3GJRB

Caspase-3 binds diverse p4 residues in peptides
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
92
structure length
92
Chain Sequence
KIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-3 subunit p17
publication title Caspase-3 binds diverse P4 residues in peptides as revealed by crystallography and structural modeling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 19
structure length 92
sequence length 92
chains with identical sequence D
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2009-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 3gjrB00
2C2MB 2XYPB 1RWPB 1GFWB 1SC1B 3R6GB 1QTNB 2HBRB 3R6LB 3R7BB 2CDRB 3R5JB 1RHRB 1RWOB 2CNOB 4LSZB 4DCPB 2XZDB 1RWXB 5IC6B 2XYGB 2QL9B 4JB8B 3IBCB 3RJMB 1RHMB 3D6HB 3R7SB 1PAUB 5K20B 2P2CB 1SC3B 2CNNB 2H54B 2QLFB 1RHUB 3GJRB 4ZVRB 3GJQB 2H48B 1I3OB 1I51B 3D6FB 4DCOB 1RHKB 2C2KB 2CJXB 2H4YB 2FQQB 2HBYB 1RWVB 1F9EB 2C2OB 3KJFB 4ZVOB 5IC4B 3GJTB 2H5JB 3EDQB 2CJYB 1BMQB 1SC4B 4ZVTB 1RWMB 2QL7B 4ZVQB 1IBCB 2Y1LB 2C2ZB 1RWKB 3KJQB 3NS7B 1RWWB 1RE1B 2H51B 2XZTB 2QL5B 3R7NB 2CNLB 3EDRB 3P45B 2H5IB 2HBQB 1PYOB 2HBZB 3P4UB 1RHJB 3IBFB 2Y0BB 4ZVPB 3GJSB 1ICEB 2QLJB 3QNWB 4ZVUB 3SIPB 2C1EB 2QLBB 2CNKB 2H65B 4DCJB 2DKOB 1NMEB 3KJNB 2XYHB 3D6MB 1QDUB 2H4WB 1RWNB 4ZVSB 1RHQB
chains in the Genus database with same CATH superfamily
3UD5A 2BKPA 2RQMA 2AGPA 1H74A 5C2CA 3C14A 4MK9A 3OXGA 2NS1B 1K1QA 4UZCA 1RA7A 3RTVA 1CLFA 2V5HG 4B3TF 1E6VA 1PYSB 4WXWA 3HZGA 1K0TA 1TK0A 3W5ZA 1AW0A 3JSRA 4DOZA 1FFSB 1GTEA 4OZJA 4NLPA 3DC2A 4FKXA 3FK4A 1U6BA 2LDYA 4MT1A 5KFAA 1R8CA 3ZC4A 1FWKA 2R7WA 1QTMA 2A18A 1G6BA 5IZHA 2F5GA 3LOUA 3MUVP 2O1PA 3MM8B 3QSIA 3J7ZT 5J1EB 4AQYF 4IRDA 3IN5A 3B82A 3MDFA 2GJIA 2ZM6J 3Q8VA 1B70B 1K44A 3OL8A 1EB0A 3S7RA 5HMZA 3L95X 4HL9A 4RKUC 1RBLA 1WOSA 4IQXA 3NCQA 4LVNP 3RRHA 3TAPA 1S59A 5EX3A 4PQAA 4C3LA 3JYTA 1IWGA 1WG1A 4NLVA 2H4WB 1RAHB 1X9SA 2CPZA 2E5HA 3BGFA 4OHXA 1U1LA 1HNVA 2PEBA 3W61A 5E3RA 1Y3JA 1HWJA 3PDNA 5B0CA 3TR5A 2J6TA 3GQCA 1Q0NA 5EUHA 3S8SA 1FRIA 2QLWA 5U47A 1AB8A 4B3OB 1RLCL 1S10A 1HW9A 4TQSA 4LRCA 3RBXA 1WEZA 3R2CJ 4K8RA 1N5YB 2Z56B 2V63A 1S5ZA 4CYUA 2NQPA 4ZP8A 1SXLA 4R0EA 2G1DA 3NEKA 2WZ1A 1G4CA 1BC6A 4PZVA 4LFAF 5IT9U 2XM3A 3HFZB 3K5LA 3BQ0A 4DV3J 1S0VA 4X4SA 4B3RJ 2CZ9A 4JI4J 4NLRA 4NZ7A 4KGMA 3D6MB 4XTTA 4N8OA 2DRAA 2CAJA 4B9NA 2N4DA 1EJ7L 1XIQA 2LQ9A 2BZ2A 1Q8IA 4X4TA 4F25A 3JAMU 2WBMA 1HNXF 2WB4A 2XYGB 4TY8A 3HSGA 2WONB 2GS8A 1HYSB 3M8YA 1WC4A 2CQBA 3LH2S 5J1NA 4JI1J 1MWYA 4ID5B 4IDKA 2OPRA 5DDOC 2OPSA 2F63A 2UVRA 1OQ3A 3CCZA 1HBNA 2IAJB 4MIBA 3Q0AA 1GT8A 2RMLA 1R89A 2OFHX 4CT9A 4OI1A 3PW4A 4DLGA 4GMKA 2OH2A 4MKBA 3OVBA 4FPRA 1HNZF 1ZPWX 1DFDA 4M5GA 3M30A 1QLNA 4JI7F 4HHUA 3KNGA 3UDCA 4KV8A 2L41A 5KFDA 2H65B 4DCJB 1TKZB 2PC6A 1R7IA 3F56A 1B7FA 2DR6A 3DLHA 2VG5A 1RTDB 3CXCR 3FZ2A 4DR2J 3QFHA 4DU7A 4LREA 1ZZNA 5HK4A 2DIVA 4L6V3 1VQ6S 5HAOA 2VPZB 1VISA 1HBOA 4HH1A 4CZCA 2ZH1A 4PYAA 3PKYA 4CLSA 5CHCB 4DPTA 3PHTA 5D0HA 4ICLB 2VL1A 3LP2B 4OX9J 1OSCA 1HFEL 3J7A1 4NCGA 2CPXA 3DYAB 4E2FB 4CO2A 2HFSA 4B3SF 4DZDA 4DV6J 2HFOA 1VQ5S 3GIKA 4JV5F 4F3QA 5AE2A 5D78A 2F9DA 3WX4A 2HQ3A 3JSBA 5F3ZA 3M2UA 3KUGA 1NPPA 2P5VA 3MEDA 2QZ8A 3IWLA 3VF0B 4KAIA 4TU9A 1WDTA 1BWEA 4DR4F 2B8PA 2HHWA 1VS3A 3TW0A 3HHEA 3WDOA 5T7LA 3PXGa 1UCNA 3EVWA 2CPHA 3A8IA 2IJNA 1DTQA 1JJCB 4QQBA 2VBZA 1UEUA 2LXFA 1FXRA 2H9ZA 5AJ3J 3HXMA 3R5BA 2CQ4A 3OW2R 2AJFE 5A8KB 3J7YU 1RT6A 3U1MA 2V69A 4LIRA 1M1HA 3IAM9 3JQKA 3NMRA 2DB1A 3W9IA 4EZ9A 2ALYB 2ZH2A 1Z2LA 4RW7B 3BO2A 1R8HA 4DJBA 4AL6A 2V8PA 1D9DA 5KT4A 1XJWB 2LCWA 6FD1A 5IS2A 4OJ3A 5M2PA 5A6WA 3HHDA 2CNLB 2CZVC 3PX6A 1Q7YT 2VG7B 2H5IB 1VK3A 4R25A 2VOOA 4R5PA 2W4DA 2HMIB 5EGYA 2ZNZA 1SL1A 1R3NA 5HJYA 4F7VA 1TV6A 2WRMA 4CH1A 2OJ3A 2OPQA 2JLGA 2UU9F 2C22A 4C11B 5CCLA 3IR6B 3FCHA 4UOCA 2ZE2B 4DG1A 4PPDA 4Q2MA 5HROA 2EG1A 4NZ6A 4G1PA 3BGUA 4J37A 2N3OA 1MN9A 5DO2A 2YWGA 5LSRA 1VMBA 5LSOA 4ECVA 2HRUA 3HHLA 1U49A 3X3UA 3QGHA 4LF1A 1FTCA 1MMDA 5B7WA 4YB6A 4HYKA 2GIRA 4EK2A 2F8HA 2ATLA 1NM2A 5DETA 1HIYA 4ZHRB 4OYXA 3T5LA 1N32F 2UXDF 2ZH6A 4NLUA 5DDPC 4JI8F 1WKKA 3AQPA 1ULRA 3N0VA 3DRPA 5H9FJ 5G0RA 1ZETA 1ACMB 2J6UA 1T05A 1NXIA 2AU0A 3OVAA 2VONA 3CDAA 3KFWX 2R3VA 3DOKB 4DF8A 5GAEI 1UJ5A 5KFTA 2CA9A 4FNHA 3JSMB 1RWPB 5HI7A 4JI3J 3A8EA 2E1CA 3LW5C 3DCAA 1XEZA 5J2MA 5A2QY 1U2CA 2E7VA 3KLIB 3EMTA 2QSWA 4J90A 3V6HA 2R8KA 4B3MJ 1C2PA 1SL2A 1VLYA 1LEOA 2WSFC 2VZ9A 4YR0A 2VJVA 3BDEA 1FT8A 1ZYQA 2Y0SD 3GILA 2ASDA 4GC7A 2XNRA 1U6FA 4CP5A 2CQ0A 1KP6A 3K8WA 2DO4A 1LFWA 3N28A 4WE1B 1JB0C 4CLWA 2XSJB 4DS4A 4RPFA 2NUHA 4CTAA 5GAHU 2VC0A 4Y2MA 3HP6A 3EUNA 3MZIA 2KHCA 3QJPA 1DARA 4J9SA 3V4MA 1VBXA 3MPWA 5CYMB 4OZ0A 3HT3A 3PYEA 3SV4A 4PR6A 3A8KA 4CM0A 1TL1B 3CJ4A 2ZD1A 5KFQA 6AT1B 2QFIA 3GFZA 2HNYA 5E41A 4B9SA 4A8MP 3NGKA 5LT5A 1HI0P 2VFTA 4F04B 4DLEA 5CQGA 5ADZA 2SXLA 4QIEA 4DFJA 1VQKS 1Y0HA 4IG3B 1JXVA 3TA0A 3JQJA 4RW6A 4J9QA 3TP2A 3BGRA 3BS9A 3UN3A 3GV8B 3CVKA 1PILA 2J9DA 4Q2LA 2B8QA 2CJYB 1FKAF 3SSSA 1UW9A 3BO4A 4ED6A 2LECA 2GVDA 3PACA 1SVDA 2IPOB 4I2PB 4EZ6A 3CW2C 4DR7J 2DNOA 1U2RA 1TELA 3CMES 2E9TA 3DLLQ 2IVMA 4C9DA 3CEDA 1RAFB 4LJMA 4MMOA 4Q0BA 4M5MA 2DJWA 2AEFA 2ROEA 4K4TA 1FWLA 5D4NA 2PI5A 2MMYA 4OL8A 2PGCA 3RRKA 4HT7A 4RLEA 4ILMA 1TMMA 1EQ0A 3DXSX 4I56A 3IRWP 3L09A 2AX0A 2IM2A 1SL0A 1PJ6A 3TAMB 3T1YF 4LVOP 2BRKA 1UZHA 3IM8A 2BOPA 5ETKA 3C3LA 1WF0A 1S6OA 3GV7B 3RJMB 4XO0A 2BE2B 5ETQA 5T41A 1YJ7A 1SKWA 4P2XA 4DV0F 1FJGF 1B64A 3CD6S 1PGZA 2HHQA 3NBPA 2B6AA 1H7WA 3OQ2A 1S79A 2VKZG 4FBUA 3W64A 3D0IE 4RNNA 3QRQA 1QUPA 4URSA 2KM8C 5EWGA 2ZUAA 4ECRA 2CPEA 4BBYA 2V2ZA 3MR5A 3MMAA 2WVBA 2XMJA 1T9TA 2Y0BB 4KO0A 4DL4A 4NXMF 3KYLA 4B3TJ 2B56A 3QNWB 4AYBD 2AZ1A 4NMLA 4XDDA 3CF5Q 1GEHA 2ASJA 2IBOA 4YDDB 1F3FA 4OYMA 2KN4A 2M9KA 3VWSA 1Q8BA 5E3AA 2LFVA 3GSDA 4LSZB 4DQRA 2Q79A 1DJ0A 2E7WA 5D0EA 1SC3B 2L9DA 4AQYJ 1R6YA 2EFQA 2HURA 3W62A 1SJ4P 1J5OB 4IO9Q 1Q79A 5D0RA 1JLQB 3AHPA 1IM4A 2B43A 1Q95G 2Z30B 1JMTA 3UI3A 3V6KA 4KKOB 3H90A 1WHVA 1BD6A 4F3OA 5IT4A 1YRTA 2UUAF 2BM1A 1EKSA 2W2PP 1FNMA 3V6DA 2NSBA 2NUUG 4AL5A 2FY1A 3KUHA 3M9MB 1C4AA 2MKCA 5A0YA 1B3TA 1NPRA 4ECYA 2KRRA 2OI2A 5KG2A 2CG8A 4DL2A 4USUA 3D28A 4RWXA 5DM7Q 5IQQA 2MZSA 1RWXB 3QRRA 1G3OA 2HKEA 4C8NA 1X5OA 1SPBP 3SSRA 3AY0A 3LWMA 2FVSA 4ZN3A 2CPDA 3R8YA 3GYNA 4LFAJ 5HVGA 2QYCA 2HHSA 4OHVA 4ATNA 3MM9B 2PDAA 2MKJA 2DNHA 3EDQB 1RCOB 3ICLA 1BMQB 1CPZA 4PKDB 2VFUA 2K7JA 4OZ1A 1SUQB 3MM8A 1KVKA 4BDPA 4K4SA 1JQGA 1CVJA 5J1EA 2DNYA 3Q8RB 3PTWA 3CMAS 5DZ6A 3TUJC 3P45B 3PR5B 3NAHA 3DRYA 3J81j 1WKLA 3JB9k 4M5KA 3NS5A 1HNXJ 1HQEB 2ADBA 2GQ2A 1VRUB 1WACA 4M5HA 1HA1A 2X7IA 4HDGA 3TWZA 2XHWA 2XMVA 1LQ9A 2MTLA 2QO3A 1M1GA 3AA8A 5KFCA 2N3LA 2D69A 1G2EA 2OHDA 1R8BA 2O3DA 1OIAA 3BSOA 2DNPA 2ZWOA 1URRA 3I4HX 4ED0A 3UO0A 1SJ3P 3MM7B 3N6NA 2R8HA 2WB1D 1B7YB 2XQCA 2HG4A 1LKZA 5KFZA 1BGXT 2ZH8A 2Q6CA 2L3MA 4I6AA 1V6HA 1HNZJ 2MGZB 4ED2A 3QATA 3SQOP 4LR8A 1FEEA 1IKWB 2E44A 2VIHA 1N5YA 4JI7J 1WSVA 4HH0A 2CQDA 5K5MA 5CZVA 3J7AN 2RB7A 1E6YA 3AXKA 4TKTA 2KU7A 3EZ5A 2HVHA 3NCPA 3GP9A 4P7TA 2AEMA 2APOA 2JLEA 3UD4P 2EBGA 3FMWA 2VC1A 2ZH5A 1C0UB 2KHDA 2HNZA 3CCJS 2N7CA 3Q2TC 2C2DA 1FKOB 4ILLA 1B0VA 1N5VA 4OI3A 2XGPA 1JJHA 4NPOA 4G1IA 1QTNB 4TQRA 1W2BR 3BF4A 3R1HA 4B3SJ 1RHRB 1TAQA 1N48A 3L4BC 3RR8A 4JV5J 1L3VA 2XS2A 5CYQB 2Q3PA 4GRSA 2FZGB 2WONA 1VQLS 4F0KA 3GJRB 1UA0A 1FESA 5LSLA 2DHSA 3MPDA 1EP4B 3SCJE 4IOBA 3SYZA 4ZVOB 3OUYB 5D4LA 4B17A 4DR4J 4ID5A 2AJ0A 4PG4A 4NYZA 2IAJA 4YQWA 1S9FA 2UVVA 2QL7B 1C1CB 3N4WA 3CCUS 1VIOA 1QSYA 2GAHC 1PJ5A 1DQAA 2VDIA 3EDRB 5B0DA 2VG6B 2HIYA 3D5MA 3MCOA 3GR0A 4G1QA 1IKVB 2AD9A 1RAOA 1TKZA 3HSZA 1NMEB 4V19X 1FD2A 1O8BA 1UAWA 4EYIB 1RTDA 4P2MA 1RAIB 3ENWA 5AXLA 3O44A 4O3SA 3R5JB 4QBUA 3PO5A 1UMJA 4QR0A 2UXCF 1FVQA 3M8RA 2W7OA 2QN6B 4O3OA 4ANCA 1IVZA 2XLKA 3LP2A 2EW9A 1XMQF 3DYAA 4RUBA 4PEOA 1Y5IB 1I6JA 1GX6A 5KFYA 1P1TA 2NYIA 1SJQA 3AJ2A 2P9EA 3M8WA 4FYVB 3IP0A 3ZTOA 5F8GA 3M4XA 2EVZA 1IXKA 4C2MA 2QE5A 2UU9J 3W1YC 2ZOMA 2GA7A 4IG0B 2GAGC 4KPYA 2ZZNA 2AMCB 2MLXA 3C6UB 4O44A 4CQ1A 4QCLA 4C0HA 3V6JA 1D9FA 3UN5A 4A8SA 4USKA 3IFEA 1PC5A 4DV5F 2R7QA 5LXYA 3LQVA 3KLEA 2QLBB 2V8HA 1U1RA 5IV4A 3R5GA 2JEFA 4C8MA 1A6LA 2C2MB 5LMNF 5GMEA 1JJ2R 4LRFA 2Z2ZA 2JDJA 3G71S 5KFJA 5A8KA 3GCXP 2FVRA 3HD2A 2DEJA 3DU5A 1JLGB 4PG5A 1N32J 2UXDJ 4JI8J 3I5CA 3FCWA 1X5SA 3QT5A 4RW7A 3EWGA 2EFGA 3HPOA 3DMJB 3AB2B 2BJEA 4X4NA 3BYRA 3CJ5A 3HHLC 2HW3A 4ZVQB 3I4PA 1S1TB 1SKRA 3A4TA 3MM5B 2J0XA 1UP1A 1FDBA 9ATCB 1S9GB 1NUEA 2VG7A 3L9ZA 1VRTA 1HKAA 2D1CA 5MAOA 1T9UA 3E01B 2QYGA 4LRBA 2HMIA 4NLGA 2F65A 2ROPA 4J9MA 5L1JA 3ONQA 3DI6B 5KFOA 3OV7A 3K58A 2OD6A 4C11A 1RA6A 2NZ4A 2ZE2A 4ZVSB 3ZZ0A 3DN9A 3MR3A 3SEOA 4L72B 1RT1B 1YBAA 1FRLA 4XPCA 1WC0A 4EEYA 5F0UA 1IJFB 1MMLA 3RB6A 1JLFB 3OTEA 4NYOA 4MFBA 2XLJA 1TKXB 1RBAA 4QU7A 2LXUA 5AXNA 2J0QD 4UY85 1HW8A 1OMSA 2P6SA 3OXLA 3RB3A 2DPIA 2W24A 2C2OB 3P5BP 2DYAA 3K5OA 3K2YA 1FF2A 2RVJA 1F9HA 4X4QA 3OVSA 1T9XA 4DX6A 2LDIA 1RWMB 3UD3P 1N5QA 2DVIA 2RRNA 1LW0B 2RQKA 3LAMA 3DOLB 4IH6A 3GE9A 2ZKTA 4DFKA 4X66F 3LP1B 3R7NB 3KMQA 2OGUA 1K1SA 4BHQA 4G3IA 3D3BJ 4Y0FA 3IBFB 3LP0B 4ZLLA 3I9V9 2XMKA 3H5SA 1PC4A 4E98A 2CUYA 2XMAA 3ZTRA 1CULB 5GAEU 1KLNA 3K17A 2VFVA 1KQGB 1EHWA 1RISA 3VGSA 2XI2A 1Q78A 1VQNS 1WG5A 5I3UA 3HZEA 2DNZA 1PBUA 2XYPB 2OEMA 1HL6A 4UT4A 4TU7A 1H2UX 3IC1A 3V4IB 1APSA 3T1HF 1HD0A 2GNKA 1CQNA 2KM8B 3C16B 3WQPA 1RHUB 4B02A 4LR9A 3KLIA 2J9EA 5ETSA 3SV3A 1RT7B 4RUAA 3LALA 3CCVS 3PZPA 4W98A 1VBYA 3EGNA 2KRBA 2AYEA 3IGNA 2IYGA 3FBEA 2HFNA 4ZDNA 3J80U 2JL9A 5BJRA 1Q81T 3IS9B 2W25A 1URNA 1A7GE 1TUGB 4WE1A 2XO7A 2XSJA 1KQFB 3OSPA 3H59A 1S97A 5DDRC 3DXBA 1LW2B 2BYCA 1XR5A 1NBEB 4KGKA 4FKYA 3G8QA 4YN3B 3P49B 3OJSA 3C8YA 3C14B 3TEHB 2XEXA 4GO5X 1TL1A 4DV0J 2OAUA 1FJGJ 3F0NA 1S1UB 1U1KA 2MY8A 2Y1JA 5IM0B 2ERRA 3ADAC 2XS7A 3CD7A 1RBOB 2VKRA 1S6QB 3G96A 1WELA 5K8MA 1SV5B 2CVIA 2C3MA 2ZHAA 3SCIE 4OZNA 2A6MA 4WJBA 4AXIA 4IG3A 3UR0A 2OIHA 5D0GA 1RADB 3KK3B 1HHSA 2ASLA 1QE1A 1CC8A 5KAKA 4YUDA 3EZUA 3NXZA 1DHMA 2V8DA 4J7CA 4NXMJ 3POTB 1VRQC 4NWBA 3BPDA 3ZZTA 1GXUA 1XMBA 5E2QA 3PW2A 3JYTB 1YZ6A 4EMDA 2DNQA 4DZ6A 2YXLA 4OMFG 3UN2A 4K4ZA 1NJIT 4ENOA 4ECUA 2DRDA 3CCQS 1YI2S 4QZVB 4JV0A 1AUSL 3EE3A 4ZP9A 3AH6A 2L9NA 4FYDA 3R3TA 4NRTA 3TAMA 5KFFA 3OTOJ 4ZVHA 3TZXA 3SBMA 4O4RA 1FNOA 3CMQA 2BE2A 4ALZA 3W63A 3G6XA 2C2NA 2RU3A 