3GIWA

Crystal structure of a duf574 family protein (sav_2177) from streptomyces avermitilis ma-4680 at 1.45 a resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
262
structure length
262
Chain Sequence
RIDTESAHSARIYDYIIGGKDYYPADKEAGDAMSREWPALPVHMRANRDWMNRAVAHLAKEAGIRQFLDIGTGIPTSPNLHEIAQSVAPESRVVYVDNDPIVLTLSQGLLASTPEGRTAYVEADMLDPASILDAPELRDTLDLTRPVALTVIAIVHFVLDEDDAVGIVRRLLEPLPSGSYLAMSIGTAEFAPQEVGRVAREYAARNMPMRLRTHAEAEEFFEGLELVEPGIVQVHKWHPDAATADGIRDEDIAMYGAVARKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein of unknown function DUF574
publication title Crystal structure of Rossmann-fold protein of unknown function (DUF574) (NP_823353.1) from Streptomyces avermitilis MA-4680 at 1.45 A resolution
rcsb
source organism Streptomyces avermitilis
molecule tags Unknown function
total genus 84
structure length 262
sequence length 262
ec nomenclature
pdb deposition date 2009-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04672 Methyltransf_19 S-adenosyl methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3giwA00
2UYOA 2HTEA 3A25A 1R00A 1YUBA 4EVIA 4AX8A 3KQVA 2UYHA 1KPGA 2DULA 1NW6A 5DWQA 2PVCA 4HSGA 3TM4A 3LGAA 2B78A 4KDRA 5K01A 2B2CA 2XVAA 2GS9A 3SR4A 4AZTA 3KQMA 2P1DA 3CKKA 3PFHA 2PWYA 4QPPA 5EMLA 5EEGA 5FWDA 3EVBA 3MERA 3DMFA 3DMGA 4MQ4A 3IV6A 5HEKA 4DCMA 4E2WA 2R6ZA 1EJ0A 3OU6A 5D1NA 4WVLA 3TMAA 5DT2A 3EVAA 4O29A 4ZTBA 3LECA 3UA3A 4AZSA 4C03A 3CVOA 4BLUA 3E23A 3P9NA 5HOQA 2NXCA 4LG1A 2N47A 3I64A 1YFJA 1G6Q1 5BXYA 1L3IA 1QAMA 4X60A 1WXWA 1XDSA 4OBWA 2G70A 3DH0A 5E2AA 3DXYA 3TKYA 2BR3A 3BWYA 5EOVA 4HRAA 4Y2HA 2HV9A 3ID6C 3JWIA 5BW4A 3M6VA 2PGXA 5GOZA 1BHJA 5F2KA 2IPXA 2YTZA 3X0DA 1KXZA 2PWPA 3E05A 1IM8A 5E2BA 5FCDA 1QYRA 4PINA 5DX0A 1SUIA 1IXKA 4K6MA 3B3JA 3R6TA 3AJDA 3A26A 3PB3A 4E70A 1YFLA 3BGDA 7MHTA 1WG8A 2BH2A 1F38A 2ERCA 3AXSA 3NVMB 1YF3A 1B42A 2FK8A 3GRRA 1G55A 3MCZA 4CXMA 3O4FA 4LECA 4PCAA 2YXDA 1NW8A 4DMGA 1HNNA 1U2ZA 3JWGA 2OXTA 2NP6A 5E9JA 3P97A 5EZQA 3LHDA 3SM3A 4YMGA 3P8ZA 4YV2A 3EPPA 3NWEA 1ZG3A 4M36A 10MHA 1BOOA 2B9EA 5CIYA 1RJEA 4FT4A 1DL5A 3ORHA 1JQ3A 5EIFA 3OCJA 3DUWA 2PX4A 4WXHA 3VC1A 2AVDA 3D2LA 1X1AA 3KPWA 4AUKA 1YZHA 4P7KA 5T64A 1ZHFA 3EGVA 5HZMA 3KR9A 1EJ6A 4DA4A 3UJDA 1Z3CA 5DX8A 3MHTA 2IGTA 4PWYA 2PX2A 1WZNA 1QZZA 1ORIA 1WY7A 1KYWA 3C6MA 3B3FA 2I7CA 3BGIA 3LCUA 3OZSA 4PGHA 1FPQA 2PT9A 5EIWA 1M6EX 2JJQA 2OKCA 3M6UA 3NTVA 3WSTA 5ICGA 2C7OA 4YMHA 2PX8A 2WK1A 3TKAA 4OA5A 3IYLW 4F84A 4CKCA 1AQJA 2Y1XA 3NWBA 2V74B 1RI5A 4ER6A 1INLA 3I9FA 3PVCA 4IKPA 3DP7A 2PV0A 1P1BA 3ME5A 5LQAA 3KQTA 3MTEA 2UZ4A 2FRXA 1QAOA 3M4XA 5CVVA 3LCCA 1YB2A 5LR6A 1M6YA 3A4TA 3HCDA 1P39A 3H2BA 5HFJA 1VBFA 4C06A 3G2PA 1EQAA 3QOXA 4HGYA 3CJTA 3AWIA 4HH4A 2AR0A 4RTJA 1F3LA 3KQSA 2EFJA 1KPIA 1XTPA 3G88A 4ISCA 3C6KA 1JTFA 2O06A 1P91A 3R24A 5IH3A 2XVMA 2YR0A 4PGGA 1Y8CA 3G8BA 2GH1A 2ZBRA 5DPMA 5GM1A 2BZGA 5KVAA 4FR0A 1L1EA 2Y1WA 3MTIA 3B5IA 1O9GA 3S68A 5CUQA 2WA1A 1G38A 4U7TB 3BT7A 3SVZA 3BWBA 2UYCA 3ER8A 4AZVA 4GOMD 4QTTB 5E1BA 1PJZA 4CTJA 4EKGA 5HIMA 5K0JA 2AVNA 1V39A 3NMUF 4GBED 3ELDA 4Y30A 4PYOA 5EVJA 2FK7A 3BWMA 5ERGB 1MJFA 2ZZKA 3ER9A 1JQDA 3BKXA 3F4KA 5DTQA 3TFWA 2HMYB 1JG2A 3GXOA 3BUSA 5FHQA 4RTNA 2XYRA 1NKVA 1MHTA 3HCAA 5K0GA 3GIWA 3UJ6A 3C0KA 3KR0A 1ZGJA 1NW3A 5T67A 4CWAA 3PX3A 4ER5A 2ORED 4YUVA 4X1OA 4HC4A 2ZCJA 1WS6A 2CWWA 2B25A 2IDKA 1Q0SA 2E5WA 2H11A 5GIPE 2IH2A 4M38A 5GIOE 3LDFA 3K6RA 3LL7A 2GPYA 2QRVA 5EPEA 4DKJA 4UOEA 5LSAA 2ONYA 2IH5A 2GLUA 3DLIA 3HA7A 1RJGA 2OPBA 3G2OA 3LDGA 4MTLA 5LQJA 1VLMA 3HNRA 3BGVA 3TQSA 4PYNA 2FCAA 4KW7A 4L7VA 3FZGA 5K8VA 1H1DA 4MWZA 2FHPA 5DRTA 5IKMA 3JWHA 4XUCA 4A6EA 4E2ZA 3REOA 5KYGA 3BKWA 1RI3A 3SSOA 5E8RA 3KR1A 2JHCA 4RVFA 2AOTA 3L8DA 2PJDA 3FYDA 1VPTA 3FPFA 4GOOD 1XCJA 2PT6A 2ZBPA 3THRA 2Z6QA 2JH8A 3R0QA 2YVLA 2YX1A 2EJTA 4C05A 4DCGA 3LX6A 5EMJA 4FT2A 5CCXA 1R18A 5DXAA 3KR2A 3GRYA 2IDJA 2IBSA 2PBFA 3KU1A 4GEKA 2DPMA 4KRGA 5K0EA 4RVGA 8MHTA 2BM9A 4GC9A 2XYQA 3LBYA 2CL5A 3EVZA 2PY6A 3TRKA 5LQCA 2P3QA 3MAGA 4P7GA 3LSTA 4C04A 5EGSA 3TLJA 2P3LA 1JR4A 2EX4A 3UJCA 2AOXA 1L3CA 2P7IA 3GO4A 4QQNA 3EVDA 4GC5A 4X63A 3EMDA 2AOUA 2QRVB 5K0FA 3UWPA 5GINE 2I9KA 1XJ5A 3HCFA 1T43A 3OFJA 2ZIFA 5K0LA 4OA8A 4E2XA 4QDJA 3HVIA 3IHTA 3OZRA 3UJ8A 4IV0A 3DOUA 4CKEA 5KQSA 3CJRA 3E8SA 1QAQA 3FUUA 2Q41A 2ZW9A 3G89A 1VIDA 2F8LA 2PXCA 4V0RA 5DSTA 1SQGA 3GCZA 1FJXA 1SVUA 4B17A 4E33A 4GQBA 3I5UA 2XYVA 1ZKDA 2NXEA 2YXEA 3NW9A 3QOWA 3R3HA 1IY9A 3OU7A 3T7RA 2AOTB 3OPNA 1N7JA 1G8AA 3CBGA 5HILA 5K03A 3ELWA 3P71T 3KPYA 1UFKA 4X41A 2ESRA 5DX1A 2BR4A 2OYRA 1VE3A 3OU2A 4PYJA 1EIZA 1VP3A 3HCBA 3NDIA 3KKZA 4E2YA 3G2QA 1O9HA 5BP7A 5EMMA 1D2CA 2PXXA 3DTNA 5EG5A 3MB5A 2VDVE 3FPEA 5E1MA 3OFKA 2C7QA 2ADMA 4U7PB 2P8JA 5CM2Z 2PX5A 5T6BA 3SSMA 2JHAA 4P58A 5MHTA 5FA8A 4GUAA 5ICCA 5EKXA 2G8NA 1SQFA 4YUXA 4RTQA 2OY0A 3EVFA 5EQJB 2GAFA 5K09A 4JXJA 4DM3A 3M6XA 2ZFUA 2O57A 1RJDA 3M70A 2AOUB 4FSXA 3P9KA 1BKYA 4PIMA 4RVDA 1SUSA 4KVZA 1JSZA 4KIGA 3AY0A 4RTPA 4RTKA 2G1PA 2ZZMA 5LQRA 3M6WA 4RSRA 4E32A 1AF7A 2ZSUA 5E1OA 3A27A 4GOLD 5FHRA 3GGDA 5GWXA 1NV8A 5EEHA 3LKZA 3LBFA 5BW5A 2VDWA 1NT2A 2NXJA 3FRHA 