3GJRB

Caspase-3 binds diverse p4 residues in peptides
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
92
structure length
92
Chain Sequence
b'KIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-3 subunit p17
molecule tags Apoptosis
source organism Homo sapiens
publication title Caspase-3 binds diverse P4 residues in peptides as revealed by crystallography and structural modeling.
pubmed doi rcsb
total genus 19
structure length 92
sequence length 92
chains with identical sequence D
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2009-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 3gjrB00
2DKOB 2CJYB 4DCPB 1RWKB 2C2MB 2CJXB 3D6HB 1PYOB 5K20B 4LSZB 1SC3B 3GJTB 1SC1B 2XYHB 3D6FB 3NS7B 3EDQB 1F9EB 3R7NB 3GJQB 1RWVB 2QLBB 1QDUB 2CNLB 3R6LB 2HBYB 2XYPB 2C2ZB 2XZTB 4DCJB 1PAUB 2H65B 1ICEB 2H5JB 1RWWB 3KJQB 1RHQB 2QLJB 4ZVRB 1RHJB 2XYGB 3QNWB 4ZVQB 1RWMB 3IBFB 5IC6B 2CDRB 2H4YB 3R7BB 4ZVOB 2H48B 2H4WB 3GJSB 2H5IB 3GJRB 1RHKB 2C2KB 3IBCB 1I51B 1IBCB 2Y1LB 3EDRB 2QLFB 4ZVPB 5IC4B 1RE1B 1RHRB 1NMEB 3P45B 1RWPB 2C2OB 3R5JB 1BMQB 2CNKB 1RWXB 1GFWB 2CNNB 2HBQB 1SC4B 4ZVSB 2P2CB 1RWNB 2H51B 3R6GB 2HBRB 1RWOB 2Y0BB 4ZVUB 1QTNB 1I3OB 2C1EB 3KJFB 3R7SB 2QL7B 2QL5B 1RHUB 3P4UB 1RHMB 2H54B 4JB8B 2QL9B 4ZVTB 3SIPB 4DCOB 2CNOB 2XZDB 3D6MB 2FQQB 2HBZB 3RJMB 3KJNB
chains in the Genus database with same CATH superfamily
2H1YA 2DNYA 4JI0F 3DOKA 4PRFA 5A0YB 3KUEA 1OIAA 4YR3A 4EO6A 4TLQA 5HQLA 2MJNA 2RQ4A 4YEAA 1SIWB 4U95A 4DV5F 1UJ5A 3H40A 2VONA 1VK3A 2DH7A 2WZ1A 3TJ8A 4NLRA 1N36F 3CCSS 3EGNA 2EVZA 3LGNA 2ZKTA 5GMDA 4FNIA 1RYRA 4WFAQ 2FHJA 3L4BC 3PO4A 3AODA 4U67Q 2DR8A 5E33A 1U8SA 4DBQA 3WBZA 2YNGB 4EZ9A 1ZTTA 1XK8A 1OS5A 2VQFJ 1KLMB 3B4MA 1RI7A 5CABA 2MZTA 3M7VA 5LMUF 4HL9A 5J2NB 4F02A 2VH7A 2QFJA 4DFMA 4C8OA 3M1VB 2J0QD 4DPWA 3MPUB 1J5OA 2PMHA 2ZUGA 4P71A 4FBUA 1UVKA 4KE5A 6FD1A 1R8BA 2GVDB 3MM8B 2EC0A 4K4VA 1YRXA 3GJQB 2GJFA 1NSAA 3I9V9 4ECSA 4NEYA 1O51A 1N6QA 2UU9J 2AJQA 1Q86T 2MDAA 4ZP6A 2FJVA 2MHNA 2RVJA 3AXMA 2CXEA 3Q83A 3PY8A 2EFQA 2HMIB 1SJRA 3IS9A 4PZVA 5HN0A 2C2EA 1RAEB 3C2PA 2HZVA 4MFBA 4TQSA 2CUYA 1RP5A 3QT5A 1NHVA 2IA6A 4LF9F 1NDKA 5J2QB 2VUGA 2R7OA 2JC1A 2EK6A 2N7YA 1ICEB 4ID5A 4MK8A 3NS5A 3PV8A 4I6YA 3UPFA 2DR7A 2CJQA 2FHMA 1P8GA 2EG2A 2EK1A 1Q78A 1NZAA 2NSCA 5EHHA 2V50A 1UVJA 2NXUA 1KC8T 3HT0A 4ECZA 4ZVQB 3LTOA 1E6YA 4DZDA 2HNZA 2OPRB 1SQEA 3GONA 4JI2F 3WX4A 2RU3A 3MAAA 5DGAA 3GCXP 4NCGA 2PEHA 1TMMA 2VICA 2OGUA 2K1RA 2W4PA 3HVWA 2JNJA 4KSEB 3QO9B 5KFEA 2A2DA 4QR2A 2AJ1A 1U2CA 5C42A 3TUPA 1O6XA 3JYTB 3OR1B 3RW7A 1XMQJ 1EIYB 3SDEA 4IR1A 5BYRA 3R2DJ 3EDRB 3LP1A 1QSSA 2HIYA 5J2MA 3IG1B 1HQUA 2Z56B 4HHJA 4ES3A 1JLEA 1R8PA 1RT7A 1WKKA 1Q95G 4QW8A 5A8WB 4C48A 4CZCA 1DLOB 1HBNB 5GADU 3KHHA 1XMOJ 3HMJG 4PYDA 2E9RX 1OSDA 3M6WA 4NLPA 2DEJA 1RT6B 1NHUA 1UVIA 1ZOTA 2QA2A 3A13A 1VLOA 2ZOMA 3BF4A 4WE1B 5C25B 5IQQA 1VC5A 4K4SA 1F1BB 3FFIB 1DTQA 2AGQA 2M9KA 2RKIA 2YNHB 1PJ6A 1UTAA 4B3RJ 1NB2A 4MK7A 1RWNB 3MAAB 3MCMA 1YLXA 1ZTWA 1S9GB 3NNAA 1HFEL 2Y0BB 1HNVA 3IA0A 2XULA 2AEJA 1FTCA 5K9FA 4DN9A 2R7RA 3B82A 1N5TA 1S1XA 1XBWA 3BBCA 4ECQA 5C5JA 1MN9A 3MMBA 3TX8A 1RT5B 1SJ4P 3OHBA 2OPQA 4WXWA 3WDOA 2M2BA 3KG0A 2WBMA 2E5JA 3IM9A 3MPWA 3W64A 4E8UA 5C2GA 5CCMA 2V4RA 5KFCA 4OLPA 3TUIC 4J9OA 2QGFB 3RRHA 2C22A 4QCLA 4KFBA 2SXLA 1UZDA 3GYGA 2KDOA 1U2RA 3ZTOA 4CT9A 5F3ZA 5I42A 2PFDA 1XMBA 5IOLA 1T7PA 2RD5C 1T9TA 2FC8A 1UWBB 1N5SA 2J8AA 2PE8A 2FDNA 2HHTA 2HHVA 2WK4A 2HQCA 5HQ8A 2W9BB 1TL1B 2BE2B 2CJAA 3GE9A 4R8UB 2C2MB 4HKQA 2Q43A 1H73A 2IMOA 2HVZA 4X4TA 1S7IA 5L1IA 1VQNS 5J1PA 3G2XA 3KOAA 3Q0AA 1PYTA 4EMDA 4NXNJ 1ZZNA 2DT9A 4B9MA 1F5AA 2BABA 2FZGB 1LWXA 3TVZA 3EVOA 1VQ8S 1Y0HA 1IR0A 2AMCB 1S99A 4DPTA 3ILLA 1PSDA 2GHWA 4KH1B 1MROB 3TRGA 1CJUA 3MMAB 3DOLA 2RRNA 2KVQE 2V8VA 4OYZA 2MXYA 1NK0A 1YTYA 1WC6A 1S4FA 2HBYB 1CJTA 2V67A 1WG4A 3D1HA 3I82A 3Q89A 4IOBA 2XYPB 1N32F 1DBDA 1C4AA 3PYEA 1SL1A 3RZAA 1RT6A 1KD1T 2LA4A 1LFPA 4ZVEA 1IM4A 4DV6F 4WIIA 5D0HA 2W2QP 1FRIA 1G1XA 1IXKA 1F0XA 5IFMA 2NREA 2GNKA 4B3OA 4O0IA 1SV5A 2FZCB 4CDIA 3JAMU 5G4DA 5AJ3F 5F9LA 3J7YI 3UNYA 3PX4A 3JTNA 5EDWA 4M63A 3IMQJ 1Y3KA 3M2UA 5G0RA 4H4OA 2OFGX 1HYSB 3T6BA 5K8OA 2AQ4A 3SDEB 4BBYA 2HHHF 5IC6B 4TKTA 4LQ3A 2E66A 2H4YB 4MT1A 5LSLA 3J80Y 1GNKA 1VIXA 2FY1A 1D09B 2CJBA 1VQ6S 2ILYA 1S7HA 5B0DA 3OTOJ 3GFZA 3DOLB 1R8CA 4IRKA 5M2RA 3C14A 1MROA 1EARA 1RHKB 3O6QA 3GU0A 3SQOP 2I6WA 4B3MJ 4JV5J 4LFAJ 3VAKA 2CQDA 4EI2A 1CS4A 1UJ6A 2N4DA 3HDSA 3A3NB 4O0NA 3BSCA 5ETNA 1NK4A 4ZJLA 1Z2LA 4OZ1A 3US5A 4ECYA 3POTA 4F4WA 4TY8A 4LF7J 1TL3B 1APSA 1R3NA 3EZOA 5LL6d 5KT7A 4QIVA 1Z1ZA 1YJ9S 2O66A 4IQMA 3TARA 1UEUA 2IC3B 2O01C 3H59A 5T7LB 2QTWA 5IS2A 3LPYA 1T8EA 2GJ2A 1IKVB 1LWEA 1NDLA 2CZ4A 2GFFA 4MKAA 5ETKA 4B17A 2ZC4A 4C11A 3CC2S 3PYGA 3HVAA 1WF0A 2CPDA 1S1VA 5B08A 2VG7A 4URQU 3V6HA 2FJBB 1G3OA 3J81U 2KZMA 1OMSA 3QBCA 3RB0A 1SKUB 1WG5A 4C0BA 3PKMA 2PMWA 2NS1B 1HWIA 1KKHA 3HULA 5D4LA 3V5RA 2YQ0A 2CIMA 2V8HA 3GCWP 2ZM6F 4LF6J 1V5VA 4NRTA 1QSYA 2HEKA 3IS9B 3C46A 1O8BA 4A8OA 4QWCA 2P6TA 2X1BA 4C97A 3J7ZT 1L3KA 2YX1A 4ETZA 1PJ5A 3PRBA 4B3SJ 2RS8A 1WHXA 3IGVA 4BDPA 3NNCA 1NEEA 2AIRB 1IJEB 1KBRA 1UP1A 4IG0A 4WPAA 1QAXA 2QMXA 3EXCX 3SMZA 3SEOA 4PWWA 3GIIA 2QN6B 2UUTA 1HQEA 3CD0A 2FLOA 4C0OC 2FQQB 2HBZB 3G8QA 1QAIA 3RJMB 3HHDA 3EGVA 2MQQA 4FF2A 1AYEA 2XBPA 3PIOQ 4WBFA 3DLKA 4JYAF 3UDEA 2ATLA 4OYBA 3HFKA 4N8NA 3T5KA 4WFYA 2MKCA 2YWGA 4WKRA 4P6QA 3RR7A 3FCWA 1YBUA 3KLIB 4IO9Q 3R27A 4C8YA 1HNWJ 1OY9A 1FVSA 1SQFA 1SQGA 3K58A 1K0VA 1QAYA 2LXFA 2ROPA 1F3VA 4G1IA 3KJVB 4J9QA 2MKYA 4Y2CA 2V2QA 4A4JA 1E6VA 4ZPDA 5ETVA 4CLWA 2KKHA 3I0SA 1YWXA 5EWFA 1R7IA 4MH8A 1U6ZA 2EKNA 3FSYA 8AT1B 2W2NP 2CA9A 3C15B 3DLGA 4ZP9A 4ECVA 1TL7A 1VHIA 3ZTSA 2FJXA 1NDCA 1N5YB 4DXLA 3D4JA 1UVMA 2I5JA 3UDCA 1JX4A 2E7VA 3CD5A 2V8PA 2W4DA 4Y2KA 5B7WA 2ZH3A 1A6LA 1Q1KA 2CPYA 1EETB 2MLZA 1IKVA 1LWEB 4WP9A 3SQGB 2YNFB 2AZ1A 1LW0A 4LUBA 4JUZA 1X9WA 2YH0A 3BGLA 4PCQA 2V63A 4JI2J 1DHMA 2ROEA 3IRXA 1ZPVA 2VG7B 1N5VA 1NJIT 2Y1IA 2B3TB 3BS9A 2Z4PA 2MGZA 1U6FA 1RTZA 3OFEA 3L7PA 2I38A 2MZQA 5LMUJ 2X7IA 4IG3A 4A48A 1AUSL 3HI9A 3ZZ0A 4O3PA 4OYWA 4LMZA 5KFMA 3AJDA 3RBZA 4NLTA 2OAUA 2XS7A 4J9PA 2DH9A 1C1CA 2WONA 4PXBA 5FDLA 3JXOA 5DLGA 2ZJPQ 4ZP8A 3P8BB 1HR0F 1BXNA 2DCLA 1YZ6A 3V4IB 3H5XA 2AX0A 5HI7A 2LQ8A 2PA8D 1IWAA 3DCAA 3BQ1A 2EBEA 1X9SA 4AE5A 1UA0A 1JK9B 3QGGA 4L6V3 5KG4A 4ZLPA 3NCPA 1GQEA 3FC9A 4C4WA 3HO1A 4AYBD 2IDLA 5GAEI 3TZYA 5DG7A 1V5IB 4GVLA 1KLMA 4K4TA 3V2UC 2A1BA 1ZM2A 2F65A 3NGDA 2ZVIA 4TVAB 2DNQA 4FYVB 4I69A 1F60B 1M5OC 1X4FA 4PXDA 2GGPA 1UFWA 2CG8A 4P2XA 4YDXA 4WCEQ 5KFIA 2BYCA 3PIPQ 1TUWA 1F2HA 2J7WA 3CO9A 3NBPB 1YRUA 4WK1A 1FKPB 2MZ1A 3DFEA 3PR5B 2BA9A 5KFTA 1W2IA 4X62F 2XY7A 1XC9A 2GO8A 2PI4A 4F4KA 3DU6A 1MMNA 2OKQA 5CXTA 4CTAB 3G6VA 1HQUB 3JS9A 3PXGa 4DI6A 3CCQS 2J6TA 2F40A 4USTA 4KHPJ 2AYEA 2FYXA 3FKBA 1XMQF 1R6VA 4YHHF 1R0CB 4NI2A 3MR3A 3V81A 5KT3A 4DQSA 2VL1A 2ZHOA 3BBFA 3F56A 3ISND 2AYMA 5BR8J 2B5JB 3GIKA 5D3GA 3VHQA 2W4CA 3N9UC 3KLVA 2OPSA 1JLQA 4URGA 2KT5A 3D1QA 4LF7F 1C4CA 3AY0A 4B3OB 3W1YC 2R7VA 3ET6B 2FVPA 2MZRA 4RW6B 1DAXA 2LLZA 4NLOA 2ERRA 2H54B 2JL9A 1V9OA 3BKFA 3R9LA 5KFXA 2XNRA 4KPCA 2CNOB 3LP0A 2XZDB 2GQQA 2GGPB 5C42B 4EBEA 2CVEA 2D74B 2OMOA 4ZDNA 4OL8A 1FRXA 1NCLA 2D9OA 3KLEA 4M5LA 3DMJB 4DR6F 2RDJA 4X4VA 2GQ2A 4AXJA 4YUDA 2VFUA 5BYQA 1QD1A 2W2OP 4FPRA 5J2PA 1TK8A 3DGPB 3QRQA 4V19X 2IYIA 2PC6A 1VIOA 2LQBA 3CDBA 1OPIA 4LREA 2B4OA 3H4BA 3M2RB 2CVIA 4YOEA 3M05A 4DR2F 2UU9F 3MR6A 4DOZA 3IAS9 1LW2A 3ENWA 4GO7X 4IFVA 1U1PA 4ELUA 2KN4A 5A8KB 3D54A 5CCLA 4X4NA 3M9MB 1PC4A 4DR7F 4Z7CA 1RCXB 3NOCA 1RT2B 3B6BA 3R5GA 5CYMB 4DR3J 3ZTPA 2HPUA 4CO1A 2N3LA 3RB4A 3ZTQA 3HHEA 1XR7A 2ZJRQ 5L39A 2DPJA 2DB1A 2HQGA 1BY9A 1TAQA 2Z8QA 2KT2A 5IWAJ 4JI8J 2IJRA 1F5CA 3NGUA 1XEZA 3L7UA 4OYPA 4TU9A 4HLBA 1C0TA 2BV3A 5AE2A 1WC5A 3ISNC 4N56A 2E1RA 5B0FA 2LKZA 3LAMA 1OYDA 2COLA 2CQ0A 4Y6IA 2UXBF 2QSFA 1TFWA 1KHVA 2GIRA 1UL3A 3DHWC 4O44B 4UUWA 5K14B 5KG1A 5L1LA 1K1QA 2DGOA 3HVRA 4F3OA 2BUNA 4MKVA 1S9EA 2HRYA 1JNRB 2FHOB 3WX8A 3JSBA 4OYXA 2B8QA 3IO1A 3DOMB 1REGX 1FWLA 4CLZA 3R3TA 3OSPA 1MLAA 4YN3B 2DXDA 1ITPA 5DQIA 2CPEA 2OPPB 4J7CA 3FNNA 4F3QA 4ZITA 1FNXH 2ZH2A 1N52B 2BZ2A 3A8JA 3MTJA 1Q8BA 1KN6A 4MMOA 1XQIA 4LRBA 1OQ3A 4DJBA 3BH7B 3ISZA 4LBHA 3MDFA 1HQEB 4PXEA 4X64J 1J2VA 1JLAB 2B9XA 1BWVA 2DGSA 2HS0A 2V8DA 2PMZD 3M9NB 1RB0A 1S6OA 3D0GE 4AQYF 4AL7A 4DDFA 3EUNA 1TTHB 1YX2A 4NMXA 2VBZA 3M2UB 5G0RB 3KWMA 3DRPB 3TA2A 3F44A 3JSMB 4CO5A 2XO6A 3ZNUA 1DURA 2E5IA 1S49A 2XHWA 3DRXA 1O5JA 1U2FA 2B9YA 3HZGA 2N82B 2AP6A 1FFSB 1R0BG 2EPIA 2RUGA 2WW4A 4FP9A 4C3MA 4MIBA 2D3ZA 4YHHJ 4Q8FA 3MD3A 2X3DA 4E0DA 1CVJA 5HMWA 3S6EA 1BLUA 2HBQB 5DDQC 9RUBA 2HHWA 3QRRA 1Q79A 2UZAA 1GMWA 5DDPC 1VQKS 4B3SF 2X51A 4U6PA 2H51B 2JEFA 2P5VA 1D3WA 1M0SA 4QU6A 1X4BA 5F8NA 2HHHJ 4NZ7A 4KGMA 1SL0A 1I3OB 3PCOB 3FEXB 4A8MP 4BS2A 3AH6A 4RKUC 4QJVA 1X4EA 4R5PA 1TV6B 2XS2A 5KFZA 2AV5A 4DV4F 2I2YA 1TV6A 1TU0B 2MSSA 4LSLB 4MKBA 1NK5A 4YB7A 1HNIB 1B70B 3OXGA 5F0UA 4B9NA 1R8HA 3A3PB 2IHR1 2R8HA 2JRSA 3AAWB 3TAPA 2R3VA 4YFUA 1Q5YA 2D41A 4DQIA 2L9DA 2YKNA 4FYYB 2HQ3A 4KQZA 4Y65A 1RAGB 2VG5B 4GMKA 1FE0A 1RT3A 5EN1A 5H9FJ 3DM2A 1N32J 3EXYA 1JWWA 4MAKA 5A8KA 4U96A 3IP0A 2K8GA 4DCPB 3AOBA 5J1NA 1L3TA 2BMBA 3VF0B 2BJEA 2CJXB 3D6HB 2AT1B 3CCUS 2FLNA 4NLGA 1FJGF 3FUYA 2XSJA 5E3QA 4WFBQ 2R2SA 2GVZB 3AB2B 5E0OA 2VFTA 1CG2A 4JI6F 3DDIA 2UUCF 2ZHAA 2H9ZA 2MKIA 3TZXA 3BQ0A 3GQCA 2FHKA 2YNGA 1SC3B 2OD6A 1S6QB 1HNZJ 2CPZA 1WC4A 4ED0A 3E8OA 3GR0A 2GO9A 3I5AA 1Q82T 1HHTP 4KO0B 2B51A 2NZCA 2QMUB 3CJ0A 1Y5IB 2WCXA 2KG1A 2XO7A 5F8JA 2DGXA 4BWJA 5D0EA 5ITHA 3MR7A 3P6YC 1NDPA 2KYZA 1TKTB 4U8VA 1M5VC 3DXBA 4ZJOA 1LOUA 2JEIA 1S9EB 3A8KA 1BE4A 4CLLA 4EBDA 2VPZB 2XM3A 1K47A 1TP7A 3E01A 4I4BA 3PKYA 2YWFA 1ZBTA 1TMJA 4HTIA 4DCJB 2HHQA 3K5PA 1RGVA 2CQ1A 1GK8A 4ED6A 2G0JA 2UXCJ 4TN2A 2XMJA 3PFOA 5HMYA 3I87A 4DU8A 4ID5B 3KJQB 1FDNA 3AFGA 3BJYA 3EYZA 3QNWB 1FT8A 2HZAA 2B9WA 2MY8A 4Y2AA 1UPPA 2G2OA 3M8QA 1NSQA 2YX7A 4ZK7M 4K2XA 