EPPA 3ULKA 1VIVA 3BBPA 3WHPA 1O97D 2HSWA 1F8YA 1RM3A 3WRYC 1QUEA 1V1RB 1NVBA 2D8AA 1F2UA 2C3OA 5G0UA 2F7SA 1E3TA 2GN4A 3LVQE 4MRPA 4B6QA 3JQQA 4MQ4A 2ZITA 5PGMA 4KO2S 3F3MA 3UTCA 2XODA 1DIOB 1SG0A 3A3YA 1DAIA 1MD9A 5HIIA 1JEQA 1XHEA 1FRFS 4R68A 2QROA 1GTMA 4BO1A 4DTIA 5KJCA 1RVDA 4FW9A 2WQ6A 3JD0A 1ZOIA 3BS4A 2IP4A 2MU1A 2MHCA 3H9BA 3P19A 2NSHA 2X2OA 4GOLD 5L8VA 4X1IA 2H8GA 1H9CA 1P5RA 3DHVA 4LRYA 1Z34A 3OICA 3QVVA 3TTVA 5DRTA 2XUGA 4WDRA 4QVKA 3MAGA 2X0NA 2EG5A 4UHBA 2PUBA 5IARA 4Q3BA 4DPLA 1M73E 3VHXB 4A0HA 4GLFA 4DA7A 4L9AA 4PLYA 4IDGA 2AFHE 2GSDA 5TQ2B 1DKOA 5TQJA 1KOLA 3RFFA 5JO0A 4NCHA 4JFRA 3WMEA 3DKVA 2Q6LA 3NHLA 4LISA 4J9VA 2OZPA 3S2GA 3HACA 4JBXA 4ASUA 4OEHA 3U40A 1FLDA 2V8OA 2ZRIA 1FYXA 1Z12A 3F5QA 1W4ZA 3OIDA 1G16A 4MW0A 3QJYA 4NJMA 4ZU6X 4Y6PA 5I9MA 3KHTA 3RVOA 4WT7A 4MVJE 3ZJ5A 4GRIA 4QLBA 5KYWB 4GOXA 1BWQA 1Y8RB 1LBTA 1HE4A 621PA 4D74A 1XEXA 5BW6B 2I4OA 5KNCA 3FUXA 2Z3WA 4RIFA 3SEQA 2FPOA 4G6ZA 2ILVA 4YRPA 4EGQA 1BXRA 3ZVRA 3W2IA 4XWWA 2SCUA 4NK4A 3RHFA 1YQ9A 4D9GA 2XRFA 3ZWXA 3GLIB 3ZUPA 2LV8A 1E2IA 2OWEA 1B0AA 2PAAA 2HAEA 1DT5A 3EA0A 1RRKA 3NHRA 3ZE8A 1TVKB 4GPBA 1TNDA 2ZBDA 2NZ8A 1JLHA 2GPBA 2VLIA 5KNDD 4LFAB 2A94A 5CDYA 1YRYE 1LW6E 5HHTA 5DCUA 3A9TA 1RE1A 2Q0XA 4M60A 1VDMA 4V02A 5HKLA 3W6ZA 1LVUA 2FLVA 5E1DA 3QWBA 1AKMA 2Z58A 3D54D 4GZLA 1R8YA 3GT3A 2PGAA 3PQCA 1RKXA 4LC1A 4A8TA 5KQLA 4OU5A 3MTAA 1XUOA 2Q3FA 2O59A 3GGGA 2ODQA 2XTMA 3DCIA 3RSHA 4B0PA 1PUXA 2YINC 3GPBA 1O7JA 2A1UA 4P92A 5FHRA 1Z35A 3K16A 5FOQA 2CUKA 3OQIA 4GP7A 4F9FA 4BO3A 3DT8A 1DTEA 1CG6A 1NY6A 4HO1X 3KDAA 1E58A 2H3HA 3A27A 2C9ZA 3R5HA 4M8IA 4QBTA 4TMZA 5B3AA 3PC3A 2G76A 4OQYA 2HBYA 3GUUA 3LQKA 1N5DA 1V6CA 1SK9A 5CLIA 5F5LA 3V9AA 5HTKA 1U8EA 3ORHA 4ZWNA 2EF0A 2PUHA 1G5RA 1MRZA 3OPQA 4WBXC 4UU0A 4ZA2A 3ZCPA 4D4JA 4AICA 3TSOA 4D0RA 5KJFA 2A4MA 5EXSA 3MUOA 5B7QA 3RABA 3UUGA 1WEKA 3UKJA 4ZVUA 1W29A 1I7QB 1R74A 3CN7A 4IHQA 4BQSA 1H8HD 1H9BA 4R2MA 3H8WA 3LYUA 2ZB3A 4QPJC 4FCWA 1L3CA 4YRLA 4BKQA 5B6IA 3E58A 4Y2SA 5EL0A 2GD1O 4Q16A 2ODTX 1C5KA 1VGQA 2Z8XA 3HVIA 2V0GA 2ADFA 1O4VA 2OCGA 2NP7A 5EVCA 5LBTA 3RW9A 2I03A 3ZE1B 4HX2A 1N9GB 4UVHA 1WMDA 1K9SA 4N3GA 4UKDA 3BXXA 1L5MA 4GO1A 3VR2D 1NGSA 1RM4A 1ISRA 5M34A 4NCAA 3FROA 3UAZA 5I9TA 2XUFA 1KI6B 3NORA 4BVAA 2A7XA 4FIDA 5DEOA 3L1KA 3IR5A 2I3AA 5C8YF 5L45A 4PIPA 1D1SA 2FVYA 2O7NA 3D8NA 3ETNA 4HY3A 3KOYA 2RGRA 4G84A 4WXRA 1IWBB 4ZMRA 1G8GA 2MYNA 4MKIA 1FDUA 1YB2A 3AI3A 3JPWA 1OTXA 1H6DA 1JIIA 1V96A 3R3ZA 5HKBA 2PRSA 4DCPA 3CPSA 3ZVMA 2ZE6A 4CTNA 3Q2IA 2XIQA 3ESAA 1ODIA 3UJ8A 4PZYA 2AJTA 2IZ1A 3A7DA 3Q7SA 1FFYA 4D0NA 3DDZX 3LUJA 2R97A 3DZKA 4FE7A 1PNRA 3OU6A 1C7QA 4HQLA 1LS6A 3CVUA 2VK2A 1C7RA 2YIMA 4H7PA 3RIMA 3MJDA 3RRBA 4CFSA 2GEDA 1QE5A 2IX9A 5JNRA 1JG3A 2IU3A 4JS0A 1Z6AA 4V2UA 1E60A 3DO6A 3MRSA 5IKMA 2IIVA 5J40A 2FSPA 5LOVA 4EJSB 1E2GA 1FLAA 1XLTC 3AB8A 4PG6A 1TKBA 3DFIA 4MOWA 5EGNA 3ZE0B 4ZVOA 3L7YA 3R20A 3ODGA 1PJ3A 5D3ZA 2LUOA 5G41A 4D3DA 1ISSA 3TTXA 2GEVA 3IPCA 1E3LA 3GQBA 4WACA 1UIRA 3ZDEA 2BDEA 2GPWA 3I1IA 4KQXA 3QLTA 2HBZA 5GGYA 2W98A 1CHDA 5DMHA 1J39A 1G7SA 1OYVA 2PX3A 3HVJA 3LGXA 2G80A 2VAMA 3O4HA 4J0CA 1GKIA 5KOHA 1KI2A 1L9KA 2BEVB 2JIBA 2V54A 4R1LA 5KTKA 1P6XA 2HJHA 4Q9IA 5JE8A 1D0IA 1RYDA 4Z4FA 2FPPA 4MPPA 1RM0A 1NVVR 3AR2A 4US1R 1TYCA 3INGA 1A9QA 2PR2A 3R9XA 4LY0A 1G5QA 4TSFD 3NALA 4N65A 1G20A 1TU3A 1CZHA 1V25A 2WC1A 3IHWA 3H8JA 1XVIA 4JJAA 1SD5A 2C9BA 3LECA 4UCFA 5DIFA 5GONB 4C6RA 1O9BA 2FNAA 1PQYA 3EFBA 4TTTS 4EZEA 2WYWA 2Q3MA 1GZ3A 4O5OA 1C1HA 2BSAA 2ETVA 3U1TA 4N49A 4WK4B 1V9SA 1GNSA 3OOHA 2FSIA 3OESA 2FPIA 4EYGA 1IC6A 1CJMA 3EY4A 3O8QA 1SD1A 1JEEA 3L7CA 4RA6A 1BDHA 2FN9A 3UN1A 3OCVA 3QXCA 5FYDA 2AOTB 3ED1A 5LQKA 4FP9A 4P0TA 2P75A 1PJTA 4KQIA 4DQ0A 3FTPA 3KJZA 2JI6A 1DJOA 1BVRA 4LV6A 2W2PA 1IQPA 4Q1DA 5L7YA 4OIFA 5GV8A 1AKRA 4FI3C 4WTOA 1O4WA 5TGZA 3CURA 4EJ0A 2F3PA 5CAEA 1W59A 3Q7PA 4GRDA 4LFCB 1W48A 3GRFA 1BEUB 1Z0UA 1Z82A 3CKMA 4JFAA 2Z95A 5IJ9A 1A1SA 3FB1A 2ZB4A 3DE6X 5FIUA 1JYEA 1CKEA 3WB1A 1DRJA 1EJBA 2IZ5A 3OKPA 1Z08A 1M66A 4MRMA 2K7FA 2X4DA 4JL6A 4AZWA 3F6YA 4FHGA 2MINB 4IMJB 1A9PA 