3UFBA 3MCTA 3TM5A 5K0NA 4YUWA 3FTCA 3HA3A 4BLVA 3CCFA 3BWCA 3PX2A 1I4WA 3TPZA 2OO3A 4PCLA 3O31A 2LD4A 2H00A 2JH9A 1N7IA 3HA5A 3HEMA 5G02A 3Q87B 4F85A 5HIKA 1BC5A 5E9WA 2ONZA 2ZTHA 4IV8A 3M33A 3GDHA 5JUWA 5H02A 2P35A 1DUSA 4QQKA 3CC8A 5CVDA 4QTUB 4KDCA 3FUVA 1XVAA 1NBIA 3T7SA 1X19A 2H1RA 1N2XA 2IP2A 4ER3A 1D2HA 3LDUA 1UIRA 3C3PA 1NE2A 5HIJA 1KYZA 3THSA 5FWAA 5P8WA 2VS1A 2AZTA 5FQOA 3GNLA 2V7EA 4ATNA 3FPJA 1PRYA 2I6GA 4RTSA 3G5LA 3HVJA 3DXXA 2JG3A 1EAMA 4FZVA 1RI2A 4RTOA 4KWCA 1TW3A 3P9CA 1JTEA 2B3TA 3DMHA 3DXZA 3ELUA 2GA9A 5JR3A 2IH4A 3PLAE 2AOVA 2G72A 1R8XA 1JG4A 4BP3A 1VQ1A 2YQZA 3NJRA 1VL5A 4IWNA 4P7FA 4R8RA 1FP1D 3EVGA 5GP1A 5LQUA 2OB2A 3HVHA 3EEYA 5EZSA 3T7TA 9MHTA 2ZWAA 4RTLA 2PSSA 4QPNA 5C1IA 1X1BA 3UZUA 2JHPA 4BLWA 4EMSA 3LKDA 3HTXA 1D2GA 1JSXA 2OB1A 2YXLA 4H0NA 5ICFA 1KHHA 3CJQA 3EVEA 1AV6A 3EMBA 3KQQA 2O0LA 3VSEA 2O07A 5FTWA 2A14A 2PXAA 1ZGAA 2ZLBA 2YUIA 5K0CA 4PIPA 4MIKA 3P9IA 1L9KA 3DLCA 2P41A 3OZTA 4GF5A 3EVCA 4PONA 4PYMA 4YUZA 1L3BA 5D1HA 1KIAA 2ZBQA 2VZ9A 4V0QA 4QVGA 1JQEA 3FYCA 4OQDA 4PYKA 3FTDA 3SXJA 3FTFA 3V97A 4CKBA 1XDUA 4QVKA 4XCXA 3FPGA 4FP9A 4CTKA 3NVKI 2HWKA 2C7PA 1X1DA 4FGZA 2AOWA 3NDJA 3PFGA 4M37A 5C9ZA 4POOA 3FUTA 4OX9Y 3EGIA 4YUYA 2ZIEA 3KPUA 2IIPA 4GOND 1XCLA 1WXXA 3PS9A 2FPOA 5HIIA 5FQNA 5CVEA 2VP3A 1SG9A 5E9QA 4C08A 3HCEA 1TPYA 5CVUA 3FUXA 3UJ7A 3BZBA 4EQZA 3P2KA 3ELYA 3T0IA 3TR6A 3UA4A 4RTMA 3U81A 1VP9A 2NXNA 2AN4A 3HM2A 3HVKA 3DR5A 3LPMA 5FUBA 1I1NA 3AXTA 3PT9A 5FADA 3HCCA 2AS0A 4R6WA 2ZWVA 4RV9A 4RVHA 4XUDA 5CVJA 3UBTA 2WA2A 4E30A 3DULA 2K4MA 2NNWB 3KQYA 4PYQA 4EKIA 2ZZNA 3RW9A 2I62A 4PNEA 3PTAA 3G7UA 1R8YA 4PYIA 4LWOA 5U4XA 3K0BA 1P1CA 2OBFA 1FP2A 1KR5A 3FRIA 5DM1A 5KS2A 4QDKA 1M0EA 1XDZA 2IBTA 1OR8A 1TW2A 3GWZA 4G56A 5F2OA 5EHIA 2QYOA 5DM2A 4C4AA 1FBNA 3CGGA 3G2MA 1EG2A 3LCVB 3I58A 4HTFA 3SGLA 4RTRA 2G71A 2CMGA 4RX1A 2FYTA 2BM8A 3VC2A 3SSNA 3EGEA 4KIFA 2BR5A 3V8VA 5DM4A 1KPHA 2P40A 3I53A 3TOSA 5F2NA 5ICEA 3A7DA 3SMQA 4MHTA 4M7RA 4RWZA 5DTRA 3FUWA 2VDUE 5K0BA 4DQ0A 5LQKA 4OBXA 1NBHA 2ZVJA 2AN5A 3KPVA 1R6AA 3B7PA 5LQNA 3O7WA 1UWVA 1ORHA 2EG5A 4BY9E 2CKDA 1ZQ9A 4BP1A 1HMYA 3A7EA 3SX0A 3VYWA 1QANA 1NV9A 2AN3A 3BXOA 3OE5A 1XXLA 3HP7A 4YV0A 4PYLA 4DF3A 3C3YA 3G5TA 2C7RA 4HGZA 1O54A 2UYQA 2Z6UA 3Q7EA 5E1DA 4FSDA 3MQ2A 2ZIGA 2OZVA 4ER7A 3GRUA 5K05A 2QE6A 2QY6A 3EEOA 3ERCA 5EC8A 3OE4A 1Q0TA 5CCBA 1JG3A 5DTMA 1R74A 4R05A 3R9XB 3RIEA 5KQRA 1NW7A 1KP9A 1I9GA 2NP7A 1G60A 4AZWA 2HNKA 5EHGA 5C0OE 1DCTA 1YZ3A 3P2EA 4HTFB 5DXJA 1SKMA 3MGGA 4C07A 2P3OA 4Z2YA 2O05A 5EKUA 5CD1A 4F86A 5DRYA 3FPHA 4P7JA 2CMHA 2R3SA 3KQPA 3UJAA 3GJYA 4ER0A 5EMKA 4DZRA 2GB4A 2ZULA 4YV1A 3KQOA 5E8JA 3ANXA 3B3GA 3UJ9A 4E31A 1G8SA 2Z6AA 5FA5A 4R8SA 5FULA 4A6DA 5M5BA 3B89A 3UJBA 2XBMA 4RYLA 3P2IA 4R6XA 2HR1A 2PKWA 1X1CA 4LWPA 4XUEA 3RODA 3GRZA 1AQIA 2EJUA 3JWJA 3KHKA 3GU3A 5DLYA 1RI1A 5DSXA 4EK9A 3FTEA 3KPJA 5GM2A 3KQWA 3IEIA 4NECA 4OQEA 3E7PA 2PLWA 1JG1A 1NW5A 2QM3A 3G8AA 4FS8A 3QV2A 4X61A 2NYUA 1RI4A 3GRVA 1RJFA 5DM0A 2KW5A 2P7HA 5B1SA 2IFTA 4HG2A
chains in the Genus database with same CATH superfamily
3A25A 1OLUB 1W4LA 4W6ZA 4YJ3F 5F1KA 3TLKA 3Q12A 1ZA2A 4UMEA 3GC6A 3ZJYA 4EVIA 1BDMA 3NHSA 4N9QA 2CJFA 3B53X 4V0KA 5DNDA 4CW7A 3RKUA 3NV7A 3P0IA 1EQ2A 4YIHA 4L4UA 3GNQA 3AVWA 3IT3A 3BYZA 3KQMA 1NJFA 2PWYA 3QUSA 5L95A 4PR0A 4B3XA 2GPTA 2EXXA 2P2LA 3IV6A 1ORTA 1Z0SA 4IDOA 3OIVA 4QJ4A 5ALGA 4E2WA 1N2BA 2WHPA 5BR4A 2Q1WA 1IULA 1VIVA 5I7HA 4FX5A 2G82A 4B7XA 4C03A 2AV6A 3STUA 4BLUA 1JHMA 5FOVA 3NVDA 1QOPB 1YFJA 4UD6A 2VZEA 3GA5A 4N82A 3M2TA 4QQ8A 3DA8A 3ZGNA 2IYPA 1KDOA 2QZPA 1KO5A 3DH0A 3JYOA 5AVJA 4ZI2A 1OT5A 6Q21A 3OQMA 1QCZA 2CFOA 4KXQA 3OC0A 1MA3A 2WIKA 1D3AA 2G0NA 3DZHA 3EY9A 1DEAA 4BVAA 3FMPB 3IHLA 2CXQA 4CL8A 4CG2A 5F1PA 3Q8KA 1GFZA 4N54A 4BVEA 2I2BA 2Y71A 4N9WA 1JDBC 1YZGA 1MPTA 4DUZB 1OI7A 3EGOA 4KV7A 2R4UA 1F38A 1CW2B 2WJZB 1KBQA 3OPYI 4LVOA 2GM5A 1NQOA 4YACA 4HQLA 4YYZA 4I8IA 1HNNA 2QVZX 2PA0A 3TUJC 5J1TB 1OYWA 1X8JA 2GJSA 5DH9A 2FE1A 1ECBA 1RC0A 5EZQA 5IC4A 2I5PO 4NDAA 4OG2A 4O0LA 1ZS9A 3OTHA 1ZI6A 1QZTA 1IY2A 4O1HA 4TSKA 4JI5B 2UDPA 5CB6A 2V54A 4QIHA 2OPHA 2YMMA 2EQBA 3WIVA 1VPLA 3FYUC 4MR8A 2OGZA 3ABSB 2ZJ1A 3C3XA 3DE2X 4TKUB 4Y2GA 3PNLA 4WN9B 4D9JA 4EHDA 3TLGA 5LP6B 3F6BX 4KXXA 1OILA 2IEGA 4V0SA 2VJMA 3KT0A 2MSCB 2G6BA 4MKFA 2WIGA 3C6MA 5JY6A 5CRIA 3I5AA 4RH3A 2LGJA 4A8PA 3WSTA 2W58A 3GEDA 5H83A 2XKBA 4GKVA 5DE3A 1K5GA 3TQCA 5JE8A 1K75A 5ED4A 3H3XA 4HRVA 3NCTA 3RJ5A 1RPAA 3AEUB 1ZN9A 3O1HB 3I0ZA 4WRRA 4AULA 2HF8A 3FWZA 4BO4A 3WICA 3IR6A 2I99A 2V6MA 1IY8A 2V74B 2P9CA 1CY8A 1WAMA 2FEKA 3ME5A 2XF2A 2A33A 2VOEA 2V6JA 3MTEA 2FRXA 2OKGA 2OXRA 2OYSA 2ZBFA 3KT8A 4J0KA 2IV7A 1YIOA 5CDFE 3O75A 1MV5A 3WYFA 2BFMA 4RA6A 1P39A 1YI0A 3R5JA 1PFWA 1YS2X 3HL0A 4JK3A 4Z0PA 5T5QA 3UMSA 5JHGB 2Q4RA 3CA8A 3ED1A 3OT5A 2AR0A 4F4UA 1F3LA 4QUKA 1T5OA 1ODTC 1ULAA 4MINA 1RQLA 2E1RA 2YY6A 2PMEA 4YONB 1X2EA 3ANSA 5GONF 4P0PB 5AW0A 1R0BA 1TYEB 1I30A 3BICA 3G8BA 221PA 1WQ3A 2BZGA 2HMSA 2V7WA 4GZ6A 2W22A 3DT6A 3I72A 2V5UA 3MS7A 1IWOA 2WFMA 3S68A 4JY7A 4D3ZA 1XHFA 2P5SA 3JVEA 4D42A 2QYHA 1E3WB 2UYCA 1LBTA 1Q7GA 3GJXC 4AZVA 1QIEA 