2CPIA 4WP9A 3BN4A 4UF4A 5GMKa 1Y4ZB 5JJBA 3JS9A 1YRUA 1GH8A 3ELHA 3HM9A 1H2VZ 3JSYA 4L75A 3GFXA 1XNRF 5E3PA 3KXDA 5HQMA 4ELVA 4FPIA 3P6YC 2GQQA 3KHLA 1FRJA 3RYLA 2XZTB 4NEZA 4ZVFA 1VQSA 2ATCB 1QUVA 1D9AA 1ZM4A 2EFOA 2J9DE 1HARA 2RH3A 4JV1A 5KG4A 1F5AA 2F40A 1ZH5A 1N52B 3W5YA 2EC0A 4CNYA 3TZYA 4TY8B 3KOAA 3ENVA 3R27A 1SQEA 2DNNA 1LK5A 3AD8C 4X4VA 3M2RA 1DY3A 3N5FA 3Q86A 2PI4A 5K8OA 4ED4A 2P2CB 2ZFHA 1HBNB 4CDIA 1I3OB 3VZHA 2RT3A 4P2SA 2GJFA 4MTPA 2HS4A 1J5OA 4ITSA 2IM0A 2A10A 4I0WA 2FB0A 2XY6A 4PPZA 3CJTA 2FVPA 2GW8A 4OZ2A 2BDPA 3TNVA 2XHCA 4KV8B 2AGQA 4LFBF 3W3SA 1CJVA 3MPVA 2VG5B 3M32B 2ILYA 3LTOA 2IC3B 1HNWF 3ZTSA 3IO1A 3FBCA 1YTYA 5L1KA 1HBOB 1GTHA 4WFBQ 3DLJA 3ISNC 4MJKA 3HO1A 3SQGA 5B0AA 3R6LB 1YSJA 4QWBA 2HNDA 4L76A 1JLAB 1VR6A 1XMOF 4AE5A 1MWZA 1ZAXA 3HKWA 2KXFA 1RAGB 1U1OA 3FZBA 4FS1A 4C0BA 1JWWA 1JIHA 1HQ2A 3JTOA 2YNIB 3AXMA 3H5UA 2V4JB 3BYPA 3MEDB 5KTQA 1RK8A 5AE3A 3QZ7A 2DXEA 1UPMB 4A8OA 1M5OC 2EXUA 3NRBA 4WFNQ 1SQFA 2BJ9A 4RU2A 3KNAA 3ZTPA 3EGZA 4MYTA 1KONA 4ZPTR 1N6QA 1KTVA 5I3QA 4LF2A 3I87A 3O2IA 4PAAA 2YKMB 4IOAQ 2DPJA 1HQEA 4PG6A 1VRUA 3BGLA 2DR5A 2W8LA 2I8EA 3W60A 3GIMA 2JZ5A 2EBEA 3BV8A 2VUGA 3CDWA 4ES3A 1UTAA 3QJJA 4LUBA 1JLBA 1D8YA 4OYPA 4IR1A 2HFVA 4KY3A 3UE2A 3MM7A 5JVHQ 2W4PA 2Z2MA 1BUXA 1GNKA 2V4RA 3DHWC 2J8SA 4ECSA 4MH8A 2BX6A 4A8QA 4WFZA 1YJRA 1U09A 3H42A 2W9BA 3P3DA 5AXMA 5HBMB 2MGZA 4M95A 3CSKA 2ZVSA 1M5VC 3DDIA 1J2VA 4CLLA 4URQU 4A47A 2FPHX 1IKWA 1JXLA 3FNNA 3M1VA 2ZZTA 5F8LA 1RGVA 2QL5B 4LR7A 2D9PA 3I56S 1WC3A 3QLHB 4QR1A 3CULA 1D8ZA 4DG1B 4EYHB 1BHNA 2WVEA 3H25A 2DNKA 2UXCJ 2FGOA 1FKOA 2UUBF 4LSNB 2BV3A 4I1TA 3TQ1A 2IYIA 5DG8A 1XMQJ 1KTQA 2MQLA 5L46A 2HHXA 2R7SA 3HHLB 2YY3A 5BYSA 1C0TB 1LOUA 4GVLA 4IRKA 2JVOA 5CYQA 4N8NA 1RHMB 4WYLA 4WFXA 5KFWA 4DL7A 2OMOA 2B4UA 1R27B 3OTBA 2BRLA 5DLFA 1F60B 4P9SA 4DR6F 3OUYA 1KN6A 2NXJA 5A6PA 1KBRA 1QSLA 3V81B 1A0OB 2CQ1A 1HI1A 4PYDA 3LWLA 3BO3A 1J27A 3T6BA 4DV5J 3PRBA 1WKJA 1T05B 1NPKA 2RD5C 2W2QP 3QBCA 5A8RB 3R1LA 2CADA 4Q7AA 3CIMA 3BEGB 3OR1A 3TYTA 2VG6A 1JJ4A 2NXUA 5LMNJ 1S48A 4Y00A 5KFUA 1N5TA 1UPPA 4TYAA 2CZ4A 4WTOB 2ASYA 3DRSA 4NOHA 2UVUA 1IKVA 2BOAA 4LF9F 1NK8A 1TU0B 4J9PA 2H3EB 2CNKB 4N76A 2RF2B 1Q86T 2BQ3A 1UVNA 2OTJS 4IFVB 3KUEA 2P9GA 2PFDA 4EWTA 2E9RX 3CCLS 3D54A 3T9ZA 2M3DA 4Y34A 2XMTA 4DR1J 2J7WA 2F4VF 1HD1A 4FYWB 2DGWA 2C2RA 5E33A 5D4PA 3BKFA 2E5JA 1DTTA 2HGMA 2XGQA 1M5HA 3TQEA 1FVSA 3I6PA 3JTPA 1H98A 4I6YA 3KDOA 3MR7A 4CTAB 3L3CA 3VAMA 2JEGA 1Y9OA 2FHJA 2LP4A 4B08A 1ZOTA 2C2ZB 1REGX 1KOHA 4IG0A 4RNFA 4NLTA 3BJYA 3CGIA 1D0EA 2FJBB 3C6UA 2MKHA 1OY8A 1UWBB 5AXKA 4CIOA 1OPZA 2GQCA 3QMQA 5KOWA 1U45A 1WHWA 5B0EA 4DF4A 4DBQA 2XLIA 5M2UA 4X4PA 2DXFA 1QY7A 2DR7A 1PG5B 4A8KA 2BA9A 3H8YA 2BR0A 1HWUA 1NSKL 4ELTA 4ECTA 4EI2A 1JLGA 2GVDB 2Y1IA 3OFHA 4X66J 1BQXA 1RT5A 1N34F 3MR6A 1F5BA 4U6PA 4RBUA 4NLDA 1GQEA 4IO1A 4YHHJ 1YIJS 3GJTB 4LSLB 4OYZA 2F9JA 5IQ6A 5IT9Y 1JNRB 5J2NA 3UNYA 3TA2A 1S1TA 2HHTA 2EPIA 2EK1A 2B4PA 4I64A 5J2PA 1S9GA 1TP7A 2PO4A 4F67A 3BZQA 4KGVB 1NCLA 1LK7A 4FBTA 1OYDA 3E01A 3FFIB 3D2WA 3T1HJ 1H7XA 2EG2A 2FC8A 2POKA 2UVWA 2LQJA 2ZUGA 4M5LA 2M70A 4DQIA 3JAMY 2HRTA 1K73T 3SIPB 3DI6A 5DG9A 2ZC4A 3KLGB 4H4KC 2UUTA 1JLCB 4NA3A 3DU6A 3K8VA 2HFUA 2K06A 3RW7A 4CT8A 4QIGA 1PIEA 1RT1A 1FXLA 2BEFA 4WZQA 3Q8PB 3H7HB 3H40A 4OYAA 5FIIA 4KHPF 3BREA 1TKXA 3DLGB 2IBKA 4LBIA 1GXTA 3R5DA 1NJYA 1RT2B 4IR9A 2Z4PA 2CJ9A 1UZDA 1LWXA 2KXNB 3U1LA 4DPUA 2IDLA 4K59A 5CH7B 3VCDA 1LW0A 1KC8T 2OKQA 1ZTTA 3LP1A 3T9NA 2JC1A 4R0JA 3Q8YA 9RUBA 4U7CA 3LP0A 3EJMA 3TI0A 2MZ1A 4PG8A 3KLHB 5IT0A 4K2JA 1CULA 2CQPA 1U0HB 1XR7A 4M5DB 5KG1A 3EXYA 2I9SA 4RX6A 2V9WA 1F9FA 3HLUA 3UDVA 5LM7E 5K8PA 1N54B 4CO1A 3RRGA 1RTIA 3GPAA 3V4IA 2J0WA 5H9EK 2B9YA 1V3RA 3IM9A 1FJ7A 3SDEA 2QIFA 3CCRS 1TUWA 4LQ9A 3VALA 2E1RA 2W7PA 2LQ5A 4KPCA 1X0PA 4P6QA 3C6TB 1RT7A 1FE4A 1QAYA 2BVZA 1H6KX 1T11A 2HHVA 2HZAA 1CG2A 1U24A 2V2VA 3BR9A 2HQDA 1I1GA 1FA0A 5JMNA 1X4FA 5L8RC 4OZ3A 2AKWB 3F44A 3IS9A 4C0OC 5KFGA 2BABA 2AZ3A 4UOHA 4DMZA 2K2PA 1LW2A 4QIVA 3QGPA 2CQCA 3GFHA 5EX0A 1RHJB 5FJ4A 5DGAA 2RDDA 1T8EA 3KG1A 2MKSA 3VAJA 1TAUA 4MK7A 2YX1A 2LU2A 2DIUA 2X3DA 3I82A 4ETXA 3CD5A 1S1UA 3AT1B 4BCAA 2PD1A 3KJNB 3VV2B 5IM0A 5KFNA 2AJ2A 4X62F 2CVEA 3GB0A 2UXBF 3LF0A 1XNRJ 3KG4A 1NHUA 2IVYA 3DDNA 4CLUA 3VAKA 1NB2A 1S6QA 4KFBA 2FHJD 1SV5A 3DDKA 2W9CA 2WVDA 5KFHA 2MKIA 3BKUA 3KK3A 3ZXWA 2ZC3A 3M8QA 4J91A 2ZOFA 2FLLA 3TANA 4QR2A 5CYJA 3CDBA 4P71A 2GC8A 1DBDA 3POTA 5GADI 1PAEX 1S6PB 4XPEA 2GMLA 2Y1LB 1NJWA 5CCMA 2DGSA 2D7SA 4EO8A 3EXCX 2MQOA 3ILJA 1R0AB 2DR8A 5LXRA 1OS5A 3EVMA 2HFZA 5T14A 3ZTQA 2CDQA 1YJTA 4NA2A 3UFCX 1NDLA 1U1NA 1XN9A 1WEXA 3Q8QB 2Z2LA 2D41A 3H4BA 2QA2A 1D09B 5FDLB 2CJQA 4PCQA 4BC9A 4YFUA 1WORA 5IOLA 4TY9A 4UTGA 2YNHA 5K9FA 4OHYA 2WSCC 1HNIA 2BE7D 5AT1B 1VK8A 1IJEB 1Z4UA 3NP5A 3G9CA 3EPIA 2FUG9 3O5TB 5HJXA 4KJIA 3OXFA 1E6YB 4LFBJ 3H0PA 4LF5J 1IWAA 3E8OA 4U9RA 1WWHA 1ZS6A 1IQTA 1HNWJ 4ZVTB 3O1LA 3CJKA 3W8GA 3W66A 3W2WA 1SJRA 1VQYA 1KNZA 2KJWA 2HNZB 1N4LA 2HSEB 4PWDA 4TN2A 4WXOA 1P1LA 2NXCA 2ZBRA 3VVTA 3K5PA 1RAJA 2B9XA 3KHRA 3RUBL 1XNQF 1KD1T 1T9YA 2MSSA 1MU2B 1OPIA 1XMOJ 1UVJA 1K0VA 1GMVA 2XMMA 2CQ3A 2MKYA 4B9MA 3PO4A 1P6TA 3HD1A 1TFWA 4H4OA 3BR8A 5G4DA 1SC1B 1F2HA 4DEZA 2O67A 4QW9A 3A12A 1SH2A 4RW4B 2ABYA 2JLFA 3CC7S 1LXNA 4GC6A 1FX2A 1GMUA 3ZNUA 2VODA 3CC2S 3GFYA 1EIYB 3Q24A 1ZZFA 5DRKA 2A0FB 5ETTA 2KG0A 4OZLA 3A3OB 4DSKA 2Q1LA 4WF9Q 1Q8KA 3OHAA 2E1MC 1Q7LB 2R7TA 4G1QB 1QAXA 3GSIA 4AUKA 1T9WA 4F2RA 4JYAF 3PCOB 1GX5A 5DJBA 2YKNB 3BH6B 5KFBA 1WD6A 2VU5A 4ZKAA 2F8MA 3G8SA 5H1SV 3M32A 5B0BA 3HFVA 3RAMA 2FVCA 3QT7A 3PVXA 2IC3A 3X1LB 4J9UE 2JNJA 5RUBA 1S1WB 1XTZA 2PA3A 2X1BA 1YWXA 3N5BA 5GAGI 3FSIA 2G9OA 2VB6A 1UVKA 1JLAA 4FDFA 4LMZA 2M4MA 2CWXA 2BW7A 3ZZRA 4CLKA 4WP8A 3MPYA 3I5BA 2ZHBA 3G87A 1HQUB 2CJXB 2WW4A 2VDHA 5KT2A 2YNIA 1F9EB 2V4JA 1RDRA 3EZOA 2CYYA 3LPEA 2YKPA 4IFYB 4CM2A 4ZP6A 3UVJB 1DRZA 2Z57B 1VBZA 4O44B 4WWSA 4B3RF 2UUBJ 1F1BB 2JC0A 4WZMA 1RWKB 3UPFA 3KKFA 2AV5A 3ETOA 4X4OA 2KT2A 3KLEB 4PQUB 1T9VA 3VR1A 1Z1ZA 4ZJQA 4W92B 5EN1A 2YKMA 4ZP7A 4X4UA 1AFIA 2IDEA 2BQRA 1LNQA 4EU0A 4URGA 4DV2F 4KHRA 1J5EF 1EZZB 4DUZF 2PE8A 3FEXB 2QSFA 3DRRB 3ET6A 1ZAWA 3DOMA 4DR6J 3PKMA 5DQGA 1RABB 1VJQA 4WK1A 2KYZA 5DG7A 4YMEA 1RB0A 1S9EA 4B9LA 1FK9B 5FD1A 3DRXA 1KS2A 2J76E 2J7UA 4RU9A 4YB7A 2NLWA 1FHTA 5HBMA 2AQ4A 4OLPA 1VRTB 2YX7A 2FLOA 2DBBA 3J7YI 3T3FA 2CIMA 3H2VE 3O8WA 2GX8A 2DGOA 4NLYA 3U27A 1FRHA 4LT6A 3ZZOA 1TR0A 4ZMMA 1BXNA 1VQMS 2Z2YB 2HIQA 3D9BA 4PG7A 4U7UD 4DSJA 3QLHA 3C15B 1L5UA 2IRXA 1S57A 2XO6A 1UEVA 3T5JA 3S6EA 2BBEA 2OEJA 2V2QA 2F4VJ 4ED5A 4LSNA 1AFJA 2PFFB 4HEA9 1KLMB 4MFBB 3IR7B 1ELOA 4I68A 1NK7A 1RUSA 1C0TA 4DV6F 3DLBA 2GGPB 2IJFA 2V8GA 4KE5A 4YB1P 4X64F 5KFKA 2MSTA 3D4JA 4GKKF 3W7BA 3Q8SB 2XI3A 2ZEJA 4L74A 2MJNA 4OX7A 2FQQB 5HSPA 2Y8WA 2BE9B 4Q8EA 1S0MA 3DLEB 4NLXA 1K9MT 3V81A 2JH3A 5L39A 2GIQA 3M9OB 3HHNB 3IMQJ 3JQMA 2M0GB 5A8RA 4NI2B 4WFAQ 2NPFA 1RWWB 2QGFB 3NOCA 2G0CA 3I31A 3FCVA 1OY6A 2IHR1 2Y9HA 2XWYA 2M8DB 5I3UB 2E5GA 2HQFA 1TVRB 3P8BB 5ETLA 4P73A 2RQCA 1N36F 3KK2A 2QLXA 2RF2A 1N34J 2D74B 4ANEA 3U1NA 1HR0F 4IFVA 2U2FA 2LKZA 1RHQB 3G6ES 1CJKB 7AT1B 2FJWA 3H5YA 3SZ2A 3NLCA 3CUNA 4YY3F 4JV2A 3AB4B 4XDCA 4P10A 5KFMA 1RT4A 2H4YB 2I0XA 3NWGA 2BKNA 2C28A 1FXDA 3D0GE 3M6UA 4HHHA 4F8RA 5DS7A 4O4GB 4ER8A 5BYRA 1SJFA 5LMUF 1CBKA 3MMJA 2M7SA 4C4WA 3T5KA 2R4FA 2FY8A 2KFYA 1OO0B 1HBUA 1P27B 4U67Q 1RZMA 5KOXA 3BKTA 4I7FB 4FN5A 1IKXB 1S4EA 2EK6A 4P74A 1UJ6A 4BWMA 2C3UA 3RZAA 4C6AA 4ELUA 2DHGA 4USIA 1OQ6A 1SJ1A 3D0HE 1UWBA 2HHHF 3FVYA 4KHPJ 2CXEA 3ENQA 2RHSB 5F8NA 3MCNA 3CJQA 4MKYA 2DKOB 3U7JA 5SZTA 2YNFB 3VAIA 3F41A 3EYZA 4X84A 1ITPA 1NO8A 2C2EA 1QE1B 4ES2A 4F0HA 1AZSB 3BGOP 2F7VA 5C5JA 1RTHA 5EDWA 1R8PA 3SI8A 2ZDOA 2DT9A 2PA8D 2OFGX 4YP3A 4J9KA 2E7XA 1JNZB 3TARA 1AYEA 4DPYA 3CCMS 1PSDA 2O01C 3VQSA 4LSLA 2PT0A 2HZVA 1NZ8A 2RNEA 2BQUA 1EAYC 3ITHA 3DLKB 2BMBA 4MK8A 2KJVA 2ZZMA 2N4CA 1ZAVA 3A13A 4Y2AA 1RTJB 3FFIA 2HZCA 4HACB 3THVA 3TUZC 1AUDA 3CJ0A 5KFEA 1HMVA 3K5MA 3KLGA 1JLCA 4E8UA 1FI4A 5CD4H 1QDUB 4CLPA 2Y3YA 5CA5A 1X9MA 5CZXA 5FLXU 3QQCD 4N41A 2DHAA 2MHEA 4X65F 4DV4F 3OLBA 2VICA 3GMGA 2X51A 1RQ0A 2FJAB 3TJAA 3DLGA 2DGVA 4HKQA 4ID8A 1O6XA 4ZITA 2VPYB 4K2XA 4HVZA 2IVFB 1RAEB 3LGHA 4F36A 3NGUA 1K8AT 2B9EA 1RT2A 3J7Z5 2N7YA 4DUYF 4EBEA 4WFYA 2K3IA 4KHMA 4KC5A 1WEYA 3I55S 1RT3B 4NYPA 2YX4A 2MDAA 5E3QA 4KH0B 4NXNF 5F41A 3M8ZA 4CLZA 1JLEA 1FE0A 2W2MP 4ZK7M 5KG7A 4X62J 3FBFA 3I9ZA 2UXBJ 4OIXA 5F9NA 3HT0A 3HHLD 4NZ0A 2R7UA 1SIZA 4DQQA 2AF6A 3R5AA 4WU3A 1DAXA 3KLHA 1VC6A 4EBCA 3PJWA 3GG1A 3M2RB 4NE9C 1U0HA 2OSRA 1BQMB 2VFRA 1YITS 3ZFVA 5A76A 5KT5A 4QWDA 4M5DA 1NU4A 1UKUA 5IFMA 1NNDA 4CLYA 2KDOA 4C98A 3VHQA 3GIJA 2M52A 2NPIA 2R7XA 2JOQA 3PX4A 5B0GA 2DRBA 3PYFA 2UUWA 4JB8B 4KGXB 1L3TA 4DR7F 2DITA 1SBRA 2XCAA 3C6TA 4IKAA 4FNIA 2AEJA 2BKOA 4ZPWR 2RHQB 1MSWD 4CO0A 3UCZP 2WVCA 1C1BA 1CJVB 2WCXA 4J9OA 4LFCF 3MAAB 2X1GA 3I0RA 1NSPA 1TKTB 3VAGA 1UEKA 2DGQA 2R42A 3JTNA 3QT6A 1RJJA 1HHTP 3SQGB 5I42B 3HJVA 2AT1B 2ACMA 2UV8G 4NLOA 1T02A 1TL3B 2VPXB 1B0TA 2HNDB 1FRMA 4I4BA 4RWWA 3WX8A 2E5LF 1S0OA 1S99A 2IM1A 2IRYA 4USWA 3RAXA 3CJSA 3Q89A 4A8XA 2ZJPQ 3FDSA 4CH7A 3MD3A 2D3O1 3RBZA 4F0MA 3SCLE 4NX9A 3L7UA 2BJ1A 2QLFB 3QSYB 3A3PB 4J9VA 2DD8S 4FVMA 2XMWA 2BUNA 1NKEA 1N6QB 4FYYB 1XNQJ 2QMUB 3MUMP 2GV1A 4NLWA 1PYTA 5GADU 3TJ9A 3AOAA 4YDXA 4YS2A 1M5KC 3M9NB 4ED1A 1FJEB 2FJDB 2EWHA 1S6PA 3FSXA 2MZTA 1WF1A 1IR1A 1EQMA 2EKNA 4F3MA 3KDNA 1N0VC 5HQLA 2ZH7A 2DGTA 2WHOA 1R0AA 2JSXA 2KZZA 3W8PA 1RTZA 1DURA 4ETZA 1G7CB 3THPA 8AT1B 1JLBB 2HEKA 4ZCLA 1A9NB 2UP1A 2XG8A 4ZA1A 2HWTA 5BXIA 3MGJA 1WHXA 1WUUA 5K14B 3CT9A 2RS8A 3T19A 5FDLA 3M8PA 2JVRA 7FDRA 3R6GB 2BXJA 2HBRB 3RG6A 5B0FA 2I6WA 2KTQA 1X0FA 2W9BB 1TL5A 4FVCA 1VLOA 2R7OA 2GVZB 2W9AA 1Q1KA 1T95A 2ZWPA 4N77A 2QJ3A 4OHZA 3MEEB 4JYAJ 3D6FB 2HHPA 2W4CA 2O66A 3M1VB 3T5HA 3PEHA 4USHA 1RI7A 1YVFA 2ZHOA 3OBIA 3G82B 3CIZA 1GK8A 5D77A 3UCGA 4PUOB 2HVZA 2DGUA 1KFDA 3WZ0A 3KJQB 5CD4A 4KTQA 4YB5A 1PYOB 2AW0A 2HBZB 4O3PA 1OYEA 4DSLA 3GR1A 4J9LA 3TUPA 2LA6A 5L9NA 1MU2A 5JVGQ 1T3OA 4RR5A 1QAIA 3QAEA 1YHQS 1U1QA 3LAKA 2XYHB 4ECQA 2OO4A 4EGLA 2WW8A 2ZOGA 1V9OA 1QSSA 5ITHA 3PIOQ 2QT7A 1KSPA 4UQGA 2BJ8A 5LJ3Y 2DY1A 4RW4A 3CTRA 2PSZA 4PXBA 1CQMA 5C2GA 3HVWA 5C7PA 4KSEB 3J80Y 1IQZA 3K89A 5E7OB 3UWTA 2XY5A 3LO3A 3JXOA 