5BXIA 2BR0A 1ELOA 4WJBA 3R7BB 2ZKUA 5KFRA 3W9HA 2WSEC 2DVIA 3AT1B 3HHKA 4WWSA 5E3AA 5SUHA 1L5UA 4BLGA 2CPIA 1IWGA 1ZM3A 3TAMB 4Y00A 2V4QA 4USMA 2QA1A 1DRZA 5T14A 2VC0A 2HFSA 4LFBF 4DV0J 2VDIA 4QW9A 1RQ0A 3AA9A 1XIQA 3A1YG 1K8AT 3HVTB 4OI4A 1HI1A 4RW4A 3H98A 4ZHRA 2ZH4A 1FX2A 2BJ8A 3JTPA 1VRTA 3PW4A 4UTGA 1NPKA 4JI5J 1TL4A 3TJAA 4PG5A 3OTDA 5SZTA 4MIWA 7FDRA 1HWLA 2K3IA 3Q8SB 3G9CA 4JOUA 2WAQD 1RT4A 4X4RA 3RW6A 1T9XA 3S01A 1DFDA 3FVYA 2XMUA 1RT2A 3FEYB 5KFVA 1MWZA 2CNKB 1D8ZA 3BN4A 1JLQB 2ROGA 1KQSR 1AXQA 2XMVA 3R8YA 1FKOB 1CBKA 2YNHA 2YXLA 3GV8B 5KFKA 4DUZF 4EYIB 1VQ9S 2BRLA 1RTJB 1FFWB 5LXRA 3EVWA 4URSA 2LU2A 3NAIA 2GV1A 3DKDA 3O3LA 4K5RA 4OZ2A 3K5LA 4ES2A 2K7KA 4I6WA 2UP1A 4P75A 3N79A 2M4MA 1RAIB 2U2FA 4OI2A 1FRLA 2B43A 2P9EA 3D0IE 3O2IA 1ZM9A 2YY3A 5L46A 3R1HA 2V9WA 2E5GA 4RNHA 2V4JA 3KG1A 4L76A 2HGNA 4LF8J 2RNEA 3MM5B 4F25A 5KFYA 4FXDA 3VAIA 1VQOS 1TL5A 3CCLS 1PAEX 2ALYB 2A10A 2NSBA 1HNWF 1XR6A 5IWAF 1DLOA 2ZZMA 4I2QB 2Q66A 1Q5VA 3MXHP 3KK2B 2RQMA 4OI1A 2RAQA 3KK2A 2FIUA 4LF5F 3IWNC 4S0MA 4DSIA 4P7TA 3K0JA 2VQFF 1YZ7A 1FF2A 3I4PA 4M5DB 4OYMA 4WE1A 5E7OB 2R8IA 3FSIA 3BO2A 3LA0A 1SKRA 3MTKA 2CQPA 2RT3A 4TYBA 4EGLA 4NCBA 1RTJA 2J6UA 2BX6A 2PGCA 4P73A 4ZVHA 2MQ8A 2D7SA 2OJ3A 2Z0GA 2E1CA 1N34J 4RBVA 4DV1J 4JV2A 2UXDJ 2CPXA 4Y0FA 2UVRA 4OYIA 4CWBA 3LP2A 1FD2A 4CNYA 3QSIA 2QMWA 5D4NA 1YQHA 4DSFA 3QSYB 3PHEA 1FHTA 2YX4A 3QGHA 2F4VF 3LP1B 3OFGA 2MKJA 4KGKA 2YKQA 3BO3A 1WORA 2X3GA 3R7NB 4CH1A 4MKYA 4K4ZA 4C98A 3D6TB 2E1MC 1N0VC 2DXEA 4J9VA 4OZ0A 1YJRA 1HR0J 3KDOA 1YJWS 1WACA 3R97A 2C3OA 1V3RA 4DR6J 4Y28C 3VVUA 1NJYA 1UJ4A 2DGQA 2C2ZB 2IIHA 4IH6A 3J81j 2IY5B 3H7HB 1Q7LB 3J7Z5 3HHNB 3FSXA 4U7CA 3TEGA 3V6KA 2CQ4A 2MQNA 3DN9A 2BANB 3ETOA 5DM7Q 2CYYA 4Q5VA 3WC0A 1W26A 1Y10A 2EEYA 4RL1A 3RBXA 1X5SA 4F36A 2AJ2A 3UCGA 5HL7Q 3G8TA 2W7PA 4O4GA 4QWBA 1RZMA 3D0HE 4DL2A 2AF6A 1GMUA 3CJ3A 5EGYA 2ZC3A 2R2RA 3Q8YA 4H4KA 3KKFA 3G6ES 2IFXA 3BPSP 4ILLA 1BWEA 1VJWA 2HLTA 3N4WA 1DQAA 4GKKF 2YTCA 1S1TA 1W25A 4ZVOB 2H48B 4IH7A 5J2PB 3CXCR 1RT5A 3ICLA 4EFAC 5KT5A 3DRSA 3NWGA 3W2VB 1T9WA 3JSMA 4USKA 2DGTA 1S72S 4FF4A 2D1CA 2NXNA 4HDHA 1FDDA 2AW0A 3ILJA 5DETA 5HJYA 2JFDA 4ECXA 1RTHA 3PJWA 1VJQA 1ZS6A 4I1TA 1ZA2B 2KG0A 3G86A 5CYJA 1KTVA 3E2EA 5I3PA 4RNFA 2Y1JA 4HI1A 4ZPVR 1HI8A 1JXLA 4QOTA 4DL5A 2C28A 2OMLA 1HI0P 1IBKF 3D67A 2DBBA 2KB2A 4WIQA 1JJHA 1ULRA 2G13A 4ITSA 4ZVPB 3WZ0A 5KG6A 4C3KA 3FRZA 4Z2XA 2NR0A 1FESA 3OJUA 2R7TA 1ZETA 2RKIB 5B0AA 5KFOA 3HLUA 2MQOA 1T02A 1ZH5A 1ZAVA 1PYSB 2LDYA 4XIUA 4IUFA 1M1HA 4ECUA 5CD4H 4LF4F 4M5NA 3OR2A 4QPXA 3W8GA 5HLFA 4U7UK 1U6BA 1S9GA 1JLAA 1SH0A 3GFXA 3MEKA 4DU7A 3BKTA 2PI5A 1B3TA 2HGLA 4ZPBA 4YMEA 4Q43A 4ZIWA 4MJKA 3RAQA 4XTTA 1N4LA 4F2SA 2ZD1A 4E2FB 1RAOA 4WYWA 3I32A 5E3CA 3M30A 3NS6A 1LFWA 2D69A 2HWHA 3GFYA 3N6MA 4IO1A 2J5AA 2VZ9A 4HH1A 4KAIA 5KFJA 3G6YA 2RQCA 2NLWA 3MECB 3DXSX 3NMRA 2J0XA 1BQMB 3M8WA 2VG6A 3TQ1A 1RTHB 3DLLQ 2E44A 1YVFA 3MUTP 1FJCA 1N5QA 4F4ZA 1CJTB 1NBEB 1H38A 2QL7B 3DGVA 3CTRA 3OLBA 3DDKA 2HAIA 2VBWA 3PVXA 1XNQF 2Y8YA 1HNZF 2E9TA 3M4XA 3NLCA 2XSJB 2H3EB 1U0HA 3ZFVA 4DR4F 2W1BA 1JB0C 2C2RA 4N41A 3D3CJ 4AT1B 1WEZA 4H4MB 3C6TA 3KK1B 1U45A 2UVUA 4JI6J 4U7UD 3IR7B 1WOSA 2GMHA 2FHJD 4LIWA 2HAFA 3EZUA 1HWJA 1P9YA 3M8SA 3W9IA 2HLUA 3M8RA 1OJ4A 4X66J 3OTCA 2ZUAA 4ZCLA 2E1PA 4CCHA 2GC8A 4B9LA 1HBUA 1HA1A 3C3LA 2OTJS 4Q45A 4B3MF 2XMMA 3P49B 1UFLA 5DM6Q 1RKJA 4OFZA 4KGVB 2OD4A 1OY8A 4NLSA 4NEZA 1U02A 1MG7A 2QLWA 3FZ2A 2HNDA 2W8KA 5DG8A 2G0CA 3DM2B 2HWTA 4IRCA 4JI7J 1VR6A 1WOOA 2LP4A 5HVFA 3SCJE 1VRTB 2DR6A 2ADCA 5HANA 1D0EA 3LGHA 2KJVA 1K0TA 2F3JA 3UW1A 1VK8A 4OI6A 4DX5A 4WU2A 3GILA 4YY3F 2R7QA 3WC2A 3UO0A 3P96A 2QLBB 2FD2A 4I6AA 4TNOA 1J27A 2PIIA 4PPDA 1WDDA 4NLDA 4H4MA 2DNHA 1ZZFA 2ZBRA 5ETPA 3GIJA 4K4XA 2BOPA 4NYOA 2RDIA 5HLFB 4PQUB 4O23A 1EKRA 3SQGA 2F9JA 2W8LA 1TKZB 1S12A 3FZBA 3MEGB 4DV3J 5J2NA 3NWRA 1NK8A 2MLXA 3MR2A 1VQLS 1MNEA 3S1TA 4EBCA 2ZFHA 1TKTA 4PWUA 2LXUA 3FK4A 4ZVRB 3M32A 3UI3A 4C7QA 3TI0A 2XYGB 1X9MA 3BDEA 3NBPA 5HROB 2M0GB 4IDKA 4YR2A 3UD4P 2Z2MA 3JSYA 4UOFA 3IBFB 2HRTA 1FO1A 2LECA 3THVA 4EO8A 3L3CA 4F0MA 1RAFB 2BQRA 2OSQA 1QAJA 2WOMA 3HF5A 2AEMA 5KT4A 4ECRA 4JI0J 1UFKA 4N7TA 2AJ0A 3ENQA 2IJFA 2XQCA 4J9MA 2G2ZA 3ZZTA 3FBFA 1HARA 4LF2A 4P7VA 2DTJA 3T41A 4DPUA 4CLUA 3MUVP 2CQCA 3AA8A 2JVRA 1I51B 1IBCB 3MGJA 2GX8A 2LQ5A 2X1AA 1I94F 4NXMJ 1R0AA 4ICLA 2B6AB 2YPZA 3OFHA 3HD1A 3B54A 2I0XA 2D3UA 4ZPCA 3VAGA 3V6DA 5H9FK 2A18A 2VPYB 5E41A 5F0WA 5LOQA 2ZH6A 3MURP 1EZZB 2GQCA 3TWZA 2AHOB 4FKYA 3K5MA 3VZHA 4WZMA 1WDTA 4KHRA 4KH0B 2GVDA 3MM8A 3ZNJ1 2DGVA 2QEXS 5L1JA 2AWZA 4DQQA 1AW0A 4IR9A 4OX6A 5AXLA 4J91A 2C3YA 2OEMA 3UVJA 4HACA 5EWGA 4DF4A 3E51A 3NP5A 2IBKA 2MSTA 4A8QA 2ZZNA 2OHDA 3OPKA 4CLSA 4B3TJ 2BW7A 3MM7B 1PJ7A 3PYFA 1B0VA 1SJ1A 2P2CB 1H7WA 2Q1LA 1C1CB 2WONB 4ZOSA 5FDLB 2KI2A 2W9CB 1WHYA 4M5JA 3JQJA 4K2JA 2LEBA 1UPMB 3GSDA 1U0HB 2A2CA 4ZVUB 3VVTA 3UCUP 1FEEA 4JI3F 3TNVA 3MEDA 5GMEA 3FMWA 2EFPA 2I5JB 3KLGB 2VQEF 2XTJP 3ITHA 3HSGA 5JXSA 2J8SA 2QL5B 3M6XA 5KFUA 1VRQC 4M1KA 4JI8F 1S79A 3CJ8A 3U27A 4QWEA 2RRAA 1H6KX 1AFJA 1NXIA 2YNIB 2GHVC 5H9EJ 2NUHA 2CZVC 4PKDB 1TVRA 2VJVA 2V2KA 1Q16B 1J5OB 1YJ7A 4DCOB 1KDNA 1TKXA 3R5CA 4LBPA 1M1GA 5CHCB 2WTFA 3CCES 4GC6A 4DFJA 3PX0A 3W7BA 3D6MB 1C0UB 1XERA 1IUJA 3K17A 4XAKA 2ASLA 4X4PA 1AROP 2RH3A 3KJNB 3X3UA 5IV3A 1QM9A 2LMIA 5GAHI 3KLEB 2DJWA 1S1XB 1SC6A 1KFDA 3CIMA 4GRSA 4TU7A 1RYSA 3NL0A 3TW0A 5CZVA 3HFVA 3QFHA 2DEIA 4GVBA 4LSNB 2F4FA 3E3XA 2V4JB 3QQCD 2J7UA 1V3SA 2HFUA 2HRUA 3J7YU 1KWMA 4HHUA 1JLEB 2HHPA 3CMQA 1VS3A 3TANA 2QLXA 1NJXA 2KM8B 3SV3A 1X0FA 1G6BA 1HQ2A 3CJSA 4OQJA 3BO4A 4OV6A 3V6JA 5H1SV 2V0NA 3QWPA 3G82A 4I0WA 2LEPA 4CM2A 4G1QB 2FZKB 4M5DA 5HQMA 3LWMA 1X4CA 1BQNB 2DISA 4WFZA 3DLKB 2DGWA 5A8RB 5AE3A 2XEXA 2EBGA 3DYAA 3BN7A 3DU5A 2K1RB 4B3RF 1NUEA 1R89A 3MI7X 4F0KA 2N4CA 4YR0A 2PFFB 2V94A 3W61A 1PG5B 1NRKA 1RXOB 3SSSA 5KOWA 1ZYQA 1NPPA 3OW2R 4UQTA 4Q0BA 4G65A 1A9NB 3TYTA 1MU2B 1P6TA 1IJFB 1SIZA 1UETA 2V6AA 5EX0A 2E5LJ 1Z4UA 3CIZA 3DNCA 2FJWA 3EGZA 2VA2A 3NG8A 1I6JA 5KT6A 1HMVA 1LWFB 1HW8A 3MWBA 4I2PB 5DS7A 1MMDA 2LQJA 4B02A 1FRJA 1U1MA 2ZNZA 3NGTA 1RHJB 1SXLA 2IDEA 1CC7A 3H25A 1N8RT 3IFEA 2W2PP 4M5GA 2BE7D 2DNOA 2X1GA 1IKYB 3HSDA 2KHDA 1CJVA 1FA0A 3CDEA 4IG0B 3GP9A 1JLBA 4A8XA 2N7CA 1JXVA 3O44A 1JLCA 4QR1A 1DQ9A 2XLIA 3TUZC 1UWBA 2RDDA 3MOZA 2W7OA 1CSJA 3D28A 3QLHA 2FUG9 4KR0B 4Q7AA 3TR5A 2JH3A 3L95X 2KT3A 4D3GA 2W7AA 5IXUA 4OJ1A 1RWUA 2CFXA 1RUSA 2H5IB 3GJRB 3KK1A 2VFRA 5AE1A 2XZWA 2BVZA 4CO0A 1RTIB 2IRXA 1N36J 3NXZA 2ASYA 3BGOP 1NSKL 5GAGI 4ZS6A 4TQRA 3UD3P 3TAQA 2FJEB 4LSLA 3H5YA 3VCDA 1VRUB 2HHSA 4CLTA 2XY5A 3DRPA 3RB3A 4RNMA 4OJGA 5JVGQ 3MMJA 2ZDOA 3KNGA 3KUHA 4OZ3A 5D15A 1QTMA 5GVQA 3GIMA 3MECA 4DR7J 3U02A 2HURA 3HFZB 3CD7A 2W2MP 3BYPA 2VOOA 3B4DA 4PABA 1HBNA 1YSJA 3MR5A 3IRWP 2NZ4A 2IAJA 4IKAA 1HWUA 1DTTB 1TFYA 1Z2ZA 5HSPA 4UF4A 4DFKA 3ZZOA 2R7WA 2BOAA 2V34A 3ENAA 4RBUA 4X66F 2EFVA 3H42A 3QAEA 3VTIA 2P9GA 4QPTA 3JQKA 3FQKA 3JB9k 3ILIA 4LRCA 2YNFA 4DR4J 4ECTA 1Q7YT 1XTZA 4CT8A 1KNZA 4CQ1A 1AT1B 3TA1A 2K06A 2CQGA 2OLWA 1HHQA 2B7BB 4IFYB 5DDRC 3Q24A 4NA3A 5HAOA 3RB6A 3AJ1A 2ALZA 4F2RA 1S0VA 2I8EA 4MYUA 2RHSB 3M6UA 4DN0A 4C8ZA 2VB6A 2IPOB 4K59A 3RRKA 4WZQA 2R4FA 1RK8A 2GAGC 2FPHX 2MTLA 2WSFC 4NYZA 2ZITA 1H98A 4AUKA 2ZBCA 4QWDA 5KAKA 2VIHA 3CDUA 3BGUA 3B8HA 4XPEA 2F1FA 1GTHA 2MY7A 1N0UA 4ZLJA 3X1LB 3G6XA 3CB4A 4J9SA 2BEFA 1FRMA 2XWXA 3K8VA 3MMAA 1KQGB 3B78A 2F5GA 4NZ0A 1B4SA 4USJC 4WP8A 3SBMA 3VGUA 4ZJQA 4RUCA 1WNEA 4M5MA 1WF2A 5C7PA 2VD3A 1P27B 1PGZA 1WSVA 5CYMA 1IBMJ 2W9BA 4CH0S 1RKIA 5DGBA 2XI3A 3K8WA 3OHAA 3M8ZA 1T11A 3TA0A 3RAMA 3N28A 5CQGA 5DDOC 1XMOF 4ERDA 4QYZK 3W2WB 5IQ6A 1WTBA 1K73T 3RGIA 1SC1B 2XYHB 1IKXA 4ETXA 4HH0A 3MFHA 1YHQS 1G4CA 1H2VZ 5FIIA 3FCHA 2V2ZA 2EWHA 2HFOA 4QIFA 3BGRA 1VBZA 4X2BA 2IVYA 3DHXA 3D68A 1JJ2R 3GG0A 2VFSA 4UOGA 2HSEB 3P5TL 4KRWA 2E5LF 4G3IA 1SJFA 4GKJJ 3QFWA 2JSXA 3AD9C 1M1KT 1FVQA 3DRSB 1HMVB 1LWFA 3W2VA 3GFHA 2HNYA 4YB1P 2WRMA 1UA1A 3VALA 4F3MA 3UR3C 1UW4A 4EU0A 4ZIVA 4RW4B 1IN0A 1C1BB 4Y3CA 3MCSA 2K3KA 4GKKJ 1C1BA 2G0IA 2KXFA 3NGKA 3GR1A 3PO5A 5EX3A 5AXMA 1RAHB 1X4DA 2YKMA 3NY0A 1XNRF 3DOKB 7AT1B 2H5JB 3KTQA 2YWWA 1IVZA 2V69A 4QQBA 4DV2J 4TY8B 3FFIA 1TL7B 1WSRA 1T3NA 2HWIA 4F67A 1NH8A 5I3UB 5D0GA 3SCLE 2F63A 2YKOA 4FZVA 4NCAA 1NM2A 3IR5B 2AYGA 5KFFA 2AYBA 3BGFA 3FGVA 2JX2A 2ZJQQ 1VQ7S 1Q0NA 3MMCA 2HVDA 1U24A 2XGPA 3DLBA 1RU2A 1JQGA 3ILOA 4PR6A 4XPCA 3DMJA 4AL6A 4HYKA 2O67A 4Y2MA 1FK9B 2ZBQA 5IM0B 1X5OA 4ZN1A 3QAUA 5A2QY 4KC5A 4RW9A 4FKXA 1FJGJ 1L3SA 5HROA 1TK0A 2CZ9A 3JAMY 2DXFA 2G2YA 3IXQA 3S7RA 4NXNF 2M3DA 2ZDPA 3C14B 1B0PA 3DOMA 4KKOB 2YH1A 1GH8A 2NPIA 5C24B 3KJVA 1XNQJ 1FD8A 2IAJB 1AB8A 1CULB 1X5TA 4CYUA 2VFVA 5KFAA 2HFVA 3GZ7A 3O8WA 4UY85 5KT2A 2MPUA 2QO3A 3T1HF 2WVFA 1RADB 5C2CA 4O3OA 5ETTA 3O5TB 2CJKA 2PSZA 2XMWA 1X4HA 2CNNB 5B0BA 5KTQA 3FRYA 2FLPA 2LFVA 1VOMA 3T1AA 3K5OA 2ASJA 2CPHA 1TKXB 1WC3A 4P52A 5F9NA 1HBUB 3GG1A 5CA5A 4UZBA 4NLYA 2R42A 1WHVA 2DHXA 5KFGA 1IBLJ 3NEKA 2CWKA 2ACYA 4R0JA 4CO4A 3KMSA 1TZ0A 3QO9A 3T9ZA 3CCTA 3MZIA 2G4BA 1D9AA 2V9KA 1N48A 1U47A 4TU8A 3MFIA 4OMFG 4ZCMA 3LGMA 1CJUB 1RT3B 1S97A 1RHUB 5GAGU 2XLKA 4ZHRB 1ROFA 2M88A 3M2VA 3MD1A 5J1EA 3W9JA 2GIQA 4AFFA 4PG4A 4ZVTB 3R5BA 3DRRA 5KFWA 2PEBA 1R8AA 1LNQA 2MMYA 3SYZA 3GMGA 2Z2ZA 5CYQB 1WTFA 4X65J 4DPXA 1KR4A 1X0PA 2UUWA 2DNNA 2G9OA 2V68A 3C19A 3VZIA 3W60A 4EWTA 3OL7A 3KLGA 2NXCA 4DL7A 2ADBA 4OJ3A 3C6TB 2LXIA 4CLYA 2GS8A 4O3QA 1X31C 2YPYA 4L72B 3BH6B 1B0TA 1KP6A 1R6YA 3F73A 2VU5A 5KFDA 4OYAA 3LANA 1W2BR 3Q2SC 2XGQA 2ACMA 3C16A 3LUYA 3TAMA 3UFCX 1YIJS 1WHWA 3IRXB 1EJ7L 4NWBA 1SH2A 4RUBA 2R2TA 4HACB 3EJMA 1L3VA 1EP4B 1F5BA 4KB7A 2CQHA 1N6QB 2RJZA 2RU9A 3AB4B 3DI6B 3EDQB 1HKAA 1WKLA 4ANEA 4IDKB 4NZ6A 3PM9A 4PXCA 1IM6A 3HCXA 3M2VB 4OZJA 5T41A 3E01B 5ETRA 4DUYJ 3HHLC 1JNZB 3N01A 4F4XA 3KLHB 1CULA 1QDUB 1YDLA 5LJ5Y 1GX5A 3AXKA 1YJNS 3R6LB 4GO5X 3VGTA 4B9VA 4PG8A 5F8GA 2QJ3A 2IM3A 3BSNA 4LQ9A 1R27B 2DPIA 3GWCA 2J0SD 4HHHA 2LYVA 3DLGB 