2LNDA 4FI3F 1FDTA 5HIMA 3D8TA 4EY4A 5CEFA 2ZQZA 2WD9A 1ZVVA 4JP3A 5A04A 1VKRA 5FR1A 4ZZ3A 3FCXA 2H3EA 4XDZA 3U4DA 2FMTA 4E5PA 2GAJA 1XP5A 1Q22A 3A4MA 4AO7A 3WLRA 1EWVA 4ACBA 4BVHA 3H2GA 2F64A 1A9XA 4ZO9A 3OEEA 1XBTA 2QL5A 3CZ9A 3D81A 4PZDA 3WWEA 5JZBA 2I3GA 1EUQA 1JJ7A 1DKMA 1SVLA 2Y1DA 4FGLA 4JH0A 4RMHA 4Y2UA 3M82A 4RA9A 5IKEA 1FFEA 3TLXA 3ETJA 1FX1A 4FCWA 1LPNA 5C4GB 2FN4A 5H70A 3REQA 2DF8A 5AJZA 1IC6A 4M38A 1JA0A 4BO7A 5EPEA 2ZI9A 1X7YA 2DVMA 1XRNA 1YJXA 3GA7A 4E6EA 1M76A 3OIFA 3RU3A 1POWA 1C7EA 1CJCA 2GJ4A 3HU3A 1KIFA 1AKEA 1YULA 4M9RA 4CQNA 1V25A 3IODA 1J2RA 1T1SA 5IFKA 3P0RA 1W2WB 5FR2A 4DM4A 1K68A 1XZIA 4KMOA 2ZYWX 4DLTA 5BUCA 2B5OA 1PR4A 1ECCA 5E38A 2Y1OA 2WHEA 4LPSA 4HLUC 3G8DA 3V34A 1SZJG 3VRHA 3FYDA 4GOOD 4LZZA 1YVRA 4YAIA 1ZX1A 3AO0B 2C04A 4FYVA 4IMJB 5T3UA 1WM1A 4HLCA 2YVLA 4Y2XA 1PJ3A 1WPQA 1UBTS 2D1TA 1OGIA 4KGXA 1NC1A 1X3SA 1E79D 2IW3A 2ODBA 3SF8B 2WYIA 3GN2A 1Z4KA 3ET5A 1DCKA 1R4AA 4J1QA 2O7VA 4A2CA 5DM60 3GLIA 4PSUA 3IOMA 3BMOB 4RENA 2OC9A 2P3QA 3HUFA 3LSTA 1NAHA 5NULA 5JQGF 1COWD 1DC4A 4ZQFA 4QT4A 1RM0A 2PRJA 5HKAA 3H8WA 1CRQA 3K9HA 7ABPA 3Q3CA 4Q7KA 1DINA 1PTJC 3WGUA 3DDCA 1RBMA 3ZU4A 1QDLB 2NUPB 3F74A 2ECQA 4UHFA 1XZHA 4R8KA 3UJ8A 5JCJD 3IO5A 1E3MA 4UHBA 2ZBGA 4D9GA 4QXRA 4XXHA 3ACCA 1J0CA 3T15A 3V2HA 1K86A 1P61B 3L06A 4R40A 1PO7A 3CLUC 5DYWA 3ESAA 3JQ7A 3ORRA 2OGSA 2PX0A 1IY9A 1R66A 3KAJA 3KOMA 2Q1UA 2UZ0A 3CUWA 3OPNA 3OU7A 3ACBA 4L2IA 5ECWA 3HZZA 4QOGA 3X1JA 2CYAA 2ESRA 1VJ5A 4QTZA 2XVZA 3HRIA 3LY8A 4U3JB 3VVBA 4HXEB 1ZIYA 3L8CA 4DC1A 4F1WA 1M9NA 1FYXA 2IU0A 1US8A 3X1KA 3K9GA 1AQJA 4CI0B 2ZRPA 5TQ2A 1LZKA 4RMJA 2CVZA 2P8JA 3ECAA 4IHAA 3U17A 4FMDF 4E07A 5JZVA 3HKDA 4L5CA 1IPEA 1U8UA 1ZVKA 3GRAA 3IP6A 3GDFA 3PZRA 1PK7A 1FRFS 4BJHB 4C0QC 4OAPA 3BFVA 4D8VA 5C51B 1Y1PA 3DFKA 1V8PA 4UE3S 3IEMA 4MARA 3LHFA 5CXSA 1VRCA 1R9MA 3H0KA 3OKAA 4KR0A 3K9QO 5IHXA 5JEDA 3QH4A 2HKIA 1RXWA 5DK6A 4PIMA 3U60B 4MDFA 2QLMA 4NBSA 5DULA 1M5UA 3FNIA 5DHSA 3AF2A 4MR9A 1K5HA 3O84A 4PCVA 1Z2OX 3VUFA 1D6SA 4RWEA 4NJMB 3TG2A 3KKOA 4FFLA 2PUBA 3LV8A 4D45A 4N3AA 4RANA 1BXRA 2EIHA 3R23A 4HX2A 3FRHA 1IHUA 4YUWA 3L7JA 2V6FA 1AKYA 3UV7A 2ZUWA 1G7CA 1K1EA 2M6KA 3PEWA 4DNQA 1KVSA 1KOGA 1SBTA 4DGQA 2ORIA 4NU6A 1B43A 1AN0A 1N7IA 1H2YA 5HIKA 2EOAA 4LC9A 2CL0X 4D3YA 3FPSA 3GDHA 3NCHA 1RFLA 1VZ3A 1BFKA 3C8MA 4PNPA 4WQMA 3VPDA 3R4CA 4B75A 1MB0A 1UMCB 3KKMA 1CZLA 2HFJA 2HPVA 2P0EA 4QPJC 4QXPA 4UCQA 3DDSA 1NF2A 2BKUA 2JFUA 4O4LB 3YASA 1U81A 1ORDA 2QRHA 3UQZA 3DE5X 4I99A 4JGBA 3T3HA 1MUUA 2BP7B 2ZREA 4J0HA 1JE0A 1USVA 3P2MA 5AM0A 3E2IA 3QBEA 2QUBA 4OXQA 1GCUA 2CNKA 3ZHOA 4RORA 3PQ8A 4QUJA 3GP3A 4ML3A 3TJZA 4B84A 3L7OA 1WU8A 4H7FA 4CMIB 2JG3A 3BC1A 4S1OA 1ZOSA 1NWCA 3ZIAA 4N6GA 1NURA 1JRLA 3HEAA 4L4XA 5AMXA 1LSJA 2Q5FA 3VQTA 1SU6A 3V4SA 1YIAA 5I8WA 2AEJA 4ZDKA 2JIMA 4MUJA 3QEJA 2J6HA 5AP9A 2F4VB 1J5XA 4QC2A 5KVQA 4CG1A 4EHNA 3K05A 1JWBB 4FR2A 2OCXA 3DZBA 3PBKA 5ALHA 4W5QA 2AFIB 4B2LA 4BNHA 3P0FA 2EYQA 1CJBA 2YW9A 4Z7JA 5LWHA 3GIDA 4PZLA 2O0LA 2HCFA 5FTWA 1C2YA 3A9CA 5KBYA 3AB8A 2DAPA 5J4HA 4HN2A 1MIOA 2BHNA 1FZTA 3N6RA 3P9IA 4OQYA 4I50B 2Y05A 4WDQA 2CJYA 2R96A 2AXPA 2GNAA 3A31A 3V1YA 4DA6A 1E2NA 2VAVA 4ESOA 1N3YA 1UZNA 4XYLA 4V03A 2X3UA 3V4ZA 1XZ8A 2BZSA 3DKKA 5AKYA 1GSIA 1XT6A 4ANFA 3SQWA 1Z6TA 2PRZA 3AEKB 5HUJA 4GGMX 4LOKA 4G8CA 2HWKA 2QB5A 4WESB 3UJ3X 3ZU5A 5HOEA 3E22B 1SULA 6AT1A 1I7PA 4BP9A 2HOQA 2R1VA 4Z1MD 1XEXB 2B5VA 3ORFA 4Y9SA 4FSHA 4IHJA 4J3NA 3ROFA 4BWYA 5EXTA 2NVUA 3TR5A 2AIRA 1G16A 2HT6A 4BBZA 5FFNA 4PR3A 1HDRA 1NXXA 4YDSA 1UIMA 3HUTA 4OMUA 2J7PA 3GGPA 1NIJA 5HX7A 1XNHA 4GI3A 2QL7A 3HY3A 1G98A 3QBJA 4KMRA 3ZDQA 5EPUA 1SIUA 1I5OA 2B8EA 1KZYC 4X7PA 4DMRA 1VP9A 2FPGA 1UDBA 3UMYA 1OH7A 3FTQA 3BWXA 4H0FA 3TW8B 1ECFA 4PLZA 1WCIB 3ONVA 1QP7A 4XCVA 3U6KA 3WK5A 2DHQA 4Q1CA 1Z74A 1P0PA 2PZKA 1G41A 3M1LA 4MA5A 1ZYUA 3MT0A 3VKUA 4MUIA 3WQRA 4PNEA 3PTAA 1B8OA 1R6BX 2VHXA 1VJRA 4L8VA 4W5RA 3RG8A 4PYIA 5FHRA 4U9HS 5L6LB 4IGEA 3L0SA 4CKBB 3MVEA 2HT1A 3CZAA 2JH3A 5EHIA 1WBBA 4OUDA 5EJ8A 5SV2A 5BOVA 3VNUA 1N2SA 2DJ5A 2GCOA 4FOOA 3ZCUA 8ATCA 1HDXA 1ZJ6A 2C94A 2J5KA 1FU7A 2RGNC 2X6RA 1CUDA 3L6EA 3L8GA 5T7BA 2X2PA 1HQKA 3BSFA 2WY2D 5BRNA 2Z1DA 1J0AA 1T9KA 3IPLA 2P75A 4Q3LA 3I53A 1XTZA 4X1YB 4BL5A 5ICEA 3AVVA 4M7OA 1P2DA 4G9GA 1OBHA 3T1NA 1F0NA 4CYMA 2W2MA 3ENVA 1TK3A 5K0BA 5MDHA 1SQ6A 3SC6A 1J56A 2AN5A 3W6ZA 1J9ZA 5KQMA 5LQNA 4UTVA 4YQZA 3NHUA 1G20E 3LX5A 2Z2JA 4TKZA 2DHRA 1VRWA 2B30A 5BSHA 2C0PA 3H18A 3NIGB 2XV1A 1P1FA 1JL3A 2HZ7A 1KQGA 5EJ5A 4U9IS 2W6OA 3ICCA 3MJTA 3I3OA 4PYLA 2QPAA 1VCHA 2QYTA 3K5HA 3Q7EA 4G0MA 4HLQB 5EHNA 1DCMA 4ZXPA 4O4HF 3DNPA 4PRLA 4ER7A 2H8GA 5EC8A 1BCSA 2H2WA 1KU0A 3ZE7A 1PSWA 5FUVA 4V38A 4R05A 2G07A 3NHPA 3KETA 1G3RA 1XEFA 3BFKA 1BWPA 5ALQA 4C4OA 1YAJA 4UDNA 1V5IA 1EX6A 2EKBA 4IZIA 2VA8A 5EHGA 2EQAA 3DOCA 4YP0A 1J5PA 2Q62A 3IVXA 1M5TA 2HBZA 2HJSA 4E15A 4B35A 1I6KA 1QQ5A 4G5YA 5KKNB 1T6NA 3BMCA 2IYNA 2OQRA 4BNMA 1XP8A 1DT5A 3INNA 4EPWA 2W2VA 1RXUA 4HN4B 1B00A 2ZAIA 2ZYDA 3B6MA 3E7DA 1J23A 4RMNA 2QM7A 4B43A 4P86A 1IK6A 1A77A 1ZI8A 1QIMA 2XJ4A 4RVSA 1WWKA 2HSGA 1DWQA 2GK6A 1G2PA 3MHPA 1EG7A 4H1TA 2XMZA 