2O2CA 4YDQA 1U98A 4NV1A 5A6SB 4BMYA 1JJBA 5IW8A 1CJSA 1N25A 1WLYA 4LE2A 1NT4A 4PC1A 3VU9B 4RM2A 5AHOA 4U6SA 4BGIA 2R6R1 5BV8A 2I7CA 3N7TA 1QHHA 1ZCBA 2GZ3A 2Q9CA 3PITA 3QPDA 4JASB 4TWJA 3F9RA 1M7HA 1V2HE 3A06A 1TYEB 5KJEA 1XJ0A 4IW3B 3KC2A 1OROA 2FPGB 2XZPA 1T1JA 3G2LA 4YFYA 1K63A 1RBYA 2O7QA 3MB8A 3F73A 1L3IA 5CLGA 5LQCA 3ENZA 2VT2A 3O95A 2X5NA 2O2XA 1N8TA 2YWDA 3D0RA 2TYSB 4JSRA 2AGVA 4LK2A 4ZO4A 5IH3A 3YASA 3ZQUA 1JB9A 1EVJA 3L0ZA 2P9YA 3PXCX 3KOZA 4RYLA 1Q6YA 1RSZA 2AK2A 4H7KA 4KFSA 4FSHA 3CEAA 1FP2A 1YDHA 1NXXA 3VR5H 4LF8B 2NU8A 3WGLA 2D74A 1ZU5A 1UJBA 3H3JA 3M8KA 4DIDA 3UOWA 3GLIE 4Z1OA 2PRYA 4YJ3F 2VK1A 1UBGA 2WJZB 2JGKA 2AMYA 5KS2A 4K9OA 4FNGA 3QITA 4Y2TA 2ZI7A 6ADHA 2YWGA 4RLHA 2F55A 1R6AA 4HR7A 4M8NE 4DC9A 4UFPA 3F98A 1ZGAA 1XBTA 4E5DA 4WOCA 3CF2A 4RWZA 4H4EA 4BBPA 2L82A 2O8BB 1XDZA 2IHBA 3O8QB 4MQMA 2P4UA 2D2EA 1F38A 3TQCA 5IBRA 3KT0A 4BTLA 3N8DA 3JQ9A 1CBUA 3ROMA 2OOKA 2MOKA 4DBLC 3I30X 2OD9A 4KXFB 4ZV9A 1L7EA 2ZIUB 4YC7A 4ARVA 3L0CA 5CA0F 5L7TA 1T5LA 3FSGD 5CXQA 4ZEXA 3I0ZA 1UBCA 2Z09A 1ONSA 1TEHA 3KTOA 3LG2A 4NF2A 4U7GA 2IPNA 4YT5A 5H16A 5A9SB 1D9XA 4P32A 3TB6A 3U4QB 2WA2A 2XKBA 4G0YA 1WXGA 1NP3A 2R8ZA 4QXQA 3U80A 2QXUA 4FN5A 5CG2A 3OURA 3UIEA 3FGNA 3GEIA 3KKOA 1WXXA 4IXMA 4G86A 3DZIA 1DOHA 4L78A 1BCSA 2YN0A 4WADA 5GZ6A 1TO1E 3GNSA 2XCUA 3ZGVA 3E5HA 5K8IA 1PZFA 2A0UA 1YTLA 4BV8A 3DB2A 1GL6A 3PTZA 1FMTA 1P17A 3IEMA 3E7XA 1NVXQ 2N1BA 3CX3A 3VNUA 3WLKX 3FCXA 3QRWA 5MGNA 2JGLA 4DT1A 1FFAA 2I1WA 1WD5A 4MXDA 1ZD5A 3W9SA 1EK6A 1R4MB 2XT0A 4J75A 1B8VA 1U3VA 4FFOA 1E1NA 5HE8A 1U2EA 3D0KA 1CR2A 2VHTA 1PZEA 4JVMA 3WYDA 3IPXA 3E4CA 5BQ3A 5CB4F 2VNKA 4Z4HA 4L4YA 5EYPA 2WEKA 4I0WB 4TMWA 1QDLB 5DT2A 2CB0A 2DULA 2UVQA 4K9LA 3OEYA 1XMSA 1IDN1 4Y1FA 4L4RA 3ZY2A 1DAOA 1N57A 4L6CA 1AV7A 1H69A 4MWTA 1E69A 2Y0EA 2P27A 4RNCA 3HO6A 1EWRA 2FZGA 4G56A 3EWNA 1E6EA 3O2QB 4J9UE 3UJHA 1U2DA 3AL2A 5E8JA 4OM7A 4BJ3A 3KJIA 4MZXA 2QBYB 3AETA 3A6DA 3I05A 4KIWA 3N8GA 1O08A 1HYEA 3GVIA 4TZ0A 4CBVA 3GAMA 3H1FA 4J91A 2O1SA 1BX1A 3TSAA 4UOEA 3FNIA 4YY3B 1MZVA 3GXOA 1LCIA 4K81B 2H5LA 1NXQA 1B1AA 1MB4A 1KIAA 4O02B 4HPWA 1RCUA 1ZK2A 3VHRA 1U3UA 2WIDA 4C4YA 1BIFA 3PEEA 4EY7A 2BHSA 3GCDA 1AZSC 4RO0A 2R8XA 3SZ3A 1GUBA 1CXZA 4PRKA 1M33A 4PV7A 5KNCD 4QUIA 1VLLA 2DTEA 2J3LA 3M5WA 1CVRA 2QX4A 3HEMA 4G4SO 3WIOA 1JR3E 1M75A 2H7XA 2JHPA 3A6KA 1Z17A 4U1RA 2OG2A 1VIAA 1IJFA 5BPFA 1YZUA 2PZBA 2OGZA 5GVSA 1NN3A 3L06A 2Z4RA 1KY4A 3AW9A 1EXMA 3PQ6A 3EGIA 1NUAA 4NK5A 3OLWA 4CMEA 1A4UA 3CWCA 5AYVA 1W1IA 2FRDA 5ED0A 2RGNC 4AZ0A 2XRYA 4ACAA 4C0BA 1OA0A 4KRXA 4UJ5A 1VRCA 3AKEA 3VC7A 3LUFA 1I33A 1QP4A 1PR1A 2JFZA 1QKJA 4CL0A 1ZDMA 4UHHA 3SLGA 1OT5A 5CW1A 4CZ2A 2FUKA 2YJZA 2SKCA 4OOFA 3MCVA 5HF8A 2PYDA 2H1SA 3HEBA 1IBMB 4XB6B 3PC8C 1A5BB 1SVKA 3R2JA 4LIPD 5H3HA 3Q0EA 1Q0LA 1T9DA 2GKSA 1EFKA 1ZGJA 2RHGB 4E5NA 5K0NA 3T3MB 3OPVA 4HDKB 4UEOA 1JHAA 5KHOC 2ZRKA 1PGNA 2JHFA 3N8IA 4FGWA 4WV3A 1ZD4A 3AG6A 4YJ2B 4YQYA 2FW6A 1DFGA 4QTUB 4ND8B 3D5QA 5B3LA 3BQMB 1PWHA 2F9LA 3HYRA 5CNIA 1OH8A 4Y9DA 2AJ8A 3PHJA 3E2MA 5FBLB 4JVOA 3S8MA 1IZZA 4S0XA 2HXGA 4AF6A 3TRFA 4D7AA 2CE2X 1A69A 4K8OA 2QG9A 4FYXA 1AZTA 1VHWA 4MPRA 4CKWA 2ZSBA 5JXIA 5DXJA 1QHHB 2YNMD 1N9GA 3W5DA 3Q8LA 3ZD6A 1SU8A 2G71A 4X8MA 4CQJA 3H2JA 3GLGB 1YVPA 1SWVA 1VPTA 3DYBA 4NJOA 4E70A 2HMTA 4FVTA 3S3TA 3RTCA 4D9FA 2BI8A 3PNQA 2AKAB 4FLMA 4GBGA 9MHTA 5EKTA 1H1LB 2R6ZA 1H2WA 2PUEA 4EA9A 4K9DA 3O4JA 3BE8A 3UMSA 3LP6A 1JDSA 1X8LA 2VJOA 2UAGA 2TECE 1QHNA 1SCBA 2SHKA 2WRZA 1Y7IA 2W43A 3R0IA 3VI3B 3UUFA 3N07A 5I47A 4C4XA 2VATA 2H5EA 4FOPA 3V7UA 4M9XA 3F71A 5CTAA 4CODB 4ZCMA 2WWGA 2PZ8A 3L6UA 3FCEA 2OG1A 3NYIA 3OE1A 2QT1A 4GW3A 3OQMA 1US8B 3ES9A 4AJLA 4EVIA 2O3RA 1A9XA 4QQKA 3LRTA 4MI1A 1JAXA 1C7JA 2O2DA 4HBZA 4GMDA 16PKA 3AQ4A 3OEWA 4TWAA 2LIPA 4RORA 4G1BA 1HQKA 4W7IA 1JSXA 5DI3B 3BGSA 1SUSA 3M34A 421PA 1W44A 3ZCQA 5C46F 3DT9A 3WWOA 2RG1A 3LPDA 2ZE5A 1KDPA 2QVXX 3WFZA 1TX4B 1PJ2A 3L5KA 3IA2A 3SF8A 2BI4A 2GZ2A 3JRXA 2QN3A 2VHQA 2ZZMA 3F6BX 2CNNA 1IIRA 3REQB 2HV8A 3NDIA 3R3XA 2ZVQX 2XR1A 2P6NA 1A7UA 2VHUA 3O8DA 5HBRA 3LL7A 5HIMA 1VP3A 1YMVA 