4IQXA 4B9UA 1CC8A 1VHFA 5KFBA 2ZHBA 4QIGA 4DSKA 3BSAA 5BR8F 3QYYA 4WTYA 1NHKL 2H65B 3CNQP 3UN5A 1FNMA 4JI1J 1QSLA 2QRRA 4A46A 1T3OA 3CCWA 3BPDA 3BYRA 1QE1A 1VBKA 2DRDA 1BQNA 5A8RA 4JP8A 2O3DA 1GAOA 1MN7A 1ZPWX 3W5YA 2JOQA 2HVHA 1RWMB 2VF3A 2ZOGA 1RCOB 4Q2MA 4J9NA 4DX6A 4JV0A 3K7RA 2B4VA 2FVQA 2D3O1 3UN2A 3M8PB 4RW7B 4JYAJ 3D7SB 3TJ9A 1VFJA 4LVNP 3OL6A 3KLHA 3PX6A 2L48A 4K4UA 1SI9A 1NK7A 3IBCB 4NYPA 1KQFB 4CI0B 2KO1A 3FBBA 1RT4B 2JLGA 4K5SA 2DNLA 4CIOA 4C6AA 2LDIA 3VR1A 1ZAWA 1YKWA 1SVDA 3K57A 1CEZA 3Q8PB 1TAUA 2XHCA 4FN5A 3HJFA 3CJKB 3K59A 3LQVA 3MAHA 5HJXA 2BANA 2HNZB 3HHLD 2C2OB 4ZVGA 4ECWA 1REVB 2BM1A 3EPGA 2R7UA 1X5PA 4I56A 1W7WA 2JHEA 1EHWA 3Q22A 5F8LA 4PWDA 1UEVA 2V2VA 1BMQB 1H7XA 2IBOA 4DG1A 4OJHA 4MTPA 1G2EA 1O0PA 2LQ9A 4M94A 1Q53A 2HK3A 3H2VE 4X4QA 4N76A 3OL9A 1QLNA 1DJ0A 1S48A 5BJRA 5F8MA 4UT4A 1MU2A 2CG4A 3BREA 3QPIA 3F41A 4KHMA 3CVKA 8RUCA 5J1EB 3FEZA 2LCWA 4RR5A 5KFHA 1H74A 3JSRA 1UAWA 1RU1A 1FDAA 2OPQB 5A0YA 3VAJA 3UD5A 3I96A 2F9DA 3SFUA 5JMNA 2ZZTA 2KJWA 3DLHA 2XI2A 2XY6A 2B5JA 2CPJA 2APOA 2Z30B 3CJ4A 5D3GB 4RNNA 3MF5A 2ZH5A 4ED3A 1XR5A 9ATCB 3N6LA 2JEGA 2HG4A 2ZEJA 2ZE2B 3IM8A 3GV7B 3ET6A 4EYHB 4TY9A 2Z57B 2DR5A 4NL5A 2EW9A 3G8SA 4EEYA 2HYIB 2KFZA 3DYAB 2DK2A 4LBIA 4IFYA 3G71S 2DY1A 3H8YA 2R7SA 1OYEA 1S0MA 1IR1A 2DIUA 1FXRA 4FVCA 4ZPAA 1PBAA 1SB6A 5K20B 3OR1A 1FI4A 4LSZB 3PW0A 3UNGC 2F8MA 4CNZA 1VMBA 2RILA 3DRYA 2NYHA 3ENVA 3HSJA 5IM0A 3OVAA 4WF9Q 3CF5Q 2BJDA 4NRUA 4OHZA 5B0GA 3OV7A 2DO0A 2J76E 4MIAA 1YJTA 1UW9A 2MKSA 1H72C 4ED7A 1K1SA 2MYFA 2QX0A 1TK5A 4QWAA 1F9EB 1VYAA 3MM6B 1N54B 2C3UA 1T0TV 2KXHA 1UMJA 5I4MA 4ES1A 2CJ9A 3PNIA 1HL6A 2FVRA 2XMKA 3SXLA 4A8YA 1VBXA 3J81Y 2MJUA 2L08A 3EVMA 4AD6A 5GAEU 4NLUA 2WHOA 2MKKA 3T3FA 2IMWP 2GW8A 1FFGB 1RTIA 5ETOA 5IV4A 4KY3A 4C8MA 2IJNA 5KFLA 1P1TA 2ZM6J 2L9NA 3AOAA 3EGWB 4ZLNA 1TQLA 4WU3A 4K4WA 2E5HA 2ZH7A 4WKYA 5F8HA 2ZH8A 1FRKA 1OPZA 2CQIA 3AHPA 1U8WA 2FJDB 4QR0A 1MMLA 3LF0A 4K50A 3A3OB 2U1AA 3H5SA 3OQ2A 3PFEA 4NASA 3UR0A 1J5EJ 1QVFR 3I6PA 3L09A 3W65A 3VQTA 1Y5NB 3MPYA 2CDRB 1SKSA 5K8NA 3U1MA 4F50A 2XB2D 3NCQA 5THWA 2VHGA 1S9FA 5GAHU 2ZNYA 2EI5A 2MHEA 3CC4S 2H4WB 4WFNQ 2BKNA 1X4AA 3JQMA 3POTB 5I42B 4Z37A 4G1PA 3CCZA 1K44A 1I1GA 1U7LA 1T9YA 3ZTRA 2Q6CA 1BUXA 1REVA 2AZ3A 6FDRA 3LALA 4F4YA 4RW6A 2IC3A 5T7LA 2PD1A 5IC4B 3WIUA 4C0HA 1D1UA 1RA6A 3AOCA 2CPFA 1CQMA 2GZOA 3W2WA 2O5DA 1RTDA 4W92B 3R5DA 3V6DB 2MEWA 3F0NA 3HKWA 4K0KF 3H90A 5ETSA 4W90B 4J9UE 3RBDA 4V19J 2POKA 1KTQA 5JVHQ 3H0PA 1RT1A 2C2DA 3HT3A 3TEHB 4J5OA 4KO0A 1RDRA 1U0SA 3C8YA 3MPDA 2EXUA 1KHWA 3DLEB 3M32B 1GFWB 4J9LA 1S6UA 4DV4J 3AD8C 1M5HA 1FKAF 2QIFA 3OJSA 4MYTA 3NKYA 3SCIE 2FB0A 2EFNA 5DO2A 3MM6A 2UXBJ 4FDFA 2B9EA 3THTA 1T05A 2W01A 4FF3A 2XMAA 1QY7A 2GIFA 1RBLA 1H3DA 1YBTA 4LRDA 4F4AA 2AEFA 4B9TA 3GPAA 2L3MA 2YKPA 2WB4A 1NH7A 3HKZD 4L73A 3LO3A 1NPRA 2G1HA 3ONQA 4LRAA 1BQXA 2Q3PA 4KYZA 4ANCA 1RBOB 1WF1A 1PILA 2I1RA 2MKHA 3BZQA 3G87A 4FXVA 4G1QA 3SSQA 4BHQA 1FJ7A 1E6YB 3PYDA 4JB8B 3H20A 4DL0C 3SIPB 1RT1B 2DRAA 1U25A 4O3NA 3T1HJ 2ABYA 2H5EA 4I7FB 1PC5A 4GKJF 1NO8A 1Q8IA 2BKOA 4A8KA 2UVVA 4DFPA 1HNXF 1HPZB 1WEXA 4ALZA 2P9CA 4KGXB 2DKOB 2VG5A 3MUMP 1GEHA 4LFBJ 2RF2B 2YKNB 1FKPA 3A12A 1HIYA 3GTYX 4NLWA 5H9EK 2R8KA 4OX7A 4ELVA 4LFAF 2ILZA 2GAHC 2GMJA 1JJCB 3PW7A 1U1KA 1KRPA 3EM1A 4OHXA 1IBKJ 2N3OA 1AFIA 4DUYF 4DR1J 1NSPA 1X7VA 4LF1A 5D0RA 5F41A 4YY3J 2W9CA 4X84A 4NXMF 4LT6A 5HBMA 2QYCA 4DV7F 3UN3A 5HBMB 4QZVB 1FXLA 4ED1A 3QT8A 1HD1A 5CZXA 3VGSA 2AGPA 5E5NA 1GX6A 2JLFA 1JMTA 2FVCA 2YNIA 1M5SA 1YG0A 4PAAA 1V6HA 2ZOFA 1Y11A 4RWXA 4UZCA 3OSNA 1YGYA 5FD1A 1S4EA 3PG9A 4C2MA 2UUBJ 5HP1A 4TYAA 2WVDA 3ZO7A 5DQGA 5M2PA 3BV8A 3LP0B 1FNOA 1FXDA 1GTEA 3Q8UA 4ZCIA 1HBMA 4DLEA 1HNVB 2BACA 1JKHA 1NJWA 2RF2A 3BM7A 1GMWD 3MMBB 3CUNA 1RWWB 1Y4ZB 3OFFA 4IH5A 5C24A 2QA4S 5D4PA 1ACMB 2J9DA 2KXNB 1S59A 1SJ3P 3H2LA 2XCAA 4RLEA 4LF8F 4UOCA 3LAKA 6AT1B 3HSZA 1OO0B 4AXIA 4F04B 3KLFB 3QWUA 2DNGA 4OHWA 2WW8A 3CMAS 1LXJA 1HBOB 1Y7PA 1NNDA 2B6AA 4NLVA 3MMCB 4UW2A 3Q2TC 3W3SA 3FQLA 2OPRA 5ETLA 2DO4A 2CQ3A 1NJZA 3AD7C 2VPWB 4OI0A 2L41A 4X4UA 1RLCL 2PT0A 2Y1LB 1NKBA 4H54A 2PO4A 4U9RA 5KG5A 4USHA 1RAAB 3PJ9A 1OWXA 1VRUA 3D1OA 1SUQB 1S0OA 2LVWA 4YQWA 2DNZA 2KM8C 4KKOA 5HATA 2NCKL 1RWPB 4NLXA 4GVBB 3OTEA 1YITS 1VBYA 4DR3F 2WVCA 4MFBB 1J5EF 1T05B 1JXEA 2RMLA 4USVA 3EPIA 4LVOP 4ZN3A 2OTLS 3Q8VA 4HEA9 4WK3A 2GMLA 3QIPA 4Q2LA 3GYNA 5F3TA 1T95A 3MEDB 3RR8A 1JLCB 2OSRA 5EUHA 1F2GA 2DHAA 7FD1A 2XMTA 1VQYA 4DV6J 1UWAA 1WC1A 4KTQA 1VI7A 1TVRB 1B64A 2BE2A 1FX4A 5AXKA 4RUHA 5GADI 2C1EB 1PKUA 5HP1B 2ZWOA 1IKWB 3LH2S 4O4GB 1IR2A 5HMZA 5AJ3J 3R1LA 1IKWA 1WELA 1JLGB 1WG1A 4DG1B 3CDAA 3TX0A 4DF8A 4G6VB 1N33F 8ATCB 2Z58B 4EK2A 4LF6F 3KNAA 2BJ7A 4ZLLA 5K8MA 3QIDA 4IOAQ 4L74A 4DLGA 5L8RC 4HR2A 1BD6A 3DGPA 3ELHA 2DH8A 4HT7A 4M5HA 2VOPA 4UUXA 4I2PA 4JI4F 1LK7A 4XO0A 2RB7A 3PEHA 4QIEA 1LW2B 4IFVB 5CYQA 2IVFB 3G96A 4NMLA 2DHSA 2HK2A 3C15A 4KFBB 4DV0F 4DR1F 1KLNA 2F4VJ 1JLBB 1KVIA 4KBIA 4NI2B 2ZWPA 3V81B 1UKUA 2OEJA 4EZ6A 1PYOB 1S1WB 4P2SA 3MM9B 3KK3B 2XWYA 1FTRA 1LXNA 3PACA 4USUA 2KFNA 3EE3A 3MPVA 2OPSB 5D4OA 5AT1B 3EICA 1AZSB 4A8WA 4P72A 4IOCQ 4DL4A 2HHXA 2ZBPA 2DHGA 3NS7B 5KFPA 1Q8KA 4DX7A 1YK9A 2R9LA 3IR6B 5LMNJ 3RRGA 5AXNA 3D2WA 3HPOA 2B7CB 3JYTA 1GXTA 2VV5A 4YP3A 5DJBA 1SL2A 5IT9Y 3W62A 1G7CB 3LP2B 4PG6A 2ZD1B 1Q81T 4DUTA 5K8PA 1HD0A 4LFCJ 1V3ZA 3RYLA 2YWEA 4RW7A 2JZ5A 1X4GA 3HZEA 4WFXA 2KYXA 4R0EA 3T6JA 2B4UA 4JBCA 4DR5J 3IG1A 1UZHA 4UOHA 4LSNA 2XZTB 4FNHA 4OHVA 3IN5A 1H0HB 1UCNA 3T19A 3QGPA 3HK2A 3GV5B 2J9CA 1X8DA 3G4SS 3CCMS 2BW2A 3UDVA 3MAQA 3W63A 2HVEA 3NOGA 3ZZZA 2X1FA 4OHYA 2RRBA 1AUDA 1LV5A 2KRBA 2KTQA 4YB5A 1FWKA 2ZVSA 5JUMA 4N5SA 2MQLA 2WBRA 2ZE2A 5F8IA 4K4YA 2M8DB 4PPZA 3M6VA 4OLOA 3I56S 3NRBA 4DL6A 4C3LA 1M5KC 2IM0A 3GB0A 1F9FA 1OY6A 1C0TB 4L75A 2HFZA 4HT5A 3FMBA 2RHQB 5FLXU 5IZHA 4CO3A 2XCPA 3CJ5A 3GJSB 2HKEA 2B8PA 2W25A 4C8NA 3NMAA 4K0KJ 5FLXY 3QT7A 4O44A 5K14A 1DARA 1EQMA 3GLJA 3V4MA 1VQ4S 3M2RA 2YBVA 3TP2A 3OXLA 3QZ7A 4DHVA 1WKJA 3CCRS 2VDHA 4DV1F 2OIHA 2CKWA 5LSOA 1VDHA 2UXDF 2FVSA 4N8OA 1UEKA 5KOXA 4DL3A 2MZSA 2YKMB 2Y1RI 2PA3A 2KU7A 1XN9A 3DLJA 3I5CA 5RUBA 3PTWA 3UDLA 3VAHA 4J9KA 3R5JB 4C8KA 4NOHA 1BGXT 1TL1A 4U8YA 4DR2J 4ER8A 1NB7A 1RWXB 3CGIA 3VAFA 4NE9C 4HTJA 2UV8A 2CADA 1VISA 3BR8A 2C42A 1T9VA 3PRDA 4Y34A 4ZVSB 2A0FB 3MHYA 4ICLB 2OEKA 4W4MA 4RU9A 4LR9A 2W9AA 2J0WA 4C11B 2DITA 4ED2A 1RACB 1LW0B 1RWOB 2BJ1A 3PR4A 1YRTA 4Q0BB 4PUOB 1HYSA 5KFSA 5A76A 1RJJA 3M30B 3FJ2A 4X62J 2D9PA 2XLJA 4B08A 4ED4A 1VQ5S 1EQ0A 1N88A 2L9WA 1QUPA 2IM1A 5LM7E 5D78A 3KHGA 2VBYA 4PQAA 3LPEA 2QE5A 3SFGA 2K2PA 3KG4A 4P2MA 5ETQA 2HS3A 3N5FA 1T03B 1MW7A 2UVWA 3RU0A 1HHSA 3P4UB 5M2UA 1U4BA 2DIVA 5HK4A 1CS4B 3D9BA 1I94J 4XK8C 5IT0A 2OUGA 2J9DE 3I0SB 3PW5A 3UCZP 4N47A 3I5BA 4CYUB 4P10A 1SKWA 3UE2A 4BC9A 2J7KA 1CQNA 2GA7A 5B09A 4DV7J 2UUBF 1KVJA 4DS4A 1FWPA 3C6UB 5CH7B 4DZ6A 1SH3A 2DD8S 2NUUG 2RQKA 2DR9A 4L3KA 3U7JA 2XSFA 2V8GA 4CLFA 1AA1B 3OR2B 1S0NA 2HHUA 1GXLA 1NKEA 3O1LA 3EMTA 3WHIA 1F6TA 2M70A 1VGYA 3AQOA 3CE8A 1WEYA 3W5XA 5B0CA 1S1VB 2M7SA 4XDCA 1MWYA 1C0UA 3THPA 3GJTB 1OSCA 3DLEA 1PIEA 2F8EX 3GIRA 2DCUB 2D3OR 1U1LA 4RX6A 5HO4A 1U1OA 2MB0B 4RW9B 2EFGA 3N5BA 3DI6A 5DRKA 1F9HA 4CP5A 3EWGA 3KFWX 3ZC4A 3TOQA 4PEOA 2HMIA 1U1QA 1H2TZ 1GT8A 3CPWR 4RBTA 4H4KC 1DTTA 1JJ4A 5E2QA 2Y0SD 2DRBA 1KVKA 4FF1A 3PZPA 2VASA 3MCOA 5LSRA 4X4OA 2UUAJ 2BE9B 3FBEA 3I0RA 3L7OA 3OD2A 4F0HA 2GVZA 2BBEA 2VPXB 3LOUA 2MQPA 2Q79A 4ZP7A 3IC1A 3TQEA 2GCFA 4HDGA 5EWEA 1KOHA 4DV5J 4F8RA 4KPYA 1JLFB 1RBAA 4LJMA 4YDDB 3CJTA 4LRFA 3J7AN 3Q8QB 3AQPA 4KIAA 4RW8A 3VWSA 4ANDA 5HMXA 1HNXJ 4CM0A 4DPYA 4OX9J 3Q86A 4RWWA 3PRVA 4ED8A 1RHQB 1S6PA 4DSEA 4R5PB 3I31A 4I7FA 4LR7A 5DLFA 2QFIA 3UQSA 5I3QA 3QZ8A 1JIHA 3RAXA 4ELTA 2RUSA 4A8FA 4O3SA 3T1YJ 3IAM9 2QC3A 4JI7F 2LU1A 1C2PA 1FE4A 1LQ9A 2EG1A 2FJAB 2YWHA 3JTOA 4WP3A 2BQ3A 1SUQA 3P3DA 2MGZB 3S8SA 3CULA 2FLLA 1P9QC 1RSCA 2E1AA 3PJXA 3TO8A 1KQKA 3BQ2A 1ZAXA 4OZLA 2C2KB 2IRUA 3DRRB 4PG7A 2BDPA 3NGSA 4KJIA 1IQTA 2ZBIA 4FYXB 1VC0A 2Z2LA 4DWIA 3C6UA 2VKZG 3SZ2A 3D66A 1RE1B 2JWNA 3NAHA 4IYQA 1N5YA 1D9FA 4DSLA 1SV5B 2MLYA 1FDBA 3BSOA 5IT4A 1R0AB 4YS2A 4FVMA 1NK9A 3OVSA 1ZA1B 1Y00A 4I64A 4P2FA 5ADZA 5E3RA 3U1LA 4J9RA 2BM0A 3A8EA 1LWCA 3D5MA 3NCRA 5L9NA 4DSJA 4KV8A 3TZWA 1FK9A 2CAJA 4QYZJ 2BQUA 4JI5F 2UUCJ 1SC4B 2GHPA 3SSRA 1VCTA 3IWLA 1NKCA 1HLWA 3P5BP 1B7YB 5A6PA 3KLIA 1NAQA 2OO4A 3FCVA 4M8LA 3K5NA 1JKHB 3CCVS 3T5JA 2AU0A 4IRDA 1QTNB 4A8SA 2F8HA 2HQFA 5J2QA 2E29A 2Z2YB 2FC9A 2MZJA 1URRA 3VQSA 3ZXWA 5L9XA 2EC2A 1XNRJ 1S76D 2UV8G 4CTAA 3R7SB 1RT7B 5A8WA 1R31A 4X65F 2HGMA 2M5YA 3RG6A 3V4IA 1CJKB 2WVBA 4E98A 2VJUA 4JV1A 3OLAA 4OI3A 1JLFA 1RHMB 2OPPA 4DS5A 3D3BJ 1B99A 4RPFA 4ZPTR 1NLKL 2AD9A 3OBIA 4PQUA 5KG3A 5KG7A 2F7VA 2JC0A 4LF9J 4TXSA 3R2CJ 1S6PB 1AZSA 1FKOA 2DY9A 3AJ2A 2UXCF 3R5AA 1DZ5A 4NCGB 1WUUA 2E7XA 2G1DA 3VV2B 2QZ8A 1KSPA 2R8JA 3QJJA 1RWKB 1SJQA 4RO0A 4ZA1A 3SCKE 4F26A 4PWDB 3QJPA 2OFHX 4AQYJ 4NX9A 1XJWB 2DNPA 3Q8RB 3KXDA 3EX7B 1CLFA 4CLKA 4IG3B 2BJ3A 2HS4A 2NXEA 2RE1A 3L9ZA 3PDNA 3UWTA 2NQPA 2P6SA 4CLPA 3MM7A 1VC6A 2WSCC 5K5MA 2YQ1A 1N33J 1BQMA 4M5KA 2XC9A 4RZRA 1VLYA 2OELA 4CO2A 1QVGR 2YVSA 1IKYA 3W5ZA 4FPIA 2R8GA 4LF4J 1EAYC 3PW2A 4D3HA 1F3FA 5KG2A 4J90A 1U1RA 2IM2A 1D8YA 4JI1F 4KT0C 1S1UA 1FCAA 4L3NA 1N34F 3OL8A 1S5ZA 2YKAA 3M9OB 4HI2A 3VAMA 3DC2A 4ATNA 2OH2A 4JI4J 1DTQB 1WI6A 5C25A 3KHLA 3BDPA 2IRYA 3OT9A 1LWCB 2KFYA 2M8HA 5KG0A 2KRRA 4N77A 4JI3J 1XWLA 3CO0P 2JJ4D 2HQIA 1IKXB 2DHHA 3ZZYA 2JEJA 5D77A 5E3PA 2BJ9A 4LR8A 3CT9A 2XG8A 1LK5A 3I4HX 4OV1A 2HZCA 3M8PA 2QLJB 4ZVFA 3T5HA 3OVBA 3CD6S 3MOJB 1L3UA 5J2MB 2VODA 1ZM4A 1PCAA 4BWMA 2M52A 1Y9OA 3CJ2A 3ETMA 3TVYA 3QMQA 5JJBA 3H4DA 4Z7YA 3MM5A 2BXJA 2A3JA 2DNRA 1BHNA 5MAOA 1BC6A 2Y3YA 3KDNA 4RJVA 1TR0A 2DGUA 4K8RA 4DQPA 1LKZA 2VBXA 4DQRA 2VA3A 1S1UB 2CWXA 4I2QA 5GMKa 4LF5J 4DR5F 3C66A 1EKSA 2LA6A 1WWHA 3MM9A 3KK3A 3OTBA 1S1WA 4FS2A 2XNQA 5CAAA 4USWA 1K9MT 2B4PA 2KVIA 4R8UA 3ZZRA 1WC0A 1P1LA 4I67A 3J7A1 3BR9A 3U1NA 4DEZA 1U26A 2DNKA 2WVEA 3CC7S 2HQDA 2B0GA 3PHTA 3OTOF 2BKPA 3C16B 1NMEB 3HP6A 3NNHA 4FYWB 4X64F 5IT9U 1OQ6A 3P45B 1PBUA 2ATCB 4OZ5A 1TKZA 1S1TB 5A2QU 3OUYA 3FDSA 1U48A 4PUOA 1Y3JA 4X4SA 1YJVA 4UQGA 1WD6A 2O1PA 1S77D 1T94A 2HFNA 3KMQA 3MEEA 2HIQA 4FS1A 1YJUA 3HD2A 1S10A 2V5HG 3WIVA 4ZMMA 1HW9A 1A0OB 1X60A 2FGCA 2DNMA 4NA1A 1FJEB 1KEKA 3R6GB 2HBRB 4B9SA 1CJVB 1SBRA 1NK6A 4QIWD 3BKUA 4FYDA 4FBTA 2J6SA 3M8YA 1UVLA 3I0RB 3K89A 4OYOA 3CJKA 3T9NA 2E9ZA 2AJFE 2JLEA 3KJFB 1TL3A 2Y9HA 3QLHB 4KGZB 2A6OA 4O3RA 3TVKA 1Q4RA 3GYXB 4BC7A 4DUZJ 2KL8A 4DMZA 3KHRA 4TLRA 5B0EA 2B56A 2YQ3A 1MWQA 5DZ6A 4FXWA 4MK9A 1VQMS 4CRJA 3CMES 2QL9B 1KONA 4Y2IA 3OUYB 2RSQA 4H4OB 1VQPS 5LXYA 3CSKA 3J80U 1T9UA 1EX8A 2CQ2A 3CW2C 2CRLA 3MEEB 3NGRA 2EFOA 2UUAF 2CJYB 3CEDA 5D6GA 1R43A 5LMNF 1IQZA 4AL5A 3CJQA 2NPFA 3H5UA 4C8LA 4USIA 4QBUA 5BYSA 3SI8A 1E6VB 1RA7A 4LFCF 4RNOA 2C2NA 5HVHA 2LEAA 3RBEA 1TUVA 2QG9B 4P74A 4P9SA 2QA4G 3W66A 2I9SA 1GXUA 2J9EA 3D6FB 1YI2S 4R25A 3LW5C 1IBLF 5DZ7A 1WJ9A 4CH7A 3RTVA 1PO6A 5MLCV 1RWVB 1KOOA 4V1Ak 2P8IA 2E7WA 1RAJA 3I9ZA 4ZPWR 1HBOA 2PN6A 2CNLB 2RIJA 4OX9F 4QYRA 3RUBL 4ENOA 4ZKAA 2KH9A 3KYLA 3MEGA 1U09A 3HX9A 2JFKA 1PAUB 2K7JA 1A7GE 1HBMB 3BBBA 3HXMA 4WXOA 2PDAA 1EP4A 4RU2A 1KS2A 1EB0A 5DG9A 1T03A 2HNYB 4UY8T 4OX8A 3CCJS 2HNDB 3LWLA 2FTRA 2YWKA 4Q8EA 2WB1D 3QGIA 1RABB 1LEOA 3N6NA 4HVZA 3VGVA 3FBCA 3Q23A 2AGOA 2EKYA 3CWJA 3IGNA 4A47A 1SPBP 1I5OB 1YBAA 2XS5A 4QU7A 1FEHA 5I3UA 4DV3F 2HVIA 4NA2A 2RS2A 2CDQA 4YB6A 3I55S 5U47A 3KUGA 2JDJA 2R2UA 1MSWD 5HVGA 3ITHB 2OP5A 1D9DA 2IA0A 1M90T 2JVOA 1RTDB 4DX8H 5DQHA 2BRKA 4RW8B 3QATA 4EUVA 1QJHA 3CJRA 3MCNA 3ZZPA 4WYLA 5L1KA 4NPOA 2A6MA 2FGOA 3HHLB 3M8QB 4WTOB 3BGRB 2CQBA 2ZH1A 3SV4A 3HHLA 2DYAA 4ILRA 1S57A 2QT7A 1GMVA 3M1VA 4J37A 3N0VA 2C3MA 2QLFB 3HJVA 4F7VA 2OI2A 1HNIA 3TUJC 3BB5A 1B7FA 3IBWA 1JLGA 2C3PA 4ID8A 2NYIA 3DDNA 3QT6A 4I68A 4OZNA 1HPZA 1RHRB 4BCAA 2AX1A 2MQMA 4C9DA 4M5IA 1DY3A 5LJ3Y 4Q44A 1Q8LA 2VG6B 5ETMA 3UVJB 1KFSA 2KHCA 4JV5F 3HVTA 2AKWB 2IVMA 1FRHA 3BEGB 4O4RA 3T1YF 3K2YA 2VKRA 5A6WA 3EZ5A 3ZZUA 1Y5LB 3CDWA 4XDDA 1U1NA 2R7XA 1CJKA 4OIXA 1URNA 3QIPB 3TZZA 2GJIA 2IYGA 4M95A 2QYGA 3KLFA 1SCJB 1CPZA 3T5LA 3A8IA 2QV6A 5CD4A 2HW3A 1UVNA 3G82B 1DQ8A 1TELA 1WOPA 3GSIA 4DPOA 1EETA 4RUAA 2ZH9A 5FJ4A 2Q6BA 2VC1A 4ILMA 1NZ8A 1RLDA 1S6QA 2ASDA 4ZCKA 1FERA 4DV2F 1QE1B 4B3TF 1QUVA 1NU4A 5LT5A 5KFNA 1HWKA 1U49A 3QJLA 5D8HB 1M5PC 1H2UX 3ADAC 2NXJA 4KV8B 4ED5A 1RISA 2FY8A 4K7QA 1WI8A 3W8PA 5KFQA 4KHPF 1N56A 4LIRA 1TUGB 2Y8WA 3IWXA 5L38A 3OXFA 2KZZA 1VQSA 3A4TA 2QSWA 4W98A 2AJ4A 3ULHA 3HM9A 3PEJA 2W24A 4GC7A 1IBMF 3QRPA 1TKDA 2VQEJ 3H2UB 4NLQA 4PYAA 2WOMB 3WQPA
chains in the Genus database with same CATH topology
2DKOB 2CJYB 4DCPB 1RWKB 2C2MB 2CJXB 3D6HB 1PYOB 5K20B 4LSZB 1SC3B 3GJTB 1SC1B 2XYHB 3D6FB 3NS7B 3EDQB 1F9EB 3R7NB 3GJQB 1RWVB 2QLBB 1QDUB 2CNLB 3R6LB 2HBYB 2XYPB 2C2ZB 2XZTB 4DCJB 1PAUB 2H65B 1ICEB 2H5JB 1RWWB 3KJQB 1RHQB 2QLJB 4ZVRB 1RHJB 2XYGB 3QNWB 4ZVQB 1RWMB 3IBFB 5IC6B 2CDRB 2H4YB 3R7BB 4ZVOB 2H48B 2H4WB 3GJSB 2H5IB 3GJRB 1RHKB 2C2KB 3IBCB 1I51B 1IBCB 2Y1LB 3EDRB 2QLFB 4ZVPB 5IC4B 1RE1B 1RHRB 1NMEB 3P45B 1RWPB 2C2OB 3R5JB 1BMQB 2CNKB 1RWXB 1GFWB 2CNNB 2HBQB 1SC4B 4ZVSB 2P2CB 1RWNB 2H51B 3R6GB 2HBRB 1RWOB 2Y0BB 4ZVUB 1QTNB 1I3OB 2C1EB 3KJFB 3R7SB 2QL7B 2QL5B 1RHUB 3P4UB 1RHMB 2H54B 4JB8B 2QL9B 4ZVTB 3SIPB 4DCOB 2CNOB 2XZDB 3D6MB 2FQQB 2HBZB 3RJMB 3KJNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DKO B;  2CJY B;  4DCP B;  1RWK B;  2C2M B;  2CJX B;  3D6H B;  1PYO B;  5K20 B;  4LSZ B;  1SC3 B;  3GJT B;  1SC1 B;  2XYH B;  3D6F B;  3NS7 B;  3EDQ B;  1F9E B;  3R7N B;  3GJQ B;  1RWV B;  2QLB B;  1QDU B;  2CNL B;  3R6L B;  2HBY B;  2XYP B;  2C2Z B;  2XZT B;  4DCJ B;  1PAU B;  2H65 B;  1ICE B;  2H5J B;  1RWW B;  3KJQ B;  1RHQ B;  2QLJ B;  4ZVR B;  1RHJ B;  2XYG B;  3QNW B;  4ZVQ B;  1RWM B;  3IBF B;  5IC6 B;  2CDR B;  2H4Y B;  3R7B B;  4ZVO B;  2H48 B;  2H4W B;  3GJS B;  2H5I B;  3GJR B;  1RHK B;  2C2K B;  3IBC B;  1I51 B;  1IBC B;  2Y1L B;  3EDR B;  2QLF B;  4ZVP B;  5IC4 B;  1RE1 B;  1RHR B;  1NME B;  3P45 B;  1RWP B;  2C2O B;  3R5J B;  1BMQ B;  2CNK B;  1RWX B;  1GFW B;  2CNN B;  2HBQ B;  1SC4 B;  4ZVS B;  2P2C B;  1RWN B;  2H51 B;  3R6G B;  2HBR B;  1RWO B;  2Y0B B;  4ZVU B;  1QTN B;  1I3O B;  2C1E B;  3KJF B;  3R7S B;  2QL7 B;  2QL5 B;  1RHU B;  3P4U B;  1RHM B;  2H54 B;  4JB8 B;  2QL9 B;  4ZVT B;  3SIP B;  4DCO B;  2CNO B;  2XZD B;  3D6M B;  2FQQ B;  2HBZ B;  3RJM B;  3KJN B; 
#chains in the Genus database with same CATH topology
 2H1Y A;  2DNY A;  4JI0 F;  3DOK A;  4PRF A;  5A0Y B;  3KUE A;  1OIA A;  4YR3 A;  4EO6 A;  4TLQ A;  5HQL A;  2MJN A;  2RQ4 A;  4YEA A;  1SIW B;  4U95 A;  4DV5 F;  1UJ5 A;  3H40 A;  2VON A;  1VK3 A;  2DH7 A;  2WZ1 A;  3TJ8 A;  4NLR A;  1N36 F;  3CCS S;  3EGN A;  2EVZ A;  3LGN A;  2ZKT A;  5GMD A;  4FNI A;  1RYR A;  4WFA Q;  2FHJ A;  3L4B C;  3PO4 A;  3AOD A;  4U67 Q;  2DR8 A;  5E33 A;  1U8S A;  4DBQ A;  3WBZ A;  2YNG B;  4EZ9 A;  1ZTT A;  1XK8 A;  1OS5 A;  2VQF J;  1KLM B;  3B4M A;  1RI7 A;  5CAB A;  2MZT A;  3M7V A;  5LMU F;  4HL9 A;  5J2N B;  4F02 A;  2VH7 A;  2QFJ A;  4DFM A;  4C8O A;  3M1V B;  2J0Q D;  4DPW A;  3MPU B;  1J5O A;  2PMH A;  2ZUG A;  4P71 A;  4FBU A;  1UVK A;  4KE5 A;  6FD1 A;  1R8B A;  2GVD B;  3MM8 B;  2EC0 A;  4K4V A;  1YRX A;  3GJQ B;  2GJF A;  1NSA A;  3I9V 9;  4ECS A;  4NEY A;  1O51 A;  1N6Q A;  2UU9 J;  2AJQ A;  1Q86 T;  2MDA A;  4ZP6 A;  2FJV A;  2MHN A;  2RVJ A;  3AXM A;  2CXE A;  3Q83 A;  3PY8 A;  2EFQ A;  2HMI B;  1SJR A;  3IS9 A;  4PZV A;  5HN0 A;  2C2E A;  1RAE B;  3C2P A;  2HZV A;  4MFB A;  4TQS A;  2CUY A;  1RP5 A;  3QT5 A;  1NHV A;  2IA6 A;  4LF9 F;  1NDK A;  5J2Q B;  2VUG A;  2R7O A;  2JC1 A;  2EK6 A;  2N7Y A;  1ICE B;  4ID5 A;  4MK8 A;  3NS5 A;  3PV8 A;  4I6Y A;  3UPF A;  2DR7 A;  2CJQ A;  2FHM A;  1P8G A;  2EG2 A;  2EK1 A;  1Q78 A;  1NZA A;  2NSC A;  5EHH A;  2V50 A;  1UVJ A;  2NXU A;  1KC8 T;  3HT0 A;  4ECZ A;  4ZVQ B;  3LTO A;  1E6Y A;  4DZD A;  2HNZ A;  2OPR B;  1SQE A;  3GON A;  4JI2 F;  3WX4 A;  2RU3 A;  3MAA A;  5DGA A;  3GCX P;  4NCG A;  2PEH A;  1TMM A;  2VIC A;  2OGU A;  2K1R A;  2W4P A;  3HVW A;  2JNJ A;  4KSE B;  3QO9 B;  5KFE A;  2A2D A;  4QR2 A;  2AJ1 A;  1U2C A;  5C42 A;  3TUP A;  1O6X A;  3JYT B;  3OR1 B;  3RW7 A;  1XMQ J;  1EIY B;  3SDE A;  4IR1 A;  5BYR A;  3R2D J;  3EDR B;  3LP1 A;  1QSS A;  2HIY A;  5J2M A;  3IG1 B;  1HQU A;  2Z56 B;  4HHJ A;  4ES3 A;  1JLE A;  1R8P A;  1RT7 A;  1WKK A;  1Q95 G;  4QW8 A;  5A8W B;  4C48 A;  4CZC A;  1DLO B;  1HBN B;  5GAD U;  3KHH A;  1XMO J;  3HMJ G;  4PYD A;  2E9R X;  1OSD A;  3M6W A;  4NLP A;  2DEJ A;  1RT6 B;  1NHU A;  1UVI A;  1ZOT A;  2QA2 A;  3A13 A;  1VLO A;  2ZOM A;  3BF4 A;  4WE1 B;  5C25 B;  5IQQ A;  1VC5 A;  4K4S A;  1F1B B;  3FFI B;  1DTQ A;  2AGQ A;  2M9K A;  2RKI A;  2YNH B;  1PJ6 A;  1UTA A;  4B3R J;  1NB2 A;  4MK7 A;  1RWN B;  3MAA B;  3MCM A;  1YLX A;  1ZTW A;  1S9G B;  3NNA A;  1HFE L;  2Y0B B;  1HNV A;  3IA0 A;  2XUL A;  2AEJ A;  1FTC A;  5K9F A;  4DN9 A;  2R7R A;  3B82 A;  1N5T A;  1S1X A;  1XBW A;  3BBC A;  4ECQ A;  5C5J A;  1MN9 A;  3MMB A;  3TX8 A;  1RT5 B;  1SJ4 P;  3OHB A;  2OPQ A;  4WXW A;  3WDO A;  2M2B A;  3KG0 A;  2WBM A;  2E5J A;  3IM9 A;  3MPW A;  3W64 A;  4E8U A;  5C2G A;  5CCM A;  2V4R A;  5KFC A;  4OLP A;  3TUI C;  4J9O A;  2QGF B;  3RRH A;  2C22 A;  4QCL A;  4KFB A;  2SXL A;  1UZD A;  3GYG A;  2KDO A;  1U2R A;  3ZTO A;  4CT9 A;  5F3Z A;  5I42 A;  2PFD A;  1XMB A;  5IOL A;  1T7P A;  2RD5 C;  1T9T A;  2FC8 A;  1UWB B;  1N5S A;  2J8A A;  2PE8 A;  2FDN A;  2HHT A;  2HHV A;  2WK4 A;  2HQC A;  5HQ8 A;  2W9B B;  1TL1 B;  2BE2 B;  2CJA A;  3GE9 A;  4R8U B;  2C2M B;  4HKQ A;  2Q43 A;  1H73 A;  2IMO A;  2HVZ A;  4X4T A;  1S7I A;  5L1I A;  1VQN S;  5J1P A;  3G2X A;  3KOA A;  3Q0A A;  1PYT A;  4EMD A;  4NXN J;  1ZZN A;  2DT9 A;  4B9M A;  1F5A A;  2BAB A;  2FZG B;  1LWX A;  3TVZ A;  3EVO A;  1VQ8 S;  1Y0H A;  1IR0 A;  2AMC B;  1S99 A;  4DPT A;  3ILL A;  1PSD A;  2GHW A;  4KH1 B;  1MRO B;  3TRG A;  1CJU A;  3MMA B;  3DOL A;  2RRN A;  2KVQ E;  2V8V A;  4OYZ A;  2MXY A;  1NK0 A;  1YTY A;  1WC6 A;  1S4F A;  2HBY B;  1CJT A;  2V67 A;  1WG4 A;  3D1H A;  3I82 A;  3Q89 A;  4IOB A;  2XYP B;  1N32 F;  1DBD A;  1C4A A;  3PYE A;  1SL1 A;  3RZA A;  1RT6 A;  1KD1 T;  2LA4 A;  1LFP A;  4ZVE A;  1IM4 A;  4DV6 F;  4WII A;  5D0H A;  2W2Q P;  1FRI A;  1G1X A;  1IXK A;  1F0X A;  5IFM A;  2NRE A;  2GNK A;  4B3O A;  4O0I A;  1SV5 A;  2FZC B;  4CDI A;  3JAM U;  5G4D A;  5AJ3 F;  5F9L A;  3J7Y I;  3UNY A;  3PX4 A;  3JTN A;  5EDW A;  4M63 A;  3IMQ J;  1Y3K A;  3M2U A;  5G0R A;  4H4O A;  2OFG X;  1HYS B;  3T6B A;  5K8O A;  2AQ4 A;  3SDE B;  4BBY A;  2HHH F;  5IC6 B;  4TKT A;  4LQ3 A;  2E66 A;  2H4Y B;  4MT1 A;  5LSL A;  3J80 Y;  1GNK A;  1VIX A;  2FY1 A;  1D09 B;  2CJB A;  1VQ6 S;  2ILY A;  1S7H A;  5B0D A;  3OTO J;  3GFZ A;  3DOL B;  1R8C A;  4IRK A;  5M2R A;  3C14 A;  1MRO A;  1EAR A;  1RHK B;  3O6Q A;  3GU0 A;  3SQO P;  2I6W A;  4B3M J;  4JV5 J;  4LFA J;  3VAK A;  2CQD A;  4EI2 A;  1CS4 A;  1UJ6 A;  2N4D A;  3HDS A;  3A3N B;  4O0N A;  3BSC A;  5ETN A;  1NK4 A;  4ZJL A;  1Z2L A;  4OZ1 A;  3US5 A;  4ECY A;  3POT A;  4F4W A;  4TY8 A;  4LF7 J;  1TL3 B;  1APS A;  1R3N A;  3EZO A;  5LL6 d;  5KT7 A;  4QIV A;  1Z1Z A;  1YJ9 S;  2O66 A;  4IQM A;  3TAR A;  1UEU A;  2IC3 B;  2O01 C;  3H59 A;  5T7L B;  2QTW A;  5IS2 A;  3LPY A;  1T8E A;  2GJ2 A;  1IKV B;  1LWE A;  1NDL A;  2CZ4 A;  2GFF A;  4MKA A;  5ETK A;  4B17 A;  2ZC4 A;  4C11 A;  3CC2 S;  3PYG A;  3HVA A;  1WF0 A;  2CPD A;  1S1V A;  5B08 A;  2VG7 A;  4URQ U;  3V6H A;  2FJB B;  1G3O A;  3J81 U;  2KZM A;  1OMS A;  3QBC A;  3RB0 A;  1SKU B;  1WG5 A;  4C0B A;  3PKM A;  2PMW A;  2NS1 B;  1HWI A;  1KKH A;  3HUL A;  5D4L A;  3V5R A;  2YQ0 A;  2CIM A;  2V8H A;  3GCW P;  2ZM6 F;  4LF6 J;  1V5V A;  4NRT A;  1QSY A;  2HEK A;  3IS9 B;  