4LY9A 3D8BA 2XE4A 3KX2A 1M8FA 2HK6A 1BMQA 2JIDA 1QMPA 1UMBA 4LWPA 2WPDD 2V45A 3QLVC 3CW9A 3KHKA 4QE3A 3SG0A 5JSYA 1OKKD 2HRRA 4UU8A 4WXRA 1LF0A 4EPVA 1ACJA 1OLXB 3R44A 3O1JC 2FZWA 5KI6A 3TTVA 2O50A 2QM3A 1NFFA 2G4LA 4AVYA 1NXQA 2P2GA 3AKEA 4G09A 2BEWB 1PDVA 1V16A 4BX0A 4HVLA 3WZ2A 2WZBA 3QOYA 4TWJA 3EDCA 4BV2A 4IJQA 1QJCA 1EWKA 3KOWA 3IKVA 1TC2A 3LGAA 3S7ZA 1CJVC 3UK0A 5ARBA 3EZ9A 2UZ1B 5IS2A 2WWXA 4FQ8A 2EBUA 3DCJA 3N2KB 4FYHA 5EEGA 1J42A 3MERA 2EWWA 4TXLA 1EE1A 2GZAA 4J1SA 4TTJA 2O14A 4B46A 3OO1A 3RB8A 1P9NA 1LBEA 2JLAA 3R3UA 4C0SA 1QRSA 5FYQA 4KH1A 2AN9A 1DRJA 1U6KA 3CVOA 3S2FA 3NPMA 4W8GA 2BKEA 2NXWA 3PZBA 3F49S 4HI0E 4JJ4A 4C0KA 1HORA 1V26A 4MW7A 5T4BA 3CKMA 2WV7A 1LJUA 1AVTA 2AH5A 1NNUA 4F8YA 2BR3A 5G0SA 2CVPA 1GGJA 4ZK2A 5CXUA 4HRAA 5JC8A 2HV9A 1M0TA 3RQIA 3UKJA 3LQ1A 3GG2A 2ZI4A 3JYQA 3M6VA 1ES9A 3VPAA 3JX9A 3M83A 3R5TA 4YJDA 3LKVA 4MUAA 2NUTB 4RPCA 3GELA 4Q01A 3V7FA 4KSCA 1E59A 1I2AA 2X2EA 3IIIA 3PC4A 1M67A 5IRCD 5LPNA 3TZEA 3RHFA 4ENSA 1QRUA 4IQFA 4MV7A 2FDRA 3OZXA 3U4QA 4M9ZA 4KAJA 1WG8A 1XOIA 1DUIA 4A9AA 3ZJ5A 2FK8A 4Y6PA 2WJ3A 3D8NA 2ZETA 3ORSA 5REQB 4EJMA 1SCUB 2EV9A 2X5NA 4PBSA 1P5HA 2FQXA 1I3OA 2ZDQA 4O4IB 5BV8A 4LMPA 5DLQC 1D6NA 1UM8A 1ZCFA 1X80B 5LL6P 1K8YB 5CK5A 4Q1EA 1GQ2A 1Q2UA 3HMQA 4DV3B 3LPNA 4Q3AA 5CIYA 3Q15C 4TL9A 4M0MA 4JN6B 1EB8A 3P7MA 2IYEA 2FN7A 5G1PA 1SO8A 2WFLA 1J90A 1HDGO 1KO4A 2WP8J 4HDRA 2MYPA 4E5KA 1I5RA 3ZWXA 4OEHA 1VHTA 4LISA 2R87A 1C8VB 3FVWA 5HYVA 3OCZA 4HATA 3FMFA 3UO8B 1A5SB 1UBNA 2D1QA 3HU2A 3ABOB 3GMTA 5EIWA 2XKAA 3A2MA 1AGNA 1N34B 1H2ZA 1HDEA 1TF2A 2JCYA 2NADA 2O0KA 3W2IA 3M6LA 1OGJA 1LJLA 1IH8A 1ULHA 3BORA 1TM2A 4HF7A 4DQDA 1VB3A 3W8DA 1ORWA 3OUTA 5DCWA 1PBNA 1J0EA 5FOUA 3PVCA 5CITA 3ZHUA 4IX1A 4KOAA 1EGMB 4KTTE 1FNMA 2V7BA 2XUKA 1M6YA 1GILA 1CUHA 4NLLA 4KFSA 2C0CA 2HA4A 4BQIA 2IV3A 2QD3A 4IIBA 3CJTA 4RTJA 1WDTA 2YQ5A 5SY9A 2NUAA 2ZK7A 2CLCX 4GPIB 2VAMA 1P91A 3ACDA 3L7CA 3GEPA 1SIBE 3K0CC 5F1YA 3W7BA 2DSNA 4NPAA 3IUQA 4L8LA 1C9KA 4KQWA 2WFZA 1QS0A 1Z7EA 3OC6A 4KWIA 3K70C 4RVOA 5FEMA 1JAXA 3H7IA 3IQEA 1GZ3A 1PJZA 4OXKA 3WJ1A 2DFDA 3M81A 1XZLA 2HJHA 2P9TA 1B0AA 4LWQA 4WERA 1OJ7A 4DILA 3L01A 3QMVA 5DZSA 3UK7A 1NNLA 5ERGB 4QULA 3DYIA 4DNPA 5LP6C 4MVJP 1XJ0A 4P53A 1GM5A 1WDMA 4KWEA 1MORA 1WLYA 4CKCB 1NKVA 1T1RA 4L8WB 1ZRSA 4AXBA 2QL6A 3GIWA 4DMMA 3ORYA 3S1SA 1MHTA 1E60A 1ZGJA 3IB6A 4ER5A 1TO1E 1JILA 5J2TB 4HC4A 1EP3B 1HGXA 1U90A 3AESA 4YPVA 4YRPA 4IH9A 3VH3A 1TVEA 3NIDB 1DC7A 3P9XA 3SQMA 2IH4A 1FFXA 2P3SA 1E7YA 2EC5A 5LSAA 1EHIA 4CMJA 3LDGA 1Y1QA 2EFEB 2Q2QA 3R0XA 4ENTA 3R6WA 4KQGA 2NT3A 3RARA 1AQYA 4RLHA 3MJFA 3AJEA 4K3UA 2C54A 4AF7A 1Y3DE 3NHLA 2BV3A 2YBEA 2ZCVA 3L0OA 4DE5A 1RXCA 3KJXA 4E2ZA 2FEAA 1CE8A 2GNOA 3NATA 4CM4B 3GGJA 4MQUA 4P38A 3HE3A 4KLZA 3VU0A 3Q72A 1EFAA 1WA5A 2B1GA 4UAUA 3QBTA 1W581 4TLMB 3RKRA 2PUTA 4AO8A 4FC6A 5EIEA 1L1RA 4DCGA 5ERXA 1KI9A 2CVHA 4ZO4A 2XQGA 3KRTA 1JNYA 3LT4A 4W1SA 2WICA 5JJBA 3FDXA 3F5SA 5AKHA 4MS1A 2ZXUA 2PR7A 1SVSA 1XTSA 3D4NA 5EFZA 4UPVA 5IUJC 3KKPA 4GC9A 3GEEA 1TEZA 1P80A 4B5KA 2CL5A 2XDWA 3LUHA 4M0LA 3TLJA 2L18A 5HUQA 1JR4A 2EX4A 3NBMA 4JROA 4LQ4A 4UQPA 4TTTS 1L3CA 4ZAGA 1GEEA 1J1IA 1TT7A 3LFUA 4RPJA 2GKOA 3UAVA 3ZNNA 1C50A 1L7BA 1IUNA 1OE0A 3RUAA 5JJKA 5K8CA 1T0PA 1XDDA 4YYEA 1L8LA 1YS7A 2O1SA 1B6GA 5JWHA 1T2NA 3HN2A 4LCJA 1KEKA 4KDEA 2CSXA 1DMSA 3R3JA 5KQSA 5T3YA 3E8SA 3FUUA 1YDMA 1C1XB 3DO8A 3G89A 3Q6MA 5HM8A 3T3NA 4GE0A 4DMFA 4KX5A 4L51A 3PFBA 1IZYA 2GBIA 3K72B 1N0WA 4B80A 5E0OA 1P74A 1NBME 1CP2A 2GTHA 2NXEA 1PHPA 2GXUA 3FIJA 3OOSA 1SRRA 2YCBA 4QELA 2XVYA 3SQNA 4C6TB 4F4CA 5LOVB 4QOFA 1EMDA 3ELWA 4EI7A 4PYJA 4KPUA 1OASA 2SKEA 2AYXA 1Y4ZA 1VP3A 2P2DA 2QU7A 2ZSHA 2OZPA 4DR3B 4MDEA 3TYXA 3NYQA 3RWBA 3P2OA 4IUYA 4GPBA 5C7YA 2BMVA 1JH8A 4GS5A 4H31A 4QFCA 4EYEA 3THXA 4CL3A 5JMWA 2B20A 1F5SA 1SBQA 2WVJA 4OHWA 4PU0A 1SOVA 2JDIA 2X4DA 4LMBA 2VAPA 4H16A 3Q5DA 4BNGA 3ZV4A 3CS3A 4DV4B 4MJ3A 1GT6A 3FWKA 4MJXA 3RLFA 4BTVA 4O8ZA 5ALMA 5HE9A 4YUXA 1Q91A 2WIDA 4IMIB 3KSZO 2N46A 3W9BA 3ZI4A 2WNIA 2B4TO 4S24A 2ZRCA 3ICEA 3R8CA 4TVOA 1W73A 5JS2A 3LI2A 3P9PA 4F04A 3PXEA 2AMYA 4S35A 2Y4OA 3O1LA 4JL8A 4F5EA 4DARA 2XLCA 5EKSA 2EU8A 3JAMA 1WBJB 1GU0A 3A9SA 2AG1A 1Q3KA 4IKEA 3JASB 3A4NA 3RV4A 2FDXA 2X5JO 4I4TB 2OQIA 4D0SA 1B41A 2D0DA 3ZHSA 1F60A 2NXJA 3AR6A 3MCTA 2XUAA 3LP8A 3UXHA 4HZIA 3SF0A 1NVKA 4UZFA 1SEVA 4LOHA 5AW2A 4B6FA 4PCLA 5KOHA 1V8OA 3COJA 5G1OA 2VKTA 4FX2A 2RCNA 4N49A 1O6BA 1T8WA 3E8XA 4EX7A 2HO4A 4FW8A 3VISA 3M33A 4LDZA 3QTTA 5LU8A 1KFEB 2Y93A 1KE2A 4KDCA 2O1WA 3C3MA 3FUVA 1XWFA 1KJZA 1X19A 2JJ1D 2PLRA 1GGEA 5TB5A 2FZ4A 4ABTA 2FLKA 3VPCA 2VS1A 1CTQA 2KLBA 2WMDA 1W1UA 3C4JA 1C7QA 4Q93A 4RTSA 5FLEX 4OTZA 1GPBA 3F71A 4DIDA 3BH7A 2E6UX 2RGCA 1A50B 1F06A 3ZD6A 1XQ1A 3HVJA 3M4NA 5DGTA 5B2ZA 5CJJA 3WOVA 2MJLA 1QQBA 2AUTA 2AL7A 4TV8B 3C15C 2PMCA 4CIXA 4HNUA 1CB7A 1XRMA 4WOPA 4U7DA 2Y27A 1LBQA 3D8SA 2K2WA 3DAYA 4BXOA 2G72A 2QD4A 1U2RA 3KBOA 2X1VA 4OMFG 4BKQA 4BP3A 2EBHX 4JNCA 3DEFA 5CT6A 4BZPA 4HGRA 1TMKA 3F6YA 3VR1A 4JLBA 2JZOA 5CT8A 1UZAA 3S70A 3A8TA 2VJYA 4BATA 2CDNA 2BEVB 1Y3HA 1X7WB 3QHQA 4B7AA 3MELA 5ICFA 3R7NA 1BYIA 2HRCA 