3MFIA 4DR5F 2W01A 1YK9A 3OR1B 1NJXA 3PFEA 4OX6A 1SI9A 4DV2J 1J5EJ 4DUZJ 2GMHA 2RE1A 3DRSB 4WIQA 5DQIA 4CLTA 4QYRA 3DGVA 2ILZA 2A2DA 2YKNA 1IBMF 3CDEA 1XBWA 4HI1A 1Q53A 3NY0A 2RDJA 2D3OR 1Y7PA 4ZVPB 1DQ8A 2OMLA 3D1HA 1HPZA 2QFJA 4AL7A 1VFJA 1S1WA 4A8FA 4GKJF 5GAGU 3MXHP 2J6SA 3IXQA 2P9CA 4ED3A 1DTTB 1RP5A 3MECB 4PXCA 4I2QB 3B8HA 1S6UA 2XZDB 5LL6d 4OFZA 1CJUA 4O0NA 4C8KA 4R8UA 1EARA 1UFWA 2KT5A 1HQUA 2C2KB 1PCAA 4ZPBA 1NHVA 1WI8A 4KIAA 1NK9A 5HO4A 5JUMA 2MQQA 1S0NA 3PYDA 3HVTB 1OWXA 3LANA 2LXIA 4IFYA 3QFWA 3UVJA 5HL7Q 5KFLA 4D3HA 3HULA 1IR0A 2GFFA 1T03B 4PQUA 3VQTA 2VBWA 1KVIA 4HLBA 2G4BA 3LGMA 2GO9A 4WTYA 2ZJRQ 1UL3A 3ZZPA 4X64J 4U95A 1X7VA 1Y10A 4GKKJ 4F4XA 3DRRA 3KTQA 2VA3A 4O23A 4EUVA 3W65A 1UVLA 4GVBB 1VGYA 1CEZA 1RT5B 2HQCA 2QRRA 4FF4A 2V0NA 5HLFB 2A3JA 5IC6B 5C42B 4ZCKA 4Y6IA 2R8JA 3KK1B 1SH0A 3AFGA 2G13A 1FK9A 4RNOA 2DTJA 2V94A 2R8GA 2HYIB 3ISND 1LV5A 5J2NB 3W9JA 1CJTA 5J2PB 2XS5A 2WVFA 4QWCA 5A8WB 1CS4B 3QRPA 3FUYA 2CQHA 1N5SA 2G2OA 5ETPA 3VGTA 2CPFA 1N36J 3PJ9A 1YZ7A 1X4GA 4YOEA 2JX2A 1HR0J 3MUTP 3WC2A 2HWIA 4U96A 2JJ4D 4K5SA 2LYVA 2V67A 2M2BA 2YKQA 4P52A 2YWFA 5HQ8A 5HMYA 3B4DA 3FQLA 3C15A 2IMWP 4Q45A 4YY3J 2DH9A 2YH0A 1KEKA 3G6VA 1NEEA 4UUXA 1U02A 4OJGA 2FVQA 2J0SD 1T0TV 1KLMA 4IQMA 1FKPA 3NGRA 3P96A 3CD0A 2ZH9A 3GONA 3A1YG 3OSNA 1YLXA 1Z2ZA 1ZA1B 2GGPA 1ZTWA 1LWEA 4DCPB 5LMUJ 1VQ4S 5ETVA 2M5YA 2VQFF 1YJVA 2AYBA 1VBKA 3E3XA 5HP1A 2MJUA 1QAJA 2HK3A 1VHFA 4B9TA 3MM6B 3DLEA 4DV1F 5IC4B 3HHKA 2HHHJ 2OPPB 3M6XA 3IR5B 1JX4A 4H4KA 3H4DA 4AFFA 3VAFA 5D8HB 4NI2A 4O3RA 2N82B 2OELA 3O3LA 3H5XA 3DGPA 3PJXA 2V9KA 2WAQD 1H73A 2KYXA 1TVRA 3HMJG 5F8JA 1IKYB 4RBVA 4ZVEA 3PV8A 2JHEA 4Y2KA 1EETA 2K1RB 4ZPDA 1RTIB 2RQ4A 1RKIA 3GWCA 3SDEB 1EX8A 1CJKA 3US5A 1VJWA 4TYBA 2NYHA 3ENAA 1LWFB 2C42A 2W2NP 3A3NB 1Q5VA 4LF4F 3IG1A 1BWVA 3S1TA 1FX4A 3PIPQ 1F0XA 1UVIA 2YWEA 4JP8A 1M1KT 2CFXA 2LMIA 4GO7X 1VHIA 1H0HB 3M6WA 3HKZD 4DV7F 3IRXA 3EM1A 2FHMA 2L48A 4MYUA 1MROB 4TLQA 1RWVB 5GMDA 3KJFB 1B99A 2KFNA 3T1YJ 4IH7A 4KRWA 3OL6A 2DNMA 5E0OA 3ISZA 4O4GA 1NKCA 1KWMA 2NXEA 2FLNA 4K0KF 1N88A 4ES1A 2DNRA 2MLZA 1JK9B 2IY5B 4G6VB 4I7FA 1IKXA 3I32A 1LWCB 1SKSA 2CJBA 3OLAA 4X65J 2C3YA 4DV4J 2DXDA 3I0SB 1I94F 2HRYA 5ETNA 2CQIA 1R6VA 1D1UA 5HANA 5E5NA 2R7VA 3M2VB 2KFZA 1LFPA 4KFBB 3QPIA 2W9CB 2YNFA 4OJ1A 5J2QB 1VC5A 4QJVA 4DUYJ 5LJ5Y 2MLYA 2GHWA 2YKOA 3M8QB 5E3CA 2LEAA 4DS5A 2HAFA 1AZSA 1TFYA 3NG8A 2J5AA 4OV1A 4NXNJ 3AA9A 1WG4A 1YJ9S 4UZBA 3R97A 3D1QA 4DSIA 4KR0B 4L3NA 4OZ5A 4C8LA 1UWAA 3PRVA 1TZ0A 2I2YA 3UDEA 1RKJA 2COLA 2RKIB 4UY8T 1TQLA 2MYFA 2R9LA 4JI5F 4IH5A 2X3GA 1SIWB 2HQGA 3KJVB 3DLKA 2WK4A 2D3UA 2CJKA 1XC9A 3C2PA 1RU1A 2F1FA 5F3TA 2JFDA 2ALZA 3MEGB 1FDNA 1RTJA 1U26A 3T41A 3A8JA 4HACA 1UVMA 4O3NA 5D15A 3QJLA 2YNHB 3TVKA 2CPYA 2FC9A 1S7IA 1X5TA 1VOMA 3LA0A 3GG0A 1TK5A 1HNIB 4USVA 2E66A 4N47A 3MWBA 4C48A 3OT9A 2HS0A 2W1BA 1VCTA 3PW5A 3DM2A 2I5JB 1QJHA 2UUAJ 1NK4A 4QU6A 1VQOS 4LFCJ 4UOGA 3K57A 3SMZA 2Y8YA 2PMWA 5KFIA 3CJKB 3MCSA 3TVZA 4HTIA 3WIUA 3W2WB 4OYOA 1U8SA 4PWDB 2VHGA 2F8EX 5HVFA 3BSCA 1RT3A 2G2YA 2E29A 5KFSA 1KHVA 4JI6F 5H9FK 1X4CA 4A8YA 2E5LJ 4K5RA 3MMCB 4M5NA 2YPYA 3HJFA 5HN0A 2AGOA 5EWFA 5KG6A 4H4OB 3TZWA 5GVQA 3D68A 3MOZA 3Q83A 1ICEB 2YQ1A 4FF1A 2DCUB 3ZZZA 1BQMA 2IJRA 1RYSA 1MW7A 2YNGB 4M5JA 3W2VB 3RBEA 1S4FA 4DX7A 3H2LA 1WC6A 4N5SA 4CO5A 4LF8F 3PM9A 4ZJLA 3LPYA 3D67A 2MEWA 2ACYA 2KZMA 1REVB 4KYZA 4RW8B 4Y28C 5DZ7A 2LQ8A 2DR9A 4ECWA 2BACA 3HFKA 2VF3A 3ILLA 2NREA 2DNLA 4OHWA 3OFFA 4KBIA 1DLOB 3MTJA 2HVDA 3OTDA 1XERA 3H2UB 3B4MA 4LF6F 1YGYA 2HS3A 1F3VA 3MAHA 3MEKA 4NLSA 2HPUA 3MAAA 3CE8A 4ZPAA 4A8WA 1VQPS 1TKTA 1X9WA 3D66A 2MQ8A 1KKHA 3OTOF 4JI2F 1YJNS 2KB2A 2JEIA 1FERA 3RW6A 4YEAA 1HHQA 3DFEA 1X5PA 5I42A 1XK8A 4OQJA 4K4VA 4F4WA 1TL3A 3GYXB 2G0JA 4B9UA 4A46A 1QM9A 4PRFA 2J8AA 3AODA 4CNZA 4V1Ak 4TU8A 1WDDA 3D6TB 4DX8H 2KKHA 3NNCA 2HVIA 1RWOB 1S12A 4P72A 1KVJA 1IBLF 4F4ZA 3KLFB 2U1AA 2YWHA 4DL6A 2B51A 4N56A 3Q2SC 2HHUA 2G0IA 1L3KA 2UUCF 3W9HA 1ZM2A 5A2QU 3G4SS 1P9QC 1OSDA 2BW2A 3RGIA 1X4AA 1U47A 4F4YA 3C46A 3HX9A 2G2ZA 2ZITA 1HWIA 4CH0S 3ET6B 1WC1A 4MAKA 3DOMB 4FYXB 1N33F 4P7VA 2VV5A 4DX5A 5ETMA 4O3QA 3TVYA 2LEBA 3R2DJ 3K59A 4JBCA 1LXJA 1ZBTA 2LU1A 5K14A 2FZCB 2B5JB 1S9EB 2PN6A 4DR5J 5EWEA 2Q66A 2VA2A 2IMOA 4M63A 3OR2B 2L9WA 4K4UA 1FEHA 3N6MA 4OV6A 1FO1A 3MFHA 2GVZA 3UR3C 2XZWA 2QL9B 5JXSA 1S1XB 4OI2A 3BBFA 3GJQB 3E51A 3PX0A 3MEEA 1FCAA 2YWKA 2E9ZA 4DCOB 1IBMJ 4XK8C 3EPGA 4HI2A 4EO6A 3BDPA 1TMJA 2DH8A 5KG5A 4NL5A 3G82A 1ZPVA 3THTA 2XC9A 1WI6A 1ZM3A 4PUOA 4YR3A 2OTLS 3EVOA 4GKJJ 4DFPA 4JUZA 4IRCA 2IA6A 1BQNB 4RBTA 1EKRA 1RE1B 3CDUA 1S49A 3MR2A 4B3OA 1SCJB 4KGZB 1NDCA 3VZIA 4BC7A 3NKYA 3AOCA 5KG0A 2J7KA 2PMHA 1X4EA 3TO8A 4ZLPA 5EHHA 2ZVIA 1W7WA 3B54A 2YWWA 3WHIA 2C3PA 1JXEA 4QPTA 3ZNJ1 4Q44A 3FRZA 4C8OA 1TUVA 4W4MA 4OI0A 2EKYA 2Z8QA 5IWAF 1YQHA 4HTJA 2W8KA 4KT0C 3G8TA 4LRAA 4P75A 3OD2A 2AJ4A 4BLGA 2WOMB 2CDRB 3MOJB 1RWUA 3CO0P 1OY9A 3R5CA 2XMUA 4QIWD 5K20B 2FTRA 4EBDA 2AJ1A 1N0UA 1Y3KA 2JRSA 2JWNA 2K7KA 3OJUA 2HBYB 4F2SA 2VQEF 4E0DA 4K50A 2I38A 2YQ3A 2CG4A 2RUSA 3AOBA 4ZLNA 1JKHB 5C25B 4Q8FA 2KG1A 2KVQE 1WHYA 4UOFA 1ZM9A 1HYSA 1K47A 2WBRA 5KT7A 1UJ4A 1NKBA 1WTBA 2QA4G 3KK2B 4CLFA 2GJ2A 4N7TA 3SSQA 1HI8A 1IN0A 1U1MA 3AAWB 3ZZUA 3PW0A 2NZCA 1IM6A 2FLPA 2JFKA 1RT4B 3QIDA 4RZRA 3MECA 4I2QA 2EC2A 4ED7A 4A48A 3BB5A 1YDLA 4PWWA 1BE4A 1TL7B 3CWJA 2ZBPA 1RHKB 3J81Y 4QWAA 4OJHA 1HBUB 1NDKA 4WPAA 1Q5YA 3U02A 5H9EJ 3HVTA 1IUJA 2RIJA 5KT3A 4DSEA 3OFEA 4UW2A 2VOPA 1FDAA 1U6ZA 1YX2A 3S01A 5F9LA 4DR3F 4ICLA 4K4YA 1VQ9S 4IOCQ 2AX1A 1NH7A 4PXEA 2AYMA 1T03A 4DQPA 2DCLA 4QWEA 2X1FA 4U7UK 4ZIVA 1I5OB 2MKKA 3PHEA 1HWKA 2VQFJ 3H98A 1RTHB 3PYGA 2PIIA 3BPSP 4DV1J 1SC6A 4GVBA 1RU2A 1QVGR 4H4MB 4X4RA 4DPXA 1FFWB 3HSJA 5HLFA 4H54A 5C42A 3KK1A 1F2GA 1WNEA 1PAUB 2H54B 3PG9A 4WYWA 3QWUA 4NASA 1B0PA 1AT1B 1U8WA 4M5IA 3E2EA 3D3CJ 3ITHB 4TLRA 1YJUA 1Q4RA 5C24B 2GCFA 3MMBB 4RW9B 2EFVA 5A8WA 1CS4A 4IUFA 3GLJA 2PEHA 1KFSA 3IWXA 4NRUA 4MKVA 1T7PA 2R2UA 5D3GB 3W5XA 4ZIWA 2QA4S 1HMVB 2ZBQA 1NK0A 3K7RA 2ZKUA 3GU0A 3C66A 1NLKL 4LF4J 4ECZA 3GJSB 2RRAA 2BJ7A 4DR1F 2AHOB 4W90B 4DV7J 5HMWA 2MZRA 3QO9B 2V6AA 4WBFA 4DHVA 4ZCIA 1RWNB 3VGVA 2G1HA 1HBMB 1N8RT 2OSQA 2LA4A 3KMSA 3EICA 4WKYA 3I96A 5BR8F 4K0KJ 2OEKA 2H48B 4XAKA 3TAQA 3WIVA 2GMJA 1V5VA 2B7BB 2FGCA 3MM6A 3IWNC 1YRXA 4ECXA 1JLEB 1FTRA 4CRJA 1GMWA 3CJ8A 2OPPA 3PW7A 1U2FA 2NCKL 1I94J 3TEGA 4LF7F 2VJUA 1XR6A 3WC0A 4L73A 3R9LA 1UFKA 4FZVA 1O51A 1U1PA 2YQ0A 1N56A 4OYIA 2R7RA 2YTCA 4F4KA 2CRLA 5F0WA 3PEJA 4NMXA 1IKYA 1RAAB 4DXLA 1X4DA 1S76D 4C8YA 3DKDA 4ZHRA 2ZDPA 2K1RA 4DN9A 2ROGA 3OTCA 4L3KA 1Y11A 3EGVA 3QAUA 1VQ7S 2KT3A 2AJQA 4YHHF 1XWLA 2MZQA 4ZJOA 2BANB 1TTHB 2LVWA 2E1PA 2HLTA 5J1PA 1LWFA 2R2TA 2QMWA 2B9WA 4F4AA 2IIHA 4JI5J 2MB0B 4K4XA 3FGVA 3DOKA 3QIPB 1NH8A 2DHHA 1C1BB 2B4OA 3RB4A 3JSMA 2LEPA 3D7SB 2IFXA 1ROFA 3TOQA 1IBKF 4USJC 1MROA 1M5PC 3I0RB 3L7PA 4DQSA 5ETOA 2DK2A 4M94A 3IA0A 1S1VB 4FF3A 1SQGA 4Y3CA 3BBCA 5KFVA 4DI6A 1W2IA 3T1AA 3DNCA 2O5DA 2VFSA 2NXNA 2GO8A 5I3PA 2H5EA 1LWCA 4RNHA 3OPKA 3Q8UA 2X1AA 3QZ8A 3UDLA 3VAHA 3FJ2A 3MF5A 3ZZYA 2MXYA 5IXUA 3I0SA 4J9NA 3M2VA 3LUYA 5DM6Q 4WK3A 3PRDA 4O0IA 1MWQA 5L1IA 3SFUA 5J2QA 2GIFA 4JI0F 2V2KA 3GIIA 4ED8A 1FRXA 1NDPA 5CYMA 3R7BB 2CNOB 4ZS6A 4ZPCA 4JI6J 1WF2A 4TVAB 4F26A 1FRKA 3CJ2A 1TL4A 4FP9A 2CNNB 3SFGA 3EX7B 1E6VB 3RAQA 1MNEA 4K4WA 2F4FA 3J81U 2GZOA 3FEZA 4DL3A 1HWLA 5KFXA 2HVEA 2QC3A 2DHXA 5DLGA 2RKIA 2BM0A 3CCSS 7FD1A 8RUCA 2MQMA 4OI6A 3FKBA 3KJVA 4DN0A 4DPOA 2KO1A 3G2XA 1SB6A 3HVAA 1R0BG 3TJ8A 4LF8J 2RRBA 4M1KA 2E5IA 3SXLA 2L08A 3MEGA 1YBTA 3GV5B 2FZKB 3FEYB 2RAQA 4KQZA 1F5CA 3M8PB 1T3NA 3B6BA 4I2PA 1F6TA 3NCRA 2HGNA 4DUTA 2OLWA 4RUCA 2XULA 4XIUA 4WCEQ 2I5JA 2I1RA 2KVIA 3KHHA 4LF6J 1VDHA 1L3UA 4C7QA 3FSYA 3CJRA 2FYXA 1R8AA 1HNVB 4NLQA 4KH1B 3TA1A 1NK6A 5I4MA 2YKAA 1DZ5A 4JI2J 1P9YA 4Z7CA 2RS2A 2MZJA 1PBAA 3VTIA 1FJCA 2GHVC 1IR2A 1B4SA 1O5JA 3MTKA 5LOQA 4RJVA 1RACB 2YVSA 5KFPA 2B0GA 4AT1B 2DY9A 1NHKL 3MMCA 4CYUB 2HWHA 2DISA 3NNHA 1L3SA 5F8IA 5KT6A 4C97A 5CAAA 3UNGC 1QVFR 2QA1A 1AROP 3D1OA 1H38A 3FQKA 2XSFA 1G1XA 1WC5A 1IBLJ 2YNGA 3FBBA 2GHPA 3G6YA 1U7LA 2W7AA 3W2VA 1DQ9A 3HVRA 3NNAA 4FXDA 3KLVA 2ZM6F 2R2SA 1TKDA 5D6GA 2UUCJ 1Q82T 1X31C 1GFWB 1REVA 4HR2A 3RBDA 3AD9C 4RW8A 1GMWD 3PNIA 2QG9B 2UZAA 1ZA2B 5F8HA 3IBCB 1NB7A 2VPWB 2XBPA 1NSAA 3V5RA 1V5IB 3GZ7A 4MIAA 2CJAA 4NCAA 4ZVGA 3OHBA 1DLOA 1N33J 1Y5NB 3ZO7A 3FMBA 1FNXH 4IDKB 2OPRB 3N9UC 1M90T 1SH3A 2OPSB 4I69A 1SC4B 1V3ZA 1RXOB 2XTJP 5HVHA 4DPWA 3BM7A 4V19J 2B7CB 1HPZB 3NS7B 2H51B 3N79A 3CCTA 2ADCA 1JLQA 2ZJQQ 3QGIA 4HHJA 2HBQB 3OL7A 4WKRA 3UW1A 4DL0C 4KKOA 1PJ7A 3M30B 1YJWS 4ZVUB 1NSQA 1CSJA 1CJUB 4AXJA 4LF5F 4M8LA 2Z58B 4R8UB 5K8NA 2FHKA 2XWXA 4G65A 3M05A 3OL9A 2MQNA 2FIUA 5L9XA 4DWIA 3KLFA 4DV3F 4Y2IA 3MURP 2AWZA 2DH7A 4DSFA 2Y1RI 4JI4F 1KQSR 1VQ8S 4RL1A 3BSNA 3N6LA 4NCGB 2ZBCA 3AQOA 1S77D 2A2CA 2H5JB 4HDHA 4ZCMA 2OP5A 3RB0A 2Q43A 3HK2A 2AP6A 2DEIA 1D3WA 5IWAJ 2HK2A 5DQHA 3V2UC 4HT5A 3M2UB 1YG0A 4AD6A 3TRGA 3MM9A 2Q6BA 4F02A 4QIFA 1SUQA 4WP3A 3C19A 4JI1F 2DGXA 5FLXY 4Q43A 1UW4A 4TNOA 3LGNA 4IYQA 2VBYA 5T7LB 2B5JA 4LBPA 2LQBA 1X60A 1VI7A 2DO0A 4OI4A 2VQEJ 5SUHA 3M8SA 4ANDA 1DTQB 3OR2A 1C4CA 1CJTB 4Z7YA 2FJEB 3BQ2A 2VASA 1O0PA 4NEYA 1U25A 2HLUA 1S1XA 4WIIA 2A6OA 1AXQA 3R7SB 4LF9J 1RT6B 4K7QA 2YPZA 2XNQA 3UCUP 1VYAA 2FDNA 3KWMA 1BLUA 2D9OA 4OYWA 3NGSA 4DR2F 2RDIA 3CO9A 3HSDA 3ILOA 2M8HA 1Y5LB 5D4OA 3BQ1A 4I6WA 5HMXA 1BQNA 1UA1A 2D3ZA 3Q23A 3CCES 4OX9F 1FKPB 3VVUA 2FHOB 4R5PB 4TXSA 1LWEB 1TV6B 2VD3A 2OPQB 1HLWA 1WJ9A 1NJZA 5HP1B 2V4QA 4FF2A 4CCHA 1C0UA 3CNQP 2WOMA 5HROB 1H3DA 3MD1A 2RJZA 3BN7A 4RO0A 4DR3J 4C8ZA 2QX0A 2WTFA 4ZVRB 2CKWA 3GYGA 2H1YA 2EI5A 3NL0A 5DDQC 3WBZA 3CB4A 2K3KA 3PR4A 3NS6A 3QYYA 3DGPB 4DL5A 3MCMA 1JKHA 5C25A 1Q8LA 1R43A 2W2OP 1BY9A 5AJ3F 1RYRA 4S0MA 1VIXA 2B4VA 3MAQA 1EETB 1EP4A 2M88A 5KFRA 2F3JA 4WU2A 4MKAA 3SCKE 2ZBIA 4RUHA 3QT8A 4ZPVR 2IA0A 4ZN1A 1KR4A 1V3SA 3DRPB 2ZNYA 2ZH3A 2A1BA 4PXDA 2KXHA 5G0RB 1C1CA 2XY7A 1WOOA 1WTFA 1W26A 5KG3A 4USMA 4LQ3A 1MG7A 2QV6A 4DU8A 1WSRA 3NGTA 6FDRA 3IG1B 2MQPA 4J5OA 4QYZJ 1M0SA 1FWPA 3IBWA 3IGVA 3PFOA 3EGWB 3IRXB 2FJVA 2C3OA 3NAIA 1U4BA 2WSEC 3P5TL 2RUGA 3HCXA 5AE1A 5THWA 4RNMA 2KI2A 1WOPA 5J2MB 1Y00A 4FXVA 1TL7A 1H2TZ 4P2FA 2VH7A 3PY8A 3TX8A 4C3MA 2QTWA 3T6JA 2JEJA 4Y65A 4Z37A 