3C46 A;  1O8B A;  4A8O A;  4QWC A;  2P6T A;  2X1B A;  4C97 A;  3J7Z T;  1L3K A;  2YX1 A;  4ETZ A;  1PJ5 A;  3PRB A;  4B3S J;  2RS8 A;  1WHX A;  3IGV A;  4BDP A;  3NNC A;  1NEE A;  2AIR B;  1IJE B;  1KBR A;  1UP1 A;  4IG0 A;  4WPA A;  1QAX A;  2QMX A;  3EXC X;  3SMZ A;  3SEO A;  4PWW A;  3GII A;  2QN6 B;  2UUT A;  1HQE A;  3CD0 A;  2FLO A;  4C0O C;  2FQQ B;  2HBZ B;  3G8Q A;  1QAI A;  3RJM B;  3HHD A;  3EGV A;  2MQQ A;  4FF2 A;  1AYE A;  2XBP A;  3PIO Q;  4WBF A;  3DLK A;  4JYA F;  3UDE A;  2ATL A;  4OYB A;  3HFK A;  4N8N A;  3T5K A;  4WFY A;  2MKC A;  2YWG A;  4WKR A;  4P6Q A;  3RR7 A;  3FCW A;  1YBU A;  3KLI B;  4IO9 Q;  3R27 A;  4C8Y A;  1HNW J;  1OY9 A;  1FVS A;  1SQF A;  1SQG A;  3K58 A;  1K0V A;  1QAY A;  2LXF A;  2ROP A;  1F3V A;  4G1I A;  3KJV B;  4J9Q A;  2MKY A;  4Y2C A;  2V2Q A;  4A4J A;  1E6V A;  4ZPD A;  5ETV A;  4CLW A;  2KKH A;  3I0S A;  1YWX A;  5EWF A;  1R7I A;  4MH8 A;  1U6Z A;  2EKN A;  3FSY A;  8AT1 B;  2W2N P;  2CA9 A;  3C15 B;  3DLG A;  4ZP9 A;  4ECV A;  1TL7 A;  1VHI A;  3ZTS A;  2FJX A;  1NDC A;  1N5Y B;  4DXL A;  3D4J A;  1UVM A;  2I5J A;  3UDC A;  1JX4 A;  2E7V A;  3CD5 A;  2V8P A;  2W4D A;  4Y2K A;  5B7W A;  2ZH3 A;  1A6L A;  1Q1K A;  2CPY A;  1EET B;  2MLZ A;  1IKV A;  1LWE B;  4WP9 A;  3SQG B;  2YNF B;  2AZ1 A;  1LW0 A;  4LUB A;  4JUZ A;  1X9W A;  2YH0 A;  3BGL A;  4PCQ A;  2V63 A;  4JI2 J;  1DHM A;  2ROE A;  3IRX A;  1ZPV A;  2VG7 B;  1N5V A;  1NJI T;  2Y1I A;  2B3T B;  3BS9 A;  2Z4P A;  2MGZ A;  1U6F A;  1RTZ A;  3OFE A;  3L7P A;  2I38 A;  2MZQ A;  5LMU J;  2X7I A;  4IG3 A;  4A48 A;  1AUS L;  3HI9 A;  3ZZ0 A;  4O3P A;  4OYW A;  4LMZ A;  5KFM A;  3AJD A;  3RBZ A;  4NLT A;  2OAU A;  2XS7 A;  4J9P A;  2DH9 A;  1C1C A;  2WON A;  4PXB A;  5FDL A;  3JXO A;  5DLG A;  2ZJP Q;  4ZP8 A;  3P8B B;  1HR0 F;  1BXN A;  2DCL A;  1YZ6 A;  3V4I B;  3H5X A;  2AX0 A;  5HI7 A;  2LQ8 A;  2PA8 D;  1IWA A;  3DCA A;  3BQ1 A;  2EBE A;  1X9S A;  4AE5 A;  1UA0 A;  1JK9 B;  3QGG A;  4L6V 3;  5KG4 A;  4ZLP A;  3NCP A;  1GQE A;  3FC9 A;  4C4W A;  3HO1 A;  4AYB D;  2IDL A;  5GAE I;  3TZY A;  5DG7 A;  1V5I B;  4GVL A;  1KLM A;  4K4T A;  3V2U C;  2A1B A;  1ZM2 A;  2F65 A;  3NGD A;  2ZVI A;  4TVA B;  2DNQ A;  4FYV B;  4I69 A;  1F60 B;  1M5O C;  1X4F A;  4PXD A;  2GGP A;  1UFW A;  2CG8 A;  4P2X A;  4YDX A;  4WCE Q;  5KFI A;  2BYC A;  3PIP Q;  1TUW A;  1F2H A;  2J7W A;  3CO9 A;  3NBP B;  1YRU A;  4WK1 A;  1FKP B;  2MZ1 A;  3DFE A;  3PR5 B;  2BA9 A;  5KFT A;  1W2I A;  4X62 F;  2XY7 A;  1XC9 A;  2GO8 A;  2PI4 A;  4F4K A;  3DU6 A;  1MMN A;  2OKQ A;  5CXT A;  4CTA B;  3G6V A;  1HQU B;  3JS9 A;  3PXG a;  4DI6 A;  3CCQ S;  2J6T A;  2F40 A;  4UST A;  4KHP J;  2AYE A;  2FYX A;  3FKB A;  1XMQ F;  1R6V A;  4YHH F;  1R0C B;  4NI2 A;  3MR3 A;  3V81 A;  5KT3 A;  4DQS A;  2VL1 A;  2ZHO A;  3BBF A;  3F56 A;  3ISN D;  2AYM A;  5BR8 J;  2B5J B;  3GIK A;  5D3G A;  3VHQ A;  2W4C A;  3N9U C;  3KLV A;  2OPS A;  1JLQ A;  4URG A;  2KT5 A;  3D1Q A;  4LF7 F;  1C4C A;  3AY0 A;  4B3O B;  3W1Y C;  2R7V A;  3ET6 B;  2FVP A;  2MZR A;  4RW6 B;  1DAX A;  2LLZ A;  4NLO A;  2ERR A;  2H54 B;  2JL9 A;  1V9O A;  3BKF A;  3R9L A;  5KFX A;  2XNR A;  4KPC A;  2CNO B;  3LP0 A;  2XZD B;  2GQQ A;  2GGP B;  5C42 B;  4EBE A;  2CVE A;  2D74 B;  2OMO A;  4ZDN A;  4OL8 A;  1FRX A;  1NCL A;  2D9O A;  3KLE A;  4M5L A;  3DMJ B;  4DR6 F;  2RDJ A;  4X4V A;  2GQ2 A;  4AXJ A;  4YUD A;  2VFU A;  5BYQ A;  1QD1 A;  2W2O P;  4FPR A;  5J2P A;  1TK8 A;  3DGP B;  3QRQ A;  4V19 X;  2IYI A;  2PC6 A;  1VIO A;  2LQB A;  3CDB A;  1OPI A;  4LRE A;  2B4O A;  3H4B A;  3M2R B;  2CVI A;  4YOE A;  3M05 A;  4DR2 F;  2UU9 F;  3MR6 A;  4DOZ A;  3IAS 9;  1LW2 A;  3ENW A;  4GO7 X;  4IFV A;  1U1P A;  4ELU A;  2KN4 A;  5A8K B;  3D54 A;  5CCL A;  4X4N A;  3M9M B;  1PC4 A;  4DR7 F;  4Z7C A;  1RCX B;  3NOC A;  1RT2 B;  3B6B A;  3R5G A;  5CYM B;  4DR3 J;  3ZTP A;  2HPU A;  4CO1 A;  2N3L A;  3RB4 A;  3ZTQ A;  3HHE A;  1XR7 A;  2ZJR Q;  5L39 A;  2DPJ A;  2DB1 A;  2HQG A;  1BY9 A;  1TAQ A;  2Z8Q A;  2KT2 A;  5IWA J;  4JI8 J;  2IJR A;  1F5C A;  3NGU A;  1XEZ A;  3L7U A;  4OYP A;  4TU9 A;  4HLB A;  1C0T A;  2BV3 A;  5AE2 A;  1WC5 A;  3ISN C;  4N56 A;  2E1R A;  5B0F A;  2LKZ A;  3LAM A;  1OYD A;  2COL A;  2CQ0 A;  4Y6I A;  2UXB F;  2QSF A;  1TFW A;  1KHV A;  2GIR A;  1UL3 A;  3DHW C;  4O44 B;  4UUW A;  5K14 B;  5KG1 A;  5L1L A;  1K1Q A;  2DGO A;  3HVR A;  4F3O A;  2BUN A;  4MKV A;  1S9E A;  2HRY A;  1JNR B;  2FHO B;  3WX8 A;  3JSB A;  4OYX A;  2B8Q A;  3IO1 A;  3DOM B;  1REG X;  1FWL A;  4CLZ A;  3R3T A;  3OSP A;  1MLA A;  4YN3 B;  2DXD A;  1ITP A;  5DQI A;  2CPE A;  2OPP B;  4J7C A;  3FNN A;  4F3Q A;  4ZIT A;  1FNX H;  2ZH2 A;  1N52 B;  2BZ2 A;  3A8J A;  3MTJ A;  1Q8B A;  1KN6 A;  4MMO A;  1XQI A;  4LRB A;  1OQ3 A;  4DJB A;  3BH7 B;  3ISZ A;  4LBH A;  3MDF A;  1HQE B;  4PXE A;  4X64 J;  1J2V A;  1JLA B;  2B9X A;  1BWV A;  2DGS A;  2HS0 A;  2V8D A;  2PMZ D;  3M9N B;  1RB0 A;  1S6O A;  3D0G E;  4AQY F;  4AL7 A;  4DDF A;  3EUN A;  1TTH B;  1YX2 A;  4NMX A;  2VBZ A;  3M2U B;  5G0R B;  3KWM A;  3DRP B;  3TA2 A;  3F44 A;  3JSM B;  4CO5 A;  2XO6 A;  3ZNU A;  1DUR A;  2E5I A;  1S49 A;  2XHW A;  3DRX A;  1O5J A;  1U2F A;  2B9Y A;  3HZG A;  2N82 B;  2AP6 A;  1FFS B;  1R0B G;  2EPI A;  2RUG A;  2WW4 A;  4FP9 A;  4C3M A;  4MIB A;  2D3Z A;  4YHH J;  4Q8F A;  3MD3 A;  2X3D A;  4E0D A;  1CVJ A;  5HMW A;  3S6E A;  1BLU A;  2HBQ B;  5DDQ C;  9RUB A;  2HHW A;  3QRR A;  1Q79 A;  2UZA A;  1GMW A;  5DDP C;  1VQK S;  4B3S F;  2X51 A;  4U6P A;  2H51 B;  2JEF A;  2P5V A;  1D3W A;  1M0S A;  4QU6 A;  1X4B A;  5F8N A;  2HHH J;  4NZ7 A;  4KGM A;  1SL0 A;  1I3O B;  3PCO B;  3FEX B;  4A8M P;  4BS2 A;  3AH6 A;  4RKU C;  4QJV A;  1X4E A;  4R5P A;  1TV6 B;  2XS2 A;  5KFZ A;  2AV5 A;  4DV4 F;  2I2Y A;  1TV6 A;  1TU0 B;  2MSS A;  4LSL B;  4MKB A;  1NK5 A;  4YB7 A;  1HNI B;  1B70 B;  3OXG A;  5F0U A;  4B9N A;  1R8H A;  3A3P B;  2IHR 1;  2R8H A;  2JRS A;  3AAW B;  3TAP A;  2R3V A;  4YFU A;  1Q5Y A;  2D41 A;  4DQI A;  2L9D A;  2YKN A;  4FYY B;  2HQ3 A;  4KQZ A;  4Y65 A;  1RAG B;  2VG5 B;  4GMK A;  1FE0 A;  1RT3 A;  5EN1 A;  5H9F J;  3DM2 A;  1N32 J;  3EXY A;  1JWW A;  4MAK A;  5A8K A;  4U96 A;  3IP0 A;  2K8G A;  4DCP B;  3AOB A;  5J1N A;  1L3T A;  2BMB A;  3VF0 B;  2BJE A;  2CJX B;  3D6H B;  2AT1 B;  3CCU S;  2FLN A;  4NLG A;  1FJG F;  3FUY A;  2XSJ A;  5E3Q A;  4WFB Q;  2R2S A;  2GVZ B;  3AB2 B;  5E0O A;  2VFT A;  1CG2 A;  4JI6 F;  3DDI A;  2UUC F;  2ZHA A;  2H9Z A;  2MKI A;  3TZX A;  3BQ0 A;  3GQC A;  2FHK A;  2YNG A;  1SC3 B;  2OD6 A;  1S6Q B;  1HNZ J;  2CPZ A;  1WC4 A;  4ED0 A;  3E8O A;  3GR0 A;  2GO9 A;  3I5A A;  1Q82 T;  1HHT P;  4KO0 B;  2B51 A;  2NZC A;  2QMU B;  3CJ0 A;  1Y5I B;  2WCX A;  2KG1 A;  2XO7 A;  5F8J A;  2DGX A;  4BWJ A;  5D0E A;  5ITH A;  3MR7 A;  3P6Y C;  1NDP A;  2KYZ A;  1TKT B;  4U8V A;  1M5V C;  3DXB A;  4ZJO A;  1LOU A;  2JEI A;  1S9E B;  3A8K A;  1BE4 A;  4CLL A;  4EBD A;  2VPZ B;  2XM3 A;  1K47 A;  1TP7 A;  3E01 A;  4I4B A;  3PKY A;  2YWF A;  1ZBT A;  1TMJ A;  4HTI A;  4DCJ B;  2HHQ A;  3K5P A;  1RGV A;  2CQ1 A;  1GK8 A;  4ED6 A;  2G0J A;  2UXC J;  4TN2 A;  2XMJ A;  3PFO A;  5HMY A;  3I87 A;  4DU8 A;  4ID5 B;  3KJQ B;  1FDN A;  3AFG A;  3BJY A;  3EYZ A;  3QNW B;  1FT8 A;  2HZA A;  2B9W A;  2MY8 A;  4Y2A A;  1UPP A;  2G2O A;  3M8Q A;  1NSQ A;  2YX7 A;  4ZK7 M;  4K2X A;  5BXI A;  2BR0 A;  1ELO A;  4WJB A;  3R7B B;  2ZKU A;  5KFR A;  3W9H A;  2WSE C;  2DVI A;  3AT1 B;  3HHK A;  4WWS A;  5E3A A;  5SUH A;  1L5U A;  4BLG A;  2CPI A;  1IWG A;  1ZM3 A;  3TAM B;  4Y00 A;  2V4Q A;  4USM A;  2QA1 A;  1DRZ A;  5T14 A;  2VC0 A;  2HFS A;  4LFB F;  4DV0 J;  2VDI A;  4QW9 A;  1RQ0 A;  3AA9 A;  1XIQ A;  3A1Y G;  1K8A T;  3HVT B;  4OI4 A;  1HI1 A;  4RW4 A;  3H98 A;  4ZHR A;  2ZH4 A;  1FX2 A;  2BJ8 A;  3JTP A;  1VRT A;  3PW4 A;  4UTG A;  1NPK A;  4JI5 J;  1TL4 A;  3TJA A;  4PG5 A;  3OTD A;  5SZT A;  4MIW A;  7FDR A;  1HWL A;  2K3I A;  3Q8S B;  3G9C A;  4JOU A;  2WAQ D;  1RT4 A;  4X4R A;  3RW6 A;  1T9X A;  3S01 A;  1DFD A;  3FVY A;  2XMU A;  1RT2 A;  3FEY B;  5KFV A;  1MWZ A;  2CNK B;  1D8Z A;  3BN4 A;  1JLQ B;  2ROG A;  1KQS R;  1AXQ A;  2XMV A;  3R8Y A;  1FKO B;  1CBK A;  2YNH A;  2YXL A;  3GV8 B;  5KFK A;  4DUZ F;  4EYI B;  1VQ9 S;  2BRL A;  1RTJ B;  1FFW B;  5LXR A;  3EVW A;  4URS A;  2LU2 A;  3NAI A;  2GV1 A;  3DKD A;  3O3L A;  4K5R A;  4OZ2 A;  3K5L A;  4ES2 A;  2K7K A;  4I6W A;  2UP1 A;  4P75 A;  3N79 A;  2M4M A;  1RAI B;  2U2F A;  4OI2 A;  1FRL A;  2B43 A;  2P9E A;  3D0I E;  3O2I A;  1ZM9 A;  2YY3 A;  5L46 A;  3R1H A;  2V9W A;  2E5G A;  4RNH A;  2V4J A;  3KG1 A;  4L76 A;  2HGN A;  4LF8 J;  2RNE A;  3MM5 B;  4F25 A;  5KFY A;  4FXD A;  3VAI A;  1VQO S;  1TL5 A;  3CCL S;  1PAE X;  2ALY B;  2A10 A;  2NSB A;  1HNW F;  1XR6 A;  5IWA F;  1DLO A;  2ZZM A;  4I2Q B;  2Q66 A;  1Q5V A;  3MXH P;  3KK2 B;  2RQM A;  4OI1 A;  2RAQ A;  3KK2 A;  2FIU A;  4LF5 F;  3IWN C;  4S0M A;  4DSI A;  4P7T A;  3K0J A;  2VQF F;  1YZ7 A;  1FF2 A;  3I4P A;  4M5D B;  4OYM A;  4WE1 A;  5E7O B;  2R8I A;  3FSI A;  3BO2 A;  3LA0 A;  1SKR A;  3MTK A;  2CQP A;  2RT3 A;  4TYB A;  4EGL A;  4NCB A;  1RTJ A;  2J6U A;  2BX6 A;  2PGC A;  4P73 A;  4ZVH A;  2MQ8 A;  2D7S A;  2OJ3 A;  2Z0G A;  2E1C A;  1N34 J;  4RBV A;  4DV1 J;  4JV2 A;  2UXD J;  2CPX A;  4Y0F A;  2UVR A;  4OYI A;  4CWB A;  3LP2 A;  1FD2 A;  4CNY A;  3QSI A;  2QMW A;  5D4N A;  1YQH A;  4DSF A;  3QSY B;  3PHE A;  1FHT A;  2YX4 A;  3QGH A;  2F4V F;  3LP1 B;  3OFG A;  2MKJ A;  4KGK A;  2YKQ A;  3BO3 A;  1WOR A;  2X3G A;  3R7N B;  4CH1 A;  4MKY A;  4K4Z A;  4C98 A;  3D6T B;  2E1M C;  1N0V C;  2DXE A;  4J9V A;  4OZ0 A;  1YJR A;  1HR0 J;  3KDO A;  1YJW S;  1WAC A;  3R97 A;  2C3O A;  1V3R A;  4DR6 J;  4Y28 C;  3VVU A;  1NJY A;  1UJ4 A;  2DGQ A;  2C2Z B;  2IIH A;  4IH6 A;  3J81 j;  2IY5 B;  3H7H B;  1Q7L B;  3J7Z 5;  3HHN