3REFA 1F8UA 2O07A 3CG4A 3DT8A 4PTZA 5EPOA 4A0QA 4DABA 5IWAB 2JPDA 1XEWX 3NLLA 4GF5A 4N5NA 2CDCA 5F73A 3D8UA 4WCVA 5TSDA 1IOZA 2MSWA 1AA6A 1KIAA 4XCQA 3OIWA 4TL7A 3EDQA 3RVKA 2D1YA 3SDBA 2JVJA 3EXG2 2AXQA 1Q0HA 1YSCA 4G9BA 2A5YB 1I3LA 1Z2EA 3OQVA 3EBPA 4JEMA 4MWCA 3RM3A 4C1NA 3U1TA 5C53B 1E89A 4P36A 3LWZA 4ZQCB 1BE0A 2I2FA 5D87A 1XA3A 2G1KA 4N5DA 3ROZA 3DOOA 3WIOA 4LXUA 3LLMA 1G21A 4RHFA 5SICE 1H5UA 2HIGA 4HZUB 2YYAA 4FONA 2X8JA 5AWFC 2N9UA 3DBIA 1QHGA 1NNSA 1AY0A 5E9QA 1VSUA 2YVAA 3K30A 3OF5A 1T3SA 1J2JA 4MOWA 4RNCA 4JVNA 1RWWA 3DDOA 1MX3A 1M2OB 1KORA 1TIPA 4WLFA 5U4QA 1LQTA 3OIUA 3DBHB 1N3IA 3TOCA 4B4WA 1H8EA 3EE6A 4C89A 1RYYA 2OBLA 4D8XA 2IOYA 2VTBA 3QWFA 3JQ9A 3QI7A 1VOTA 3WLEA 3WLIA 4DB4A 1LDEA 3L7KA 1NN0A 4FM9A 3GVPA 4DRXB 4FPXA 1IN8A 1PL6A 2WA2A 2BF7A 3AEQB 4GX0A 1P9WA 2NNWB 2VF2A 4N5LA 4OHCA 2VUHB 1W8DA 5F33A 5BQXA 5C4IA 5KTKA 4FFVA 3ZBPA 2WF6A 5F52A 4JR2A 4MTCA 1VBMA 3G7UA 3RUEA 2PRIA 3W79A 5CA0F 1QR2A 3G2NA 3LG2A 4G5SA 2G25A 2IBTA 4L57A 5AXDA 4IIHA 4HNSA 5JYBA 5GJBA 2JAQA 2Q4OA 7ADHA 1K4MA 3N86A 4C4AA 4YAFA 4KE7A 2RAVA 3BCRA 3FCCA 3IQGX 1KFJB 2AG5A 4DWJA 3SI7A 2ODQA 1VI5A 3LK6A 4X94A 3PFIA 4PC2A 3I58A 3KLMX 4LOLA 2CE7A 2IU3A 2OFXA 1TPZA 2Q8QA 1U11A 2V6BA 1AQLA 3C5CA 3RUFA 5L3QB 3DEHA 1VYVA 4JUIA 2POQX 3HTXA 1AGYA 1CYDA 2XT0A 3C2QA 1Z38A 3IAFA 3OZCA 1FB5A 4J0FA 4KIFA 1NP7A 4YP5A 4EY3A 1YZUA 4BE7B 3NP9A 1AV7A 1BZYA 1T6ZA 4LHXA 2C1XA 2YZNA 4TRNA 4YLGA 1ISPA 2P11A 2OGUA 3BWEA 1ZMRA 1VJ1A 4RWZA 1DDIA 1P2BA 1YK0A 2VDUE 2XB8A 3URMA 3LUGA 3GGCA 4R5HA 5TT1A 4ZIRB 2GF2A 1B16A 3G23A 3DHVA 2EG5A 3NBUA 5LXTF 4CM8A 3PICA 2ZIUB 3ONDA 2P6OA 5JAIA 3N59A 2Q1YA 1QYXA 4MB0A 3BRWA 2Y2UA 3D6TB 3HP7A 4O3FA 4RFSB 4UJ3A 4L9SA 1KRHA 2X40A 4J7XA 1KERA 2I9PA 2D3TA 3K35A 3MTJA 3OZEA 4DUGA 1XVVA 4I3HA 4B0PA 1BD3A 4K1XA 1R74A 2GD6A 3QITA 2DQZA 4OHBA 1YQUA 3IL2A 4Z2AA 5BYJA 2IZ5A 4COOA 1O4VA 4J16A 1G60A 3M1IA 2CLLB 2OYCA 5K0ZA 4LF5B 3CUSA 4Y9DA 1BFUA 2V1UA 4ZDIA 1M75A 2B83A 3ASVA 2BFAA 4WXPA 4UZEA 1RD4A 1NLMA 3NETA 4QHYA 4A8JB 4UUAA 2Z1NA 2GPJA 3G2KA 5BV0A 5EMKA 1TL7C 4LJ8A 4AY2A 4HP8A 5LMCA 1L7PA 4IDAA 1ZICA 4EITA 2QK4A 4DDUA 5BN1A 4ROSA 4TZ6A 5IMSA 3QPUA 4IUDS 1XPOA 3UWDA 4GMGA 1P0IA 1T4DA 2W8ZA 4QNNA 4BZXA 1IAVA 1Y7IA 3SPXA 1AE1A 3MMZA 2ZB8A 2JJYA 3P4YA 4BMDA 3F3MA 2A94A 1JZSA 1MT0A 1X1CA 2BKAA 2J09A 2QIOA 4XUEA 2NAFA 5E95A 4BVBA 5H9WA 4UD2A 4ZVKA 4WXEA 5G4KA 2Q5CA 3QFCA 4BJ1A 4L8FA 2CNLA 1W5EA 4ZZ2A 1KI2A 1LVUA 4R0NA 1IWBB 1RJFA 1F2DA 2HSJA 2P7HA 4DLBA 4OYHA 5H9VA 2F9FA 4LDNA 1FLAA 3JRWA 3ADKA 5L45A 4KH0A 2P79A 1KAMA 2DFPA 4AX8A 2WQ7A 4AY4A 4WK2B 1PR2A 1O96B 1WXFA 4DDVA 3ONFA 4INJA 3AETA 3IRUA 1R37A 2EW8A 4AZTA 2YDXA 5A5DA 4J0DA 1VMKA 1PF7E 4KE8A 1GPNA 4R7ZA 3LT5A 4MQ4A 1U7HA 4M1SA 3CUUA 2JFYA 1WMEA 1TYDE 3E2PA 5EGNA 2LXNA 2BRUC 1KDVA 2Q27A 4GX2A 2N47A 2JLVA 1E1MA 1CEQA 4JVSB 3MSCA 4B9AA 3B1YA 3ZBTA 1IMOA 4HBZA 3OM1A 1KAHA 2HUNA 1FVFA 4JGGA 1J8DA 1G20A 1NVVQ 1R2QA 1RPNA 2GCNA 4L16A 3WXMA 4PS0A 3ZG6A 3UAXA 3ZD7A 1QHSA 3P0HA 4TROA 5AKKA 1CZHA 4NF2A 5EJGA 5F2KA 5A02A 1CSEE 2IPXA 3E05A 1TLFA 3L02A 2IRWA 5CGZA 3TINA 1ZU5A 3PFWO 4XKJA 4C7OA 2LV8A 4FMCB 3VDMA 1VLQA 3PSHA 4WZAA 3EPRA 1BIFA 3AEXA 4HNQA 2OBXA 2G04A 4AO6A 1CIJA 3N07A 4NG4A 2XECA 1GP2A 2VHCA 2ZVPX 1BA2A 3FHJA 3R4VA 4WJKB 2DWCA 2WJ4A 4M0DA 4DMGA 1O03A 2OXFA 4F2DA 3IBGA 1NVGA 2YWJA 3EPPA 3NWEA 1PZXA 5IU6A 1BDIA 3A1SA 4MRMA 1NQUA 1L4GA 2VJQA 2GM9A 5JU6A 2B4QA 4LXIA 2BUAA 1FVXA 1OMOA 1PYGA 1QKKA 1A4IA 3H1EA 1FMJA 1UPTA 4MITA 2XT9A 4RO0A 2GN8A 4MQEB 1X1AA 3PT5A 4KXMA 4MUGA 2JCXA 1KDZA 2JAWA 2Y99A 1YZHA 4MHOA 5E6UB 4PTYA 4UEOA 5BSMA 5C8YF 1A04A 2Q3FA 4KAFA 2FPPA 2YWEA 1PLKA 3R0VA 4MVJA 4K2AA 1OI2A 3ITDA 2W2LD 1XQWA 4Q3DA 3ESCA 3DDWA 1QGED 2IITA 2XGMA 4QBHA 2DPLA 4NBLA 3BQMB 4EO7A 1J8QA 1O9BA 2I71A 5DVZA 4FEGA 3ZCXA 4ZFNA 4WK6A 4PO1A 2C2HA 2Q5QA 4N1AA 3WK7A 4UFOA 2AEMA 3WBKA 5M04A 2YNMC 2W8BA 3BRCA 3CCCA 5ALRA 3W5AA 4FFSA 1PTJA 3ND6A 1QO0D 2X77A 2KSQA 4LSMA 5AJUA 5IAJA 3D64A 4CM9D 3FKSD 2X8WA 3NO4A 3VYTB 4BNFA 3M9XA 4UUMA 1FDWA 3HCDA 4BQNA 4RADA 1TMGE 4C4RA 1LJ8A 2Y0PA 1XELA 1VLZA 2I66A 4MMYB 1QVWA 3VXKA 4KGZA 4UHKA 1X8KA 5JZMA 2W5UA 3DL2A 3PWZA 5T4FA 1ZUWA 3BX1A 3TXXA 5JALA 2ALJA 1WPGA 2H5JA 3UENA 2H1LA 3R24A 3GEGA 2Y9PB 3H17A 3SJBA 4FC7A 1HNXB 3IVRA 2XRZA 4QTYA 5C8VA 1O6CA 2D1FA 4RCZA 2EATA 2OG2A 3GF4A 4B6GA 1EB9A 2BY4A 2FVXA 2WA1A 4G6ZA 4ROTA 4TUYA 3S3TA 4CIDA 5JXIA 3THWB 2J9YB 4I8DA 3MWJA 4WK0B 5K3EA 1KTIA 1F8FA 1DJPA 3WK4A 4ERNA 1DC6A 1Q1NA 1ONBA 2NTYC 3CU5A 3CF2A 4EPTA 1ZUNB 2HU7A 3UMVA 1BX0A 4ETIA 3IAAA 2VDOB 3PGA1 2M98A 1EK1A 3PUJA 3F4KA 2N1BA 2QSZA 2R6GA 1T34A 5HCNA 5CXXA 1DEXA 2O0HA 2Z9BA 1ECGA 4QOIA 4DS3A 3U7GA 2YXBA 4WLVA 3RRZA 1KI4A 1YACA 1REQA 4LY3A 3HFJA 2F9MA 2I29A 2IHBA 2V4ZA 3CB4A 4Q7LA 5DU2A 2XW6A 2B99A 5HJEA 2PUDA 4H7DA 4U5QA 1WCYA 3EW7A 1WF6A 1TVKA 3NQ41 1XTTA 1ZXLA 4TX1A 1THMA 4R8LA 2IH2A 1YMVA 2OESA 4H6WA 1UF9A 3LDFA 3QK7A 1XD8A 2ONYA 5F4ZA 5CFMA 2CFRA 5K7SA 4FWBA 3FOEC 2P5YA 1V6CA 3TD6A 2B1QA 5IWCA 4ZAXA 4CLHA 4P4SA 3L8EA 2VK1A 1Q83A 1QH1B 1T13A 2WKWA 1HURA 4WBSA 3S44A 2ZVQX 1XJCA 1C81A 3V3TA 3DFFA 1IUPA 1RPTA 2QTLA 2ZUCA 3M8KA 4FOTA 4J94A 