5L38A 5MLCV 4OX8A 2K8GA 2RU9A 2BJ3A 3BH7B 5IV3A 3HF5A 4CWBA 2P6TA 4U8VA 1YBUA 3UQSA 3ETMA 4OYBA 3HI9A 2HQIA 4C3KA 5L1LA 3CC4S 5BR8J 5GAHI 4FS2A 2PMZD 3GIRA 2QLJB 4MIWA 4D3GA 1AA1B 5B09A 4ZLJA 1XQIA 1FFGB 3CCWA 2ZD1B 1VC0A 4Y2CA 4BS2A 1MMNA 3RU0A 4H4MA 1U0SA 2HNYB 4LF7J 2RILA 1SKUB 1CC7A 5CXTA 3D6HB 1NK5A 2ZH4A 2XB2D 2J9CA 3G86A 4JOUA 1I51B 1S72S 1X4BA 2V50A 1P8GA 1RCXB 3TUIC 1UFLA 4RW6B 3ILIA 5C24A 5ETRA 3NOGA 3MMBA 1U48A 4RW9A 3BGRB 3QGGA 2CQ2A 5DGBA 4OLOA 3M6VA 2CWKA 3TZZA 4JI3F 2OUGA 4BWJA 4ZOSA 3O6QA 5D3GA 1W25A 3KG0A 2MY7A 2HGLA 3QWPA 4UUWA 3VGUA 2V68A 3DMJA 4X2BA 4B3MF 4ILRA 2MHNA 2FD2A 3ULHA 3P4UB 3DM2B 1RSCA 2EFNA 3F73A 4Q0BB 3K0JA 4UQTA 3AD7C 3MM5A 2B3TB 2YBVA 2EEYA 2P8IA 2C1EB 3QO9A 1IBKJ 4EFAC 3MHYA 2KL8A 2IRUA 2CPJA 3M7VA 3GTYX 3OFGA 3K5NA 2CQGA 1HBMA 1RLDA 2VBXA 2V34A 2AYGA 4CO3A 1PO6A 2NR0A 1PKUA 2YH1A 1R31A 3HDSA 1FDDA 1KRPA 1MLAA 1GXLA 4QOTA 2V8VA 1KHWA 3MI7X 2UV8A 3NWRA 3I5AA 3Q22A 4QPXA 1JLFA 4ERDA 2EFPA 3FC9A 2OD4A 3NBPB 4QYZK 2B6AB 1R0CB 5F8MA 2E1AA 3N01A 1IBCB 1KDNA 8ATCB 2QMXA 4LBHA 2HAIA 4JI0J 2MPUA 2AIRB 2IM3A 4J9RA 2QEXS 3MMAB 4DFMA 1KQKA 1Q16B 4KO0B 3DOLA 2FJXA 3B78A 4YR2A 5M2RA 2RSQA 5CABA 4PABA 1H72C 3KHGA 2BANA 3MPUB 5HATA 3AJ1A 4I67A 4A4JA 5B08A 1NZAA 3NMAA 3QIPA 4NA1A 2KH9A 1FD8A 4KB7A 3NGDA 4Q5VA 1GAOA 3IAS9 2Z0GA 2R8IA 1S7HA 4DDFA 3BSAA 1YKWA 1S1VA 1X4HA 4NCBA 3L7OA 3C16A 3TX0A 2BJDA 1M5SA 4QW8A 1QD1A 4USTA 4CO4A 3RR7A 2DNGA 1X8DA 2R2RA 3FRYA 1T94A 4LIWA 3DHXA 4FXWA 4F50A 1UETA 1NAQA 3CPWR 4B9VA 1NRKA 4Z2XA 4U8YA 3V6DB 2XCPA 4PWUA 4CI0B 2LLZA 5BYQA 1MN7A 4LRDA 3H20A 5A0YB 1KOOA 3BBBA 3GCWP 3AJDA 1OJ4A 1TK8A 3CJ3A 2NSCA
chains in the Genus database with same CATH topology
2C2MB 2XYPB 1RWPB 1GFWB 1SC1B 3R6GB 1QTNB 2HBRB 3R6LB 3R7BB 2CDRB 3R5JB 1RHRB 1RWOB 2CNOB 4LSZB 4DCPB 2XZDB 1RWXB 5IC6B 2XYGB 2QL9B 4JB8B 3IBCB 3RJMB 1RHMB 3D6HB 3R7SB 1PAUB 5K20B 2P2CB 1SC3B 2CNNB 2H54B 2QLFB 1RHUB 3GJRB 4ZVRB 3GJQB 2H48B 1I3OB 1I51B 3D6FB 4DCOB 1RHKB 2C2KB 2CJXB 2H4YB 2FQQB 2HBYB 1RWVB 1F9EB 2C2OB 3KJFB 4ZVOB 5IC4B 3GJTB 2H5JB 3EDQB 2CJYB 1BMQB 1SC4B 4ZVTB 1RWMB 2QL7B 4ZVQB 1IBCB 2Y1LB 2C2ZB 1RWKB 3KJQB 3NS7B 1RWWB 1RE1B 2H51B 2XZTB 2QL5B 3R7NB 2CNLB 3EDRB 3P45B 2H5IB 2HBQB 1PYOB 2HBZB 3P4UB 1RHJB 3IBFB 2Y0BB 4ZVPB 3GJSB 1ICEB 2QLJB 3QNWB 4ZVUB 3SIPB 2C1EB 2QLBB 2CNKB 2H65B 4DCJB 2DKOB 1NMEB 3KJNB 2XYHB 3D6MB 1QDUB 2H4WB 1RWNB 4ZVSB 1RHQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C2M B;  2XYP B;  1RWP B;  1GFW B;  1SC1 B;  3R6G B;  1QTN B;  2HBR B;  3R6L B;  3R7B B;  2CDR B;  3R5J B;  1RHR B;  1RWO B;  2CNO B;  4LSZ B;  4DCP B;  2XZD B;  1RWX B;  5IC6 B;  2XYG B;  2QL9 B;  4JB8 B;  3IBC B;  3RJM B;  1RHM B;  3D6H B;  3R7S B;  1PAU B;  5K20 B;  2P2C B;  1SC3 B;  2CNN B;  2H54 B;  2QLF B;  1RHU B;  3GJR B;  4ZVR B;  3GJQ B;  2H48 B;  1I3O B;  1I51 B;  3D6F B;  4DCO B;  1RHK B;  2C2K B;  2CJX B;  2H4Y B;  2FQQ B;  2HBY B;  1RWV B;  1F9E B;  2C2O B;  3KJF B;  4ZVO B;  5IC4 B;  3GJT B;  2H5J B;  3EDQ B;  2CJY B;  1BMQ B;  1SC4 B;  4ZVT B;  1RWM B;  2QL7 B;  4ZVQ B;  1IBC B;  2Y1L B;  2C2Z B;  1RWK B;  3KJQ B;  3NS7 B;  1RWW B;  1RE1 B;  2H51 B;  2XZT B;  2QL5 B;  3R7N B;  2CNL B;  3EDR B;  3P45 B;  2H5I B;  2HBQ B;  1PYO B;  2HBZ B;  3P4U B;  1RHJ B;  3IBF B;  2Y0B B;  4ZVP B;  3GJS B;  1ICE B;  2QLJ B;  3QNW B;  4ZVU B;  3SIP B;  2C1E B;  2QLB B;  2CNK B;  2H65 B;  4DCJ B;  2DKO B;  1NME B;  3KJN B;  2XYH B;  3D6M B;  1QDU B;  2H4W B;  1RWN B;  4ZVS B;  1RHQ B; 
#chains in the Genus database with same CATH topology
 3UD5 A;  2BKP A;  2RQM A;  2AGP A;  1H74 A;  5C2C A;  3C14 A;  4MK9 A;  3OXG A;  2NS1 B;  1K1Q A;  4UZC A;  1RA7 A;  3RTV A;  1CLF A;  2V5H G;  4B3T F;  1E6V A;  1PYS B;  4WXW A;  3HZG A;  1K0T A;  1TK0 A;  3W5Z A;  1AW0 A;  3JSR A;  4DOZ A;  1FFS B;  1GTE A;  4OZJ A;  4NLP A;  3DC2 A;  4FKX A;  3FK4 A;  1U6B A;  2LDY A;  4MT1 A;  5KFA A;  1R8C A;  3ZC4 A;  1FWK A;  2R7W A;  1QTM A;  2A18 A;  1G6B A;  5IZH A;  2F5G A;  3LOU A;  3MUV P;  2O1P A;  3MM8 B;  3QSI A;  3J7Z T;  5J1E B;  4AQY F;  4IRD A;  3IN5 A;  3B82 A;  3MDF A;  2GJI A;  2ZM6 J;  3Q8V A;  1B70 B;  1K44 A;  3OL8 A;  1EB0 A;  3S7R A;  5HMZ A;  3L95 X;  4HL9 A;  4RKU C;  1RBL A;  1WOS A;  4IQX A;  3NCQ A;  4LVN P;  3RRH A;  3TAP A;  1S59 A;  5EX3 A;  4PQA A;  4C3L A;  3JYT A;  1IWG A;  1WG1 A;  4NLV A;  2H4W B;  1RAH B;  1X9S A;  2CPZ A;  2E5H A;  3BGF A;  4OHX A;  1U1L A;  1HNV A;  2PEB A;  3W61 A;  5E3R A;  1Y3J A;  1HWJ A;  3PDN A;  5B0C A;  3TR5 A;  2J6T A;  3GQC A;  1Q0N A;  5EUH A;  3S8S A;  1FRI A;  2QLW A;  5U47 A;  1AB8 A;  4B3O B;  1RLC L;  1S10 A;  1HW9 A;  4TQS A;  4LRC A;  3RBX A;  1WEZ A;  3R2C J;  4K8R A;  1N5Y B;  2Z56 B;  2V63 A;  1S5Z A;  4CYU A;  2NQP A;  4ZP8 A;  1SXL A;  4R0E A;  2G1D A;  3NEK A;  2WZ1 A;  1G4C A;  1BC6 A;  4PZV A;  4LFA F;  5IT9 U;  2XM3 A;  3HFZ B;  3K5L A;  3BQ0 A;  4DV3 J;  1S0V A;  4X4S A;  4B3R J;  2CZ9 A;  4JI4 J;  4NLR A;  4NZ7 A;  4KGM A;  3D6M B;  4XTT A;  4N8O A;  2DRA A;  2CAJ A;  4B9N A;  2N4D A;  1EJ7 L;  1XIQ A;  2LQ9 A;  2BZ2 A;  1Q8I A;  4X4T A;  4F25 A;  3JAM U;  2WBM A;  1HNX F;  2WB4 A;  2XYG B;  4TY8 A;  3HSG A;  2WON B;  2GS8 A;  1HYS B;  3M8Y A;  1WC4 A;  2CQB A;  3LH2 S;  5J1N A;  4JI1 J;  1MWY A;  4ID5 B;  4IDK A;  2OPR A;  5DDO C;  2OPS A;  2F63 A;  2UVR A;  1OQ3 A;  3CCZ A;  1HBN A;  2IAJ B;  4MIB A;  3Q0A A;  1GT8 A;  2RML A;  1R89 A;  2OFH X;  4CT9 A;  4OI1 A;  3PW4 A;  4DLG A;  4GMK A;  2OH2 A;  4MKB A;  3OVB A;  4FPR A;  1HNZ F;  1ZPW X;  1DFD A;  4M5G A;  3M30 A;  1QLN A;  4JI7 F;  4HHU A;  3KNG A;  3UDC A;  4KV8 A;  2L41 A;  5KFD A;  2H65 B;  4DCJ B;  1TKZ B;  2PC6 A;  1R7I A;  3F56 A;  1B7F A;  2DR6 A;  3DLH A;  2VG5 A;  1RTD B;  3CXC R;  3FZ2 A;  4DR2 J;  3QFH A;  4DU7 A;  4LRE A;  1ZZN A;  5HK4 A;  2DIV A;  4L6V 3;  1VQ6 S;  5HAO A;  2VPZ B;  1VIS A;  1HBO A;  4HH1 A;  4CZC A;  2ZH1 A;  4PYA A;  3PKY A;  4CLS A;  5CHC B;  4DPT A;  3PHT A;  5D0H A;  4ICL B;  2VL1 A;  3LP2 B;  4OX9 J;  1OSC A;  1HFE L;  3J7A 1;  4NCG A;  2CPX A;  3DYA B;  4E2F B;  4CO2 A;  2HFS A;  4B3S F;  4DZD A;  4DV6 J;  2HFO A;  1VQ5 S;  3GIK A;  4JV5 F;  4F3Q A;  5AE2 A;  5D78 A;  2F9D A;  3WX4 A;  2HQ3 A;  3JSB A;  5F3Z A;  3M2U A;  3KUG A;  1NPP A;  2P5V A;  3MED A;  2QZ8 A;  3IWL A;  3VF0 B;  4KAI A;  4TU9 A;  1WDT A;  1BWE A;  4DR4 F;  2B8P A;  2HHW A;  1VS3 A;  3TW0 A;  3HHE A;  3WDO A;  5T7L A;  3PXG a;  1UCN A;  3EVW A;  2CPH A;  3A8I A;  2IJN A;  1DTQ A;  1JJC B;  4QQB A;  2VBZ A;  1UEU A;  2LXF A;  1FXR A;  2H9Z A;  5AJ3 J;  3HXM A;  3R5B A;  2CQ4 A;  3OW2 R;  2AJF E;  5A8K B;  3J7Y U;  1RT6 A;  3U1M A;  2V69 A;  4LIR A;  1M1H A;  3IAM 9;  3JQK A;  3NMR A;  2DB1 A;  3W9I A;  4EZ9 A;  2ALY B;  2ZH2 A;  1Z2L A;  4RW7 B;  3BO2 A;  1R8H A;  4DJB A;  4AL6 A;  2V8P A;  1D9D A;  5KT4 A;  1XJW B;  2LCW A;  6FD1 A;  5IS2 A;  4OJ3 A;  5M2P A;  5A6W A;  3HHD A;  2CNL B;  2CZV C;  3PX6 A;  1Q7Y T;  2VG7 B;  2H5I B;  1VK3 A;  4R25 A;  2VOO A;  4R5P A;  2W4D A;  2HMI B;  5EGY A;  2ZNZ A;  1SL1 A;  1R3N A;  5HJY A;  4F7V A;  1TV6 A;  2WRM A;  4CH1 A;  2OJ3 A;  2OPQ A;  2JLG A;  2UU9 F;  2C22 A;  4C11 B;  5CCL A;  3IR6 B;  3FCH A;  4UOC A;  2ZE2 B;  4DG1 A;  4PPD A;  4Q2M A;  5HRO A;  2EG1 A;  4NZ6 A;  4G1P A;  3BGU A;  4J37 A;  2N3O A;  1MN9 A;  5DO2 A;  2YWG A;  5LSR A;  1VMB A;  5LSO A;  4ECV A;  2HRU A;  3HHL A;  1U49 A;  3X3U A;  3QGH A;  4LF1 A;  1FTC A;  1MMD A;  5B7W A;  4YB6 A;  4HYK A;  2GIR A;  4EK2 A;  2F8H A;  2ATL A;  1NM2 A;  5DET A;  1HIY A;  4ZHR B;  4OYX A;  3T5L A;  1N32 F;  2UXD F;  2ZH6 A;  4NLU A;  5DDP C;  4JI8 F;  1WKK A;  3AQP A;  1ULR A;  3N0V A;  3DRP A;  5H9F J;  5G0R A;  1ZET A;  1ACM B;  2J6U A;  1T05 A;  1NXI A;  2AU0 A;  3OVA A;  2VON A;  3CDA A;  3KFW X;  2R3V A;  3DOK B;  4DF8 A;  5GAE I;  1UJ5 A;  5KFT A;  2CA9 A;  4FNH A;  3JSM B;  1RWP B;  5HI7 A;  4JI3 J;  3A8E A;  2E1C A;  3LW5 C;  3DCA A;  1XEZ A;  5J2M A;  5A2Q Y;  1U2C A;  2E7V A;  3KLI B;  3EMT A;  2QSW A;  4J90 A;  3V6H A;  2R8K A;  4B3M J;  1C2P A;  1SL2 A;  1VLY A;  1LEO A;  2WSF C;  2VZ9 A;  4YR0 A;  2VJV A;  3BDE A;  1FT8 A;  1ZYQ A;  2Y0S D;  3GIL A;  2ASD A;  4GC7 A;  2XNR A;  1U6F A;  4CP5 A;  2CQ0 A;  1KP6 A;  3K8W A;  2DO4 A;  1LFW A;  3N28 A;  4WE1 B;  1JB0 C;  4CLW A;  2XSJ B;  4DS4 A;  4RPF A;  2NUH A;  4CTA A;  5GAH U;  2VC0 A;  4Y2M A;  3HP6 A;  3EUN A;  3MZI A;  2KHC A;  3QJP A;  1DAR A;  4J9S A;  3V4M A;  1VBX A;  3MPW A;  5CYM B;  4OZ0 A;  3HT3 A;  3PYE A;  3SV4 A;  4PR6 A;  3A8K A;  4CM0 A;  1TL1 B;  3CJ4 A;  2ZD1 A;  5KFQ A;  6AT1 B;  2QFI A;  3GFZ A;  2HNY A;  5E41 A;  4B9S A;  4A8M P;  3NGK A;  5LT5 A;  1HI0 P;  2VFT A;  4F04 B;  4DLE A;  5CQG A;  5ADZ A;  2SXL A;  4QIE A;  4DFJ A;  1VQK S;  1Y0H A;  4IG3 B;  1JXV A;  3TA0 A;  3JQJ A;  4RW6 A;  4J9Q A;  3TP2 A;  3BGR A;  3BS9 A;  3UN3 A;  3GV8 B;  3CVK A;  1PIL A;  2J9D A;  4Q2L A;  2B8Q A;  2CJY B;  1FKA F;  3SSS A;  1UW9 A;  3BO4 A;  4ED6 A;  2LEC A;  2GVD A;  3PAC A;  1SVD A;  2IPO B;  4I2P B;  4EZ6 A;  3CW2 C;  4DR7 J;  2DNO A;  1U2R A;  1TEL A;  3CME S;  2E9T A;  3DLL Q;  2IVM A;  4C9D A;  3CED A;  1RAF B;  4LJM A;  4MMO A;  4Q0B A;  4M5M A;  2DJW A;  2AEF A;  2ROE A;  4K4T A;  1FWL A;  5D4N A;  2PI5 A;  2MMY A;  4OL8 A;  2PGC A;  3RRK A;  4HT7 A;  4RLE A;  4ILM A;  1TMM A;  1EQ0 A;  3DXS X;  4I56 A;  3IRW P;  3L09 A;  2AX0 A;  2IM2 A;  1SL0 A;  1PJ6 A;  3TAM B;  3T1Y F;  4LVO P;  2BRK A;  1UZH A;  3IM8 A;  2BOP A;  5ETK A;  3C3L A;  1WF0 A;  1S6O A;  3GV7 B;  3RJM B;  4XO0 A;  2BE2 B;  5ETQ A;  5T41 A;  1YJ7 A;  1SKW A;  4P2X A;  4DV0 F;  1FJG F;  1B64 A;  3CD6 S;  1PGZ A;  2HHQ A;  3NBP A;  2B6A A;  1H7W A;  3OQ2 A;  1S79 A;  2VKZ G;  4FBU A;  3W64 A;  3D0I E;  4RNN A;  3QRQ A;  1QUP A;  4URS A;  2KM8 C;  5EWG A;  2ZUA A;  4ECR A;  2CPE A;  4BBY A;  2V2Z A;  3MR5 A;  3MMA A;  2WVB A;  2XMJ A;  1T9T A;  2Y0B B;  4KO0 A;  4DL4 A;  4NXM F;  3KYL A;  4B3T J;  2B56 A;  3QNW B;  4AYB D;  2AZ1 A;  4NML A;  4XDD A;  3CF5 Q;  1GEH A;  2ASJ A;  2IBO A;  4YDD B;  1F3F A;  4OYM A;  2KN4 A;  2M9K A;  3VWS A;  1Q8B A;  5E3A A;  2LFV A;  3GSD A;  4LSZ B;  4DQR A;  2Q79 A;  1DJ0 A;  2E7W A;  5D0E A;  1SC3 B;  2L9D A;  4AQY J;  1R6Y A;  2EFQ A;  2HUR A;  3W62 A;  1SJ4 P;  1J5O B;  4IO9 Q;  1Q79 A;  5D0R A;  1JLQ B;  3AHP A;  1IM4 A;  2B43 A;  1Q95 G;  2Z30 B;  1JMT A;  3UI3 A;  3V6K A;  4KKO B;  3H90 A;  1WHV A;  1BD6 A;  4F3O A;  5IT4 A;  1YRT A;  2UUA F;  2BM1 A;  1EKS A;  2W2P P;  1FNM A;  3V6D A;  2NSB A;  2NUU G;  4AL5 A;  2FY1 A;  3KUH A;  3M9M B;  1C4A A;  2MKC A;  5A0Y A;  1B3T A;  1NPR A;  4ECY A;  2KRR A;  2OI2 A;  5KG2 A;  2CG8 A;  4DL2 A;  4USU A;  3D28 A;  4RWX A;  5DM7 Q;  5IQQ A;  2MZS A;  1RWX B;  3QRR A;  1G3O A;  2HKE A;  4C8N A;  1X5O A;  1SPB P;  3SSR A;  3AY0 A;  3LWM A;  2FVS A;  4ZN3 A;  2CPD A;  3R8Y A;  3GYN A;  4LFA J;  5HVG A;  2QYC A;  2HHS A;  4OHV A;  4ATN A;  3MM9 B;  2PDA A;  2MKJ A;  2DNH A;  3EDQ B;  1RCO B;  3ICL A;  1BMQ B;  1CPZ A;  4PKD B;  2VFU A;  2K7J A;  4OZ1 A;  1SUQ B;  3MM8 A;  1KVK A;  4BDP A;  4K4S A;  1JQG A;  1CVJ A;  5J1E A;  2DNY A;  3Q8R B;  3PTW A;  3CMA S;  5DZ6 A;  3TUJ C;  3P45 B;  3PR5 B;  3NAH A;  3DRY A;  3J81 j;  1WKL A;  3JB9 k;  4M5K A;  3NS5 A;  1HNX J;  1HQE B;  2ADB A;  2GQ2 A;  1VRU B;  1WAC A;  4M5H A;  1HA1 A;  2X7I A;  4HDG A;  3TWZ A;  2XHW A;  2XMV A;  1LQ9 A;  2MTL A;  2QO3 A;  1M1G A;  3AA8 A;  5KFC A;  2N3L A;  2D69 A;  1G2E A;  2OHD A;  1R8B A;  2O3D A;  1OIA A;  3BSO A;  2DNP A;  2ZWO A;  1URR A;  3I4H X;  4ED0 A;  3UO0 A;  1SJ3 P;  3MM7 B;  3N6N A;  2R8H A;  2WB1 D;  1B7Y B;  2XQC A;  2HG4 A;  1LKZ A;  5KFZ A;  1BGX T;  2ZH8 A;  2Q6C A;  2L3M A;  4I6A A;  1V6H A;  1HNZ J;  2MGZ B;  4ED2 A;  3QAT A;  3SQO P;  4LR8 A;  1FEE A;  1IKW B;  2E44 A;  2VIH A;  1N5Y A;  4JI7 J;  1WSV A;  4HH0 A;  2CQD A;  5K5M A;  5CZV A;  3J7A N;  2RB7 A;  1E6Y A;  3AXK A;  4TKT A;  2KU7 A;  3EZ5 A;  2HVH A;  3NCP A;  3GP9 A;  4P7T A;  2AEM A;  2APO A;  2JLE A;  3UD4 P;  2EBG A;  3FMW A;  2VC1 A;  2ZH5 A;  1C0U B;  2KHD A;  2HNZ A;  3CCJ S;  2N7C A;  3Q2T C;  2C2D A;  1FKO B;  4ILL A;  1B0V A;  1N5V A;  4OI3 A;  2XGP A;  1JJH A;  4NPO A;  4G1I A;  1QTN B;  4TQR A;  1W2B R;  3BF4 A;  3R1H A;  4B3S J;  1RHR B;  1TAQ A;  1N48 A;  3L4B C;  3RR8 A;  4JV5 J;  1L3V A;  2XS2 A;  5CYQ B;  2Q3P A;  4GRS A;  2FZG B;  2WON A;  1VQL S;  4F0K A;  3GJR B;  1UA0 A;  1FES A;  5LSL A;  2DHS A;  3MPD A;  1EP4 B;  3SCJ E;  4IOB A;  3SYZ A;  4ZVO B;  3OUY B;  5D4L A;  4B17 A;  4DR4 J;  4ID5 A;  2AJ0 A;  4PG4 A;  4NYZ A;  2IAJ A;  4YQW A;  1S9F A;  2UVV A;  2QL7 B;  1C1C B;  3N4W A;  3CCU S;  1VIO A;  1QSY A;  2GAH C;  1PJ5 A;  1DQA A;  2VDI A;  3EDR B;  5B0D A;  2VG6 B;  2HIY A;  3D5M A;  3MCO A;  3GR0 A;  4G1Q A;  1IKV B;  2AD9 A;  1RAO A;  1TKZ A;  3HSZ A;  1NME B;  4V19 X;  1FD2 A;  1O8B A;  1UAW A;  4EYI B;  1RTD A;  4P2M A;  1RAI B;  3ENW A;  5AXL A;  3O44 A;  4O3S A;  3R5J B;  4QBU A;  3PO5 A;  1UMJ A;  4QR0 A;  2UXC F;  1FVQ A;  3M8R A;  2W7O A;  2QN6 B;  4O3O A;  4ANC A;  1IVZ A;  2XLK A;  3LP2 A;  2EW9 A;  1XMQ F;  3DYA A;  4RUB A;  4PEO A;  1Y5I B;  1I6J A;  1GX6 A;  5KFY A;  1P1T A;  2NYI A;  1SJQ A;  3AJ2 A;  2P9E A;  3M8W A;  4FYV B;  3IP0 A;  3ZTO A;  5F8G A;  3M4X A;  2EVZ A;  1IXK A;  4C2M A;  2QE5 A;  2UU9 J;  3W1Y C;  2ZOM A;  2GA7 A;  4IG0 B;  2GAG C;  4KPY A;  2ZZN A;  2AMC B;  2MLX A;  3C6U B;  4O44 A;  4CQ1 A;  4QCL A;  4C0H A;  3V6J A;  1D9F A;  3UN5 A;  4A8S A;  4USK A;  3IFE A;  1PC5 A;  4DV5 F;  2R7Q A;  5LXY A;  3LQV A;  3KLE A;  2QLB B;  2V8H A;  1U1R A;  5IV4 A;  3R5G A;  2JEF A;  4C8M A;  1A6L A;  2C2M B;  5LMN F;  5GME A;  1JJ2 R;  4LRF A;  2Z2Z A;  2JDJ A;  3G71 S;  5KFJ A;  5A8K A;  3GCX P;  2FVR A;  3HD2 A;  2DEJ A;  3DU5 A;  1JLG B;  4PG5 A;  1N32 J;  2UXD J;  4JI8 J;  3I5C A;  3FCW A;  1X5S A;  3QT5 A;  4RW7 A;  3EWG A;  2EFG A;  3HPO A;  3DMJ B;  3AB2 B;  2BJE A;  4X4N A;  3BYR A;  3CJ5 A;  3HHL C;  2HW3 A;  4ZVQ B;  3I4P A;  1S1T B;  1SKR A;  3A4T A;  3MM5 B;  2J0X A;  1UP1 A;  1FDB A;  9ATC B;  1S9G B;  1NUE A;  2VG7 A;  3L9Z A;  1VRT A;  1HKA A;  2D1C A;  5MAO A;  1T9U A;  3E01 B;  2QYG A;  4LRB A;  2HMI A;  4NLG A;  2F65 A;  2ROP A;  4J9M A;  5L1J A;  3ONQ A;  3DI6 B;  5KFO A;  3OV7 A;  3K58 A;  2OD6 A;  4C11 A;  1RA6 A;  2NZ4 A;  2ZE2 A;  4ZVS B;  3ZZ0 A;  3DN9 A;  3MR3 A;  3SEO A;  4L72 B;  1RT1 B;  1YBA A;  1FRL A;  4XPC A;  1WC0 A;  4EEY A;  5F0U A;  1IJF B;  1MML A;  3RB6 A;  1JLF B;  3OTE A;  4NYO A;  4MFB A;  2XLJ A;  1TKX B;  1RBA A;  4QU7 A;  2LXU A;  5AXN A;  2J0Q D;  4UY8 5;  1HW8 A;  1OMS A;  2P6S A;  3OXL A;  3RB3 A;  2DPI A;  2W24 A;  2C2O B;  3P5B P;  2DYA A;  3K5O A;  3K2Y A;  1FF2 A;  2RVJ A;  1F9H A;  4X4Q A;  3OVS A;  1T9X A;  4DX6 A;  2LDI A;  1RWM B;  3UD3 P;  1N5Q A;  2DVI A;  2RRN A;  1LW0 B;  2RQK A;  3LAM A;  3DOL B;  4IH6 A;  3GE9 A;  2ZKT A;  4DFK A;  4X66 F;  3LP1 B;  3R7N B;  3KMQ A;  2OGU A;  1K1S A;  4BHQ A;  4G3I A;  3D3B J;  4Y0F A;  3IBF B;  3LP0 B;  4ZLL A;  3I9V 9;  2XMK A;  3H5S A;  1PC4 A;  4E98 A;  2CUY A;  2XMA A;  3ZTR A;  1CUL B;  5GAE U;  1KLN A;  3K17 A;  2VFV A;  1KQG B;  1EHW A;  1RIS A;  3VGS A;  2XI2 A;  1Q78 A;  1VQN S;  1WG5 A;  5I3U A;  3HZE A;  2DNZ A;  1PBU A;  2XYP B;  2OEM A;  1HL6 A;  4UT4 A;  4TU7 A;  1H2U X;  3IC1 A;  3V4I B;  1APS A;  3T1H F;  1HD0 A;  2GNK A;  1CQN A;  2KM8 B;  3C16 B;  3WQP A;  1RHU B;  4B02 A;  4LR9 A;  3KLI A;  2J9E A;  5ETS A;  3SV3 A;  1RT7 B;  4RUA A;  3LAL A;  3CCV S;  3PZP A;  4W98 A;  1VBY A;  3EGN A;  2KRB A;  2AYE A;  3IGN A;  2IYG A;  3FBE A;  2HFN A;  4ZDN A;  3J80 U;  2JL9 A;  5BJR A;  1Q81 T;  3IS9 B;  2W25 A;  1URN A;  1A7G E;  1TUG B;  4WE1 A;  2XO7 A;  2XSJ A;  1KQF B;  3OSP A;  3H59 A;  1S97 A;  5DDR C;  3DXB A;  1LW2 B;  2BYC A;  1XR5 A;  1NBE B;  4KGK A;  4FKY A;  3G8Q A;  4YN3 B;  3P49 B;  3OJS A;  3C8Y A;  3C14 B;  3TEH B;  2XEX A;  4GO5 X;  1TL1 A;  4DV0 J;  2OAU A;  1FJG J;  3F0N A;  1S1U B;  1U1K A;  2MY8 A;  2Y1J A;  5IM0 B;  2ERR A;  3ADA C;  2XS7 A;  3CD7 A;  1RBO B;  2VKR A;  1S6Q B;  3G96 A;  1WEL A;  5K8M A;  1SV5 B;  2CVI A;  2C3M A;  2ZHA A;  3SCI E;  4OZN A;  2A6M A;  4WJB A;  4AXI A;  4IG3 A;  3UR0 A;  2OIH A;  5D0G A;  1RAD B;  3KK3 B;  1HHS A;  2ASL A;  1QE1 A;  1CC8 A;  5KAK A;  4YUD A;  3EZU A;  3NXZ A;  1DHM A;  2V8D A;  4J7C A;  4NXM J;  3POT B;  1VRQ C;  4NWB A;  3BPD A;  3ZZT A;  1GXU A;  1XMB A;  5E2Q A;  3PW2 A;  3JYT B;  1YZ6 A;  4EMD A;  2DNQ A;  4DZ6 A;  2YXL A;  4OMF G;  3UN2 A;  4K4Z A;  1NJI T;  4ENO A;  4ECU A;  2DRD A;  3CCQ S;  1YI2 S;  4QZV B;  4JV0 A;  1AUS L;  3EE3 A;  4ZP9 A;  3AH6 A;  2L9N A;  4FYD A;  3R3T A;  4NRT A;  3TAM A;  5KFF A;  3OTO J;  4ZVH A;  3TZX A;  3SBM A;  4O4R A;  1FNO A;  3CMQ A;  2BE2 A;  4ALZ A;  3W63 A;  3G6X A;  2C2N A;  2RU3 A;  2CPI A;  4WP9 A;  3BN4 A;  4UF4 A;  5GMK a;  1Y4Z B;  5JJB A;  3JS9 A;  1YRU A;  1GH8 A;  3ELH A;  3HM9 A;  1H2V Z;  3JSY A;  4L75 A;  3GFX A;  1XNR F;  5E3P A;  3KXD A;  5HQM A;  4ELV A;  4FPI A;  3P6Y C;  2GQQ A;  3KHL A;  1FRJ A;  3RYL A;  2XZT B;  4NEZ A;  4ZVF A;  1VQS A;  2ATC B;  1QUV A;  1D9A A;  1ZM4 A;  2EFO A;  2J9D E;  1HAR A;  2RH3 A;  4JV1 A;  5KG4 A;  1F5A A;  2F40 A;  1ZH5 A;  1N52 B;  3W5Y A;  2EC0 A;  4CNY A;  3TZY A;  4TY8 B;  3KOA A;  3ENV A;  3R27 A;  1SQE A;  2DNN A;  1LK5 A;  3AD8 C;  4X4V A;  3M2R A;  1DY3 A;  3N5F A;  3Q86 A;  2PI4 A;  5K8O A;  4ED4 A;  2P2C B;  2ZFH A;  1HBN B;  4CDI A;  1I3O B;  3VZH A;  2RT3 A;  4P2S A;  2GJF A;  4MTP A;  2HS4 A;  1J5O A;  4ITS A;  2IM0 A;  2A10 A;  4I0W A;  2FB0 A;  2XY6 A;  4PPZ A;  3CJT A;  2FVP A;  2GW8 A;  4OZ2 A;  2BDP A;  3TNV A;  2XHC A;  4KV8 B;  2AGQ A;  4LFB F;  3W3S A;  1CJV A;  3MPV A;  2VG5 B;  3M32 B;  2ILY A;  3LTO A;  2IC3 B;  1HNW F;  3ZTS A;  3IO1 A;  3FBC A;  1YTY A;  5L1K A;  1HBO B;  1GTH A;  4WFB Q;  3DLJ A;  3ISN C;  4MJK A;  3HO1 A;  3SQG A;  5B0A A;  3R6L B;  1YSJ A;  4QWB A;  2HND A;  4L76 A;  1JLA B;  1VR6 A;  1XMO F;  4AE5 A;  1MWZ A;  1ZAX A;  3HKW A;  2KXF A;  1RAG B;  1U1O A;  3FZB A;  4FS1 A;  4C0B A;  1JWW A;  1JIH A;  1HQ2 A;  3JTO A;  2YNI B;  3AXM A;  3H5U A;  2V4J B;  3BYP A;  3MED B;  5KTQ A;  1RK8 A;  5AE3 A;  3QZ7 A;  2DXE A;  1UPM B;  4A8O A;  1M5O C;  2EXU A;  3NRB A;  4WFN Q;  1SQF A;  2BJ9 A;  4RU2 A;  3KNA A;  3ZTP A;  3EGZ A;  4MYT A;  1KON A;  4ZPT R;  1N6Q A;  1KTV A;  5I3Q A;  4LF2 A;  3I87 A;  3O2I A;  4PAA A;  2YKM B;  4IOA Q;  2DPJ A;  1HQE A;  4PG6 A;  1VRU A;  3BGL A;  2DR5 A;  2W8L A;  2I8E A;  3W60 A;  3GIM A;  2JZ5 A;  2EBE A;  3BV8 A;  2VUG A;  3CDW A;  4ES3 A;  1UTA A;  3QJJ A;  4LUB A;  1JLB A;  1D8Y A;  4OYP A;  4IR1 A;  2HFV A;  4KY3 A;  3UE2 A;  3MM7 A;  5JVH Q;  2W4P A;  2Z2M A;  1BUX A;  1GNK A;  2V4R A;  3DHW C;  2J8S A;  4ECS A;  4MH8 A;  2BX6 A;  4A8Q A;  4WFZ A;  1YJR A;  1U09 A;  3H42 A;  2W9B A;  3P3D A;  5AXM A;  5HBM B;  2MGZ A;  4M95 A;  3CSK A;  2ZVS A;  1M5V C;  3DDI A;  1J2V A;  4CLL A;  4URQ U;  4A47 A;  2FPH X;  1IKW A;  1JXL A;  3FNN A;  3M1V A;  2ZZT A;  5F8L A;  1RGV A;  2QL5 B;  4LR7 A;  2D9P A;  3I56 S;  1WC3 A;  3QLH B;  4QR1 A;  3CUL A;  1D8Z A;  4DG1 B;  4EYH B;  1BHN A;  2WVE A;  3H25 A;  2DNK A;  2UXC J;  2FGO A;  1FKO A;  2UUB F;  4LSN B;  2BV3 A;  4I1T A;  3TQ1 A;  2IYI A;  5DG8 A;  1XMQ J;  1KTQ A;  2MQL A;  5L46 A;  2HHX A;  2R7S A;  3HHL B;  2YY3 A;  5BYS A;  1C0T B;  1LOU A;  4GVL A;  4IRK A;  2JVO A;  5CYQ A;  4N8N A;  1RHM B;  4WYL A;  4WFX A;  5KFW A;  4DL7 A;  2OMO A;  2B4U A;  1R27 B;  3OTB A;  2BRL A;  5DLF A;  1F60 B;  4P9S A;  4DR6 F;  3OUY A;  1KN6 A;  2NXJ A;  5A6P A;  1KBR A;  1QSL A;  3V81 B;  1A0O B;  2CQ1 A;  1HI1 A;  4PYD A;  3LWL A;  3BO3 A;  1J27 A;  3T6B A;  4DV5 J;  3PRB A;  1WKJ A;  1T05 B;  1NPK A;  2RD5 C;  2W2Q P;  3QBC A;  5A8R B;  3R1L A;  2CAD A;  4Q7A A;  3CIM A;  3BEG B;  3OR1 A;  3TYT A;  2VG6 A;  1JJ4 A;  2NXU A;  5LMN J;  1S48 A;  4Y00 A;  5KFU A;  1N5T A;  1UPP A;  4TYA A;  2CZ4 A;  4WTO B;  2ASY A;  3DRS A;  4NOH A;  2UVU A;  1IKV A;  2BOA A;  4LF9 F;  1NK8 A;  1TU0 B;  4J9P A;  2H3E B;  2CNK B;  4N76 A;  2RF2 B;  1Q86 T;  2BQ3 A;  1UVN A;  2OTJ S;  4IFV B;  3KUE A;  2P9G A;  2PFD A;  4EWT A;  2E9R X;  3CCL S;  3D54 A;  3T9Z A;  2M3D A;  4Y34 A;  2XMT A;  4DR1 J;  2J7W A;  2F4V F;  1HD1 A;  4FYW B;  2DGW A;  2C2R A;  5E33 A;  5D4P A;  3BKF A;  2E5J A;  1DTT A;  2HGM A;  2XGQ A;  1M5H A;  3TQE A;  1FVS A;  3I6P A;  3JTP