B;  3FSX A;  4U7C A;  3TEG A;  3V6K A;  2CQ4 A;  2MQN A;  3DN9 A;  2BAN B;  3ETO A;  5DM7 Q;  2CYY A;  4Q5V A;  3WC0 A;  1W26 A;  1Y10 A;  2EEY A;  4RL1 A;  3RBX A;  1X5S A;  4F36 A;  2AJ2 A;  3UCG A;  5HL7 Q;  3G8T A;  2W7P A;  4O4G A;  4QWB A;  1RZM A;  3D0H E;  4DL2 A;  2AF6 A;  1GMU A;  3CJ3 A;  5EGY A;  2ZC3 A;  2R2R A;  3Q8Y A;  4H4K A;  3KKF A;  3G6E S;  2IFX A;  3BPS P;  4ILL A;  1BWE A;  1VJW A;  2HLT A;  3N4W A;  1DQA A;  4GKK F;  2YTC A;  1S1T A;  1W25 A;  4ZVO B;  2H48 B;  4IH7 A;  5J2P B;  3CXC R;  1RT5 A;  3ICL A;  4EFA C;  5KT5 A;  3DRS A;  3NWG A;  3W2V B;  1T9W A;  3JSM A;  4USK A;  2DGT A;  1S72 S;  4FF4 A;  2D1C A;  2NXN A;  4HDH A;  1FDD A;  2AW0 A;  3ILJ A;  5DET A;  5HJY A;  2JFD A;  4ECX A;  1RTH A;  3PJW A;  1VJQ A;  1ZS6 A;  4I1T A;  1ZA2 B;  2KG0 A;  3G86 A;  5CYJ A;  1KTV A;  3E2E A;  5I3P A;  4RNF A;  2Y1J A;  4HI1 A;  4ZPV R;  1HI8 A;  1JXL A;  4QOT A;  4DL5 A;  2C28 A;  2OML A;  1HI0 P;  1IBK F;  3D67 A;  2DBB A;  2KB2 A;  4WIQ A;  1JJH A;  1ULR A;  2G13 A;  4ITS A;  4ZVP B;  3WZ0 A;  5KG6 A;  4C3K A;  3FRZ A;  4Z2X A;  2NR0 A;  1FES A;  3OJU A;  2R7T A;  1ZET A;  2RKI B;  5B0A A;  5KFO A;  3HLU A;  2MQO A;  1T02 A;  1ZH5 A;  1ZAV A;  1PYS B;  2LDY A;  4XIU A;  4IUF A;  1M1H A;  4ECU A;  5CD4 H;  4LF4 F;  4M5N A;  3OR2 A;  4QPX A;  3W8G A;  5HLF A;  4U7U K;  1U6B A;  1S9G A;  1JLA A;  1SH0 A;  3GFX A;  3MEK A;  4DU7 A;  3BKT A;  2PI5 A;  1B3T A;  2HGL A;  4ZPB A;  4YME A;  4Q43 A;  4ZIW A;  4MJK A;  3RAQ A;  4XTT A;  1N4L A;  4F2S A;  2ZD1 A;  4E2F B;  1RAO A;  4WYW A;  3I32 A;  5E3C A;  3M30 A;  3NS6 A;  1LFW A;  2D69 A;  2HWH A;  3GFY A;  3N6M A;  4IO1 A;  2J5A A;  2VZ9 A;  4HH1 A;  4KAI A;  5KFJ A;  3G6Y A;  2RQC A;  2NLW A;  3MEC B;  3DXS X;  3NMR A;  2J0X A;  1BQM B;  3M8W A;  2VG6 A;  3TQ1 A;  1RTH B;  3DLL Q;  2E44 A;  1YVF A;  3MUT P;  1FJC A;  1N5Q A;  4F4Z A;  1CJT B;  1NBE B;  1H38 A;  2QL7 B;  3DGV A;  3CTR A;  3OLB A;  3DDK A;  2HAI A;  2VBW A;  3PVX A;  1XNQ F;  2Y8Y A;  1HNZ F;  2E9T A;  3M4X A;  3NLC A;  2XSJ B;  2H3E B;  1U0H A;  3ZFV A;  4DR4 F;  2W1B A;  1JB0 C;  2C2R A;  4N41 A;  3D3C J;  4AT1 B;  1WEZ A;  4H4M B;  3C6T A;  3KK1 B;  1U45 A;  2UVU A;  4JI6 J;  4U7U D;  3IR7 B;  1WOS A;  2GMH A;  2FHJ D;  4LIW A;  2HAF A;  3EZU A;  1HWJ A;  1P9Y A;  3M8S A;  3W9I A;  2HLU A;  3M8R A;  1OJ4 A;  4X66 J;  3OTC A;  2ZUA A;  4ZCL A;  2E1P A;  4CCH A;  2GC8 A;  4B9L A;  1HBU A;  1HA1 A;  3C3L A;  2OTJ S;  4Q45 A;  4B3M F;  2XMM A;  3P49 B;  1UFL A;  5DM6 Q;  1RKJ A;  4OFZ A;  4KGV B;  2OD4 A;  1OY8 A;  4NLS A;  4NEZ A;  1U02 A;  1MG7 A;  2QLW A;  3FZ2 A;  2HND A;  2W8K A;  5DG8 A;  2G0C A;  3DM2 B;  2HWT A;  4IRC A;  4JI7 J;  1VR6 A;  1WOO A;  2LP4 A;  5HVF A;  3SCJ E;  1VRT B;  2DR6 A;  2ADC A;  5HAN A;  1D0E A;  3LGH A;  2KJV A;  1K0T A;  2F3J A;  3UW1 A;  1VK8 A;  4OI6 A;  4DX5 A;  4WU2 A;  3GIL A;  4YY3 F;  2R7Q A;  3WC2 A;  3UO0 A;  3P96 A;  2QLB B;  2FD2 A;  4I6A A;  4TNO A;  1J27 A;  2PII A;  4PPD A;  1WDD A;  4NLD A;  4H4M A;  2DNH A;  1ZZF A;  2ZBR A;  5ETP A;  3GIJ A;  4K4X A;  2BOP A;  4NYO A;  2RDI A;  5HLF B;  4PQU B;  4O23 A;  1EKR A;  3SQG A;  2F9J A;  2W8L A;  1TKZ B;  1S12 A;  3FZB A;  3MEG B;  4DV3 J;  5J2N A;  3NWR A;  1NK8 A;  2MLX A;  3MR2 A;  1VQL S;  1MNE A;  3S1T A;  4EBC A;  2ZFH A;  1TKT A;  4PWU A;  2LXU A;  3FK4 A;  4ZVR B;  3M32 A;  3UI3 A;  4C7Q A;  3TI0 A;  2XYG B;  1X9M A;  3BDE A;  3NBP A;  5HRO B;  2M0G B;  4IDK A;  4YR2 A;  3UD4 P;  2Z2M A;  3JSY A;  4UOF A;  3IBF B;  2HRT A;  1FO1 A;  2LEC A;  3THV A;  4EO8 A;  3L3C A;  4F0M A;  1RAF B;  2BQR A;  2OSQ A;  1QAJ A;  2WOM A;  3HF5 A;  2AEM A;  5KT4 A;  4ECR A;  4JI0 J;  1UFK A;  4N7T A;  2AJ0 A;  3ENQ A;  2IJF A;  2XQC A;  4J9M A;  2G2Z A;  3ZZT A;  3FBF A;  1HAR A;  4LF2 A;  4P7V A;  2DTJ A;  3T41 A;  4DPU A;  4CLU A;  3MUV P;  2CQC A;  3AA8 A;  2JVR A;  1I51 B;  1IBC B;  3MGJ A;  2GX8 A;  2LQ5 A;  2X1A A;  1I94 F;  4NXM J;  1R0A A;  4ICL A;  2B6A B;  2YPZ A;  3OFH A;  3HD1 A;  3B54 A;  2I0X A;  2D3U A;  4ZPC A;  3VAG A;  3V6D A;  5H9F K;  2A18 A;  2VPY B;  5E41 A;  5F0W A;  5LOQ A;  2ZH6 A;  3MUR P;  1EZZ B;  2GQC A;  3TWZ A;  2AHO B;  4FKY A;  3K5M A;  3VZH A;  4WZM A;  1WDT A;  4KHR A;  4KH0 B;  2GVD A;  3MM8 A;  3ZNJ 1;  2DGV A;  2QEX S;  5L1J A;  2AWZ A;  4DQQ A;  1AW0 A;  4IR9 A;  4OX6 A;  5AXL A;  4J91 A;  2C3Y A;  2OEM A;  3UVJ A;  4HAC A;  5EWG A;  4DF4 A;  3E51 A;  3NP5 A;  2IBK A;  2MST A;  4A8Q A;  2ZZN A;  2OHD A;  3OPK A;  4CLS A;  4B3T J;  2BW7 A;  3MM7 B;  1PJ7 A;  3PYF A;  1B0V A;  1SJ1 A;  2P2C B;  1H7W A;  2Q1L A;  1C1C B;  2WON B;  4ZOS A;  5FDL B;  2KI2 A;  2W9C B;  1WHY A;  4M5J A;  3JQJ A;  4K2J A;  2LEB A;  1UPM B;  3GSD A;  1U0H B;  2A2C A;  4ZVU B;  3VVT A;  3UCU P;  1FEE A;  4JI3 F;  3TNV A;  3MED A;  5GME A;  3FMW A;  2EFP A;  2I5J B;  3KLG B;  2VQE F;  2XTJ P;  3ITH A;  3HSG A;  5JXS A;  2J8S A;  2QL5 B;  3M6X A;  5KFU A;  1VRQ C;  4M1K A;  4JI8 F;  1S79 A;  3CJ8 A;  3U27 A;  4QWE A;  2RRA A;  1H6K X;  1AFJ A;  1NXI A;  2YNI B;  2GHV C;  5H9E J;  2NUH A;  2CZV C;  4PKD B;  1TVR A;  2VJV A;  2V2K A;  1Q16 B;  1J5O B;  1YJ7 A;  4DCO B;  1KDN A;  1TKX A;  3R5C A;  4LBP A;  1M1G A;  5CHC B;  2WTF A;  3CCE S;  4GC6 A;  4DFJ A;  3PX0 A;  3W7B A;  3D6M B;  1C0U B;  1XER A;  1IUJ A;  3K17 A;  4XAK A;  2ASL A;  4X4P A;  1ARO P;  2RH3 A;  3KJN B;  3X3U A;  5IV3 A;  1QM9 A;  2LMI A;  5GAH I;  3KLE B;  2DJW A;  1S1X B;  1SC6 A;  1KFD A;  3CIM A;  4GRS A;  4TU7 A;  1RYS A;  3NL0 A;  3TW0 A;  5CZV A;  3HFV A;  3QFH A;  2DEI A;  4GVB A;  4LSN B;  2F4F A;  3E3X A;  2V4J B;  3QQC D;  2J7U A;  1V3S A;  2HFU A;  2HRU A;  3J7Y U;  1KWM A;  4HHU A;  1JLE B;  2HHP A;  3CMQ A;  1VS3 A;  3TAN A;  2QLX A;  1NJX A;  2KM8 B;  3SV3 A;  1X0F A;  1G6B A;  1HQ2 A;  3CJS A;  4OQJ A;  3BO4 A;  4OV6 A;  3V6J A;  5H1S V;  2V0N A;  3QWP A;  3G82 A;  4I0W A;  2LEP A;  4CM2 A;  4G1Q B;  2FZK B;  4M5D A;  5HQM A;  3LWM A;  1X4C A;  1BQN B;  2DIS A;  4WFZ A;  3DLK B;  2DGW A;  5A8R B;  5AE3 A;  2XEX A;  2EBG A;  3DYA A;  3BN7 A;  3DU5 A;  2K1R B;  4B3R F;  1NUE A;  1R89 A;  3MI7 X;  4F0K A;  2N4C A;  4YR0 A;  2PFF B;  2V94 A;  3W61 A;  1PG5 B;  1NRK A;  1RXO B;  3SSS A;  5KOW A;  1ZYQ A;  1NPP A;  3OW2 R;  4UQT A;  4Q0B A;  4G65 A;  1A9N B;  3TYT A;  1MU2 B;  1P6T A;  1IJF B;  1SIZ A;  1UET A;  2V6A A;  5EX0 A;  2E5L J;  1Z4U A;  3CIZ A;  3DNC A;  2FJW A;  3EGZ A;  2VA2 A;  3NG8 A;  1I6J A;  5KT6 A;  1HMV A;  1LWF B;  1HW8 A;  3MWB A;  4I2P B;  5DS7 A;  1MMD A;  2LQJ A;  4B02 A;  1FRJ A;  1U1M A;  2ZNZ A;  3NGT A;  1RHJ B;  1SXL A;  2IDE A;  1CC7 A;  3H25 A;  1N8R T;  3IFE A;  2W2P P;  4M5G A;  2BE7 D;  2DNO A;  2X1G A;  1IKY B;  3HSD A;  2KHD A;  1CJV A;  1FA0 A;  3CDE A;  4IG0 B;  3GP9 A;  1JLB A;  4A8X A;  2N7C A;  1JXV A;  3O44 A;  1JLC A;  4QR1 A;  1DQ9 A;  2XLI A;  3TUZ C;  1UWB A;  2RDD A;  3MOZ A;  2W7O A;  1CSJ A;  3D28 A;  3QLH A;  2FUG 9;  4KR0 B;  4Q7A A;  3TR5 A;  2JH3 A;  3L95 X;  2KT3 A;  4D3G A;  2W7A A;  5IXU A;  4OJ1 A;  1RWU A;  2CFX A;  1RUS A;  2H5I B;  3GJR B;  3KK1 A;  2VFR A;  5AE1 A;  2XZW A;  2BVZ A;  4CO0 A;  1RTI B;  2IRX A;  1N36 J;  3NXZ A;  2ASY A;  3BGO P;  1NSK L;  5GAG I;  4ZS6 A;  4TQR A;  3UD3 P;  3TAQ A;  2FJE B;  4LSL A;  3H5Y A;  3VCD A;  1VRU B;  2HHS A;  4CLT A;  2XY5 A;  3DRP A;  3RB3 A;  4RNM A;  4OJG A;  5JVG Q;  3MMJ A;  2ZDO A;  3KNG A;  3KUH A;  4OZ3 A;  5D15 A;  1QTM A;  5GVQ A;  3GIM A;  3MEC A;  4DR7 J;  3U02 A;  2HUR A;  3HFZ B;  3CD7 A;  2W2M P;  3BYP A;  2VOO A;  3B4D A;  4PAB A;  1HBN A;  1YSJ A;  3MR5 A;  3IRW P;  2NZ4 A;  2IAJ A;  4IKA A;  1HWU A;  1DTT B;  1TFY A;  1Z2Z A;  5HSP A;  4UF4 A;  4DFK A;  3ZZO A;  2R7W A;  2BOA A;  2V34 A;  3ENA A;  4RBU A;  4X66 F;  2EFV A;  3H42 A;  3QAE A;  3VTI A;  2P9G A;  4QPT A;  3JQK A;  3FQK A;  3JB9 k;  3ILI A;  4LRC A;  2YNF A;  4DR4 J;  4ECT A;  1Q7Y T;  1XTZ A;  4CT8 A;  1KNZ A;  4CQ1 A;  1AT1 B;  3TA1 A;  2K06 A;  2CQG A;  2OLW A;  1HHQ A;  2B7B B;  4IFY B;  5DDR C;  3Q24 A;  4NA3 A;  5HAO A;  3RB6 A;  3AJ1 A;  2ALZ A;  4F2R A;  1S0V A;  2I8E A;  4MYU A;  2RHS B;  3M6U A;  4DN0 A;  4C8Z A;  2VB6 A;  2IPO B;  4K59 A;  3RRK A;  4WZQ A;  2R4F A;  1RK8 A;  2GAG C;  2FPH X;  2MTL A;  2WSF C;  4NYZ A;  2ZIT A;  1H98 A;  4AUK A;  2ZBC A;  4QWD A;  5KAK A;  2VIH A;  3CDU A;  3BGU A;  3B8H A;  4XPE A;  2F1F A;  1GTH A;  2MY7 A;  1N0U A;  4ZLJ A;  3X1L B;  3G6X A;  3CB4 A;  4J9S A;  2BEF A;  1FRM A;  2XWX A;  3K8V A;  3MMA A;  1KQG B;  3B78 A;  2F5G A;  4NZ0 A;  1B4S A;  4USJ C;  4WP8 A;  3SBM A;  3VGU A;  4ZJQ A;  4RUC A;  1WNE A;  4M5M A;  1WF2 A;  5C7P A;  2VD3 A;  1P27 B;  1PGZ A;  1WSV A;  5CYM A;  1IBM J;  2W9B A;  4CH0 S;  1RKI A;  5DGB A;  2XI3 A;  3K8W A;  3OHA A;  3M8Z A;  1T11 A;  3TA0 A;  3RAM A;  3N28 A;  5CQG A;  5DDO C;  1XMO F;  4ERD A;  4QYZ K;  3W2W B;  5IQ6 A;  1WTB A;  1K73 T;  3RGI A;  1SC1 B;  2XYH B;  1IKX A;  4ETX A;  4HH0 A;  3MFH A;  1YHQ S;  1G4C A;  1H2V Z;  5FII A;  3FCH A;  2V2Z A;  2EWH A;  2HFO A;  4QIF A;  3BGR A;  1VBZ A;  4X2B A;  2IVY A;  3DHX A;  3D68 A;  1JJ2 R;  3GG0 A;  2VFS A;  4UOG A;  2HSE B;  3P5T L;  4KRW A;  2E5L F;  4G3I A;  1SJF A;  4GKJ J;  3QFW A;  2JSX A;  3AD9 C;  1M1K T;  1FVQ A;  3DRS B;  1HMV B;  1LWF A;  3W2V A;  3GFH A;  2HNY A;  4YB1 P;  2WRM A;  1UA1 A;  3VAL A;  4F3M A;  3UR3 C;  1UW4 A;  4EU0 A;  4ZIV A;  4RW4 B;  1IN0 A;  1C1B B;  4Y3C A;  3MCS A;  2K3K A;  4GKK J;  1C1B A;  2G0I A;  2KXF A;  3NGK A;  3GR1 A;  3PO5 A;  5EX3 A;  5AXM A;  1RAH B;  1X4D A;  2YKM A;  3NY0 A;  1XNR F;  3DOK B;  7AT1 B;  2H5J B;  3KTQ A;  2YWW A;  1IVZ A;  2V69 A;  4QQB A;  4DV2 J;  4TY8 B;  3FFI A;  1TL7 B;  1WSR A;  1T3N A;  2HWI A;  4F67 A;  1NH8 A;  5I3U B;  5D0G A;  3SCL E;  2F63 A;  2YKO A;  4FZV A;  4NCA A;  1NM2 A;  3IR5 B;  2AYG A;  5KFF A;  2AYB A;  3BGF A;  3FGV A;  2JX2 