2DT5A 1LDEA 2W6IA 3IS3A 4KR3A 1LRKA 5JDIC 1PLJA 2BEVA 3OCXA 4GFDA 1L7DA 1LSUA 5HMLA 4CT4B 3TYXA 3RTGA 1EB9A 2H07A 3L1JA 3RVMA 5BNTA 3DTNA 3VH3A 5FUMA 1CDEA 4LWZA 1APBA 1EHIA 3N8HA 4IX9A 4XYMA 3EZXA 1PD0A 3I32A 2G82A 2A1TR 3HPQA 3KSMA 2JC3A 5CNKA 1Q7EA 1CT9A 1VHDA 3H5AA 4DQLA 3M1YA 1P2BA 5F76A 3FTFA 4KGDA 2PFKA 2YFQA 1MJGM 3EG5A 4ZRNA 2FSHA 5LKRA 1YZ3A 1QRAA 2CVZA 4L3WA 3GEHA 4NFSA 4DLTA 4KQ1A 4NYMQ 4CKWB 3TCNA 4D42A 2WFAA 2FMXA 3WMFA 5J4HA 1UPFA 4XCQA 2CLSA 1R0ZA 4M38A 4GKAA 3IL2A 1YVDA 4IEIA 1PF7E 3KT3A 3B1JA 2HQBA 2FWRA 3DSRA 1ISFA 1KP3A 2AW3A 4IIJB 4JLUA 4U2DA 2IA5A 2PGLA 2FRDC 4KK4A 1KC3A 4Q7LA 4Y6QA 1OX6A 1ACLA 3TJZA 3PWSA 5JNVA 3FCSB 4E5UA 4JXXA 1Z0JA 3GLVA 2Q5HA 4JUDX 1H1TA 1XIVA 1NU8A 1LBEA 3HCFA 2PX6A 4LX8A 2IYQA 4H7DA 5LQNA 4AZVA 4DEVA 2Q2OA 3QJGA 4G0QA 4UUNA 4V3BA 4MS4A 3PFNA 4ZTZB 4BLTA 5C8ZA 4UNPA 5IXSA 3FDZB 2QX9A 1KPIA 3FPLA 4K40A 1WO8A 1NE7A 1YDEA 3CEHA 4BAUA 1B6RA 4W9NA 1JHPA 3JVIA 3FOFC 1KH2A 5LBIA 3ZQ4A 5KVSA 1ETHA 3BD9A 1AURA 2D7JA 2NVOA 4IIJA 3G9XA 2I0FA 3H4MA 4H6WA 1DCTA 4QYMA 5CVUA 5FTWA 1OGJA 4F71A 3FR7A 1OF1A 2AE1A 2JIOA 2Q49A 2WJ3A 3RNLA 4ENVA 4BP9A 3USES 4O4LF 4JI5B 2H2FA 4ZQGA 3U3JA 3G5AA 4YA6A 4EKDA 1P1IA 3T38A 2FGJA 1DG9A 1EDBA 1J0EA 3VOTA 4J90A 2BEWB 3NBMA 1FC0A 3I3SR 4UQLA 2V4ZA 3UM9A 5AXCA 4U2KA 5FFNA 5P21A 4BIIA 2EKZA 4CV2A 1IY0A 1SQSA 3MWFA 2QM0A 3RS0A 5A4JA 1D09A 2QENA 3OWOA 3DWGA 4Q7EA 2FXIA 2C7QA 5IXYA 4MV5A 3RB8A 4HN9A 1VB3A 2PT5A 1DZ3A 1HDXA 1TFRA 4RVOA 4HNTA 3KR2A 3E53A 1G5PA 2A67A 1ZOLA 4WLVA 5H68A 4YR9A 4D8WA 4R16A 3IO3A 1XX6A 4Y9RA 3ZH2A 3T34A 1YUBA 4GPD1 4ZODA 1E3SA 1I2MA 1B0UA 1NR1A 3PRJA 4JLAA 3RHZA 4HFJA 3WX0A 1Z5PA 5LP1A 1XPJA 5MN5A 5LZ4A 3DBHA 1D4FA 1U4NA 4NX2A 2WWFA 4BMOB 1HO3A 1Y3DE 1HURA 2F64A 3SYMA 1XB2A 4IQFA 1IE3A 1ZCJA 2QRJA 1YKSA 1QUFA 3OZRA 4PFQA 4JL5A 4TRNA 1FTWA 1RBZA 2XUKA 1A77A 1FYVA 4ND8A 4EYQA 2DFKB 1N2GA 3E27A 1FX0B 4QT0A 4BQFA 2PVCA 2AJLI 3ESYA 4G36A 2CNBA 4ON9A 4DYDA 2IX3A 2CK3A 2Z6UA 3WWZA 1JDZA 4I5DA 3G0CA 4HL6A 2H65A 1EG2A 5EMLA 4I9NA 4R1QA 4GOMD 4EG0A 3IIIA 1WPQA 2OUIA 1GAQA 3TNFA 3BMXA 2NNLD 3F74A 3P9NA 3UICA 2V4UA 2UV8A 4DLSA 6YASA 2PYZA 2EZ4A 2QTHA 3EZFA 3BD7A 2GD6A 1J0DA 1XTVA 3AU8A 4J0FA 4Q18A 2N3ZA 4ESOA 2QWXA 3D6AA 3ZTWA 1P3JA 3ZZUA 2PWYA 1XEXB 4B74A 3ONVA 2YFHA 1YQXA 5JANA 1WJGA 1R50A 2EQBA 2RONA 3LUGA 5F1KA 1ZMRA 5TJHA 1R8SA 5CRIA 3SEZA 3T0FA 5IX8A 1FP4B 4IJWA 2ACEA 2BFOA 5L95A 2ZPTX 2ZB7A 1MNQA 1PL7A 3DULA 3LKZA 3SVTA 2EL7A 1JQAA 1I5RA 1GQFA 1NR5A 3HA2A 1HT0A 3RVPA 5EEGA 3DE2X 2WABA 4BEJA 4MMZB 3GRRA 2C95A 4KLCA 5IAGA 3OTWA 4AULA 3D4PA 2RKBA 2Y93A 1EX6A 3ENVA 1NWHA 3F7OA 1P7ZA 4LXQA 5A05A 3NH6A 2BWJA 4YIHA 5GTDA 2W93A 3BXPA 4L57A 4AG5A 5A3JA 1XC7A 3O8LA 3P9QA 3DP7A 1Q0UA 2NV0A 4IDHA 2F17A 3DAOA 4YP7A 4CKZA 3ZWQA 3CCCA 4PQYA 1PFKA 3TH5A 1M6YA 4X93A 4NHOA 4DNFA 5B1SA 5HPYB 1II9A 1Z0IA 3MQ4A 2IEBA 3WB0A 1UP4A 1RXSA 3SQOA 2BBOA 4NPAA 2IYOA 4LDJA 2XF8A 1LEHA 4DNXA 5T4EA 1NXPA 4AO6A 3EOBI 3GC6A 1UFVA 4KGVA 4E5YA 4MV1A 2BHTA 3FI0A 5AK6A 4RHEA 1KAOA 1R66A 2WJ4A 3O31A 3P9PA 1RPAA 3UT0A 5LQJA 2ZWVA 3K2EA 1J25A 3OC6A 4GPZA 4JP1A 1W46A 4D82A 5A4DA 4ZQEA 1MG5A 5DHUA 1C1DB 1V3TA 2PMWB 1OBVA 2AOTA 1Y3FE 2Z0MA 2FRXA 3BGVA 3D7RA 2GJ4A 3D8BA 3MTQA 4F2WA 5KSZA 2PT6A 3A4IA 1I8TA 3AV0B 1IY8A 1KXJA 1LPMA 1TKRA 3BXFA 3EFOB 3P97A 3NT4A 2WFLA 5ISMA 2IEGA 2O3SA 1ESNA 3ASYA 1U4OA 1DEHA 4O4IF 3I9FA 2NYVA 2WSSD 5EOVA 1RT9A 2G9VA 2V55B 2XVAA 2BJVA 4HNRA 4R8LA 1M8GA 4TV8F 4XASA 5EIOA 4E5VA 2RHCA 2W2OA 3T95A 3ETLA 4AG3A 3ERCA 5BSGA 3CPEA 4FEYA 3ED5A 1KI4A 1U28C 2AZ4A 4PANA 3V8MA 1XZBA 2FWJA 4RW0A 4AN0A 2EX0A 5AXBA 1F4VA 2W8BB 1TRHA 1C9JA 2HFJA 3W1VA 2HWXA 1HKUA 4EO9A 4NS4A 3PX7A 3SZMA 5KTMA 2EYQA 1YS2X 2CL5A 2XQKA 2Y66A 1SCDA 1X7DA 2Y9PB 2ZGVA 3PDWA 3IR7A 4KFRA 4L1KA 4OYYA 3CZQA 3GY0A 1WCXA 1GG2A 4PPGA 3OJOA 1VCHA 1A2OA 6REQB 4TGLA 3KKQA 1JQLB 2PVSA 4GDMA 4AZSA 2Y2VA 1PEYA 1O87A 4TXLA 2R7AA 5D87A 4WCVA 2RK6A 1SKQA 3A9VA 1WB6A 1Q16A 2XWPA 5I8PA 2QX8A 5M2QA 1JLLB 2D3WA 3SGLA 2GXUA 2QEQA 3JZIA 1H85A 1WMFA 1IMJA 2OV8A 2RG7A 2PZAA 3M82A 4BFCA 5IBCA 4IKPA 4Q47A 3D4NA 3WLHA 1Z2CA 2ORWA 