A;  1H98 A;  4I6Y A;  3KDO A;  3MR7 A;  4CTA B;  3L3C A;  3VAM A;  2JEG A;  1Y9O A;  2FHJ A;  2LP4 A;  4B08 A;  1ZOT A;  2C2Z B;  1REG X;  1KOH A;  4IG0 A;  4RNF A;  4NLT A;  3BJY A;  3CGI A;  1D0E A;  2FJB B;  3C6U A;  2MKH A;  1OY8 A;  1UWB B;  5AXK A;  4CIO A;  1OPZ A;  2GQC A;  3QMQ A;  5KOW A;  1U45 A;  1WHW A;  5B0E A;  4DF4 A;  4DBQ A;  2XLI A;  5M2U A;  4X4P A;  2DXF A;  1QY7 A;  2DR7 A;  1PG5 B;  4A8K A;  2BA9 A;  3H8Y A;  2BR0 A;  1HWU A;  1NSK L;  4ELT A;  4ECT A;  4EI2 A;  1JLG A;  2GVD B;  2Y1I A;  3OFH A;  4X66 J;  1BQX A;  1RT5 A;  1N34 F;  3MR6 A;  1F5B A;  4U6P A;  4RBU A;  4NLD A;  1GQE A;  4IO1 A;  4YHH J;  1YIJ S;  3GJT B;  4LSL B;  4OYZ A;  2F9J A;  5IQ6 A;  5IT9 Y;  1JNR B;  5J2N A;  3UNY A;  3TA2 A;  1S1T A;  2HHT A;  2EPI A;  2EK1 A;  2B4P A;  4I64 A;  5J2P A;  1S9G A;  1TP7 A;  2PO4 A;  4F67 A;  3BZQ A;  4KGV B;  1NCL A;  1LK7 A;  4FBT A;  1OYD A;  3E01 A;  3FFI B;  3D2W A;  3T1H J;  1H7X A;  2EG2 A;  2FC8 A;  2POK A;  2UVW A;  2LQJ A;  2ZUG A;  4M5L A;  2M70 A;  4DQI A;  3JAM Y;  2HRT A;  1K73 T;  3SIP B;  3DI6 A;  5DG9 A;  2ZC4 A;  3KLG B;  4H4K C;  2UUT A;  1JLC B;  4NA3 A;  3DU6 A;  3K8V A;  2HFU A;  2K06 A;  3RW7 A;  4CT8 A;  4QIG A;  1PIE A;  1RT1 A;  1FXL A;  2BEF A;  4WZQ A;  3Q8P B;  3H7H B;  3H40 A;  4OYA A;  5FII A;  4KHP F;  3BRE A;  1TKX A;  3DLG B;  2IBK A;  4LBI A;  1GXT A;  3R5D A;  1NJY A;  1RT2 B;  4IR9 A;  2Z4P A;  2CJ9 A;  1UZD A;  1LWX A;  2KXN B;  3U1L A;  4DPU A;  2IDL A;  4K59 A;  5CH7 B;  3VCD A;  1LW0 A;  1KC8 T;  2OKQ A;  1ZTT A;  3LP1 A;  3T9N A;  2JC1 A;  4R0J A;  3Q8Y A;  9RUB A;  4U7C A;  3LP0 A;  3EJM A;  3TI0 A;  2MZ1 A;  4PG8 A;  3KLH B;  5IT0 A;  4K2J A;  1CUL A;  2CQP A;  1U0H B;  1XR7 A;  4M5D B;  5KG1 A;  3EXY A;  2I9S A;  4RX6 A;  2V9W A;  1F9F A;  3HLU A;  3UDV A;  5LM7 E;  5K8P A;  1N54 B;  4CO1 A;  3RRG A;  1RTI A;  3GPA A;  3V4I A;  2J0W A;  5H9E K;  2B9Y A;  1V3R A;  3IM9 A;  1FJ7 A;  3SDE A;  2QIF A;  3CCR S;  1TUW A;  4LQ9 A;  3VAL A;  2E1R A;  2W7P A;  2LQ5 A;  4KPC A;  1X0P A;  4P6Q A;  3C6T B;  1RT7 A;  1FE4 A;  1QAY A;  2BVZ A;  1H6K X;  1T11 A;  2HHV A;  2HZA A;  1CG2 A;  1U24 A;  2V2V A;  3BR9 A;  2HQD A;  1I1G A;  1FA0 A;  5JMN A;  1X4F A;  5L8R C;  4OZ3 A;  2AKW B;  3F44 A;  3IS9 A;  4C0O C;  5KFG A;  2BAB A;  2AZ3 A;  4UOH A;  4DMZ A;  2K2P A;  1LW2 A;  4QIV A;  3QGP A;  2CQC A;  3GFH A;  5EX0 A;  1RHJ B;  5FJ4 A;  5DGA A;  2RDD A;  1T8E A;  3KG1 A;  2MKS A;  3VAJ A;  1TAU A;  4MK7 A;  2YX1 A;  2LU2 A;  2DIU A;  2X3D A;  3I82 A;  4ETX A;  3CD5 A;  1S1U A;  3AT1 B;  4BCA A;  2PD1 A;  3KJN B;  3VV2 B;  5IM0 A;  5KFN A;  2AJ2 A;  4X62 F;  2CVE A;  3GB0 A;  2UXB F;  3LF0 A;  1XNR J;  3KG4 A;  1NHU A;  2IVY A;  3DDN A;  4CLU A;  3VAK A;  1NB2 A;  1S6Q A;  4KFB A;  2FHJ D;  1SV5 A;  3DDK A;  2W9C A;  2WVD A;  5KFH A;  2MKI A;  3BKU A;  3KK3 A;  3ZXW A;  2ZC3 A;  3M8Q A;  4J91 A;  2ZOF A;  2FLL A;  3TAN A;  4QR2 A;  5CYJ A;  3CDB A;  4P71 A;  2GC8 A;  1DBD A;  3POT A;  5GAD I;  1PAE X;  1S6P B;  4XPE A;  2GML A;  2Y1L B;  1NJW A;  5CCM A;  2DGS A;  2D7S A;  4EO8 A;  3EXC X;  2MQO A;  3ILJ A;  1R0A B;  2DR8 A;  5LXR A;  1OS5 A;  3EVM A;  2HFZ A;  5T14 A;  3ZTQ A;  2CDQ A;  1YJT A;  4NA2 A;  3UFC X;  1NDL A;  1U1N A;  1XN9 A;  1WEX A;  3Q8Q B;  2Z2L A;  2D41 A;  3H4B A;  2QA2 A;  1D09 B;  5FDL B;  2CJQ A;  4PCQ A;  4BC9 A;  4YFU A;  1WOR A;  5IOL A;  4TY9 A;  4UTG A;  2YNH A;  5K9F A;  4OHY A;  2WSC C;  1HNI A;  2BE7 D;  5AT1 B;  1VK8 A;  1IJE B;  1Z4U A;  3NP5 A;  3G9C A;  3EPI A;  2FUG 9;  3O5T B;  5HJX A;  4KJI A;  3OXF A;  1E6Y B;  4LFB J;  3H0P A;  4LF5 J;  1IWA A;  3E8O A;  4U9R A;  1WWH A;  1ZS6 A;  1IQT A;  1HNW J;  4ZVT B;  3O1L A;  3CJK A;  3W8G A;  3W66 A;  3W2W A;  1SJR A;  1VQY A;  1KNZ A;  2KJW A;  2HNZ B;  1N4L A;  2HSE B;  4PWD A;  4TN2 A;  4WXO A;  1P1L A;  2NXC A;  2ZBR A;  3VVT A;  3K5P A;  1RAJ A;  2B9X A;  3KHR A;  3RUB L;  1XNQ F;  1KD1 T;  1T9Y A;  2MSS A;  1MU2 B;  1OPI A;  1XMO J;  1UVJ A;  1K0V A;  1GMV A;  2XMM A;  2CQ3 A;  2MKY A;  4B9M A;  3PO4 A;  1P6T A;  3HD1 A;  1TFW A;  4H4O A;  3BR8 A;  5G4D A;  1SC1 B;  1F2H A;  4DEZ A;  2O67 A;  4QW9 A;  3A12 A;  1SH2 A;  4RW4 B;  2ABY A;  2JLF A;  3CC7 S;  1LXN A;  4GC6 A;  1FX2 A;  1GMU A;  3ZNU A;  2VOD A;  3CC2 S;  3GFY A;  1EIY B;  3Q24 A;  1ZZF A;  5DRK A;  2A0F B;  5ETT A;  2KG0 A;  4OZL A;  3A3O B;  4DSK A;  2Q1L A;  4WF9 Q;  1Q8K A;  3OHA A;  2E1M C;  1Q7L B;  2R7T A;  4G1Q B;  1QAX A;  3GSI A;  4AUK A;  1T9W A;  4F2R A;  4JYA F;  3PCO B;  1GX5 A;  5DJB A;  2YKN B;  3BH6 B;  5KFB A;  1WD6 A;  2VU5 A;  4ZKA A;  2F8M A;  3G8S A;  5H1S V;  3M32 A;  5B0B A;  3HFV A;  3RAM A;  2FVC A;  3QT7 A;  3PVX A;  2IC3 A;  3X1L B;  4J9U E;  2JNJ A;  5RUB A;  1S1W B;  1XTZ A;  2PA3 A;  2X1B A;  1YWX A;  3N5B A;  5GAG I;  3FSI A;  2G9O A;  2VB6 A;  1UVK A;  1JLA A;  4FDF A;  4LMZ A;  2M4M A;  2CWX A;  2BW7 A;  3ZZR A;  4CLK A;  4WP8 A;  3MPY A;  3I5B A;  2ZHB A;  3G87 A;  1HQU B;  2CJX B;  2WW4 A;  2VDH A;  5KT2 A;  2YNI A;  1F9E B;  2V4J A;  1RDR A;  3EZO A;  2CYY A;  3LPE A;  2YKP A;  4IFY B;  4CM2 A;  4ZP6 A;  3UVJ B;  1DRZ A;  2Z57 B;  1VBZ A;  4O44 B;  4WWS A;  4B3R F;  2UUB J;  1F1B B;  2JC0 A;  4WZM A;  1RWK B;  3UPF A;  3KKF A;  2AV5 A;  3ETO A;  4X4O A;  2KT2 A;  3KLE B;  4PQU B;  1T9V A;  3VR1 A;  1Z1Z A;  4ZJQ A;  4W92 B;  5EN1 A;  2YKM A;  4ZP7 A;  4X4U A;  1AFI A;  2IDE A;  2BQR A;  1LNQ A;  4EU0 A;  4URG A;  4DV2 F;  4KHR A;  1J5E F;  1EZZ B;  4DUZ F;  2PE8 A;  3FEX B;  2QSF A;  3DRR B;  3ET6 A;  1ZAW A;  3DOM A;  4DR6 J;  3PKM A;  5DQG A;  1RAB B;  1VJQ A;  4WK1 A;  2KYZ A;  5DG7 A;  4YME A;  1RB0 A;  1S9E A;  4B9L A;  1FK9 B;  5FD1 A;  3DRX A;  1KS2 A;  2J76 E;  2J7U A;  4RU9 A;  4YB7 A;  2NLW A;  1FHT A;  5HBM A;  2AQ4 A;  4OLP A;  1VRT B;  2YX7 A;  2FLO A;  2DBB A;  3J7Y I;  3T3F A;  2CIM A;  3H2V E;  3O8W A;  2GX8 A;  2DGO A;  4NLY A;  3U27 A;  1FRH A;  4LT6 A;  3ZZO A;  1TR0 A;  4ZMM A;  1BXN A;  1VQM S;  2Z2Y B;  2HIQ A;  3D9B A;  4PG7 A;  4U7U D;  4DSJ A;  3QLH A;  3C15 B;  1L5U A;  2IRX A;  1S57 A;  2XO6 A;  1UEV A;  3T5J A;  3S6E A;  2BBE A;  2OEJ A;  2V2Q A;  2F4V J;  4ED5 A;  4LSN A;  1AFJ A;  2PFF B;  4HEA 9;  1KLM B;  4MFB B;  3IR7 B;  1ELO A;  4I68 A;  1NK7 A;  1RUS A;  1C0T A;  4DV6 F;  3DLB A;  2GGP B;  2IJF A;  2V8G A;  4KE5 A;  4YB1 P;  4X64 F;  5KFK A;  2MST A;  3D4J A;  4GKK F;  3W7B A;  3Q8S B;  2XI3 A;  2ZEJ A;  4L74 A;  2MJN A;  4OX7 A;  2FQQ B;  5HSP A;  2Y8W A;  2BE9 B;  4Q8E A;  1S0M A;  3DLE B;  4NLX A;  1K9M T;  3V81 A;  2JH3 A;  5L39 A;  2GIQ A;  3M9O B;  3HHN B;  3IMQ J;  3JQM A;  2M0G B;  5A8R A;  4NI2 B;  4WFA Q;  2NPF A;  1RWW B;  2QGF B;  3NOC A;  2G0C A;  3I31 A;  3FCV A;  1OY6 A;  2IHR 1;  2Y9H A;  2XWY A;  2M8D B;  5I3U B;  2E5G A;  2HQF A;  1TVR B;  3P8B B;  5ETL A;  4P73 A;  2RQC A;  1N36 F;  3KK2 A;  2QLX A;  2RF2 A;  1N34 J;  2D74 B;  4ANE A;  3U1N A;  1HR0 F;  4IFV A;  2U2F A;  2LKZ A;  1RHQ B;  3G6E S;  1CJK B;  7AT1 B;  2FJW A;  3H5Y A;  3SZ2 A;  3NLC A;  3CUN A;  4YY3 F;  4JV2 A;  3AB4 B;  4XDC A;  4P10 A;  5KFM A;  1RT4 A;  2H4Y B;  2I0X A;  3NWG A;  2BKN A;  2C28 A;  1FXD A;  3D0G E;  3M6U A;  4HHH A;  4F8R A;  5DS7 A;  4O4G B;  4ER8 A;  5BYR A;  1SJF A;  5LMU F;  1CBK A;  3MMJ A;  2M7S A;  4C4W A;  3T5K A;  2R4F A;  2FY8 A;  2KFY A;  1OO0 B;  1HBU A;  1P27 B;  4U67 Q;  1RZM A;  5KOX A;  3BKT A;  4I7F B;  4FN5 A;  1IKX B;  1S4E A;  2EK6 A;  4P74 A;  1UJ6 A;  4BWM A;  2C3U A;  3RZA A;  4C6A A;  4ELU A;  2DHG A;  4USI A;  1OQ6 A;  1SJ1 A;  3D0H E;  1UWB A;  2HHH F;  3FVY A;  4KHP J;  2CXE A;  3ENQ A;  2RHS B;  5F8N A;  3MCN A;  3CJQ A;  4MKY A;  2DKO B;  3U7J A;  5SZT A;  2YNF B;  3VAI A;  3F41 A;  3EYZ A;  4X84 A;  1ITP A;  1NO8 A;  2C2E A;  1QE1 B;  4ES2 A;  4F0H A;  1AZS B;  3BGO P;  2F7V A;  5C5J A;  1RTH A;  5EDW A;  1R8P A;  3SI8 A;  2ZDO A;  2DT9 A;  2PA8 D;  2OFG X;  4YP3 A;  4J9K A;  2E7X A;  1JNZ B;  3TAR A;  1AYE A;  4DPY A;  3CCM S;  1PSD A;  2O01 C;  3VQS A;  4LSL A;  2PT0 A;  2HZV A;  1NZ8 A;  2RNE A;  2BQU A;  1EAY C;  3ITH A;  3DLK B;  2BMB A;  4MK8 A;  2KJV A;  2ZZM A;  2N4C A;  1ZAV A;  3A13 A;  4Y2A A;  1RTJ B;  3FFI A;  2HZC A;  4HAC B;  3THV A;  3TUZ C;  1AUD A;  3CJ0 A;  5KFE A;  1HMV A;  3K5M A;  3KLG A;  1JLC A;  4E8U A;  1FI4 A;  5CD4 H;  1QDU B;  4CLP A;  2Y3Y A;  5CA5 A;  1X9M A;  5CZX A;  5FLX U;  3QQC D;  4N41 A;  2DHA A;  2MHE A;  4X65 F;  4DV4 F;  3OLB A;  2VIC A;  3GMG A;  2X51 A;  1RQ0 A;  2FJA B;  3TJA A;  3DLG A;  2DGV A;  4HKQ A;  4ID8 A;  1O6X A;  4ZIT A;  2VPY B;  4K2X A;  4HVZ A;  2IVF B;  1RAE B;  3LGH A;  4F36 A;  3NGU A;  1K8A T;  2B9E A;  1RT2 A;  3J7Z 5;  2N7Y A;  4DUY F;  4EBE A;  4WFY A;  2K3I A;  4KHM A;  4KC5 A;  1WEY A;  3I55 S;  1RT3 B;  4NYP A;  2YX4 A;  2MDA A;  5E3Q A;  4KH0 B;  4NXN F;  5F41 A;  3M8Z A;  4CLZ A;  1JLE A;  1FE0 A;  2W2M P;  4ZK7 M;  5KG7 A;  4X62 J;  3FBF A;  3I9Z A;  2UXB J;  4OIX A;  5F9N A;  3HT0 A;  3HHL D;  4NZ0 A;  2R7U A;  1SIZ A;  4DQQ A;  2AF6 A;  3R5A A;  4WU3 A;  1DAX A;  3KLH A;  1VC6 A;  4EBC A;  3PJW A;  3GG1 A;  3M2R B;  4NE9 C;  1U0H A;  2OSR A;  1BQM B;  2VFR A;  1YIT S;  3ZFV A;  5A76 A;  5KT5 A;  4QWD A;  4M5D A;  1NU4 A;  1UKU A;  5IFM A;  1NND A;  4CLY A;  2KDO A;  4C98 A;  3VHQ A;  3GIJ A;  2M52 A;  2NPI A;  2R7X A;  2JOQ A;  3PX4 A;  5B0G A;  2DRB A;  3PYF A;  2UUW A;  4JB8 B;  4KGX B;  1L3T A;  4DR7 F;  2DIT A;  1SBR A;  2XCA A;  3C6T A;  4IKA A;  4FNI A;  2AEJ A;  2BKO A;  4ZPW R;  2RHQ B;  1MSW D;  4CO0 A;  3UCZ P;  2WVC A;  1C1B A;  1CJV B;  2WCX A;  4J9O A;  4LFC F;  3MAA B;  2X1G A;  3I0R A;  1NSP A;  1TKT B;  3VAG A;  1UEK A;  2DGQ A;  2R42 A;  3JTN A;  3QT6 A;  1RJJ A;  1HHT P;  3SQG B;  5I42 B;  3HJV A;  2AT1 B;  2ACM A;  2UV8 G;  4NLO A;  1T02 A;  1TL3 B;  2VPX B;  1B0T A;  2HND B;  1FRM A;  4I4B A;  4RWW A;  3WX8 A;  2E5L F;  1S0O A;  1S99 A;  2IM1 A;  2IRY A;  4USW A;  3RAX A;  3CJS A;  3Q89 A;  4A8X A;  2ZJP Q;  3FDS A;  4CH7 A;  3MD3 A;  2D3O 1;  3RBZ A;  4F0M A;  3SCL E;  4NX9 A;  3L7U A;  2BJ1 A;  2QLF B;  3QSY B;  3A3P B;  4J9V A;  2DD8 S;  4FVM A;  2XMW A;  2BUN A;  1NKE A;  1N6Q B;  4FYY B;  1XNQ J;  2QMU B;  3MUM P;  2GV1 