A;  2ZJQ Q;  1VQ7 S;  1Q0N A;  3MMC A;  2HVD A;  1U24 A;  2XGP A;  3DLB A;  1RU2 A;  1JQG A;  3ILO A;  4PR6 A;  4XPC A;  3DMJ A;  4AL6 A;  4HYK A;  2O67 A;  4Y2M A;  1FK9 B;  2ZBQ A;  5IM0 B;  1X5O A;  4ZN1 A;  3QAU A;  5A2Q Y;  4KC5 A;  4RW9 A;  4FKX A;  1FJG J;  1L3S A;  5HRO A;  1TK0 A;  2CZ9 A;  3JAM Y;  2DXF A;  2G2Y A;  3IXQ A;  3S7R A;  4NXN F;  2M3D A;  2ZDP A;  3C14 B;  1B0P A;  3DOM A;  4KKO B;  2YH1 A;  1GH8 A;  2NPI A;  5C24 B;  3KJV A;  1XNQ J;  1FD8 A;  2IAJ B;  1AB8 A;  1CUL B;  1X5T A;  4CYU A;  2VFV A;  5KFA A;  2HFV A;  3GZ7 A;  3O8W A;  4UY8 5;  5KT2 A;  2MPU A;  2QO3 A;  3T1H F;  2WVF A;  1RAD B;  5C2C A;  4O3O A;  5ETT A;  3O5T B;  2CJK A;  2PSZ A;  2XMW A;  1X4H A;  2CNN B;  5B0B A;  5KTQ A;  3FRY A;  2FLP A;  2LFV A;  1VOM A;  3T1A A;  3K5O A;  2ASJ A;  2CPH A;  1TKX B;  1WC3 A;  4P52 A;  5F9N A;  1HBU B;  3GG1 A;  5CA5 A;  4UZB A;  4NLY A;  2R42 A;  1WHV A;  2DHX A;  5KFG A;  1IBL J;  3NEK A;  2CWK A;  2ACY A;  4R0J A;  4CO4 A;  3KMS A;  1TZ0 A;  3QO9 A;  3T9Z A;  3CCT A;  3MZI A;  2G4B A;  1D9A A;  2V9K A;  1N48 A;  1U47 A;  4TU8 A;  3MFI A;  4OMF G;  4ZCM A;  3LGM A;  1CJU B;  1RT3 B;  1S97 A;  1RHU B;  5GAG U;  2XLK A;  4ZHR B;  1ROF A;  2M88 A;  3M2V A;  3MD1 A;  5J1E A;  3W9J A;  2GIQ A;  4AFF A;  4PG4 A;  4ZVT B;  3R5B A;  3DRR A;  5KFW A;  2PEB A;  1R8A A;  1LNQ A;  2MMY A;  3SYZ A;  3GMG A;  2Z2Z A;  5CYQ B;  1WTF A;  4X65 J;  4DPX A;  1KR4 A;  1X0P A;  2UUW A;  2DNN A;  2G9O A;  2V68 A;  3C19 A;  3VZI A;  3W60 A;  4EWT A;  3OL7 A;  3KLG A;  2NXC A;  4DL7 A;  2ADB A;  4OJ3 A;  3C6T B;  2LXI A;  4CLY A;  2GS8 A;  4O3Q A;  1X31 C;  2YPY A;  4L72 B;  3BH6 B;  1B0T A;  1KP6 A;  1R6Y A;  3F73 A;  2VU5 A;  5KFD A;  4OYA A;  3LAN A;  1W2B R;  3Q2S C;  2XGQ A;  2ACM A;  3C16 A;  3LUY A;  3TAM A;  3UFC X;  1YIJ S;  1WHW A;  3IRX B;  1EJ7 L;  4NWB A;  1SH2 A;  4RUB A;  2R2T A;  4HAC B;  3EJM A;  1L3V A;  1EP4 B;  1F5B A;  4KB7 A;  2CQH A;  1N6Q B;  2RJZ A;  2RU9 A;  3AB4 B;  3DI6 B;  3EDQ B;  1HKA A;  1WKL A;  4ANE A;  4IDK B;  4NZ6 A;  3PM9 A;  4PXC A;  1IM6 A;  3HCX A;  3M2V B;  4OZJ A;  5T41 A;  3E01 B;  5ETR A;  4DUY J;  3HHL C;  1JNZ B;  3N01 A;  4F4X A;  3KLH B;  1CUL A;  1QDU B;  1YDL A;  5LJ5 Y;  1GX5 A;  3AXK A;  1YJN S;  3R6L B;  4GO5 X;  3VGT A;  4B9V A;  4PG8 A;  5F8G A;  2QJ3 A;  2IM3 A;  3BSN A;  4LQ9 A;  1R27 B;  2DPI A;  3GWC A;  2J0S D;  4HHH A;  2LYV A;  3DLG B;  4IQX A;  4B9U A;  1CC8 A;  1VHF A;  5KFB A;  2ZHB A;  4QIG A;  4DSK A;  3BSA A;  5BR8 F;  3QYY A;  4WTY A;  1NHK L;  2H65 B;  3CNQ P;  3UN5 A;  1FNM A;  4JI1 J;  1QSL A;  2QRR A;  4A46 A;  1T3O A;  3CCW A;  3BPD A;  3BYR A;  1QE1 A;  1VBK A;  2DRD A;  1BQN A;  5A8R A;  4JP8 A;  2O3D A;  1GAO A;  1MN7 A;  1ZPW X;  3W5Y A;  2JOQ A;  2HVH A;  1RWM B;  2VF3 A;  2ZOG A;  1RCO B;  4Q2M A;  4J9N A;  4DX6 A;  4JV0 A;  3K7R A;  2B4V A;  2FVQ A;  2D3O 1;  3UN2 A;  3M8P B;  4RW7 B;  4JYA J;  3D7S B;  3TJ9 A;  1VFJ A;  4LVN P;  3OL6 A;  3KLH A;  3PX6 A;  2L48 A;  4K4U A;  1SI9 A;  1NK7 A;  3IBC B;  4NYP A;  1KQF B;  4CI0 B;  2KO1 A;  3FBB A;  1RT4 B;  2JLG A;  4K5S A;  2DNL A;  4CIO A;  4C6A A;  2LDI A;  3VR1 A;  1ZAW A;  1YKW A;  1SVD A;  3K57 A;  1CEZ A;  3Q8P B;  1TAU A;  2XHC A;  4FN5 A;  3HJF A;  3CJK B;  3K59 A;  3LQV A;  3MAH A;  5HJX A;  2BAN A;  2HNZ B;  3HHL D;  2C2O B;  4ZVG A;  4ECW A;  1REV B;  2BM1 A;  3EPG A;  2R7U A;  1X5P A;  4I56 A;  1W7W A;  2JHE A;  1EHW A;  3Q22 A;  5F8L A;  4PWD A;  1UEV A;  2V2V A;  1BMQ B;  1H7X A;  2IBO A;  4DG1 A;  4OJH A;  4MTP A;  1G2E A;  1O0P A;  2LQ9 A;  4M94 A;  1Q53 A;  2HK3 A;  3H2V E;  4X4Q A;  4N76 A;  3OL9 A;  1QLN A;  1DJ0 A;  1S48 A;  5BJR A;  5F8M A;  4UT4 A;  1MU2 A;  2CG4 A;  3BRE A;  3QPI A;  3F41 A;  4KHM A;  3CVK A;  8RUC A;  5J1E B;  3FEZ A;  2LCW A;  4RR5 A;  5KFH A;  1H74 A;  3JSR A;  1UAW A;  1RU1 A;  1FDA A;  2OPQ B;  5A0Y A;  3VAJ A;  3UD5 A;  3I96 A;  2F9D A;  3SFU A;  5JMN A;  2ZZT A;  2KJW A;  3DLH A;  2XI2 A;  2XY6 A;  2B5J A;  2CPJ A;  2APO A;  2Z30 B;  3CJ4 A;  5D3G B;  4RNN A;  3MF5 A;  2ZH5 A;  4ED3 A;  1XR5 A;  9ATC B;  3N6L A;  2JEG A;  2HG4 A;  2ZEJ A;  2ZE2 B;  3IM8 A;  3GV7 B;  3ET6 A;  4EYH B;  4TY9 A;  2Z57 B;  2DR5 A;  4NL5 A;  2EW9 A;  3G8S A;  4EEY A;  2HYI B;  2KFZ A;  3DYA B;  2DK2 A;  4LBI A;  4IFY A;  3G71 S;  2DY1 A;  3H8Y A;  2R7S A;  1OYE A;  1S0M A;  1IR1 A;  2DIU A;  1FXR A;  4FVC A;  4ZPA A;  1PBA A;  1SB6 A;  5K20 B;  3OR1 A;  1FI4 A;  4LSZ B;  3PW0 A;  3UNG C;  2F8M A;  4CNZ A;  1VMB A;  2RIL A;  3DRY A;  2NYH A;  3ENV A;  3HSJ A;  5IM0 A;  3OVA A;  4WF9 Q;  3CF5 Q;  2BJD A;  4NRU A;  4OHZ A;  5B0G A;  3OV7 A;  2DO0 A;  2J76 E;  4MIA A;  1YJT A;  1UW9 A;  2MKS A;  1H72 C;  4ED7 A;  1K1S A;  2MYF A;  2QX0 A;  1TK5 A;  4QWA A;  1F9E B;  1VYA A;  3MM6 B;  1N54 B;  2C3U A;  1T0T V;  2KXH A;  1UMJ A;  5I4M A;  4ES1 A;  2CJ9 A;  3PNI A;  1HL6 A;  2FVR A;  2XMK A;  3SXL A;  4A8Y A;  1VBX A;  3J81 Y;  2MJU A;  2L08 A;  3EVM A;  4AD6 A;  5GAE U;  4NLU A;  2WHO A;  2MKK A;  3T3F A;  2IMW P;  2GW8 A;  1FFG B;  1RTI A;  5ETO A;  5IV4 A;  4KY3 A;  4C8M A;  2IJN A;  5KFL A;  1P1T A;  2ZM6 J;  2L9N A;  3AOA A;  3EGW B;  4ZLN A;  1TQL A;  4WU3 A;  4K4W A;  2E5H A;  2ZH7 A;  4WKY A;  5F8H A;  2ZH8 A;  1FRK A;  1OPZ A;  2CQI A;  3AHP A;  1U8W A;  2FJD B;  4QR0 A;  1MML A;  3LF0 A;  4K50 A;  3A3O B;  2U1A A;  3H5S A;  3OQ2 A;  3PFE A;  4NAS A;  3UR0 A;  1J5E J;  1QVF R;  3I6P A;  3L09 A;  3W65 A;  3VQT A;  1Y5N B;  3MPY A;  2CDR B;  1SKS A;  5K8N A;  3U1M A;  4F50 A;  2XB2 D;  3NCQ A;  5THW A;  2VHG A;  1S9F A;  5GAH U;  2ZNY A;  2EI5 A;  2MHE A;  3CC4 S;  2H4W B;  4WFN Q;  2BKN A;  1X4A A;  3JQM A;  3POT B;  5I42 B;  4Z37 A;  4G1P A;  3CCZ A;  1K44 A;  1I1G A;  1U7L A;  1T9Y A;  3ZTR A;  2Q6C A;  1BUX A;  1REV A;  2AZ3 A;  6FDR A;  3LAL A;  4F4Y A;  4RW6 A;  2IC3 A;  5T7L A;  2PD1 A;  5IC4 B;  3WIU A;  4C0H A;  1D1U A;  1RA6 A;  3AOC A;  2CPF A;  1CQM A;  2GZO A;  3W2W A;  2O5D A;  1RTD A;  4W92 B;  3R5D A;  3V6D B;  2MEW A;  3F0N A;  3HKW A;  4K0K F;  3H90 A;  5ETS A;  4W90 B;  4J9U E;  3RBD A;  4V19 J;  2POK A;  1KTQ A;  5JVH Q;  3H0P A;  1RT1 A;  2C2D A;  3HT3 A;  3TEH B;  4J5O A;  4KO0 A;  1RDR A;  1U0S A;  3C8Y A;  3MPD A;  2EXU A;  1KHW A;  3DLE B;  3M32 B;  1GFW B;  4J9L A;  1S6U A;  4DV4 J;  3AD8 C;  1M5H A;  1FKA F;  2QIF A;  3OJS A;  4MYT A;  3NKY A;  3SCI E;  2FB0 A;  2EFN A;  5DO2 A;  3MM6 A;  2UXB J;  4FDF A;  2B9E A;  3THT A;  1T05 A;  2W01 A;  4FF3 A;  2XMA A;  1QY7 A;  2GIF A;  1RBL A;  1H3D A;  1YBT A;  4LRD A;  4F4A A;  2AEF A;  4B9T A;  3GPA A;  2L3M A;  2YKP A;  2WB4 A;  1NH7 A;  3HKZ D;  4L73 A;  3LO3 A;  1NPR A;  2G1H A;  3ONQ A;  4LRA A;  1BQX A;  2Q3P A;  4KYZ A;  4ANC A;  1RBO B;  1WF1 A;  1PIL A;  2I1R A;  2MKH A;  3BZQ A;  3G87 A;  4FXV A;  4G1Q A;  3SSQ A;  4BHQ A;  1FJ7 A;  1E6Y B;  3PYD A;  4JB8 B;  3H20 A;  4DL0 C;  3SIP B;  1RT1 B;  2DRA A;  1U25 A;  4O3N A;  3T1H J;  2ABY A;  2H5E A;  4I7F B;  1PC5 A;  4GKJ F;  1NO8 A;  1Q8I A;  2BKO A;  4A8K A;  2UVV A;  4DFP A;  1HNX F;  1HPZ B;  1WEX A;  4ALZ A;  2P9C A;  4KGX B;  2DKO B;  2VG5 A;  3MUM P;  1GEH A;  4LFB J;  2RF2 B;  2YKN B;  1FKP A;  3A12 A;  1HIY A;  3GTY X;  4NLW A;  5H9E K;  2R8K A;  4OX7 A;  4ELV A;  4LFA F;  2ILZ A;  2GAH C;  2GMJ A;  1JJC B;  3PW7 A;  1U1K A;  1KRP A;  3EM1 A;  4OHX A;  1IBK J;  2N3O A;  1AFI A;  4DUY F;  4DR1 J;  1NSP A;  1X7V A;  4LF1 A;  5D0R A;  5F41 A;  4YY3 J;  2W9C A;  4X84 A;  4NXM F;  4LT6 A;  5HBM A;  2QYC A;  4DV7 F;  3UN3 A;  5HBM B;  4QZV B;  1FXL A;  4ED1 A;  3QT8 A;  1HD1 A;  5CZX A;  3VGS A;  2AGP A;  5E5N A;  1GX6 A;  2JLF A;  1JMT A;  2FVC A;  2YNI A;  1M5S A;  1YG0 A;  4PAA A;  1V6H A;  2ZOF A;  1Y11 A;  4RWX A;  4UZC A;  3OSN A;  1YGY A;  5FD1 A;  1S4E A;  3PG9 A;  4C2M A;  2UUB J;  5HP1 A;  4TYA A;  2WVD A;  3ZO7 A;  5DQG A;  5M2P A;  3BV8 A;  3LP0 B;  1FNO A;  1FXD A;  1GTE A;  3Q8U A;  4ZCI A;  1HBM A;  4DLE A;  1HNV B;  2BAC A;  1JKH A;  1NJW A;  2RF2 A;  3BM7 A;  1GMW D;  3MMB B;  3CUN A;  1RWW B;  1Y4Z B;  3OFF A;  4IH5 A;  5C24 A;  2QA4 S;  5D4P A;  1ACM B;  2J9D A;  2KXN B;  1S59 A;  1SJ3 P;  3H2L A;  2XCA A;  4RLE A;  4LF8 F;  4UOC A;  3LAK A;  6AT1 B;  3HSZ A;  1OO0 B;  4AXI A;  4F04 B;  3KLF B;  3QWU A;  2DNG A;  4OHW A;  2WW8 A;  3CMA S;  1LXJ A;  1HBO B;  1Y7P A;  1NND A;  2B6A A;  4NLV A;  3MMC B;  4UW2 A;  3Q2T C;  3W3S A;  3FQL A;  2OPR A;  5ETL A;  2DO4 A;  2CQ3 A;  1NJZ A;  3AD7 C;  2VPW B;  4OI0 A;  2L41 A;  4X4U A;  1RLC L;  2PT0 A;  2Y1L B;  1NKB A;  4H54 A;  2PO4 A;  4U9R A;  5KG5 A;  4USH A;  1RAA B;  3PJ9 A;  1OWX A;  1VRU A;  3D1O A;  1SUQ B;  1S0O A;  2LVW A;  4YQW A;  2DNZ A;  2KM8 C;  4KKO A;  5HAT A;  2NCK L;  1RWP B;  4NLX A;  4GVB B;  3OTE A;  1YIT S;  1VBY A;  4DR3 F;  2WVC A;  4MFB B;  1J5E F;  1T05 B;  1JXE A;  2RML A;  4USV A;  3EPI A;  4LVO P;  4ZN3 A;  2OTL S;  3Q8V A;  4HEA 9;  4WK3 A;  2GML A;  3QIP A;  4Q2L A;  3GYN A;  5F3T A;  1T95 A;  3MED B;  3RR8 A;  1JLC B;  2OSR A;  5EUH A;  1F2G A;  2DHA A;  7FD1 A;  2XMT A;  1VQY A;  4DV6 J;  1UWA A;  1WC1 A;  4KTQ A;  1VI7 A;  1TVR B;  1B64 A;  2BE2 A;  1FX4 A;  5AXK A;  4RUH A;  5GAD I;  2C1E B;  1PKU A;  5HP1 B;  2ZWO A;  1IKW B;  3LH2 S;  4O4G B;  1IR2 A;  5HMZ A;  5AJ3 J;  3R1L A;  1IKW A;  1WEL A;  1JLG B;  1WG1 A;  4DG1 B;  3CDA A;  3TX0 A;  4DF8 A;  4G6V B;  1N33 F;  8ATC B;  2Z58 B;  4EK2 A;  4LF6 F;  3KNA A;  2BJ7 A;  4ZLL A;  5K8M A;  3QID A;  4IOA Q;  4L74 A;  4DLG A;  5L8R C;  4HR2 A;  1BD6 A;  3DGP A;  3ELH A;  2DH8 A;  4HT7 A;  4M5H A;  2VOP A;  4UUX A;  4I2P A;  4JI4 F;  1LK7 A;  4XO0 A;  2RB7 A;  3PEH A;  4QIE A;  1LW2 B;  4IFV B;  5CYQ A;  2IVF B;  3G96 A;  4NML A;  2DHS A;  2HK2 A;  3C15 A;  4KFB B;  4DV0 F;  4DR1 F;  1KLN A;  2F4V J;  1JLB B;  1KVI A;  4KBI A;  4NI2 B;  2ZWP A;  3V81 B;  1UKU A;  2OEJ A;  4EZ6 A;  1PYO B;  