1U2QA 3BH6A 3LKBA 1PV1A 3A3PA 3DMRA 4R98A 2Q27A 3A2NA 1SXJB 3LI2A 4QNRA 4X20A 5B37A 4NNPA 3ZK8A 4BB0A 1MO4A 1JEAA 1ENPA 1SU7A 5K0BA 1GZUA 3REGA 3IEXA 4INAA 3RC1A 1CY0A 3KLOA 5ENDA 4LE1A 3UUEA 3FTQA 5A4AA 2JLYA 1QIMA 1DKMA 5E7QA 2MWMA 2VL7A 3NVDA 4DY6A 3M6XA 4DYHA 2QGZA 3QPCA 1QWSA 2WVHA 3DBLB 4I6GA 1NDUA 3VPCA 2QM3A 4KMOA 3NT2A 1EXVA 5I4KA 3KT8A 3B7WA 1B3BA 3I04M 1T36A 5LLSA 4FOOA 5IF9A 1M3SA 4XQ0A 2MTBA 2PLFA 3DWIA 1Q0RA 3KKNA 1HK7A 4MW9A 4DFDA 2Q5JA 3AHHA 1QGUA 5BYAA 1ZL0A 1TM4E 2IU4A 3TPZA 3TRHA 4EF4A 2JHCA 1FF9A 1LBSA 2DKNA 2Q8PA 5A9TA 3HKCA 4BKPA 4Z7QB 4UCQA 5GP1A 3Q7RA 4CIBA 4C6SA 1OXVA 3N2IA 2W7TA 1WRBA 3JD1A 1R0YA 4UNRA 4YK7A 4F5YA 4F4IA 3ZHZA 5A3QA 4XD2A 3R9IA 1NFFA 5CG1A 5JCOC 3GW8A 1KMIY 4FZVA 1PKEA 2ZTLA 4AL4A 4ARSA 2ZIAA 1Y6RA 4URHA 3CX4A 1S4MA 2AUMA 4WFQA 5AR1A 4ZVMA 8ATCA 2GUWA 4O4HF 3U4QA 5DF1A 2W37A 1R16A 3TUJC 3W2GA 4B80A 4CU2A 3I23A 1L6RA 2VF4X 1DTWA 3HLTA 2EP5A 1EG7A 1GG9A 1WUKS 2J9XB 2XTNA 3KB8A 3PEVA 4IG4A 5KYGA 3LHDA 1E3QA 2I99A 3N1UA 4P6VF 2NZJA 1XMIA 1I5OA 3BSWA 1JQ3A 3I4FA 3TXXA 1GITA 4ENRA 4KJXA 4ZCQA 4BWYA 1O3YA 1R9MA 5K3FA 4FGJA 4RMJA 2QTGA 2QTTA 3AXSA 3WLFA 3GVXA 3FF4A 2IUTA 4BPBA 1DHTA 2X42A 2HHCA 1VG8A 1E98A 1F0PA 1VPEA 2GCOB 2ZANA 4YUXA 2FPLA 2SCUB 1DLJA 1JHUA 1YD7A 2YHIA 4JUBA 4A03A 3FZGA 4LOHA 4F4UA 2R1ZA 1Y8QB 3KQOA 4PO9A 3JTEA 4ZYLA 1JDBB 4JD5A 1JE1A 1R2QA 3EH2A 4KSBA 2JKYA 3O47A 5CB8A 3GCWA 2A57A 4JLSA 2YMLA 3K5IA 3PXBA 1ZL2A 3PGKA 1JSRA 1VCIA 1WOYA 3QMVA 4ARCA 1NXOA 5BWMA 1EK0A 2A0XA 3PX3A 4FDVA 2R1TB 1QGOA 2D1YA 3HRKA 1TAHA 3GELA 3IH5A 3KUKA 5TT1A 3RC2A 1C2YA 1OXSC 2G5TA 2ZIZA 3L0SA 4R1MA 1P75A 3CS3A 3EB9A 1QF7A 4IDBA 3X3HA 5JYBA 2OAP1 3EEOA 4WFJA 5DO9A 4B3SB 3MT9A 3B78A 4EECA 1GTJ1 4Q7QA 1UC9A 1KZ1A 1BW9A 1G3QA 1SG9A 3OQNA 1CQPA 1Y1LA 3C3WA 4C89A 1QAMA 1TZ2A 3A2KA 2XYRA 3OWXA 3A6HA 3HHPA 5ENZA 1E3WA 2X9QA 4ZC8A 4D44A 4CG2A 5K4HA 2V3CC 2E87A 3LYLA 3OTQA 1DO0A 1VSQA 1FVOA 2GETA 1LC3A 1OLXA 1Y81A 2PU5A 3NGLA 1A4RA 3AF0A 2B36A 4EDFA 1XCLA 4GI1A 2AS0A 4HWOA 4DNPA 1XVAA 3BRCA 4JAVC 3IHTA 2NUTA 1AGRA 2R751 4AECA 4BVEA 4EG3A 4LYYA 5LR6A 5JNSA 3JQFA 3V6MA 5JY1A 4R3WA 4GPEA 5D84A 4RKQA 1TJ5A 2UVDA 2VWHA 4G0ZA 3LV8A 3KKPA 1WDWB 4ZJYA 1JA1A 1V47A 4IJUA 4ND4A 3DE1X 3JU3A 2C3PA 2XDQA 3FNEA 4ZCSA 5J2UA 4BX0A 2QD3A 1YSCA 1VLZA 3CWZA 2XYVA 3QV2A 4OGGA 3ZX4A 3IAM1 1JEYB 2WPDA 4EITA 5FTLA 5IT9A 2RGWA 3SSMA 5BSFA 3PQ4A 4ZT6A 3X0DA 2GPJA 3IQIX 1XZPA 4Q3AA 4ZQBA 5A03A 5EHXA 5I7VA 1RHRA 4YRNA 1LSJA 1ENZA 4BNWA 2A5JA 3DHYA 3FUCA 1C7FA 1JHZA 3AU9A 4LRUA 1WP4A 1UCFA 2HEGA 2BW0A 1M1NA 2YMMA 3NFRA 4K3UA 5A5VA 1XP8A 3C7AA 3O03A 3HWX1 2DWPA 1U1DA 2HU2A 4KX5A 4LNUB 4AMGA 4YRBA 4FONA 1SBZA 1K0FA 2J59A 3WDKA 3MN1A 2DMRA 2DOKA 1ICEA 2PSSA 3I2FA 4F6CA 3KHKA 2OLKA 4BVGA 1WMEA 1XHFA 3OF3A 5AKYA 3LIIA 3GLFE 4N5LA 3U62A 5KOIA 3JWIA 3H2KA 3UJ7A 2V9CA 2TS1A 4YMSA 4GP6A 3N6VA 4NZPA 3H0CA 3B82A 3QKSB 3S55A 1Z5UA 3EVTA 1DEOA 4F45A 1VA5A 4MLDA 3TSYA 4IWYA 3WWEA 4EY3A 1KDVA 3J7TA 3CRMA 1FMLA 3EDMA 3G02A 4JN6B 4WH0A 3T4XA 3SAJA 3S1AA 5HYVA 3PDHA 2IYFA 3IPRA 4JJIA 4WZBE 1QOPB 1HGXA 1G7CA 3NCHA 2YHUA 1JJAA 4M99A 1IPFA 2GRAA 2E6UX 3NPMA 3OCJA 1NBME 1T4BA 4IQGA 1WIWA 3ZHBA 1PS8A 2K87A 4AD8A 1Q11A 5K0ZA 2YNMA 1TIKA 2X86A 5TS2A 2YKGA 4FCCA 4AIIA 3GU3A 3I6QA 2NWQA 4KLRA 2FP3A 3HB9A 4IJQA 2H1FA 4UM5A 5LA6B 3UYKA 1DP4A 2XSZA 4HRXA 1GT91 2O2YA 3PZBA 1ZC3A 3L8CA 1MJ5A 1RTKA 2VYND 3IJEB 4K86A 3DLAA 2DG2A 4E32A 5I4IA 3ZGYA 3QK7A 1PRYA 4LV5B 2C2YA 4NJEA 3ZUGA 3ZV3A 5A4KA 1N5OX 1DC3A 3V9PA 3RIEA 2JG3A 4RM3A 3S1AB 1VJRA 2X0IA 2D6FA 1QYWA 1JIXA 1ZQ1A 1K8ZB 3HXPA 4NULA 5ITZB 2J08A 3RKRA 2H4ZA 3GJXC 5J58A 1X8XA 5AXDA 5FXMA 3K9BA 4FMBB 1BQ3A 3D4OA 4D6XA 1NF3A 2PLAA 3P9XA 3V7YA 1QTNA 5JXJA 4INZA 5CFLA 4F84A 1M2HA 1X7XB 2EQAA 1XK6A 3HTXA 5J43A 3DM9B 5KSPA 1II8A 2C8JA 3QPBA 1GRVA 1A9TA 2D7CA 3LQQA 5THQA 1O5IA 4Z1MA 4F06A 4KVZA 4XOIA 4M0CA 2HN9A 2X7HA 4Q66C 3WKDA 4AY6A 5HQTA 2GO7A 3OLZA 2QIPA 5A4MS 3TGWA 1PJCA 2VKTA 4ZQHA 3C70A 3RS9A 4FXPA 2G1PA 3URKA 1OFIA 2MR6A 2QW0X 1UBOS 2FUCA 2XCTB 3A32A 1LTHR 4B2IA 2MSLA 2QDXA 1ZRSA 2RIPA 3TR0A 4HKTA 2XQJA 1OX4B 3PFKA 4PLCA 