2BPOA 3T7KA 1RI3A 2ZS8A 3UPUA 1KEVA 1ZOPA 5BUQA 2H5IA 4Z86A 2OLKA 2ZIXA 3GJ7A 3QKWA 3QEKA 4IY1A 1TO2E 1ZP6A 2PJDA 4R41A 5GGXA 3UV3A 2G08A 2PIDA 3FPFA 2AJDA 4E5NA 2JIRA 1P3Y1 2Z6QA 3ZOZA 1WSWA 3UMBA 1K92A 3KQUA 2XIJA 2H18A 4C0AC 2CLKB 3KR2A 2OBBA 4BNZA 4K6OA 1HDYA 2UVPA 1NNEA 1ZK3A 2BGUA 1Z5UA 4AAYA 2YUTA 4KJZA 2V3CC 5JXHA 2DP4E 3OZDA 1DWUA 2D5CA 2EBFX 4MS3B 4DCSA 3FLEA 5MN4A 4ZI3A 1IHDA 3SFVA 3LW8A 1E6MA 5F2EA 2AI3A 3HJHA 5AM1A 3MT7A 2HRDA 2PDAA 2PH5A 4P3NA 3PNKA 1E5DA 5IZCC 4YWJA 5LYJA 4EGAA 2ZSJA 5EXSA 3V8PA 5K0LA 4OA8A 4LUCA 2PO7A 4NJEA 5AOCA 3STXA 3M9LA 4Y0VA 3R6DA 3DBRB 3MINB 5J2UF 3D0RA 3OBBA 2V58A 3AR8A 1C9NA 4LKOA 3CLRD 4GQBA 4E0BA 2Q2OA 3E48A 4H7PA 3EIUA 4L3OA 3ZLTA 1LLCA 3H5VA 4I7EA 2GBCA 4DLUA 2H0RA 5J4YA 2AX3A 5HRAA 2O3TA 2XZTA 1TAGA 1L4MA 3BMXA 3KKZA 4M9XA 4O4JF 2EZTA 4WVFA 3IRVA 1Q7TA 3D6VA 3DTNA 621PA 3ED5A 5KYKA 3QPDA 2I65A 2XB2A 2BEJA 2EP5A 4LTMA 4BEWA 3KWLA 4YRLA 1KEEA 2XDQA 3F47A 5T6BA 3HUEA 2WWVD 4O59O 2H5EA 4GUAA 5B3AA 4FCVA 4NRDA 3ZUPA 1R8SA 1UJ6A 1C3EA 2WAXA 5T8KA 4Y1EA 5HMMA 2YWHA 4YRSA 3DFZA 1G63A 3IIJA 4N7BA 3IALA 2E7ZA 1KDYA 3VX3A 1P0CA 4UM5A 4HH0A 3NAGA 2OTCA 3PIIA 5F64A 2QPTA 3TSWA 4CEIB 1A4RA 2W70A 1JFTA 3GB9A 2H48A 2FHSA 3SYNA 4B6SA 2DQ4A 5IXSA 3KDPA 1JJAA 1FLNA 4J0CA 4PRZA 1D4OA 3W05A 1KJQA 3LRPA 3GGDA 4GOLD 1JHXA 1YV9A 1JVSA 4UBMA 5AJWA 1A88A 2WTAA 5I5GA 3TZKA 5B7QA 2C31A 4ND8A 1QF9A 1GN9A 1NT2A 4LDJA 4M2LA 1Z13A 5FTLA 3O3OB 3KLPX 2R2AA 3FIUA 5EA2A 5JD5A 1JAIA 1FLVA 1G9TA 3DVAA 1DAMA 2GD0A 1SIOA 3QHAA 4IG9A 4PZCA 5G41A 3RI3A 1RVDA 1GZVA 5BYBA 4RVCA 1GSOA 2JH9A 2Q9UA 3HEMA 2PS3A 3B5EA 4N7RA 1I1OA 5IYZB 2R65A 1YO6A 2QW8A 1CS4C 1UK8A 2P35A 5HIAA 4KR2A 4GM4A 1T26A 3QLEA 3P0JA 4YAUA 3NORA 5LJIA 1QHNA 4E12A 1N2XA 2IP2A 2RGNA 1GL9B 3CTPA 3G6WA 1HH4A 4L08A 2LDBA 3THSA 5JRZA 5BSGA 2D0IA 4D02A 1QUEA 3S2SA 1G0NA 2AF3C 3G5LA 3PQEA 1USUA 3ZNPA 1FDVA 2FX5A 1EX7A 3WVNA 3KQNA 2VDQB 1DQNA 2IDMA 4FZVA 4A2WA 1Z63A 4IIDA 1GUBA 4AI6A 4BNDA 4FLMA 2QBYA 1O97C 5IMBA 1J6UA 2B3TA 4C76A 3PLAE 4RGYA 2W6JA 1ITZA 2PUFA 1IUOA 2VNKA 4ZT7A 1RWMA 1TJNA 3K9LA 4IWNA 4Q4DA 4ZVUA 4IGIA 4RKFA 3H2SA 1EM6A 4F9GA 9MHTA 1P1IA 3ZWQA 1X1BA 4TTRA 3RSGA 4ZV9A 4UUPA 4CR6A 1Q84A 3KTDA 1MT3A 1JALA 3MLAA 4L0DA 1ADJA 4BNIA 1KSFX 2VDNB 2R66A 1Y98A 1HKUA 1T5SA 4P4GA 3PJGA 4R2MA 4IF6A 4ADSG 2WYVA 1L7QA 1M6WA 2AE1A 1NVBA 3CPHA 4IDDA 3WRXC 4WFJA 1EE9A 5HJ7A 1K27A 1JQEA 5I9NA 1QVRA 2BVNA 2CDBA 3HHEA 1K7FB 3FCYA 3PL1A 1HX7A 4TT8A 4XTRA 1WD5A 4CUZA 3A6ZA 1RZRD 4CTKA 2O9JA 5DN6A 3EW9A 3R7AA 1KBZA 2JI8A 4QM6A 3OCCA 4TRRA 4RK6A 4F56A 3ROGA 4ZAZA 3KKNA 1G6HA 5TMEA 1KFBB 1Z18A 1CR1A 1ML4A 4RCYA 4LOJA 4W9RA 4AMVA 1B1CA 2W11A 3IPRA 4D98A 4LF9B 3GFVA 5C52B 2VZ0A 2ZYGA 4D9MA 3QLVA 1K88A 2FMFA 2VDJA 3BZBA 4FNMA 4G0WA 3SIPA 3Q8WA 2DKNA 1KFKB 1ZONA 2ACEA 3ZNQA 3K2QA 4BOYA 2BJHA 4BQEA 3HVKA 1IU9A 1SOWA 3JALA 3GP5A 3T41A 4IIFA 1L2TA 1PGQA 4TTPA 2OV4A 2M9MA 5CVJA 3EXEA 4LYGA 2ZANA 3CV3A 1U9IA 3F5DA 3T99A 3VPGA 1GRNA 1FDUA 1LTQA 1WUYA 2QU8A 1ZO8A 2WM9B 2Y9MB 1SH7A 4Y6RA 4ZVSA 3AJ9A 3WRWA 4F1KA 6REQB 1E4VA 1YMUA 1ODJA 2CZGA 4ZYUA 1JR3A 2UUAB 1WV0A 2HK7A 1NHGA 5JROA 4J4BA 4I4IA 2E49A 1M0EA 5TVKA 3UFXA 1SU7A 4LNUB 4GL2A 4HEA6 1Z8DA 1GPKA 5JNSA 3WAKA 1UMKA 4MS4B 4Q15A 3ETEA 2XE8A 2VXCA 2D4AA 3I92A 3NM4A 1Q15A 3L7LA 4NAHA 4RFLA 4HDNA 4UW9A 5BNFA 4GLLA 3KKEA 4NZNA 4IZ6A 3JZIA 3ZQUA 4CR8A 2OILA 1I5EA 4BPBA 4DDKA 1JKJB 1Q7BA 3EPKA 3AHEA 3IFSA 3TOSA 5F2NA 4JT2A 1FFAA 2QTVA 5AVTA 4DNXA 4MYDA 3T7EA 4F06A 3CMCO 3TZCA 1L7DA 3KM0A 1G8KA 3ND8A 1HV8A 5CDTA 1YC5A 2QUJA 1ZD1A 4MP8A 2FN9A 1BXGA 1B15A 1FYWA 1K66A 1Z75A 2J9GA 3AF5A 1XK7A 4L74A 3ZNOA 5LDHA 4F8JA 4YV7A 1ZQ9A 3L6OO 2GXQA 2EKLA 2I4OA 4C7KA 1E3LA 4LSZA 4EJ2A 2XWBF 2FZLA 3V6MA 4PQFA 3O4RA 2OZVA 1U4OA 3M1AA 2X0IA 4TXNA 1NY5A 4GMXA 1A0OA 1C30A 4YMIA 1OLUA 2ZYUX 3GPBA 2H0QA 1RSZA 4OP2A 4KLNA 1WQ1R 1N5IA 1E3TA 4BVJA 1B8VA 1ULSA 1X0XA 1NR5A 2IYFA 4H59A 2IOQA 3G9QA 3EOAI 4ZRMA 3TLYA 1Y7PA 3WL3A 1YZ3A 2ON6A 3P2EA 4W1PA 3S29A 1NPYA 3GA0A 3I9OA 5D7NA 2CLHB 4KN8A 3SXUA 2EP8A 1XMPA 5KTMA 3V8MA 5JZOA 2E0IA 3TF5A 3S55A 4AQ7A 2OXEA 1MC1A 3U4HA 4RMGA 5TMDA 4GW3A 3PE6A 3QNMA 3GGOA 4IOJA 1P9RA 1JW9B 2Q29A 4QOJA 5CPBA 1MFPA 2HLNA 1ZCAA 4DYVA 3WJ7A 4O25A 4B7CA 1G7RA 1VKZA 1Q0RA 5FULA 3U7FB 3CONA 3KAKA 1M2GA 3PGXA 4R6XA 2KM1A 4B76A 4RIEA 1I94B 4XVHA 4RZUA 3GDOA 4GFDA 1NSYA 5F5XA 4AQDA 4D4JA 1XQVA 4YCMA 3FTEA 4GO1A 1W36B 1VLHA 4RZ3A 5A4MS 2W2NA 3E7PA 5DNVA 3W5JA 1I7NA 3AHDA 4YHBA 1ANKA 1UKAA 1PBTA 3GGSA 4XIFA 3ZN2A 5MN5A 3U1BA 4W1RA 3EULA 4AY5A 3NX4A 3D1JA 2O54A 3FW1A 1RJ9B 2AF4C 4J1NA 2HWWA 2WLTA 4MRSA 4KDRA 5A4DA 5AO9A 3K0CA 5LB4A 1NXOA 4JT9A 1AZWA 4D3SA 3N7TA 3NOOA 3KXPA 2PPVA 3OSZA 2PL1A 4EA8A 3U7JA 2PLNA 5J59A 3O73A 1L6RA 3FBTA 4P54A 1F2UB 5DT2A 2YWGA 2WR8A 4MLCA 5AVQA 2DXIA 4CTOA 4REOA 2AA3A 2PRKA 3WNBA 3ZY5A 1GTL1 2ZRLA 4WN9A 2QQEA 4OBWA 5LP6A 2XHEA 4RF2A 2BKVA 5KYUB 1F48A 1RRFA 3OEED 1GVNB 1V45E 2CLOB 3EOZA 2B4YA 3KK0A 5IK2A 2RC5A 2CYBA 1P2VA 1YRHA 2WTMA 5TV2A 1CNMA 3TZLA 5ITSA 3AF3A 1V8ZA 1YDWA 1M74A 3B51X 4FLFA 4YCJA 2GWHA 2I6XA 5I01A 1BD4A 4BTEA 2ZR9A 3RVRA 3IPYA 5EIBD 2QTFA 1K4YA 1QHXA 1IXKA 2WTNA 1G5IA 