A;  4NLW A;  1PYT A;  5GAD U;  3TJ9 A;  3AOA A;  4YDX A;  4YS2 A;  1M5K C;  3M9N B;  4ED1 A;  1FJE B;  2FJD B;  2EWH A;  1S6P A;  3FSX A;  2MZT A;  1WF1 A;  1IR1 A;  1EQM A;  2EKN A;  4F3M A;  3KDN A;  1N0V C;  5HQL A;  2ZH7 A;  2DGT A;  2WHO A;  1R0A A;  2JSX A;  2KZZ A;  3W8P A;  1RTZ A;  1DUR A;  4ETZ A;  1G7C B;  3THP A;  8AT1 B;  1JLB B;  2HEK A;  4ZCL A;  1A9N B;  2UP1 A;  2XG8 A;  4ZA1 A;  2HWT A;  5BXI A;  3MGJ A;  1WHX A;  1WUU A;  5K14 B;  3CT9 A;  2RS8 A;  3T19 A;  5FDL A;  3M8P A;  2JVR A;  7FDR A;  3R6G B;  2BXJ A;  2HBR B;  3RG6 A;  5B0F A;  2I6W A;  2KTQ A;  1X0F A;  2W9B B;  1TL5 A;  4FVC A;  1VLO A;  2R7O A;  2GVZ B;  2W9A A;  1Q1K A;  1T95 A;  2ZWP A;  4N77 A;  2QJ3 A;  4OHZ A;  3MEE B;  4JYA J;  3D6F B;  2HHP A;  2W4C A;  2O66 A;  3M1V B;  3T5H A;  3PEH A;  4USH A;  1RI7 A;  1YVF A;  2ZHO A;  3OBI A;  3G82 B;  3CIZ A;  1GK8 A;  5D77 A;  3UCG A;  4PUO B;  2HVZ A;  2DGU A;  1KFD A;  3WZ0 A;  3KJQ B;  5CD4 A;  4KTQ A;  4YB5 A;  1PYO B;  2AW0 A;  2HBZ B;  4O3P A;  1OYE A;  4DSL A;  3GR1 A;  4J9L A;  3TUP A;  2LA6 A;  5L9N A;  1MU2 A;  5JVG Q;  1T3O A;  4RR5 A;  1QAI A;  3QAE A;  1YHQ S;  1U1Q A;  3LAK A;  2XYH B;  4ECQ A;  2OO4 A;  4EGL A;  2WW8 A;  2ZOG A;  1V9O A;  1QSS A;  5ITH A;  3PIO Q;  2QT7 A;  1KSP A;  4UQG A;  2BJ8 A;  5LJ3 Y;  2DY1 A;  4RW4 A;  3CTR A;  2PSZ A;  4PXB A;  1CQM A;  5C2G A;  3HVW A;  5C7P A;  4KSE B;  3J80 Y;  1IQZ A;  3K89 A;  5E7O B;  3UWT A;  2XY5 A;  3LO3 A;  3JXO A;  3MFI A;  4DR5 F;  2W01 A;  1YK9 A;  3OR1 B;  1NJX A;  3PFE A;  4OX6 A;  1SI9 A;  4DV2 J;  1J5E J;  4DUZ J;  2GMH A;  2RE1 A;  3DRS B;  4WIQ A;  5DQI A;  4CLT A;  4QYR A;  3DGV A;  2ILZ A;  2A2D A;  2YKN A;  1IBM F;  3CDE A;  1XBW A;  4HI1 A;  1Q53 A;  3NY0 A;  2RDJ A;  2D3O R;  1Y7P A;  4ZVP B;  1DQ8 A;  2OML A;  3D1H A;  1HPZ A;  2QFJ A;  4AL7 A;  1VFJ A;  1S1W A;  4A8F A;  4GKJ F;  5GAG U;  3MXH P;  2J6S A;  3IXQ A;  2P9C A;  4ED3 A;  1DTT B;  1RP5 A;  3MEC B;  4PXC A;  4I2Q B;  3B8H A;  1S6U A;  2XZD B;  5LL6 d;  4OFZ A;  1CJU A;  4O0N A;  4C8K A;  4R8U A;  1EAR A;  1UFW A;  2KT5 A;  1HQU A;  2C2K B;  1PCA A;  4ZPB A;  1NHV A;  1WI8 A;  4KIA A;  1NK9 A;  5HO4 A;  5JUM A;  2MQQ A;  1S0N A;  3PYD A;  3HVT B;  1OWX A;  3LAN A;  2LXI A;  4IFY A;  3QFW A;  3UVJ A;  5HL7 Q;  5KFL A;  4D3H A;  3HUL A;  1IR0 A;  2GFF A;  1T03 B;  4PQU A;  3VQT A;  2VBW A;  1KVI A;  4HLB A;  2G4B A;  3LGM A;  2GO9 A;  4WTY A;  2ZJR Q;  1UL3 A;  3ZZP A;  4X64 J;  4U95 A;  1X7V A;  1Y10 A;  4GKK J;  4F4X A;  3DRR A;  3KTQ A;  2VA3 A;  4O23 A;  4EUV A;  3W65 A;  1UVL A;  4GVB B;  1VGY A;  1CEZ A;  1RT5 B;  2HQC A;  2QRR A;  4FF4 A;  2V0N A;  5HLF B;  2A3J A;  5IC6 B;  5C42 B;  4ZCK A;  4Y6I A;  2R8J A;  3KK1 B;  1SH0 A;  3AFG A;  2G13 A;  1FK9 A;  4RNO A;  2DTJ A;  2V94 A;  2R8G A;  2HYI B;  3ISN D;  1LV5 A;  5J2N B;  3W9J A;  1CJT A;  5J2P B;  2XS5 A;  2WVF A;  4QWC A;  5A8W B;  1CS4 B;  3QRP A;  3FUY A;  2CQH A;  1N5S A;  2G2O A;  5ETP A;  3VGT A;  2CPF A;  1N36 J;  3PJ9 A;  1YZ7 A;  1X4G A;  4YOE A;  2JX2 A;  1HR0 J;  3MUT P;  3WC2 A;  2HWI A;  4U96 A;  2JJ4 D;  4K5S A;  2LYV A;  2V67 A;  2M2B A;  2YKQ A;  4P52 A;  2YWF A;  5HQ8 A;  5HMY A;  3B4D A;  3FQL A;  3C15 A;  2IMW P;  4Q45 A;  4YY3 J;  2DH9 A;  2YH0 A;  1KEK A;  3G6V A;  1NEE A;  4UUX A;  1U02 A;  4OJG A;  2FVQ A;  2J0S D;  1T0T V;  1KLM A;  4IQM A;  1FKP A;  3NGR A;  3P96 A;  3CD0 A;  2ZH9 A;  3GON A;  3A1Y G;  3OSN A;  1YLX A;  1Z2Z A;  1ZA1 B;  2GGP A;  1ZTW A;  1LWE A;  4DCP B;  5LMU J;  1VQ4 S;  5ETV A;  2M5Y A;  2VQF F;  1YJV A;  2AYB A;  1VBK A;  3E3X A;  5HP1 A;  2MJU A;  1QAJ A;  2HK3 A;  1VHF A;  4B9T A;  3MM6 B;  3DLE A;  4DV1 F;  5IC4 B;  3HHK A;  2HHH J;  2OPP B;  3M6X A;  3IR5 B;  1JX4 A;  4H4K A;  3H4D A;  4AFF A;  3VAF A;  5D8H B;  4NI2 A;  4O3R A;  2N82 B;  2OEL A;  3O3L A;  3H5X A;  3DGP A;  3PJX A;  2V9K A;  2WAQ D;  1H73 A;  2KYX A;  1TVR A;  3HMJ G;  5F8J A;  1IKY B;  4RBV A;  4ZVE A;  3PV8 A;  2JHE A;  4Y2K A;  1EET A;  2K1R B;  4ZPD A;  1RTI B;  2RQ4 A;  1RKI A;  3GWC A;  3SDE B;  1EX8 A;  1CJK A;  3US5 A;  1VJW A;  4TYB A;  2NYH A;  3ENA A;  1LWF B;  2C42 A;  2W2N P;  3A3N B;  1Q5V A;  4LF4 F;  3IG1 A;  1BWV A;  3S1T A;  1FX4 A;  3PIP Q;  1F0X A;  1UVI A;  2YWE A;  4JP8 A;  1M1K T;  2CFX A;  2LMI A;  4GO7 X;  1VHI A;  1H0H B;  3M6W A;  3HKZ D;  4DV7 F;  3IRX A;  3EM1 A;  2FHM A;  2L48 A;  4MYU A;  1MRO B;  4TLQ A;  1RWV B;  5GMD A;  3KJF B;  1B99 A;  2KFN A;  3T1Y J;  4IH7 A;  4KRW A;  3OL6 A;  2DNM A;  5E0O A;  3ISZ A;  4O4G A;  1NKC A;  1KWM A;  2NXE A;  2FLN A;  4K0K F;  1N88 A;  4ES1 A;  2DNR A;  2MLZ A;  1JK9 B;  2IY5 B;  4G6V B;  4I7F A;  1IKX A;  3I32 A;  1LWC B;  1SKS A;  2CJB A;  3OLA A;  4X65 J;  2C3Y A;  4DV4 J;  2DXD A;  3I0S B;  1I94 F;  2HRY A;  5ETN A;  2CQI A;  1R6V A;  1D1U A;  5HAN A;  5E5N A;  2R7V A;  3M2V B;  2KFZ A;  1LFP A;  4KFB B;  3QPI A;  2W9C B;  2YNF A;  4OJ1 A;  5J2Q B;  1VC5 A;  4QJV A;  4DUY J;  5LJ5 Y;  2MLY A;  2GHW A;  2YKO A;  3M8Q B;  5E3C A;  2LEA A;  4DS5 A;  2HAF A;  1AZS A;  1TFY A;  3NG8 A;  2J5A A;  4OV1 A;  4NXN J;  3AA9 A;  1WG4 A;  1YJ9 S;  4UZB A;  3R97 A;  3D1Q A;  4DSI A;  4KR0 B;  4L3N A;  4OZ5 A;  4C8L A;  1UWA A;  3PRV A;  1TZ0 A;  2I2Y A;  3UDE A;  1RKJ A;  2COL A;  2RKI B;  4UY8 T;  1TQL A;  2MYF A;  2R9L A;  4JI5 F;  4IH5 A;  2X3G A;  1SIW B;  2HQG A;  3KJV B;  3DLK A;  2WK4 A;  2D3U A;  2CJK A;  1XC9 A;  3C2P A;  1RU1 A;  2F1F A;  5F3T A;  2JFD A;  2ALZ A;  3MEG B;  1FDN A;  1RTJ A;  1U26 A;  3T41 A;  3A8J A;  4HAC A;  1UVM A;  4O3N A;  5D15 A;  3QJL A;  2YNH B;  3TVK A;  2CPY A;  2FC9 A;  1S7I A;  1X5T A;  1VOM A;  3LA0 A;  3GG0 A;  1TK5 A;  1HNI B;  4USV A;  2E66 A;  4N47 A;  3MWB A;  4C48 A;  3OT9 A;  2HS0 A;  2W1B A;  1VCT A;  3PW5 A;  3DM2 A;  2I5J B;  1QJH A;  2UUA J;  1NK4 A;  4QU6 A;  1VQO S;  4LFC J;  4UOG A;  3K57 A;  3SMZ A;  2Y8Y A;  2PMW A;  5KFI A;  3CJK B;  3MCS A;  3TVZ A;  4HTI A;  3WIU A;  3W2W B;  4OYO A;  1U8S A;  4PWD B;  2VHG A;  2F8E X;  5HVF A;  3BSC A;  1RT3 A;  2G2Y A;  2E29 A;  5KFS A;  1KHV A;  4JI6 F;  5H9F K;  1X4C A;  4A8Y A;  2E5L J;  4K5R A;  3MMC B;  4M5N A;  2YPY A;  3HJF A;  5HN0 A;  2AGO A;  5EWF A;  5KG6 A;  4H4O B;  3TZW A;  5GVQ A;  3D68 A;  3MOZ A;  3Q83 A;  1ICE B;  2YQ1 A;  4FF1 A;  2DCU B;  3ZZZ A;  1BQM A;  2IJR A;  1RYS A;  1MW7 A;  2YNG B;  4M5J A;  3W2V B;  3RBE A;  1S4F A;  4DX7 A;  3H2L A;  1WC6 A;  4N5S A;  4CO5 A;  4LF8 F;  3PM9 A;  4ZJL A;  3LPY A;  3D67 A;  2MEW A;  2ACY A;  2KZM A;  1REV B;  4KYZ A;  4RW8 B;  4Y28 C;  5DZ7 A;  2LQ8 A;  2DR9 A;  4ECW A;  2BAC A;  3HFK A;  2VF3 A;  3ILL A;  2NRE A;  2DNL A;  4OHW A;  3OFF A;  4KBI A;  1DLO B;  3MTJ A;  2HVD A;  3OTD A;  1XER A;  3H2U B;  3B4M A;  4LF6 F;  1YGY A;  2HS3 A;  1F3V A;  3MAH A;  3MEK A;  4NLS A;  2HPU A;  3MAA A;  3CE8 A;  4ZPA A;  4A8W A;  1VQP S;  1TKT A;  1X9W A;  3D66 A;  2MQ8 A;  1KKH A;  3OTO F;  4JI2 F;  1YJN S;  2KB2 A;  2JEI A;  1FER A;  3RW6 A;  4YEA A;  1HHQ A;  3DFE A;  1X5P A;  5I42 A;  1XK8 A;  4OQJ A;  4K4V A;  4F4W A;  1TL3 A;  3GYX B;  2G0J A;  4B9U A;  4A46 A;  1QM9 A;  4PRF A;  2J8A A;  3AOD A;  4CNZ A;  4V1A k;  4TU8 A;  1WDD A;  3D6T B;  4DX8 H;  2KKH A;  3NNC A;  2HVI A;  1RWO B;  1S12 A;  4P72 A;  1KVJ A;  1IBL F;  4F4Z A;  3KLF B;  2U1A A;  2YWH A;  4DL6 A;  2B51 A;  4N56 A;  3Q2S C;  2HHU A;  2G0I A;  1L3K A;  2UUC F;  3W9H A;  1ZM2 A;  5A2Q U;  3G4S S;  1P9Q C;  1OSD A;  2BW2 A;  3RGI A;  1X4A A;  1U47 A;  4F4Y A;  3C46 A;  3HX9 A;  2G2Z A;  2ZIT A;  1HWI A;  4CH0 S;  3ET6 B;  1WC1 A;  4MAK A;  3DOM B;  4FYX B;  1N33 F;  4P7V A;  2VV5 A;  4DX5 A;  5ETM A;  4O3Q A;  3TVY A;  2LEB A;  3R2D J;  3K59 A;  4JBC A;  1LXJ A;  1ZBT A;  2LU1 A;  5K14 A;  2FZC B;  2B5J B;  1S9E B;  2PN6 A;  4DR5 J;  5EWE A;  2Q66 A;  2VA2 A;  2IMO A;  4M63 A;  3OR2 B;  2L9W A;  4K4U A;  1FEH A;  3N6M A;  4OV6 A;  1FO1 A;  3MFH A;  2GVZ A;  3UR3 C;  2XZW A;  2QL9 B;  5JXS A;  1S1X B;  4OI2 A;  3BBF A;  3GJQ B;  3E51 A;  3PX0 A;  3MEE A;  1FCA A;  2YWK A;  2E9Z A;  4DCO B;  1IBM J;  4XK8 C;  3EPG A;  4HI2 A;  4EO6 A;  3BDP A;  1TMJ A;  2DH8 A;  5KG5 A;  4NL5 A;  3G82 A;  1ZPV A;  3THT A;  2XC9 A;  1WI6 A;  1ZM3 A;  4PUO A;  4YR3 A;  2OTL S;  3EVO A;  4GKJ J;  4DFP A;  4JUZ A;  4IRC A;  2IA6 A;  1BQN B;  4RBT A;  1EKR A;  1RE1 B;  3CDU A;  1S49 A;  3MR2 A;  4B3O A;  1SCJ B;  4KGZ B;  1NDC A;  3VZI A;  4BC7 A;  3NKY A;  3AOC A;  5KG0 A;  2J7K A;  2PMH A;  1X4E A;  3TO8 A;  4ZLP A;  5EHH A;  2ZVI A;  1W7W A;  3B54 A;  2YWW A;  3WHI A;  2C3P A;  1JXE A;  4QPT A;  3ZNJ 1;  4Q44 A;  3FRZ A;  4C8O A;  1TUV A;  4W4M A;  4OI0 A;  2EKY A;  2Z8Q A;  5IWA F;  1YQH A;  4HTJ A;  2W8K A;  4KT0 C;  3G8T A;  4LRA A;  4P75 A;  3OD2 A;  2AJ4 A;  4BLG A;  2WOM B;  2CDR B;  3MOJ B;  1RWU A;  3CO0 P;  1OY9 A;  3R5C A;  2XMU A;  4QIW D;  5K20 B;  2FTR A;  4EBD A;  2AJ1 A;  1N0U A;  1Y3K A;  2JRS A;  2JWN A;  2K7K A;  3OJU A;  2HBY B;  4F2S A;  2VQE F;  4E0D A;  4K50 A;  2I38 A;  2YQ3 A;  2CG4 A;  2RUS A;  3AOB A;  4ZLN A;  1JKH B;  5C25 B;  4Q8F A;  2KG1 A;  2KVQ E;  1WHY A;  4UOF A;  1ZM9 A;  1HYS A;  1K47 A;  2WBR A;  5KT7 A;  1UJ4 A;  1NKB A;  1WTB A;  2QA4 G;  3KK2 B;  4CLF A;  2GJ2 A;  4N7T A;  3SSQ A;  1HI8 A;  1IN0 A;  1U1M A;  3AAW B;  3ZZU A;  3PW0 A;  2NZC A;  1IM6 A;  2FLP A;  2JFK A;  1RT4 B;  3QID A;  4RZR A;  3MEC A;  4I2Q A;  2EC2 A;  4ED7 A;  4A48 A;  3BB5 A;  1YDL A;  4PWW A;  1BE4 A;  1TL7 B;  3CWJ A;  2ZBP A;  1RHK B;  3J81 Y;  4QWA A;  4OJH A;  1HBU B;  1NDK A;  4WPA A;  1Q5Y A;  3U02 A;  5H9E J;  3HVT A;  1IUJ A;  2RIJ A;  5KT3 A;  4DSE A;  3OFE A;  4UW2 A;  2VOP A;  1FDA A;  1U6Z A;  1YX2 A;  3S01 A;  5F9L A;  4DR3 F;  4ICL A;  4K4Y A;  1VQ9 S;  4IOC Q;  2AX1 A;  1NH7 A;  4PXE A;  2AYM A;  1T03 A;  4DQP A;  2DCL A;  4QWE A;  2X1F A;  4U7U K;  4ZIV A;  1I5O B;  2MKK A;  3PHE A;  1HWK A;  2VQF J;  3H98 A;  1RTH B;  3PYG A;  2PII A;  3BPS P;  4DV1 J;  1SC6 A;  4GVB A;  1RU2 A;  1QVG R;  4H4M B;  4X4R A;  4DPX A;  1FFW B;  3HSJ A;  5HLF A;  4H54 A;  5C42 A;  3KK1 A;  1F2G A;  1WNE A;  1PAU B;  2H54 B;  3PG9 A;  4WYW A;  3QWU A;  4NAS A;  1B0P A;  1AT1 B;  1U8W A;  4M5I A;  3E2E A;  3D3C J;  3ITH