4XGNA 4JB3A 2XQFA 5KTYA 3EXHC 1P31A 2NXNA 4HGYA 4RANA 1GTL1 3TAHA 2GD2A 3U6KA 2FEMA 2C3MA 1CUAA 1WABA 3GXBA 3W7VA 1TQ4A 1FXSA 3BICA 1EE9A 1LGYA 4X1OA 1D9ZA 4MPDA 1VHJA 2C3YA 4NBWA 1JH8A 4DLPA 4FHDA 2P2LA 3KTAA 1FTGA 5AVJA 1T4CB 5C3UA 3ROQA 1AUPA 1JQDA 4TUYF 1MO6A 1JT2A 1W5AA 5K3CA 3HCCA 1RXVA 2JGDA 1Q0TA 3TNJA 4QSHA 3IERA 2DBVO 3KLMX 1IN6A 4MV4A 4WNCA 1QVZA 1Z18A 1CV2A 1X87A 2OKCA 3HY3A 1FLNA 4HNAA 4HQNA 3ZYCA 1E1DA 4REQA 3VR0A 1PNTA 1T3ZA 3OQ1A 4MVJH 3I2GA 4RELA 2HGZA 4BZQA 1VE7A 4YJHB 4WY5A 1X38A 4O6VA 4RZHA 4Y6GB 5HCIA 3UAYA 1XZDA 1U1CA 1MEOA 1QM5A 1U0NA 3O7MA 5DMXA 4MSUA 2DR3A 4OMUA 2FWMX 2OHVA 3WQBA 1SH7A 2HRZA 2ZTSA 3T7AA 4MTCA 2LNDA 1TU0A 3N0XA 2VC2B 3BL6A 4LDAA 4NBSA 2O0HA 1YVRA 4Z3OA 2IKQA 1L8LA 2EFHB 2I1LA 3VPAA 3MMPA 2AI1A 3P4UA 5H80A 3KBOA 3TZCA 4YAIA 5AP9A 1G2IA 3IBFA 1PNOA 2V98A 1JVBA 3P20A 4KFCA 1K8YB 5HXAA 4PRYA 1SCUB 3PPVA 5K0SA 2J41A 5L3VA 3QPUA 1ZC4A 3EGDB 3QEKA 5BT9A 4EOGA 3CV3A 2OAEA 1D1TA 1V3UA 4JEIA 3T3EA 3G79A 4BO0A 4QXMA 1CWUA 1GKLA 5EJ6A 3JZMA 3GLFB 2AN3A 4PX2A 4X61A 3AVPA 3FCCA 3IAAA 3SF0A 5TVKA 3O9VA 1Q91A 1JTFA 3DUWA 2QRGA 2Y77A 4P58A 1DRUA 2EZTA 4UBMA 4AZ3A 3LUBA 1FVHA 3R5KA 3PFBA 5FOSA 5DM1A 3ZZNA 3OEHD 3WGUA 1KDYA 2JA2A 3KEFA 4OLHA 1KF0A 3SEFA 2C7GA 4Y3UA 1ZVVA 5DGXA 2FKAA 1MB3A 1I30A 2RHDA 1H0SA 2WYUA 2YQ5A 3ZDBA 2XUZA 2RGAA 1VBNA 1NPYA 1LSSA 2CLOB 3GJRA 2GYVA 4N39A 2I7DA 2ZG6A 3FPJA 4A0FA 3RTAA 3TLJA 3THYB 1M6VB 2FEKA 4FIZA 1E18A 3TR5A 4WZAE 4B8WA 5CAEB 4J29A 2ZRGA 3BC1A 1L3BA 5LYJA 1HQYE 1ZJJA 3LBFA 4FDMA 1PZNA 4IUCS 4KK3A 3TLGA 3AOEC 2ZPUA 2Z3VA 1QV6A 2PFSA 3G0OA 1CY2A 3F9CA 4IO1A 4JR1A 4MUYA 4OH7A 3VPXA 2RHHA 1YNSA 4HAYA 4AZ3B 3LU1A 2W2TA 1IM2A 1GUYA 2IUFA 4OQFA 3SHWA 1OAAA 3INTA 3OOEA 4E22A 1FFHA 4DJ5X 2DGDA 3RK1A 4JI3B 4A36A 5U9CA 3EHEA 1C9YA 5FH9A 2OO5A 5JY6A 3MHTA 5EJ5A 3A6PC 1NUTA 1NW4A 2BEUB 2OE2A 3UWOA 5C4MA 3GCXA 2PS1A 4P0PB 1ADGA 3HFGA 3I34X 1ENYA 1WSAA 2OHOA 5AT1A 2WT4A 4KNVA 1LLCA 1P0FA 3BIFA 4L15A 4E4RA 4AY3A 3HU5A 3FMIA 1CY6A 2WWHA 3I8XA 2VZ9A 2ZYHA 3LLVA 1RMTA 3R1IA 2E5WA 3UGTA 4CRWB 1XTRA 1ZWKA 4I7EA 4M1YA 4V24A 1UDAA 4OQNA 1E2BA 5DNCA 1U1FA 3IQWA 4AXXA 1B8OA 3LW8A 1XD8A 2ODWA 3SR0A 1P9OA 5JAOA 3DTTA 1IBCA 3OZGA 2HYDA 1UWCA 2P4HX 1XF1A 4WFKA 3FAZA 3AVTA 2QUZA 2OXTA 3LFHA 3HB4X 5DKFA 5JIBA 3RM3A 4NMWA 1AMNA 1J8YF 3ZWVA 1GGVA 4BFLA 5C8DA 3ZLVA 4C30A 2HF9A 1CUVA 7GPBA 3B7PA 4JLDA 3LH5A 3NGXA 3TSZA 2C78A 4AFNA 3KZOA 1LV7A 3CUWA 2RDMA 4J2HA 3S44A 3RYHA 2AOVA 2JASA 3M9WA 2QE7D 1V1MB 3RVQA 4CV1A 2CV1A 2IUYA 5JJBA 3GFTA 1XZLA 2QI9C 3LCCA 4KQ2A 1I4EB 3SNKA 4BVKA 3KV1A 4BCDA 2AFHB 4LY9A 1LW7A 3O3NB 2W4IA 2ZK7A 4XVHA 5AHWA 5BMVF 1YOVA 2O5RA 3OIUA 1J2UA 3MM4A 3G88A 2CHFA 2F8TA 1Y5IA 3JQBA 4TVBA 1SU4A 3V4SA 5FAKA 4P7KA 2G4LA 3L7IA 5H8WA 2HT6A 5JW6A 5TNXA 3MFQA 4RFSA 5E7JA 3T1HB 2XUIA 4B4OA 1JHMA 3RS2A 2WD8A 3OHPA 3TOXA 1IMOA 3COYA 4QHTA 4JENA 3HBJA 3QE4A 4H27A 1Y7LA 2OEPA 4NPHA 5CDSA 2I9KA 2CVFA 3GH1A 2PL1A 4CQLA 1YZYA 2EXXA 4MEBA 3H5WA 4E5MA 1RBQA 4NE2A 2I76A 4JSYA 1I1OA 5A1TA 2P6UA 2ICAA 3KELA 3SP1A 1G8HA 3ZW7A 2OCAA 4Y2VA 1NPTO 1YQDA 1P7PA 3ROEA 1FTNA 3UC9A 4O59O 3L18A 2REBA 2QUBA 4DLZA 1Q1EA 3A9UA 3ZIDA 1H2BA 1QYDA 2XPCA 3B3AA 3VNBA 5C5DA 1IEWA 1M2OA 1RP1A 2YZ2A 3DTYA 2H1HA 3A70A 4GXTA 4Y8VA 5DNDA 2XNJA 4MP6A 4BMNA 4CR7A 2P2SA 3B1VA 5I9BA 4EUNA 3KOOA 3OF2A 8ADHA 1YRBA 5JLAA 3W79A 4MVJD 3ONNA 5BVGA 5DX8A 1Y7PA 4DCMA 3X43A 5C9ZA 2JLUA 4AY4A 4OHFA 2WTMA 5KNDA 1T5IA 2Q4BA 3QVTA 2KM1A 3WYAA 4QEDA 2WU4A 3BTSA 5ES4B 3N3AC 2BL4A 2I67A 3KXIA 3WK9A 1Y3BE 1E4VA 4OHMA 3L8FA 1D6JA 3CF4A 1P6QA 3A6LA 9LDTA 5COQA 1U6JA 5DM2A 1D2HA 1KEKA 4B3GA 1PFYA 2QJWA 5AKGA 3ELWA 3H19A 3HSSA 1RAAA 1DBVO 1OBCA 2W9XA 2QYTA 3O21A 5KOJB 1LS1A 1GPYA 4KO8A 1Y1KE 1PJ4A 3WZMA 4PLPA 4RZQA 1JHRA 3HUUA 5CVJA 1T0HB 1EGMB 5F7JA 3T4UA 4Z3KA 2BH2A 1XNJA 4QPNA 3OBBA 2DERA 5H3CA 5KKAA 4JELA 3FFBA 1SUPA 5ABPA 5FPHA 4FMCF 4BQOA 2QRVB 4HFMA 1YJCA 1EUQA 1KA9H 2OXRA 3PE3A 2VCHA 3A1FA 4EUHA 1I3OA 5JAQA 3FGZA 3T3NA 3WV4A 1ETUA 3V80A 1LTKA 3GFFA 3PUWA 3SHTA 4BNXA 4DDKA 3S6JA 4F56A 4G67A 4DR7B 5B7PA 2CK3D 2WTEA 3ECCA 1Q12A 3SLKA 1C8KA 2CNLA 