2PZGA 3D5EA 1R5NA 1FUIA 2R97A 2QAGB 3U80A 4E70A 4HVCA 2XWQA 2JF0A 3G7SA 3LXXA 4P4TA 4HUQB 5DWDA 5K3FB 3CR7A 4G9EA 4ON9A 4ZYTA 3P9SA 2Z0MA 3OUZA 5AI9A 2RJ3A 4ZVTA 3SC2B 6ADHA 1SCBA 2I3ZA 3RRXA 3CRW1 3NFYA 2JLWA 2BDTA 3G17A 1QFYA 5E9JA 3OJCA 2WNHA 1WZEA 5H81A 5KHAA 1R9GA 1KS2A 3AV0B 3NHBA 4X1IB 4BO3A 5KYYA 3ZE6A 3A1TA 4MI3A 2ZTLA 3C7TA 4LSWA 3V8BA 2IYSA 1H3EA 2CKMA 3ZK9A 2B4AA 1KQPA 1ZH2A 1J25A 2XY4A 2PGNA 4BMYA 5M34A 1HLDA 1V1JA 4LGYA 4BGUA 2C3UA 1V47A 1A7AA 5FLYA 3KPWA 2FSSA 1L7OA 1QG4A 4XQ0A 1DFIA 2CXOA 4RW0A 1E3WA 1W5SA 5GMOA 4LHVA 5MN6A 3KJHA 3O8RA 2A0WA 1W1WA 1XXHE 3DMDA 3PWTA 1AXGA 1OPRA 3MNFA 3WB0A 5IM5A 1DBIA 3EFEA 3VSCA 2DBQA 3B3FA 3TW0A 1MQ9A 3WL6A 3SWWA 1W19A 3BN3A 5AI6A 1E7WA 4CQLB 4WAUA 3Q85A 1YE5A 1D8AA 3QE4A 5ICGA 5LLDA 1HG0A 1XKLA 2IUUA 4OA5A 5CW2A 1VECA 1L5QA 5HCIA 3ROMA 4CODB 4F4FA 4ZEOA 5I7FA 4BFTA 4BDSA 2ENWA 4G1EB 2VBIA 1RI5A 3IOEA 3O91A 4LRXA 1YRBA 1WSDA 4PLPA 4QU9A 3V8EA 4L0QA 1LLDA 1PNRA 4DLPA 2A1UB 3RU2A 1ID1A 3BREA 3DWIA 4HWSA 2CUTA 3OLCX 4C0XA 2I55A 2GERA 3D0OA 4TS3A 4BKUA 4UVHA 5H5JA 2OVFA 1K3TA 1XTPA 4FXPA 4LW8A 1J8FA 1RMYA 3CSSA 5AJYA 1OZHA 1UWCA 2C4VA 4ZYYA 4RETA 4ZO8A 3CW2A 5IBCA 1KDTA 5EWLB 4YRNA 4EG1A 2O3RA 4HDMB 3HMKA 3A2KA 5CYPA 3OJEA 4LTNA 2RARA 5KKAA 5FPQA 3LWNA 5D84A 2AMVA 2WWFA 4MXDA 5SZKB 4YRGA 2WD7B 1F8GA 1EFCA 3K1YA 2W98A 1II0A 3CUEF 1V39A 4DEVA 3CR3C 4GBED 2WU4A 2DYKA 1ZRHA 2ZZKA 2PM8A 2Q4TA 3H3FA 2OP0A 1T5IA 5GOTA 3KFLA 4EECA 3SF8A 3A6KA 1Z4OA 4KV9A 2COEA 3GT0A 1RXVA 7MDHA 4QFBA 3U3JA 4GVPA 3X44A 5CTAA 3K0EA 5K6AA 4LJ7A 2C9BA 3KZMA 5J4LA 4IIUA 3LLVA 4X8OA 3RROA 1TFUA 1H8HA 4ESEA 5C46F 4HEHA 4HPWA 1MR3F 2V59A 2G9VA 4ZCLA 3RFFA 1V8BA 3K4HA 2NUBA 2YJGA 4LMRA 4KLRA 4KRFA 2WM8A 3T0FA 1IN4A 2NUPA 1ATZA 3IPCA 4AJ2A 3LT1A 2D2VA 1OIWA 4JXXA 3V9AA 9GPBA 2ZBDA 4PNZA 2A5DA 2NO7A 4R7TA 3GMSA 2DKFA 2MYTA 3UNXA 3AONB 1H6DA 3LF2A 5COBA 3STTA 1R4NB 1AS0A 4Y9UA 4KQ9A 3KFVA 1JFSA 2II6A 4W9NC 2GEFA 3U7IA 4WGGA 1YDHA 1V8FA 1KAEA 4N5HX 3JD3A 2ZSKA 4XOUA 1TF7A 4Q9JA 4NMWA 2ZUDA 1NWHA 4QUDA 1Y9ZA 4U3JA 4XPIB 3C6ZA 2VLBA 3ILXA 2C61A 3MUEA 4HCJA 3WQSB 2IBSA 1J20A 3FCAA 2PBFA 2RHHA 3HDYA 4OGLA 3B60A 3Q3HA 2E6KA 3BCUA 4Q7QA 4MULA 5B6IA 4QEKA 1CRPA 4EHIA 1STOA 2XZDA 3NM6B 5IN5A 5I9LA 2ODPA 3LYHA 3ZIAD 3AH8A 2QUHA 4LJRA 3PHHA 4BFZA 3WL5A 1DV2A 3VKGA 5JS1A 1WCXA 1Z56C 4KZKA 3AG6A 4OLJA 5A5VA 3CISA 3K6KA 3IAHA 1YTLA 3LY9A 5B3KA 3ZY6A 3GQBB 4EEXA 3OFJA 3ANTA 1GCAA 4E2XA 1O2DA 2O3UA 3E03A 5CFOA 1DRVA 2G76A 2Y1EA 1JBQA 1WSAA 1A9PA 1JXAA 1Q1GA 1RYMA 3MWEB 4JJGA 4NJMA 3IP5A 3HP4A 1ELOA 4Q9HA 5J63A 4YJ3B 1Y3AA 2IXTA 3IKTA 1IOVA 4ZXFA 1FTNA 3J81k 3MJCA 1OIXA 4KQCA 2MR6A 1E1KA 1N5OX 4MB6A 1PX2A 3AF1A 4MUFA 4EY6A 5KNBA 3EAFA 3L79A 2CHVA 3P32A 3PHIA 1T15A 5DX1A 1H42A 3ZHYA 3LX4A 1IWPB 1EIZA 2ZQYA 1FNBA 4A73A 1E5TA 3WISA 1PHRA 3A4IA 3DFMA 5EXPA 3C3EA 2BWJA 3S1AB 3VJKA 3T1TA 2WU8A 1YCGA 1XDBA 2QP9X 2FRDC 2VH1A 3I2IA 1ZKMA 3I6QA 4UM9B 4P33A 5IG2A 1F7UA 3UHPA 2EVWX 2C7QA 2EKZA 1GZ7A 5HP4A 3FHTA 4Z0TA 1UT5A 3ZDXB 1AO0A 1UMCA 4IJMA 3EIXA 2C29D 1U5AA 3D6FA 4OLFA 4DFDA 2CE2X 3L4EA 3M4ZA 4O4LA 1KDPA 1KKMA 4I6JA 4P93A 3QEAZ 2W6NA 1V1MB 3KVNA 4ZU3A 4DPMA 4A91A 2XMGA 1KR2A 5JMTA 2O57A 3UHAA 3HB5X 2GN4A 1YBMA 2Y6UA 1F0KA 4Q66C 4B3BA 1IZ9A 1E2HA 2HH9A 3RV3A 3TRHA 2WSYB 3VH1A 5AKGA 3HADA 5THXA 5H59A 3R7BA 5B55A 2FZCA 2C59A 1CDOA 2GZDA 1E3DA 3FAKA 3N28A 2I8AA 1AF7A 3VU9B 1LC3A 1LDNA 4Q47A 4EG7A 1H3FA 1YZKA 2XGJA 1P6XA 3AB7A 3AL3A 1SXGA 4MPRA 5KX5B 1JMVA 2J0QA 3NAMA 4BVFA 1SVIA 5IANA 2JIZA 2VDWA 2RGBA 2BSXA 1AS3A 1KO7A 5JT1A 3OAAA 2F1HA 1FFYA 1K6EA 3BE8A 2GD1O 2GPAA 5K0NA 3CH7A 1Z4JA 1Q50A 2CV0A 2IW1A 2H65A 2Q5HA 1BS2A 5CA1B 5A3SA 2AFIA 2WUGA 3R7SA 2W2OA 1ZGHA 3U37A 2DQYA 4GPZA 5G02A 3HA5A 3VNQA 2HQ1A 3KJFA 3D6NB 3DKIA 1Z22A 4XB6B 3T4PA 1L8QA 4RDXA 1D9ZA 1GGNA 3L7IA 3V33A 3WR5A 1U7PA 1XZFA 2O8DA 4I50A 1IOLA 3T5DA 1XU9A 1XVAA 2VHWA 1Y7LA 1KAGA 2IPAB 1SKAA 3QELB 3TDNA 3U9TA 1DDOA 1MAWA 1R0RE 3CWZA 3KKLA 3VV3A 5L40A 1O94C 3LRXA 3AEKA 2RAFA 4NE7A 4NEHB 4Y9RA 5K1ZA 3RRYA 5KYWB 3FSJX 1V95A 4WESA 2QV7A 3E22A 4G2TA 2IXAA 1T8PA 1F14A 1Z6ZA 2GPBA 1G66A 3PFNA 4IFBA 3HFGA 1RI2A 3WLLA 3KDSE 4RTOA 2NO6A 3OPYA 2ZJ6A 1W4BA 1BRMA 2P2CA 4UXIA 3L7DA 5EKDA 3WYBA 4KQFA 3OQ6A 1WL8A 3MPUA 2OLJA 3FHLA 2RIPA 1OZ0A 4WASA 4Z4GA 3B3AA 1D9XA 2G40A 4Y6OA 3EVGA 4WSOA 5KPJA 1W88B 3NBYC 3OE1A 3IMCA 1YVDA 3HVHA 2ZWAA 1C0PA 1JIXA 1R10A 1F8YA 5D86A 4BVLA 5FX2A 5JECA 2YCLA 2ZR0A 4LGVA 2KBFA 4YI3A 1IEVA 4ZREA 1CV2A 1ONPA 3ANNA 5AUPB 5GONB 2WUFA 3H1BA 4LI3X 3FZYA 1NN3A 1RQPA 4H7HA 4XOIA 3B6JA 4OHOA 5F5LA 3TRDA 1NZDA 4YRDA 1WMFA 1CEXA 4UTXA 2GEDA 4PYMA 3RWMB 3T7DA 4YUZA 1E58A 1RHMA 4MHSA 4BLTA 3ML1A 1XRSB 1T8UA 1PGJA 3L4KA 5IKXA 3TSYA 1XDWA 3EDYA 4XJVA 1AGPA 1YE3A 3G02A 4NBNA 2OCDA 4CKBA 5KYXB 4W9MC 3FPGA 4FP9A 3T12A 2BHLA 3ZY4A 3DL4A 4UM8B 3WY9A 4ZCTA 1A9RA 3B6EA 4E09A 4CETA 4X71A 1LFAA 1L5GB 1WTAA 1WXHA 2NV6A 1JDUA 4GICA 4CL2A 4YALA 3EGIA 1BTOA 4OLBA 1EESA 2V97A 4Q4JB 4YCBA 3IVCA 2QLFA 1V48A 4H18A 1NW9B 3OZAA 3HEBA 3EXFB 2PS1A 4CMEA 4DMHA 4DR4B 1CYEA 4X1YA 4H2DA 1CUBA 4WBXC 2OA0A 3WAJA 3R7FA 1QCCA 2E4ZA 1OCEA 3ESZA 4QO8A 1XLWA 3TR6A 3O6VA 3DEJA 