B;  4TLR A;  1YJU A;  1Q4R A;  5C24 B;  2GCF A;  3MMB B;  4RW9 B;  2EFV A;  5A8W A;  1CS4 A;  4IUF A;  3GLJ A;  2PEH A;  1KFS A;  3IWX A;  4NRU A;  4MKV A;  1T7P A;  2R2U A;  5D3G B;  3W5X A;  4ZIW A;  2QA4 S;  1HMV B;  2ZBQ A;  1NK0 A;  3K7R A;  2ZKU A;  3GU0 A;  3C66 A;  1NLK L;  4LF4 J;  4ECZ A;  3GJS B;  2RRA A;  2BJ7 A;  4DR1 F;  2AHO B;  4W90 B;  4DV7 J;  5HMW A;  2MZR A;  3QO9 B;  2V6A A;  4WBF A;  4DHV A;  4ZCI A;  1RWN B;  3VGV A;  2G1H A;  1HBM B;  1N8R T;  2OSQ A;  2LA4 A;  3KMS A;  3EIC A;  4WKY A;  3I96 A;  5BR8 F;  4K0K J;  2OEK A;  2H48 B;  4XAK A;  3TAQ A;  3WIV A;  2GMJ A;  1V5V A;  2B7B B;  2FGC A;  3MM6 A;  3IWN C;  1YRX A;  4ECX A;  1JLE B;  1FTR A;  4CRJ A;  1GMW A;  3CJ8 A;  2OPP A;  3PW7 A;  1U2F A;  2NCK L;  1I94 J;  3TEG A;  4LF7 F;  2VJU A;  1XR6 A;  3WC0 A;  4L73 A;  3R9L A;  1UFK A;  4FZV A;  1O51 A;  1U1P A;  2YQ0 A;  1N56 A;  4OYI A;  2R7R A;  2YTC A;  4F4K A;  2CRL A;  5F0W A;  3PEJ A;  4NMX A;  1IKY A;  1RAA B;  4DXL A;  1X4D A;  1S76 D;  4C8Y A;  3DKD A;  4ZHR A;  2ZDP A;  2K1R A;  4DN9 A;  2ROG A;  3OTC A;  4L3K A;  1Y11 A;  3EGV A;  3QAU A;  1VQ7 S;  2KT3 A;  2AJQ A;  4YHH F;  1XWL A;  2MZQ A;  4ZJO A;  2BAN B;  1TTH B;  2LVW A;  2E1P A;  2HLT A;  5J1P A;  1LWF A;  2R2T A;  2QMW A;  2B9W A;  4F4A A;  2IIH A;  4JI5 J;  2MB0 B;  4K4X A;  3FGV A;  3DOK A;  3QIP B;  1NH8 A;  2DHH A;  1C1B B;  2B4O A;  3RB4 A;  3JSM A;  2LEP A;  3D7S B;  2IFX A;  1ROF A;  3TOQ A;  1IBK F;  4USJ C;  1MRO A;  1M5P C;  3I0R B;  3L7P A;  4DQS A;  5ETO A;  2DK2 A;  4M94 A;  3IA0 A;  1S1V B;  4FF3 A;  1SQG A;  4Y3C A;  3BBC A;  5KFV A;  4DI6 A;  1W2I A;  3T1A A;  3DNC A;  2O5D A;  2VFS A;  2NXN A;  2GO8 A;  5I3P A;  2H5E A;  1LWC A;  4RNH A;  3OPK A;  3Q8U A;  2X1A A;  3QZ8 A;  3UDL A;  3VAH A;  3FJ2 A;  3MF5 A;  3ZZY A;  2MXY A;  5IXU A;  3I0S A;  4J9N A;  3M2V A;  3LUY A;  5DM6 Q;  4WK3 A;  3PRD A;  4O0I A;  1MWQ A;  5L1I A;  3SFU A;  5J2Q A;  2GIF A;  4JI0 F;  2V2K A;  3GII A;  4ED8 A;  1FRX A;  1NDP A;  5CYM A;  3R7B B;  2CNO B;  4ZS6 A;  4ZPC A;  4JI6 J;  1WF2 A;  4TVA B;  4F26 A;  1FRK A;  3CJ2 A;  1TL4 A;  4FP9 A;  2CNN B;  3SFG A;  3EX7 B;  1E6V B;  3RAQ A;  1MNE A;  4K4W A;  2F4F A;  3J81 U;  2GZO A;  3FEZ A;  4DL3 A;  1HWL A;  5KFX A;  2HVE A;  2QC3 A;  2DHX A;  5DLG A;  2RKI A;  2BM0 A;  3CCS S;  7FD1 A;  8RUC A;  2MQM A;  4OI6 A;  3FKB A;  3KJV A;  4DN0 A;  4DPO A;  2KO1 A;  3G2X A;  1SB6 A;  3HVA A;  1R0B G;  3TJ8 A;  4LF8 J;  2RRB A;  4M1K A;  2E5I A;  3SXL A;  2L08 A;  3MEG A;  1YBT A;  3GV5 B;  2FZK B;  3FEY B;  2RAQ A;  4KQZ A;  1F5C A;  3M8P B;  1T3N A;  3B6B A;  4I2P A;  1F6T A;  3NCR A;  2HGN A;  4DUT A;  2OLW A;  4RUC A;  2XUL A;  4XIU A;  4WCE Q;  2I5J A;  2I1R A;  2KVI A;  3KHH A;  4LF6 J;  1VDH A;  1L3U A;  4C7Q A;  3FSY A;  3CJR A;  2FYX A;  1R8A A;  1HNV B;  4NLQ A;  4KH1 B;  3TA1 A;  1NK6 A;  5I4M A;  2YKA A;  1DZ5 A;  4JI2 J;  1P9Y A;  4Z7C A;  2RS2 A;  2MZJ A;  1PBA A;  3VTI A;  1FJC A;  2GHV C;  1IR2 A;  1B4S A;  1O5J A;  3MTK A;  5LOQ A;  4RJV A;  1RAC B;  2YVS A;  5KFP A;  2B0G A;  4AT1 B;  2DY9 A;  1NHK L;  3MMC A;  4CYU B;  2HWH A;  2DIS A;  3NNH A;  1L3S A;  5F8I A;  5KT6 A;  4C97 A;  5CAA A;  3UNG C;  1QVF R;  2QA1 A;  1ARO P;  3D1O A;  1H38 A;  3FQK A;  2XSF A;  1G1X A;  1WC5 A;  1IBL J;  2YNG A;  3FBB A;  2GHP A;  3G6Y A;  1U7L A;  2W7A A;  3W2V A;  1DQ9 A;  3HVR A;  3NNA A;  4FXD A;  3KLV A;  2ZM6 F;  2R2S A;  1TKD A;  5D6G A;  2UUC J;  1Q82 T;  1X31 C;  1GFW B;  1REV A;  4HR2 A;  3RBD A;  3AD9 C;  4RW8 A;  1GMW D;  3PNI A;  2QG9 B;  2UZA A;  1ZA2 B;  5F8H A;  3IBC B;  1NB7 A;  2VPW B;  2XBP A;  1NSA A;  3V5R A;  1V5I B;  3GZ7 A;  4MIA A;  2CJA A;  4NCA A;  4ZVG A;  3OHB A;  1DLO A;  1N33 J;  1Y5N B;  3ZO7 A;  3FMB A;  1FNX H;  4IDK B;  2OPR B;  3N9U C;  1M90 T;  1SH3 A;  2OPS B;  4I69 A;  1SC4 B;  1V3Z A;  1RXO B;  2XTJ P;  5HVH A;  4DPW A;  3BM7 A;  4V19 J;  2B7C B;  1HPZ B;  3NS7 B;  2H51 B;  3N79 A;  3CCT A;  2ADC A;  1JLQ A;  2ZJQ Q;  3QGI A;  4HHJ A;  2HBQ B;  3OL7 A;  4WKR A;  3UW1 A;  4DL0 C;  4KKO A;  1PJ7 A;  3M30 B;  1YJW S;  4ZVU B;  1NSQ A;  1CSJ A;  1CJU B;  4AXJ A;  4LF5 F;  4M8L A;  2Z58 B;  4R8U B;  5K8N A;  2FHK A;  2XWX A;  4G65 A;  3M05 A;  3OL9 A;  2MQN A;  2FIU A;  5L9X A;  4DWI A;  3KLF A;  4DV3 F;  4Y2I A;  3MUR P;  2AWZ A;  2DH7 A;  4DSF A;  2Y1R I;  4JI4 F;  1KQS R;  1VQ8 S;  4RL1 A;  3BSN A;  3N6L A;  4NCG B;  2ZBC A;  3AQO A;  1S77 D;  2A2C A;  2H5J B;  4HDH A;  4ZCM A;  2OP5 A;  3RB0 A;  2Q43 A;  3HK2 A;  2AP6 A;  2DEI A;  1D3W A;  5IWA J;  2HK2 A;  5DQH A;  3V2U C;  4HT5 A;  3M2U B;  1YG0 A;  4AD6 A;  3TRG A;  3MM9 A;  2Q6B A;  4F02 A;  4QIF A;  1SUQ A;  4WP3 A;  3C19 A;  4JI1 F;  2DGX A;  5FLX Y;  4Q43 A;  1UW4 A;  4TNO A;  3LGN A;  4IYQ A;  2VBY A;  5T7L B;  2B5J A;  4LBP A;  2LQB A;  1X60 A;  1VI7 A;  2DO0 A;  4OI4 A;  2VQE J;  5SUH A;  3M8S A;  4AND A;  1DTQ B;  3OR2 A;  1C4C A;  1CJT B;  4Z7Y A;  2FJE B;  3BQ2 A;  2VAS A;  1O0P A;  4NEY A;  1U25 A;  2HLU A;  1S1X A;  4WII A;  2A6O A;  1AXQ A;  3R7S B;  4LF9 J;  1RT6 B;  4K7Q A;  2YPZ A;  2XNQ A;  3UCU P;  1VYA A;  2FDN A;  3KWM A;  1BLU A;  2D9O A;  4OYW A;  3NGS A;  4DR2 F;  2RDI A;  3CO9 A;  3HSD A;  3ILO A;  2M8H A;  1Y5L B;  5D4O A;  3BQ1 A;  4I6W A;  5HMX A;  1BQN A;  1UA1 A;  2D3Z A;  3Q23 A;  3CCE S;  4OX9 F;  1FKP B;  3VVU A;  2FHO B;  4R5P B;  4TXS A;  1LWE B;  1TV6 B;  2VD3 A;  2OPQ B;  1HLW A;  1WJ9 A;  1NJZ A;  5HP1 B;  2V4Q A;  4FF2 A;  4CCH A;  1C0U A;  3CNQ P;  2WOM A;  5HRO B;  1H3D A;  3MD1 A;  2RJZ A;  3BN7 A;  4RO0 A;  4DR3 J;  4C8Z A;  2QX0 A;  2WTF A;  4ZVR B;  2CKW A;  3GYG A;  2H1Y A;  2EI5 A;  3NL0 A;  5DDQ C;  3WBZ A;  3CB4 A;  2K3K A;  3PR4 A;  3NS6 A;  3QYY A;  3DGP B;  4DL5 A;  3MCM A;  1JKH A;  5C25 A;  1Q8L A;  1R43 A;  2W2O P;  1BY9 A;  5AJ3 F;  1RYR A;  4S0M A;  1VIX A;  2B4V A;  3MAQ A;  1EET B;  1EP4 A;  2M88 A;  5KFR A;  2F3J A;  4WU2 A;  4MKA A;  3SCK E;  2ZBI A;  4RUH A;  3QT8 A;  4ZPV R;  2IA0 A;  4ZN1 A;  1KR4 A;  1V3S A;  3DRP B;  2ZNY A;  2ZH3 A;  2A1B A;  4PXD A;  2KXH A;  5G0R B;  1C1C A;  2XY7 A;  1WOO A;  1WTF A;  1W26 A;  5KG3 A;  4USM A;  4LQ3 A;  1MG7 A;  2QV6 A;  4DU8 A;  1WSR A;  3NGT A;  6FDR A;  3IG1 B;  2MQP A;  4J5O A;  4QYZ J;  1M0S A;  1FWP A;  3IBW A;  3IGV A;  3PFO A;  3EGW B;  3IRX B;  2FJV A;  2C3O A;  3NAI A;  1U4B A;  2WSE C;  3P5T L;  2RUG A;  3HCX A;  5AE1 A;  5THW A;  4RNM A;  2KI2 A;  1WOP A;  5J2M B;  1Y00 A;  4FXV A;  1TL7 A;  1H2T Z;  4P2F A;  2VH7 A;  3PY8 A;  3TX8 A;  4C3M A;  2QTW A;  3T6J A;  2JEJ A;  4Y65 A;  4Z37 A;  5L38 A;  5MLC V;  4OX8 A;  2K8G A;  2RU9 A;  2BJ3 A;  3BH7 B;  5IV3 A;  3HF5 A;  4CWB A;  2P6T A;  4U8V A;  1YBU A;  3UQS A;  3ETM A;  4OYB A;  3HI9 A;  2HQI A;  4C3K A;  5L1L A;  3CC4 S;  5BR8 J;  5GAH I;  4FS2 A;  2PMZ D;  3GIR A;  2QLJ B;  4MIW A;  4D3G A;  1AA1 B;  5B09 A;  4ZLJ A;  1XQI A;  1FFG B;  3CCW A;  2ZD1 B;  1VC0 A;  4Y2C A;  4BS2 A;  1MMN A;  3RU0 A;  4H4M A;  1U0S A;  2HNY B;  4LF7 J;  2RIL A;  1SKU B;  1CC7 A;  5CXT A;  3D6H B;  1NK5 A;  2ZH4 A;  2XB2 D;  2J9C A;  3G86 A;  4JOU A;  1I51 B;  1S72 S;  1X4B A;  2V50 A;  1P8G A;  1RCX B;  3TUI C;  1UFL A;  4RW6 B;  3ILI A;  5C24 A;  5ETR A;  3NOG A;  3MMB A;  1U48 A;  4RW9 A;  3BGR B;  3QGG A;  2CQ2 A;  5DGB A;  4OLO A;  3M6V A;  2CWK A;  3TZZ A;  4JI3 F;  2OUG A;  4BWJ A;  4ZOS A;  3O6Q A;  5D3G A;  1W25 A;  3KG0 A;  2MY7 A;  2HGL A;  3QWP A;  4UUW A;  3VGU A;  2V68 A;  3DMJ A;  4X2B A;  4B3M F;  4ILR A;  2MHN A;  2FD2 A;  3ULH A;  3P4U B;  3DM2 B;  1RSC A;  2EFN A;  3F73 A;  4Q0B B;  3K0J A;  4UQT A;  3AD7 C;  3MM5 A;  2B3T B;  2YBV A;  2EEY A;  2P8I A;  2C1E B;  3QO9 A;  1IBK J;  4EFA C;  3MHY A;  2KL8 A;  2IRU A;  2CPJ A;  3M7V A;  3GTY X;  3OFG A;  3K5N A;  2CQG A;  1HBM A;  1RLD A;  2VBX A;  2V34 A;  2AYG A;  4CO3 A;  1PO6 A;  2NR0 A;  1PKU A;  2YH1 A;  1R31 A;  3HDS A;  1FDD A;  1KRP A;  1MLA A;  1GXL A;  4QOT A;  2V8V A;  1KHW A;  3MI7 X;  2UV8 A;  3NWR A;  3I5A A;  3Q22 A;  4QPX A;  1JLF A;  4ERD A;  2EFP A;  3FC9 A;  2OD4 A;  3NBP B;  4QYZ K;  2B6A B;  1R0C B;  5F8M A;  2E1A A;  3N01 A;  1IBC B;  1KDN A;  8ATC B;  2QMX A;  4LBH A;  2HAI A;  4JI0 J;  2MPU A;  2AIR B;  2IM3 A;  4J9R A;  2QEX S;  3MMA B;  4DFM A;  1KQK A;  1Q16 B;  4KO0 B;  3DOL A;  2FJX A;  3B78 A;  4YR2 A;  5M2R A;  2RSQ A;  5CAB A;  4PAB A;  1H72 C;  3KHG A;  2BAN A;  3MPU B;  5HAT A;  3AJ1 A;  4I67 A;  4A4J A;  5B08 A;  1NZA A;  3NMA A;  3QIP A;  4NA1 A;  2KH9 A;  1FD8 A;  4KB7 A;  3NGD A;  4Q5V A;  1GAO A;  3IAS 9;  2Z0G A;  2R8I A;  1S7H A;  4DDF A;  3BSA A;  1YKW A;  1S1V A;  1X4H A;  4NCB A;  3L7O A;  3C16 A;  3TX0 A;  2BJD A;  1M5S A;  4QW8 A;  1QD1 A;  4UST A;  4CO4 A;  3RR7 A;  2DNG A;  1X8D A;  2R2R A;  3FRY A;  1T94 A;  4LIW A;  3DHX A;  4FXW A;  4F50 A;  1UET A;  1NAQ A;  3CPW R;  4B9V A;  1NRK A;  4Z2X A;  4U8Y A;  3V6D B;  2XCP A;  4PWU A;  4CI0 B;  2LLZ A;  5BYQ A;  1MN7 A;  4LRD A;  3H20 A;  5A0Y B;  1KOO A;  3BBB A;  3GCW P;  3AJD A;  1OJ4 A;  1TK8 A;  3CJ3 A;  2NSC A; 
#chains in the Genus database with same CATH homology
 2C2M B;  2XYP B;  1RWP B;  1GFW B;  1SC1 B;  3R6G B;  1QTN B;  2HBR B;  3R6L B;  3R7B B;  2CDR B;  3R5J B;  1RHR B;  1RWO B;  2CNO B;  4LSZ B;  4DCP B;  2XZD B;  1RWX B;  5IC6 B;  2XYG B;  2QL9 B;  4JB8 B;  3IBC B;  3RJM B;  1RHM B;  3D6H B;  3R7S B;  1PAU B;  5K20 B;  2P2C B;  1SC3 B;  2CNN B;  2H54 B;  2QLF B;  1RHU B;  3GJR B;  4ZVR B;  3GJQ B;  2H48 B;  1I3O B;  1I51 B;  3D6F B;  4DCO B;  1RHK B;  2C2K B;  2CJX B;  2H4Y B;  2FQQ B;  2HBY B;  1RWV B;  1F9E B;  2C2O B;  3KJF B;  4ZVO B;  5IC4 B;  3GJT B;  2H5J B;  3EDQ B;  2CJY B;  1BMQ B;  1SC4 B;  4ZVT B;  1RWM B;  2QL7 B;  4ZVQ B;  1IBC B;  2Y1L B;  2C2Z B;  1RWK B;  3KJQ B;  3NS7 B;  1RWW B;  1RE1 B;  2H51 B;  2XZT B;  2QL5 B;  3R7N B;  2CNL B;  3EDR B;  3P45 B;  2H5I B;  2HBQ B;  1PYO B;  2HBZ B;  3P4U B;  1RHJ B;  3IBF B;  2Y0B B;  4ZVP B;  3GJS B;  1ICE B;  2QLJ B;  3QNW B;  4ZVU B;  3SIP B;  2C1E B;  2QLB B;  2CNK B;  2H65 B;  4DCJ B;  2DKO B;  1NME B;  3KJN B;  2XYH B;  3D6M B;  1QDU B;  2H4W B;  1RWN B;  4ZVS B;  1RHQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...