3RSLA 3UEOA 3D6NB 4HYYA 1MTZA 2CVOA 2OO5C 3QW4B 1VL1A 1T29A 2B34A 1KGDA 3UQZA 1Z5WA 1YR1A 4C9BA 2ZLBA 1DC8A 1DXYA 3M70A 4GMHA 2PH3A 4MQ6A 1BG6A 2EKPA 3JAKA 2GFIA 1KVQA 1OZ0A 4CM3A 8MHTA 3C3KA 1G6Q1 4K2HA 4XYBA 2BTQA 3V48A 1SVIA 3RYFA 5K05A 2QUJA 1QIGA 1EFHA 2QD1A 2VWPA 4DLKA 3UYLA 4EGFA 2GBLA 4MJXA 1G5HA 5CA0A 1ESDA 2FWBA 1RMQA 2G88A 1HYHA 2BFCB 5AJXA 2R4QA 4AZ0B 5K45A 5JDCA 3S27A 2WIGA 3QIAA 4PZ9A 5CR9A 1FDWA 2ZS7A 4A10A 4QOEA 4WL0A 5K4GA 2MINA 2GKOA 1E3DA 1KORA 4QHYA 4UU7A 1IONA 5LA6A 1WR8A 2X23A 3JZFA 2C3UA 3NTOA 3OEED 1YR9A 4OI0A 4RPKA 3EODA 3DOJA 3MEQA 1ORTA 4CIWA 2VTEA 2YDYA 1T9BA 3B9RA 2Q29A 2B1QA 5BYBA 3IB6A 3M7IA 1Z36A 4FGLA 3WP0A 1U7XA 4EHBA 4IZOA 3IPAA 4ZPJA 1PP4A 3RNOA 4YRKA 1G6OA 1QHYA 3GA5A 3VSEA 3Q9SA 1J0XO 1W0KA 2VTBA 1X42A 4U8GA 5BUCA 2UZ0A 2H7VA 1UM9B 4IIUA 3WR5A 3N28A 1QQTA 2BKXA 3K8ZA 3H6KA 4MHOA 1XMVA 4JXZA 1SCQA 2ZXEA 3KP1A 3M4XA 2IWRA 3PTLA 1RYFA 821PA 1HR0B 1JILA 2F62A 2E4VA 2J9FA 2O23A 2WUDA 2ZJ0A 3C8HA 5CBKA 3HFRA 4H3SA 5CVTA 1J2TA 3V97A 1Y34E 1JHOA 2AN1A 3G17A 4X54A 3T0GA 1V7PC 3AC0A 1W2HA 2GBFA 3C7CB 1T34A 4BN4A 4D4GA 1C50A 2XH8A 1TAGA 3FI9A 4DOMA 2X2EA 4RVNA 2GXSA 3DHNA 3P71T 1SFRA 1MJFA 5JS7A 4HQFA 5KQRA 1GD1O 2VJAA 2WU8A 3N2NA 5LSAA 1EDDA 1L1EA 3UJCA 3FWKA 1QGZA 2HRBA 2WSIA 1YRWA 2B94A 1XRLA 4B7UA 4IOMA 1D7AA 4BJ6A 4TPKA 4CG3A 3EQ9A 3K92A 3M5CA 3PXAA 4RV5A 5ALSA 2R0QC 4OXXA 2F8SA 4QDKA 4UREA 2PMFA 3VXKA 1Y8QA 1E5DA 1RVV1 2WSMA 3COSA 4QIHA 4C43A 2OOSA 3IAFA 4ZGWA 3WLAA 2I3DA 2IXDA 1DO8A 3B5JA 1PV2A 4MWCA 2JJ2A 1ESCA 4EB6A 1TPZA 1QU2A 1S89A 4P3YA 4YS6A 1GDDA 5CFRA 4NEQA 3LKDA 4CEIB 4FR5A 1R8XA 4Z8YA 1JWLA 3EISA 3CN9A 4J6EA 1OMOA 3K35A 4AKIA 4M8KA 1D6SA 2N46A 1X80B 3AEUB 4Y1RA 1NP7A 3IKJA 4W6ZA 4N3BA 2XZLA 3Q2OA 4BN0A 2GYYA 4NYMR 5FADA 2UYGA 1K6JA 3F5FA 1W73A 3F7NA 5D5HA 3IOMA 5GOZA 2OCBA 3WIDA 3VNQA 1A5TA 2WOJA 3W2TA 5KO2A 5T6BA 3IP1A 4DWJA 4A5SA 2AR0A 4XM0A 1NG9A 1I94B 1CZRA 1P5ZB 1RC1A 2JZCA 2C58A 4FN4A 3N8NA 1AF4A 2ONYA 2CFTA 1J0BA 4KN5A 1THZA 5EI5A 3NQ41 1BE6A 2M1ZA 4I1UA 3AV3A 2FH5B 2MSEB 3EVZA 3LYHA 3O5AA 4C0HA 3UHOA 1NR7A 1OWPA 4P98A 1L7OA 1QIIA 2FQYA 4TXJA 1YR6A 5AW7A 5JFGA 3I9OA 1X9HA 1B1CA 2Y71A 3HBMA 4D92A 3H3XA 4F4HA 3WK5A 4E5KA 3IR6A 2OECA 4CMEC 4WLEA 2ESRA 1W87A 2G09A 4DAOA 4UFOA 4OYHA 1VMKA 2QAGC 2VK8A 5EHQA 4Y2QA 1RZRD 2VHYA 2FZWA 1TC2A 3W06A 1MGPA 3B20A 3HKEA 4AJNA 1SPXA 4EUSA 1QRTA 1OOEA 2YRFA 1RFGE 4MGEA 2G6BA 3HM9A 3ADOA 4MYCA 1A5AB 3FNRA 2OXEA 1M5TA 2C88A 1Y3HA 1MC8A 1KJ9A 1N2SA 4LVNA 4NE7A 3ZBTA 2DPMA 1GDTA 4RJLA 5ARBA 4ENUA 1ZBDA 5ERXA 3DOCA 2I66A 1HQDA 4MRVA 3WHKA 1YZTA 4KWCA 3PJDA 5LD2C 3I28A 1J06A 1BGVA 2SKEA 1M1NB 4ZK6A 1RLOA 3W90A 3ND9A 4M9ZA 3IAEA 3VO8A 3ZI4A 2C5FA 5KIAA 4AKEA 4RSRA 1DKQA 4RKRA 4PPYA 3ZDDA 4TLCA 1C0LA 3D1VA 3NBXX 3BFJA 2CLEB 2I9PA 1UT6A 4MEAA 5DTQA 3CC8A 3SBOA 3ZU2A 4YAUA 2ISCA 1EK2A 4S1WA 5FTMA 4BV9A 5BQPA 4C7XA 3TI7A 3DZDA 5IYZA 1YNOA 2PSHA 1JAHA 1CUBA 1SKUA 3IB3A 4J7XA 4WN9A 2FKNA 4DDVA 1O0CA 3VGPA 4TXNA 3TGLA 1W88A 2C94A 3QM1A 5THXA 3TEFA 1YJAA 4CUZA 1FNMA 1ZNYA 5HW0A 1BGWA 3IMEA 4JC5A 3KUCA 3VYSB 4WHMA 3WIEA 2POQX 2O2SA 4IS3A 3VAAA 1HDOA 5CH3A 5GADl 1LXCA 2C2BA 2YASA 4X3OA 6GPBA 4GH5A 4OJNA 3FY4A 1RP7A 4PHGA 3CUSA 3NM4A 4PXYA 2FX2A 1OI4A 2Z04A 4ER6A 4KI7A 3T1NA 2V7TA 2Z4SA 3IDAA 1UJ4A 4PLGA 3WSVA 5HOQA 1KYXA 4YWJA 5KCZA 4C6HA 3K4HA 1Z7WA 2NO7A 3ZD7A 1R0BA 4TYYA 1FTQA 1M6HA 1T6NA 4P4SB 1R6BX 2OENG 4GUAA 4MDHA 1QIDA 4TSKA 2KBFA 2FI1A 3IUPA 5C7IO 4P0QB 1U2ZA 4CKBA 4ZVQA 2Q6OA 3NTXA 3HDGA 1VDZA 3TW0A 1EFVB 3WQSB 5JZ9A 5KHLB 1E2QA 2IZZA 1AZLA 2V7XA 1H2ZA 3IVGA 1QO0A 1OTHA 1UFQA 2F3SA 2P9FA 3G8BA 4N5MA 1EVKA 2WKQA 3LYAA 2X0FA 4E3ZA 4JVLA 1OTYA 1ECCA 2O52A 4A16A 4G09A 1OA1A 5F52A 3S2ZA 2QD4A 3K8YA 4NBKA 2NTJA 5JJ5A 3M1LA 3AIOA 4TMVA 1TTPB 3O84A 4WBNA 5TLSA 4B3HA 2MSCB 3GARA 4L9RA 2HPAA 5K6TA 4Q4DA 4YPFA 3IBGA 1WUYA 2WWTA 3HQ4O 3SE0A 3L0DA 3CUVA 4B6SA 2WHPB 4GLOA 2FJUA 3LPMA 4CL8A 1Y1SA 1BRMA 2R8EA 3MS7A 4YMTA 5J4LA 2OO7A 4DCCA 1N6IA 5SZKB 5LQSA 3MSCA 2VQ3A 3ORSA 3QPWA 1Q1NA 4EPWA 1U2PA 2G7ZA 3P2YA 4J07A 4KTVE 4BGUA 4QJ3A 4OL9A 1BX3A 3HR4A 2JGIA 3U4IA 2QMEA 