4RLQA 1WQ4A 2NU9B 1IZ8A 1QCYA 2VYCA 3DR5A 5DGDA 1KARA 3REGA 1Y6RA 2IYXA 3U4GA 2VQ3A 4I1YA 1WEKA 4Q7JB 4I8XA 5E4JA 3RBZA 1XTUA 2QTTA 4BFWA 1I24A 3KQYA 2H5LA 1RAIA 1E6KA 1U6JA 1YUNA 2ZRIA 4DMCA 4RQTA 4WBNA 1DEHA 4GEGA 1Z7GA 3QOFA 1M0SA 3EVTA 2VT3A 2WWTA 1EXMA 5ILGA 3GJ0A 1CZNA 1XMQB 3NOXA 1E2FA 4Q4HB 4XYBA 3PFCA 4WTOA 1U1CA 4QDKA 3BTVA 3NM5A 1OYOA 1MDFA 3L6BA 3DPSA 4KC0A 1JG6A 3C3KA 3OQPA 4UULA 4ZRDA 5ITWA 5AVSA 2XQVA 1I7LA 2NPIA 4F2HA 1MHPA 1T36B 4X6LA 1DDGA 2FYTA 5FI3A 2EZ4A 3L77A 2JBWA 2Q4BA 1K6MA 1P5ZB 3PUXA 2HZBA 1QFXA 3L9XA 4D80A 3G0IA 1ZM4A 4E5UA 5TGDA 5JQGB 2HXSA 4D9BA 1GGHA 1L7XA 1TGYA 2G1AA 2V7VA 3I01A 1LPOA 1K4KA 3P94A 1QTRA 2W2KB 3IGFA 3EGXB 4MQBA 5BRJA 1XAIA 3A6JA 2IEAA 2EYUA 3ZQ4A 4MIYA 1X87A 1YQWA 1Q20A 1FYEA 2YOFA 3BQNB 1HYQA 3CPSA 1EVYA 2GDZA 2GYYA 3Q9SA 2UAGA 5C5DA 2UUBB 3SX0A 5I7SA 2AN3A 3BXOA 3HJAA 1OLXA 1R0SA 3AI2A 3ISJA 5A6SB 4M8LA 3UUGA 2QR3A 2PZAA 4E3ZA 3KO8A 2I6FA 2JLCA 3GMDA 4FEYA 2BEWA 2JFNA 3V00A 3PPWA 3GLGE 2B8TA 2C2KA 5TE9A 2DFKB 1SOMA 1XRRA 2DUUA 3DCYA 1EXVA 1Y1SA 1UJMA 4RHEA 2CXSA 4ZGGA 1B76A 5HA5A 4XSHA 4AZWA 3GBPA 1L4EA 4JBGA 5A4IS 1RR6A 2X9VA 2UZ1A 3VX4A 1MQSA 5IABA 1SKMA 3E61A 3N2KA 4NE2A 2GFHA 2GTPA 4OGKA 3ZLBA 4GPAA 1U7XA 2XQKA 4NK5A 2CMHA 2PO5A 4DCTA 3FPLA 2I7XA 4FMDB 1U8XX 1EVEA 4AROA 3NNSA 4YV1A 1IN7A 5FBRB 5E7MA 1SXJB 1BVHA 4Q9DA 3DGEC 1YZYA 3JQDA 3AR7A 5JH7F 2EDCA 3B9RA 4JBIA 3AGQA 4H17A 1GD1O 1N5JA 4Z9XA 1GNVA 3B1ZA 3NHKA 3RS8A 1UK6A 3UJBA 3IP1A 5K8LA 3OTOB 1RHKA 3HN7A 2QDXA 3DM5A 3HRKA 3Q3VA 2WDPA 2C4TA 3H04A 1KAOA 4PHHA 3VR5A 1TYZA 3C97A 1L5HB 4GECA 2YICA 4PGFA 1E0DA 3KPJA 1Z33A 4R01A 2NUTA 4GP7A 3TFOA 4GSKA 2RKOA 3VO9A 5KB3A 2VYVD 2GHTA 2FJ0A 3JSAA 3V6LA 2IHNA 3HB4X 3LPCA 2GN9A 1ULUA 2J87A 2PBZA 4BAZA 3CG0A 1XDGA 4AD8A 5JWRA 1QIGA 1K9SA 5GTDA 3BM5A 4PG5A 5DWQA 1NW6A 1T3HA 3LOQA 5REQA 3IEUA 1SCUA 3GFQA 4BWGA 2RGDA 1ENOA 3LC1O 4O4IA 1ESZA 1X7XA 4GYKA 1ZRMA 2RBKA 3L0YA 2WF8A 4YTEA 1AJEA 4ZHQA 1X80A 4L1KA 3T5MA 5IT5A 4WOBA 1SU8A 4X93A 1Y6GA 4FNGA 1J8YF 2DQSA 1TU4A 4KK4A 5MFPA 1BGWA 2HMVA 2JFXA 2GM4A 1Y3IA 4U02A 2B0CA 3E23A 1VSTA 3JQ8B 4DQKA 3ZGXA 1OX6A 2JFBA 4JEHA 1QHIA 1WVMA 1AUVA 1NYRA 3GARA 3QVJA 1UFOA 1E7SA 1Y5IA 2JGIA 1C3LA 2Q3LA 1PTKA 3H2HA 3W3ZB 4CV2A 1Y4DE 1SVOA 3EDRA 1IJKA 2ZDHA 3IPAA 5ADUS 5ICSA 2NO9A 1UK9A 1DQRA 2REBA 4O5AA 1GZ5A 1BMDA 4LVUA 3PIRA 3TZHA 1JPVA 1MRNA 2WG0A 5IVKA 2J4CA 3DNFA 4AMZA 4BFYA 3L0IB 3OZ7A 2Y92A 1YC2A 5FPTA 2NO5A 5HKKD 3MCUA 5IJXA 1T3GA 4IW3B 2A9VA 4K8OA 4YXFA 1AB6A 2P8SA 3PB3A 3PKIA 4OP1A 5DHAA 5KC9A 3ADCA 1ADFA 2UXBB 1UBUS 2CHEA 3NVMB 3TXYA 1ZN7A 1WDKA 4F72A 3MCZA 1YCDA 1X3LA 4XFDA 4LECA 2WI8A 4PCAA 4L72A 1ZJ5A 3OX4A 1HFEL 1GPH1 1ZC4A 2Q7XA 5SZHB 3PUKA 4QGGA 2O1XA 3MJVA 4EOGA 2P4HX 3TAHA 1PN3A 4KQMA 4U0KA 1LTHR 3Q2IA 1TD9A 1YCHA 1CKEA 3B48A 3QWHA 2ZG6A 1PUXA 4FHEA 1NQWA 4M36A 2GAIA 4ND3A 3SFTA 1V7CA 3W6OA 4CF4A 5AFSA 1E77A 1TT5A 3ITNA 3HO6A 3IUSA 3KQLA 4LFBB 2IZ1A 2PX4A 1GYQA 1Y9AA 2AVDA 3DWFA 2EHDA 4TLDA 4UDOA 5JAQA 1FU4A 2Z5GA 4JBXA 3N0TA 3OO0A 2FQQA 3IBCA 3A6DA 2YY7A 5LBIA 5LZ2A 5LVAA 4PWYA 3GYBA 4RY0A 1WZNA 4UTZA 5IEJA 1KYWA 1VGRA 1NBOA 4EJ6A 1JA1A 1HYHA 2WIAA 3C70A 3DP9A 3QIVA 4ZVMA 2HI0A 5JSQA 5FEUA 3E7XA 1SY7A 3LQRA 2XDAA 4BQRA 2GXAA 4HQNA 1KQOA 1MVOA 1JDTA 3AR4A 4GKJB 2QGNA 1PEAA 3IYLW 2ZQ5A 2VDPB 4WCFB 2ECOA 4CKCA 5IZCA 1QX4A 2YS6A 1WW3A 1R0XA 5DP2A 3X1DA 1J39A 3ZJUA 2IF0A 2YJZA 4M1KA 3KQTA 1EZ4A 3M4XA 5CM9C 5CVVA 2AX4A 4EHAA 1JG7A 1XYYA 2P9FA 4AT1A 1UBSB 5DHFA 2RI6A 2J46A 1K7YA 3C87A 3CEJA 3G2PA 1TA9A 1PNOA 3AOEA 4HH4A 5EN4A 5HZKA 2X3YA 4BO9A 1RXYA 3CNLA 5EE9A 5JCXA 5KKCA 2WKPA 1GG2A 1WMSA 5IH3A 3B3QA 2PGIA 4PE5B 1YA4A 2FOXA 5KTPA 1WLSA 3WKCA 4FYIA 5BWOA 5ALSA 4XW2A 3FPBA 5AJHA 2AWNA 2P9YA 4KAXA 4NVRA 3S8MA 3WLFA 2JLQA 3UG6A 2IT1A 1GARA 2JDID 2XCUA 4I1OA 2B3DA 1VSBA 2GETA 4QWWA 2GARA 1RADA 4HDSB 4AJKA 5M29A 2EWVA 5F9MA 4Y30A 1B7GO 1XEAA 2GPSA 2JKVA 1PZNA 1UOQA 4ARCA 1MJFA 3D31A 3LQ2A 1JQDA 2HPHA 3QU9A 4DWOA 2N0SA 3ER9A 3H0CA 5HJ2A 2AQKA 2BGGA 4GLOA 3JATA 2RC6A 3BUSA 4RVUA 1WX1A 2P27A 3T3MB 7AT1A 2YMPA 1JLKA 2ZJOA 1X8LA 1T5BA 2W42A 3GJRA 2RGWA 2PGOA 5G0WA 3RSZA 1TKCA 1Z73A 3SOPA 4LE2A 2X86A 2FSVC 2UVQA 3GJTA 4A92A 2W0SA 4BJ5A 2ZSFA 2R2GA 4IDEA 4MH0R 4RE6A 2FF5A 4HWOA 1UOPA 3E5NA 3V4RA 3AFHA 5JBNA 4G8DA 1QCDA 4UE2A 5AK0A 3B1WA 4RXTA 2BGJA 4G1BA 2GBGA 2VYQA 3HNRA 3K0SA 3GOHA 3ZK8A 1DGQA 2PKQO 2ZUUA 4KW7A 1DT3A 4K6KA 5EIOA 3F5QA 1C1XA 3QPWA 1VLJA 1ZESA 4O4HB 5IKMA 1XE3A 1K97A 4XARA 4KR6A 4JBLA 5MGBA 5BNZA 1DKPA 4R0MA 3GUVA 4AN1A 5E8RA 1SC3A 2NO1A 1JDJA 1PW7A 3IH5A 4MEAA 4TMTA 4C6TA 5JJLA 5F98A 2V7QA 2LR0A 4JUDX 4K46A 4DAOA 2O4UX 1DXHA 3A1VA 2FWMX 3QUTA 1I0ZA 5FWXB 3LUDA 5IP5A 4NAUA 5A1JA 1BKDR 3UMMA 5DXAA 1YOVA 4G4SP 1CY4A 4YJGA 1SVKA 1W34A 3R75A 4WHMA 3EAQA 4IWXA 5B1EA 2JRCA 4D92A 3O3NB 2CXUA 3RU7A 5L6MB 3O8CA 3FNGA 3WAGA 2X5KO 1JSCA 1SG0A 3E0XA 4EHLA 1FSPA 1QF6A 1DLJA 5BW8A 3JZDA 3O47A 3W9SA 2YWDA 3C7DB 4IP0A 1SOAA 3CF0A 4JJAA 1B8UA 2ZIAA 1EK6A 2BTQB 2BFPA 4FFNA 4Z4HA 1NYLA 3AIMA 1X1SA 2ZVDA 3FPKA 4PO8A 4XA8A 2LCQA 5EKTA 2QRVB 3W90A 4TVKA 2ASVA 3OZGA 2I9KA 1RE1A 2WM2A 1ZCZA 2QMOA 2Z8YA 3EWSA 4N47A 3ILYA 3VKWA