1MP0A 4QBHA 4UZSA 3SSNA 2AX4A 4N0MA 1HWYA 2VDMB 1UBSB 1Y4AE 4WGGA 3UAGA 3B1KA 3P94A 1HDIA 2EGHA 4QYWA 3O1JC 4KDEA 4MQFB 1BU5A 3WMGA 3VJRA 3D3QA 3AB3A 5K6RA 4MWZA 4DF3A 1ZCFA 1GLVA 1T24A 4P33A 1ENOA 1I3CA 3SJCA 1XPRA 4PFJA 2P79A 4OQZA 1JR3A 2VCEA 4MK4A 5JAMA 1ONBA 1KBZA 1BXRB 3LUDA 1K4KA 3EDCA 4IXTA 3AOGA 4NDZA 5BMVB 1E3MA 4RZ2A 3KJGA 4NYJQ 4D9MA 2W6OA 4FHZA 3GJ5A 1HV8A 4DQDA 3DBRA 2AF3C 1Q83A 5DW0A 4UAGA 2HX1A 4AJ1A 2PZJA 1G9XA 2AFIB 2ZSKA 3BJIC 5FNVB 3HJTA 4LC9A 4AURA 4FFBA 3RS4A 1KJYA 3M6IA 5F7XA 4ZVPA 4I4TA 1KZ9A 1PGJA 3ELDA 4L76A 1V39A 3C0KA 2CDCA 4IPTA 1MFZA 1Z8FA 3S5JA 4WK6A 1ZJZA 5G1NA 1V11A 4P22A 4OGLA 3THSA 2IBSA 1P9RA 4BQQA 3NIFB 1WDMA 4U5QA 4OL0A 3UV3A 4X66B 1PZMA 4FWTA 5DYIA 1T0BA 1V41E 2NO9A 2TMYA 2YYZA 3TBHA 3O9ZA 1T2DA 3FOWA 4RABA 3ZWAA 3AJ8A 2ON6A 4IIBA 4UMVA 1AQJA 3K70B 3SC6A 1I0LA 2GKGA 5B57C 4LHZA 1GVNB 2WKPA 4RTSA 2J09A 4AMZA 2E1RA 3EYWA 2UYHA 3LIPA 3BK2A 3K9CA 3A05A 1N75A 4KOAA 4WW0A 2JJ1A 4X71A 1QGAA 4YP5A 2EJVA 4OI1A 1YOBA 4DTCA 1NKTA 2J3JA 4LF4B 3U5TA 4LQ4A 2IXEA 1BDBA 4JHXA 3SXJA 1BEEA 2UDPA 4JU9A 2ZETA 1O9HA 2WKWA 3Q72A 2QU7A 2KI5A 1PR2A 3G6WA 3GDGA 2C8VA 5CURA 3OT1A 3T1QA 5D5QA 4L7QA 1P60A 3WMXA 3SNHA 3L4BA 1YHNA 3ZU5A 3MBKA 4RD1A 5DCWA 1U2DC 4B3TB 1I1NA 2A9RA 3IEIA 1F5NA 3ZWKA 3OLQA 1U0EA 4BFXA 2QXTA 2AXEA 3I1JA 2GHQA 4Q39A 3TE7A 4J16C 5KC8A 2REQA 2RI6A 4HDNA 4RVGA 4M9SA 2NZ2A 2X9GA 4NCIA 2ZQZA 1CUIA 1IWOA 3WIVA 2IHTA 2QL9A 4B7ZA 3MWJA 4EDHA 5FYQA 3WLNA 3RC8A 2XSZD 1P61B 5EPOA 5IULC 3ZCVA 5EMNA 3WL5A 4HB3A 5AHKA 4H7HA 2B8TA 4IG9A 4D9HA 1OKKD 2BONA 3LBAA 4TT8A 5ERGB 3W5VA 2AR7A 2YJ5A 5BWLA 3HEAA 2YYAA 1G9TA 1KS2A 1AA9A 3T1YB 1ULAA 3IT0A 4D25A 1SCKA 2QGFA 1GN8A 4DM4A 3VR3A 3I39X 4DJTA 3WGJA 1GZSA 2JZOA 1YB5A 4G89A 3GJ8A 2KSQA 3KOWA 3PX2A 4HLQB 4TLBA 5ANRB 1CP3A 2G7MC 2ZUSA 1XALA 2Q5LA 3A4MA 2DHDA 3BH7A 3AERA 4N7RA 2DRIA 2RHWA 2JS7A 2Q6VA 3I4LA 3SZOA 5JPDA 2PLRA 2YZNA 3BB1A 3LOQA 3KZNA 3F0TA 2Q5OA 2B98A 3QE3A 4YALA 1BJRE 2C0QA 2O8EB 1VE1A 2BFCA 1I2CA 2IC5A 2WTNA 3U26A 3U9LA 3V1UA 4BNIA 1XQVA 4OB7A 4KB5A 2W4MA 1DGQA 3AI1A 2CJYA 2LDBA 4G9BA 3T7IA 2XA2A 1C3XA 2EHDA 3Q8XB 3ZY3A 4LZLA 2VUSA 5I7AA 1WXIA 3TNLA 5GJBA 1EINA 1VLHA 1ZCZA 2GCGA 4YV7A 3PFHA 2PZFA 3QPAA 3MHPA 3FLBA 1UP6A 4R2IA 5JNUA 4HHEA 3JARA 2OFXA 1N2EA 4U39A 3B51X 4UJ3A 1HL7A 1ZIYA 1E6MA 3GZ4A 2H0QA 3GLKA 1T0JB 3S2IA 1NFQA 4MVYA 5KKCA 5MFZA 4RY9A 1MEEA 4INOA 3DMTA 4ASUD 4D8VA 4QDUA 4RV9A 4PYMA 4CF3A 3ZCSA 4JUIA 4CMJA 1E1KA 5EWMA 2PNJA 5T8KC 1CFJA 1CJKC 3AUJB 4R2XA 3IVAA 4HH0A 4PVCA 1UKAA 3B1FA 2AUNA 1YACA 1ZONA 1T4GA 3BORA 4NCBA 4BNKA 4BTVA 4EENA 4ER0A 1WXFA 1CP2A 3F3SA 1NG1A 1F6DA 1MH9A 1GFSA 1JPNA 1Z75A 3HN6A 4DSTA 3GUYA 3LPCA 1DG1G 2W6ID 4J43A 4KPUA 5E7MA 2H2IA 2Z30A 2ECFA 3ADPA 2QPOA 3LX6A 3RYHB 2BFAA 4AJJA 1U5BB 4C7MA 2B3DA 3MBOA 1UKBA 1YZFA 2WMNB 3LY8A 4G8DA 2XE4A 3WK4A 3A1UA 1LSOA 4KWEA 4A26A 1JG1A 2WWIA 2WY2D 2D4AA 3NBYC 5TE9A 3EUAA 3NHKA 4ZYYA 5CEJA 1XPUA 2QVLA 4MWGA 2N47A 3PWKA 4WLNA 2HK6A 4RMHA 4KAXA 2FW8A 1Z2NX 4QE3A 1T3HA 1LX6A 1AHIA 4HYTA 3WHIA 1WUJS 1NW6A 1HE5A 2GOYA 2ZR0A 4FYKA 2R00A 4Y18A 4JEMA 5ALYA 4C1NA 5K20A 2H4YA 3EGDA 2RD2A 1W4BA 3OIWA 3QFRA 1QZUA 4YCLA 1QZZA 2AEEA 3DVQX 3T7DA 3EZ2A 5DYNA 3KQVA 4K28A 4C7OB 3QWAA 2J0SA 4Z99A 2J6HA 4GR4A 1OGYA 1QTRA 3C1OA 2KE5A 1XSEA 1EEXB 2AH5A 3GBVA 3GLRA 3DO5A 3WLMA 5BV2P 5CNMA 2WM2A 1LKZA 4DY4A 2HJWA 4L4XA 2PUGA 2EATA 1YI8A 2ZIFA 2AUTA 2ZBRA 4G2TA 3DPUA 5B36A 4QGAA 5D51S 5MDHA 5B1IA 1YZKA 2ZIXA 2ZZNA 1ZW1A 4GX1A 5E6UA 5B58C 4YRGA 3VZPA 4MS3B 2X7JA 1IBLB 1SEPA 1U8XX 1P0MA 1KI7A 2W6PA 4PSKA 5K3AA 4Z6KA 2CV2A 1FNDA 3F4KA 3C74A 4F4FA 3SPXA 4CNQA 3BT7A 1SUBA 3DDNA 4MVJA 4CLHA 1KZ4A 4LJYA 4N8EA 3PPXA 1Q95A 3LHIA 3DDWA 3GDFA 4J1NA 4GRAA 1VKZA 3R9WA 3TDNA 2X8LA 2W11A 1SXIA 1UAYA 2F48A 4K9SA 3KXLA 3GUZA 1M2VA 4MS1A 3RROA 5C4IA 2FF7A 3BMOB 2B61A 4CNBA 1M0TA 3CO0S 1ORDA 1TQ2A 2IK8A 2R2GA 1RAGA 3PICA 4KFUA 4MUJA 3U7JA 3ZTTA 3P27A 4BZXA 2UUPA 2XNCA 3K9NA 1J2EA 1W34A 4RUKA 4L75A 3OM9A 4L8YA 2JFVA 1DOAA 2ZWMA 3JWEA 1S4QA 3RRZA 4J7UA 3ANLA 3U2QA 1AH2A 3GFBA 5JUWA 1CQWA 2DUJA 2Q5CA 3BIWA 3BMQA 4LJ9A 3JQ7B 3WGMA 1RHMA 3G0HA 2WM8A 5JRJA 1YTUA 2QTZA 2VAVA 1U7UA 1H2HA 3LCJA 4IMPA 4OP1A 4QGHA 4LF5B 1ECJA 4JH0A 3INRA 2I2FA 3UK7A 2ZKLA 2WT9A 3JATB 1OUMA 3LVBA 3ORRA 4JOCA 3D3NA 4TL8A 3ZVNA 1ZM9A 2BD0A 4WA7A 5GJCA 2Q99A 4N3NA 4V0RA 1GUZA 5DLEA 3A3KA 4W5QA 4NSNA 4D97A 2AF4C 2WNHA 2K2WA 4X62B 3G9UA 2FMUA 1N1GA 3KIPA 3R0XA 3SVLA 1TTHA 4F6LA 1PT5A 1DC5A 2JIQA 3KZ1E 4L16A 1TEZA 1SXPA 1F3LA 2EG9A 4PCAA 1VHLA 2HLNA 4A6XA 1W581 3ZWYA 3OZWA 3SQMA 4LJRA 1G8KA 2OVFA 3I42A 3G0GA 3WGVA 3CNNA 3CTMA 3JTMA 3FOAA 1TGYA 2VS1A 1PKXA 5HF5A 4BX9A 1HX7A 1YH3A 1WM1A 2EHJA 3VGJA 3HKDA 2FEWB 2XOKA 3F78A 3BCHA 4HUJA 4N0PA 2OXFA 3IMGA 3ETDA 2O14A 3TZQA 3J7AC 3D9QX 5DNAA 1PW5A 4NJMB 5BN1A 1GL3A 1GV1A 1RXEA 1E1QD 1CFZA 2AFIA 2O7VA 2PO7A 3DO8A 5AK0A 3A37A 1KDTA 5FNVA 3BGDA 4H6PA 5KDDA 1QF6A 3ILSA 3QEJA 1ZI6A 3GJSA 1NVTA 4QFCA 2IXTA 5EKSA 3CMMA 3UHPA 3ENNA 3HWRA 3L8DA 4FFWA 1CR0A 1TQHA 1RLMA 3GGCA 3H2IA 5HGXA 3DVRX 1W4CA 5C34B 5LXTF 4QU9A 4FHEA 1UDCA 2IP1A 1HNWB 2DBQA 1TECE 2FK8A 4WESA 1CVLA 1ECFA 3EDYA 2ZRNA 4TSFA 3RIHA 1VXOA 4CETA 1BHQ1 4OIMA 2P2CA 4Z8XA 5K6AA 3W8NA 1CULC 2IYVA 1E1QA 1UUFA 2BJWA 1UODA 3HJAA 4N12A 2ZAYA 3MJEA 3NC1C 1A97A 4NZNA 3CT6A 2R8OA 3IBYA 4H1HA 1F06A 2AWOA 2R9VA 4PZCA 4WY2A 3EPJA 4YP9A 3K1TA 1IRIA 1V37A 2OV2A 4JLWA 2CXHA 3DAYA 2FX5A 3KWLA 2JVJA 2VDOB 3HJCA 5IDXA 3IKTA 3LDAA 3GFGA 3ZWOA 4TVOA 2QGNA 4JLMA 2CYAA 2N0SA 3OT1B 4M53A 4NZ9A 4D41A 4MQ5A 5JJLA 3R4CA 1T8RA 1RWQA 3BJZA 4BNZA 2WPNA 1CERA 3D6MA 2BFFA 3QOXA 2O3TA 5IHXA 1PR6A 2PQ6A 5GM1A 2ECQA 1TIBA 4FILA 4GGOA 2O5EA 1DVRA 4CTJA 4QAJA 4N01A 4L3OA 3K6RA 1N34B 1HLPA 4F3YA 4DWWA 1T9GS 1B3RA 1YT5A 1ZH4A 1X1AA 5JQGA 1GPBA 4DV3B 5AOAA 2QYHA 1L5HB 4E0BA 1RYEA 2ZU6A 4EQ6B 2ZVJA 5I6DA 3QMPA 1E7QA 3SM3A 3GZNB 4NJEB 5DTMA 4PQRA 4NQZA 1JI0A 4I8XA 3D64A 3VU8A 3FDXA 1L5RA 3HR7A 1PLLA 2HEIA 5JXHA 1YB7A 3N2KA 5CLFA 3Q6IA 1KIMA 1XYVA 5K2OA 3EPKA 1RLJA 4WDQA 2PUTA 2O5CA 1NJSA 3I6IA 3CX8A 2E7ZA 1FY2A 2FQXA 2X5OA 3G2MA 1E89A 4FFBB 4PONA 7REQB 1QYRA 1R5OA 1LK7A 4LHEA 2YS7A 4TX1A 4I55B 5FULA 3FWZA 3CU5A 1KY3A 4J8PA 2JAOA 4Z9FA 3RKSA 4ABYA 1Q3TA 1W49A 4G5XA 3U3RA 2H6EA 3VYWA 3KJHA 4GPTA 3WBBA 4G9EA 3G9QA 1N0UA 3L6BA 4PF1A 4QWMA 1YQQA 1I4LD 2QRMA 2X15A 3NHFA 2G1JA 2V7PA 2IPOA 3N9IA 5DDIP 3FMOB 2FG6C 2IIBA 2IVFA 3VO2A 1MA0A 4HDRA 1DIGA 1LFAA 2IHJA 3DQZA 3OSZA 1I4TD 4QUHA 4WASA 3WP1B 2Y1KA 3CVXA 3WLQA 1XVTA 2VK4A 3RTEA 4DQUA 2G0NA 3W5CA 3A4TA 3V8VA 1SIBE 1AO3A 2YJNA 4TVKA 3N0WA 2GEKA 4K05A 1A9SA 2YC2C 5HCUA 4BKUA 1CTQA 5EN4A 3NNSA 4BS9A 4YUZA 1T8WA 1I5EA 3DDOA 3JWPA 1CS0B 1TO6A 2VHVA 3MJFA 5F1PA 2HPZA 3WBJA 4OQPA 4D4IA 4F6RA 3N0RA 4RPGA 4L0DA 1XCJA 2EC5A 1Q50A 1P2SA 3M3HA 4DGSA 1XKTA 5B3JA 2AHRA 5KX5A 5DI3A 5JU6A 1I9GA 2GB4A 4IRMA 1M54A 4C7BA 5JRZA 1LBHA 4QNMA 5BUQA 1IPEA 4FC7A 2R48A 5FAXA 1HF3A 1PNVA 1UKCA 3G6KA 4LDRA 1JW9B 2YQZA 4LYHA 4V2IA 5MHTA 1R4NA 3K8OE 4YT4A 3REQA 3F6SA 3Q3HA 4XDHA 3K72B 5DCLA 4AB1A 4B85A 3C8UA 2I54A 2AOWA 4IV8A 5K2MA 1J7KA 3EOZA 3NU1A 4BU0A 3DYIA 1TW3A 4XEHA 1TF7A 3H5RA 3L2OB 3C3DA 4JYZA 4W5JA 4EGSA 1W5SA 3NIGB 5TMDA 1KP2A 1JTVA 3N2EA 4JKYA 2X4IA 3OPYA 1YCFA 2Z6AA 2H7YA 4N5HX 1Z0ZA 2VBGA 2Q1SA 1NQUA 3B1YA 1UMBA 2B7CA 4RLSA 5CA1A 4BXOA 3OE4A 3A04A 1RRMA 3D81A 3HDVA 1YJQA 4B6FA 5H7XA 1YZHA 3O4GA 3ENQA 4OAOA 2D3TA 4RVCA 1TW2A 1G2OA 1V6SA 4ZI5A 4EHHA 2EFEB 6Q21A 3UJNA 3CLSD 2DFNA 5CM9C 1WZEA 2GTIA 3PSHA 2Z57A 2VHEA 1YRAA 3HI4A 3I83A 4QZVA 3MWKA 2FN8A 2V6IA 3ICEA 1XZNA 3GWZA 4G9GA 4FGSA 2AFHA 2HD4A 4S12A 3KHSA 3GBSA 2ZIVB 3PDJA 1I3MA 1HETA 4GX5A 3TJRA 5CCXA 1J6UA 4PHHA 3KLPX 1IG3A 2C2MA 3H1TA 3N05A 1UKEA 1O03A 1P91A 2IP2A 3PC2A 4BWGA 4CLOA 5LP6F 5JVDF 3KKLA 4XPIA 5LZ9A 3CVWA 4PNZA 2UXCB 4CT0A 1BWRA 3D6VA 4M0KA 3WLEA 2C4HA 3SZLA 4DV4B 2UYOA 1E7MA 3FIJA 3BMNA 1C3EA 3C3MA 3IDZA 4TTSA 1HDYA 2OCPA 1JB1A 2GASA 2H2HA 5EC8A 4R41A 1N4AA 4B4UA 1RI1A 4ZZ2A 1R4MA 1RRGA 2P41A 4F6RB 1FRQA 4KP7A 2Y2UA 4LTMA 1UOQA 1QVRA 2PZKA 4HAIA 4J4TA 3STTA 1SKMA 4MIKA 1F7UA 1EE1A 1P5HA 4PN3A 1T5BA 4ESVA 1OB5A 4LWOA 1QWOA 3PHGA 4N5IX 4RQUA 4CI9A 4GLBA 1DMSA 5IANA 1A8UA 1K5GA 1QNFA 2CEKA 1TK9A 1CZLA 1KEWA 2EZ9A 3AM5A 4HUQA 5EJGA 4DADA 3