1S1W B;  4P2S A;  3MM9 B;  3KK3 B;  2XWY A;  1FTR A;  1LXN A;  3PAC A;  4USU A;  2KFN A;  3EE3 A;  3MPV A;  2OPS B;  5D4O A;  5AT1 B;  3EIC A;  1AZS B;  4A8W A;  4P72 A;  4IOC Q;  4DL4 A;  2HHX A;  2ZBP A;  2DHG A;  3NS7 B;  5KFP A;  1Q8K A;  4DX7 A;  1YK9 A;  2R9L A;  3IR6 B;  5LMN J;  3RRG A;  5AXN A;  3D2W A;  3HPO A;  2B7C B;  3JYT A;  1GXT A;  2VV5 A;  4YP3 A;  5DJB A;  1SL2 A;  5IT9 Y;  3W62 A;  1G7C B;  3LP2 B;  4PG6 A;  2ZD1 B;  1Q81 T;  4DUT A;  5K8P A;  1HD0 A;  4LFC J;  1V3Z A;  3RYL A;  2YWE A;  4RW7 A;  2JZ5 A;  1X4G A;  3HZE A;  4WFX A;  2KYX A;  4R0E A;  3T6J A;  2B4U A;  4JBC A;  4DR5 J;  3IG1 A;  1UZH A;  4UOH A;  4LSN A;  2XZT B;  4FNH A;  4OHV A;  3IN5 A;  1H0H B;  1UCN A;  3T19 A;  3QGP A;  3HK2 A;  3GV5 B;  2J9C A;  1X8D A;  3G4S S;  3CCM S;  2BW2 A;  3UDV A;  3MAQ A;  3W63 A;  2HVE A;  3NOG A;  3ZZZ A;  2X1F A;  4OHY A;  2RRB A;  1AUD A;  1LV5 A;  2KRB A;  2KTQ A;  4YB5 A;  1FWK A;  2ZVS A;  5JUM A;  4N5S A;  2MQL A;  2WBR A;  2ZE2 A;  5F8I A;  4K4Y A;  2M8D B;  4PPZ A;  3M6V A;  4OLO A;  3I56 S;  3NRB A;  4DL6 A;  4C3L A;  1M5K C;  2IM0 A;  3GB0 A;  1F9F A;  1OY6 A;  1C0T B;  4L75 A;  2HFZ A;  4HT5 A;  3FMB A;  2RHQ B;  5FLX U;  5IZH A;  4CO3 A;  2XCP A;  3CJ5 A;  3GJS B;  2HKE A;  2B8P A;  2W25 A;  4C8N A;  3NMA A;  4K0K J;  5FLX Y;  3QT7 A;  4O44 A;  5K14 A;  1DAR A;  1EQM A;  3GLJ A;  3V4M A;  1VQ4 S;  3M2R A;  2YBV A;  3TP2 A;  3OXL A;  3QZ7 A;  4DHV A;  1WKJ A;  3CCR S;  2VDH A;  4DV1 F;  2OIH A;  2CKW A;  5LSO A;  1VDH A;  2UXD F;  2FVS A;  4N8O A;  1UEK A;  5KOX A;  4DL3 A;  2MZS A;  2YKM B;  2Y1R I;  2PA3 A;  2KU7 A;  1XN9 A;  3DLJ A;  3I5C A;  5RUB A;  3PTW A;  3UDL A;  3VAH A;  4J9K A;  3R5J B;  4C8K A;  4NOH A;  1BGX T;  1TL1 A;  4U8Y A;  4DR2 J;  4ER8 A;  1NB7 A;  1RWX B;  3CGI A;  3VAF A;  4NE9 C;  4HTJ A;  2UV8 A;  2CAD A;  1VIS A;  3BR8 A;  2C42 A;  1T9V A;  3PRD A;  4Y34 A;  4ZVS B;  2A0F B;  3MHY A;  4ICL B;  2OEK A;  4W4M A;  4RU9 A;  4LR9 A;  2W9A A;  2J0W A;  4C11 B;  2DIT A;  4ED2 A;  1RAC B;  1LW0 B;  1RWO B;  2BJ1 A;  3PR4 A;  1YRT A;  4Q0B B;  4PUO B;  1HYS A;  5KFS A;  5A76 A;  1RJJ A;  3M30 B;  3FJ2 A;  4X62 J;  2D9P A;  2XLJ A;  4B08 A;  4ED4 A;  1VQ5 S;  1EQ0 A;  1N88 A;  2L9W A;  1QUP A;  2IM1 A;  5LM7 E;  5D78 A;  3KHG A;  2VBY A;  4PQA A;  3LPE A;  2QE5 A;  3SFG A;  2K2P A;  3KG4 A;  4P2M A;  5ETQ A;  2HS3 A;  3N5F A;  1T03 B;  1MW7 A;  2UVW A;  3RU0 A;  1HHS A;  3P4U B;  5M2U A;  1U4B A;  2DIV A;  5HK4 A;  1CS4 B;  3D9B A;  1I94 J;  4XK8 C;  5IT0 A;  2OUG A;  2J9D E;  3I0S B;  3PW5 A;  3UCZ P;  4N47 A;  3I5B A;  4CYU B;  4P10 A;  1SKW A;  3UE2 A;  4BC9 A;  2J7K A;  1CQN A;  2GA7 A;  5B09 A;  4DV7 J;  2UUB F;  1KVJ A;  4DS4 A;  1FWP A;  3C6U B;  5CH7 B;  4DZ6 A;  1SH3 A;  2DD8 S;  2NUU G;  2RQK A;  2DR9 A;  4L3K A;  3U7J A;  2XSF A;  2V8G A;  4CLF A;  1AA1 B;  3OR2 B;  1S0N A;  2HHU A;  1GXL A;  1NKE A;  3O1L A;  3EMT A;  3WHI A;  1F6T A;  2M70 A;  1VGY A;  3AQO A;  3CE8 A;  1WEY A;  3W5X A;  5B0C A;  1S1V B;  2M7S A;  4XDC A;  1MWY A;  1C0U A;  3THP A;  3GJT B;  1OSC A;  3DLE A;  1PIE A;  2F8E X;  3GIR A;  2DCU B;  2D3O R;  1U1L A;  4RX6 A;  5HO4 A;  1U1O A;  2MB0 B;  4RW9 B;  2EFG A;  3N5B A;  3DI6 A;  5DRK A;  1F9H A;  4CP5 A;  3EWG A;  3KFW X;  3ZC4 A;  3TOQ A;  4PEO A;  2HMI A;  1U1Q A;  1H2T Z;  1GT8 A;  3CPW R;  4RBT A;  4H4K C;  1DTT A;  1JJ4 A;  5E2Q A;  2Y0S D;  2DRB A;  1KVK A;  4FF1 A;  3PZP A;  2VAS A;  3MCO A;  5LSR A;  4X4O A;  2UUA J;  2BE9 B;  3FBE A;  3I0R A;  3L7O A;  3OD2 A;  4F0H A;  2GVZ A;  2BBE A;  2VPX B;  3LOU A;  2MQP A;  2Q79 A;  4ZP7 A;  3IC1 A;  3TQE A;  2GCF A;  4HDG A;  5EWE A;  1KOH A;  4DV5 J;  4F8R A;  4KPY A;  1JLF B;  1RBA A;  4LJM A;  4YDD B;  3CJT A;  4LRF A;  3J7A N;  3Q8Q B;  3AQP A;  4KIA A;  4RW8 A;  3VWS A;  4AND A;  5HMX A;  1HNX J;  4CM0 A;  4DPY A;  4OX9 J;  3Q86 A;  4RWW A;  3PRV A;  4ED8 A;  1RHQ B;  1S6P A;  4DSE A;  4R5P B;  3I31 A;  4I7F A;  4LR7 A;  5DLF A;  2QFI A;  3UQS A;  5I3Q A;  3QZ8 A;  1JIH A;  3RAX A;  4ELT A;  2RUS A;  4A8F A;  4O3S A;  3T1Y J;  3IAM 9;  2QC3 A;  4JI7 F;  2LU1 A;  1C2P A;  1FE4 A;  1LQ9 A;  2EG1 A;  2FJA B;  2YWH A;  3JTO A;  4WP3 A;  2BQ3 A;  1SUQ A;  3P3D A;  2MGZ B;  3S8S A;  3CUL A;  2FLL A;  1P9Q C;  1RSC A;  2E1A A;  3PJX A;  3TO8 A;  1KQK A;  3BQ2 A;  1ZAX A;  4OZL A;  2C2K B;  2IRU A;  3DRR B;  4PG7 A;  2BDP A;  3NGS A;  4KJI A;  1IQT A;  2ZBI A;  4FYX B;  1VC0 A;  2Z2L A;  4DWI A;  3C6U A;  2VKZ G;  3SZ2 A;  3D66 A;  1RE1 B;  2JWN A;  3NAH A;  4IYQ A;  1N5Y A;  1D9F A;  4DSL A;  1SV5 B;  2MLY A;  1FDB A;  3BSO A;  5IT4 A;  1R0A B;  4YS2 A;  4FVM A;  1NK9 A;  3OVS A;  1ZA1 B;  1Y00 A;  4I64 A;  4P2F A;  5ADZ A;  5E3R A;  3U1L A;  4J9R A;  2BM0 A;  3A8E A;  1LWC A;  3D5M A;  3NCR A;  5L9N A;  4DSJ A;  4KV8 A;  3TZW A;  1FK9 A;  2CAJ A;  4QYZ J;  2BQU A;  4JI5 F;  2UUC J;  1SC4 B;  2GHP A;  3SSR A;  1VCT A;  3IWL A;  1NKC A;  1HLW A;  3P5B P;  1B7Y B;  5A6P A;  3KLI A;  1NAQ A;  2OO4 A;  3FCV A;  4M8L A;  3K5N A;  1JKH B;  3CCV S;  3T5J A;  2AU0 A;  4IRD A;  1QTN B;  4A8S A;  2F8H A;  2HQF A;  5J2Q A;  2E29 A;  2Z2Y B;  2FC9 A;  2MZJ A;  1URR A;  3VQS A;  3ZXW A;  5L9X A;  2EC2 A;  1XNR J;  1S76 D;  2UV8 G;  4CTA A;  3R7S B;  1RT7 B;  5A8W A;  1R31 A;  4X65 F;  2HGM A;  2M5Y A;  3RG6 A;  3V4I A;  1CJK B;  2WVB A;  4E98 A;  2VJU A;  4JV1 A;  3OLA A;  4OI3 A;  1JLF A;  1RHM B;  2OPP A;  4DS5 A;  3D3B J;  1B99 A;  4RPF A;  4ZPT R;  1NLK L;  2AD9 A;  3OBI A;  4PQU A;  5KG3 A;  5KG7 A;  2F7V A;  2JC0 A;  4LF9 J;  4TXS A;  3R2C J;  1S6P B;  1AZS A;  1FKO A;  2DY9 A;  3AJ2 A;  2UXC F;  3R5A A;  1DZ5 A;  4NCG B;  1WUU A;  2E7X A;  2G1D A;  3VV2 B;  2QZ8 A;  1KSP A;  2R8J A;  3QJJ A;  1RWK B;  1SJQ A;  4RO0 A;  4ZA1 A;  3SCK E;  4F26 A;  4PWD B;  3QJP A;  2OFH X;  4AQY J;  4NX9 A;  1XJW B;  2DNP A;  3Q8R B;  3KXD A;  3EX7 B;  1CLF A;  4CLK A;  4IG3 B;  2BJ3 A;  2HS4 A;  2NXE A;  2RE1 A;  3L9Z A;  3PDN A;  3UWT A;  2NQP A;  2P6S A;  4CLP A;  3MM7 A;  1VC6 A;  2WSC C;  5K5M A;  2YQ1 A;  1N33 J;  1BQM A;  4M5K A;  2XC9 A;  4RZR A;  1VLY A;  2OEL A;  4CO2 A;  1QVG R;  2YVS A;  1IKY A;  3W5Z A;  4FPI A;  2R8G A;  4LF4 J;  1EAY C;  3PW2 A;  4D3H A;  1F3F A;  5KG2 A;  4J90 A;  1U1R A;  2IM2 A;  1D8Y A;  4JI1 F;  4KT0 C;  1S1U A;  1FCA A;  4L3N A;  1N34 F;  3OL8 A;  1S5Z A;  2YKA A;  3M9O B;  4HI2 A;  3VAM A;  3DC2 A;  4ATN A;  2OH2 A;  4JI4 J;  1DTQ B;  1WI6 A;  5C25 A;  3KHL A;  3BDP A;  2IRY A;  3OT9 A;  1LWC B;  2KFY A;  2M8H A;  5KG0 A;  2KRR A;  4N77 A;  4JI3 J;  1XWL A;  3CO0 P;  2JJ4 D;  2HQI A;  1IKX B;  2DHH A;  3ZZY A;  2JEJ A;  5D77 A;  5E3P A;  2BJ9 A;  4LR8 A;  3CT9 A;  2XG8 A;  1LK5 A;  3I4H X;  4OV1 A;  2HZC A;  3M8P A;  2QLJ B;  4ZVF A;  3T5H A;  3OVB A;  3CD6 S;  3MOJ B;  1L3U A;  5J2M B;  2VOD A;  1ZM4 A;  1PCA A;  4BWM A;  2M52 A;  1Y9O A;  3CJ2 A;  3ETM A;  3TVY A;  3QMQ A;  5JJB A;  3H4D A;  4Z7Y A;  3MM5 A;  2BXJ A;  2A3J A;  2DNR A;  1BHN A;  5MAO A;  1BC6 A;  2Y3Y A;  3KDN A;  4RJV A;  1TR0 A;  2DGU A;  4K8R A;  4DQP A;  1LKZ A;  2VBX A;  4DQR A;  2VA3 A;  1S1U B;  2CWX A;  4I2Q A;  5GMK a;  4LF5 J;  4DR5 F;  3C66 A;  1EKS A;  2LA6 A;  1WWH A;  3MM9 A;  3KK3 A;  3OTB A;  1S1W A;  4FS2 A;  2XNQ A;  5CAA A;  4USW A;  1K9M T;  2B4P A;  2KVI A;  4R8U A;  3ZZR A;  1WC0 A;  1P1L A;  4I67 A;  3J7A 1;  3BR9 A;  3U1N A;  4DEZ A;  1U26 A;  2DNK A;  2WVE A;  3CC7 S;  2HQD A;  2B0G A;  3PHT A;  3OTO F;  2BKP A;  3C16 B;  1NME B;  3HP6 A;  3NNH A;  4FYW B;  4X64 F;  5IT9 U;  1OQ6 A;  3P45 B;  1PBU A;  2ATC B;  4OZ5 A;  1TKZ A;  1S1T B;  5A2Q U;  3OUY A;  3FDS A;  1U48 A;  4PUO A;  1Y3J A;  4X4S A;  1YJV A;  4UQG A;  1WD6 A;  2O1P A;  1S77 D;  1T94 A;  2HFN A;  3KMQ A;  3MEE A;  2HIQ A;  4FS1 A;  1YJU A;  3HD2 A;  1S10 A;  2V5H G;  3WIV A;  4ZMM A;  1HW9 A;  1A0O B;  1X60 A;  2FGC A;  2DNM A;  4NA1 A;  1FJE B;  1KEK A;  3R6G B;  2HBR B;  4B9S A;  1CJV B;  1SBR A;  1NK6 A;  4QIW D;  3BKU A;  4FYD A;  4FBT A;  2J6S A;  3M8Y A;  1UVL A;  3I0R B;  3K89 A;  4OYO A;  3CJK A;  3T9N A;  2E9Z A;  2AJF E;  2JLE A;  3KJF B;  1TL3 A;  2Y9H A;  3QLH B;  4KGZ B;  2A6O A;  4O3R A;  3TVK A;  1Q4R A;  3GYX B;  4BC7 A;  4DUZ J;  2KL8 A;  4DMZ A;  3KHR A;  4TLR A;  5B0E A;  2B56 A;  2YQ3 A;  1MWQ A;  5DZ6 A;  4FXW A;  4MK9 A;  1VQM S;  4CRJ A;  3CME S;  2QL9 B;  1KON A;  4Y2I A;  3OUY B;  2RSQ A;  4H4O B;  1VQP S;  5LXY A;  3CSK A;  3J80 U;  1T9U A;  1EX8 A;  2CQ2 A;  3CW2 C;  2CRL A;  3MEE B;  3NGR A;  2EFO A;  2UUA F;  2CJY B;  3CED A;  5D6G A;  1R43 A;  5LMN F;  1IQZ A;  4AL5 A;  3CJQ A;  2NPF A;  3H5U A;  4C8L A;  4USI A;  4QBU A;  5BYS A;  3SI8 A;  1E6V B;  1RA7 A;  4LFC F;  4RNO A;  2C2N A;  5HVH A;  2LEA A;  3RBE A;  1TUV A;  2QG9 B;  4P74 A;  4P9S A;  2QA4 G;  3W66 A;  2I9S A;  1GXU A;  2J9E A;  3D6F B;  1YI2 S;  4R25 A;  3LW5 C;  1IBL F;  5DZ7 A;  1WJ9 A;  4CH7 A;  3RTV A;  1PO6 A;  5MLC V;  1RWV B;  1KOO A;  4V1A k;  2P8I A;  2E7W A;  1RAJ A;  3I9Z A;  4ZPW R;  1HBO A;  2PN6 A;  2CNL B;  2RIJ A;  4OX9 F;  4QYR A;  3RUB L;  4ENO A;  4ZKA A;  2KH9 A;  3KYL A;  3MEG A;  1U09 A;  3HX9 A;  2JFK A;  1PAU B;  2K7J A;  1A7G E;  1HBM B;  3BBB A;  3HXM A;  4WXO A;  2PDA A;  1EP4 A;  4RU2 A;  1KS2 A;  1EB0 A;  5DG9 A;  1T03 A;  2HNY B;  4UY8 T;  4OX8 A;  3CCJ S;  2HND B;  3LWL A;  2FTR A;  2YWK A;  4Q8E A;  2WB1 D;  3QGI A;  1RAB B;  1LEO A;  3N6N A;  4HVZ A;  3VGV A;  3FBC A;  3Q23 A;  2AGO A;  2EKY A;  3CWJ A;  3IGN A;  4A47 A;  1SPB P;  1I5O B;  1YBA A;  2XS5 A;  4QU7 A;  1FEH A;  5I3U A;  4DV3 F;  2HVI A;  4NA2 A;  2RS2 A;  2CDQ A;  4YB6 A;  3I55 S;  5U47 A;  3KUG A;  2JDJ A;  2R2U A;  1MSW D;  5HVG A;  3ITH B;  2OP5 A;  1D9D A;  2IA0 A;  1M90 T;  2JVO A;  1RTD B;  4DX8 H;  5DQH A;  2BRK A;  4RW8 B;  3QAT A;  4EUV A;  1QJH A;  3CJR A;  3MCN A;  3ZZP A;  4WYL A;  5L1K A;  4NPO A;  2A6M A;  2FGO A;  3HHL B;  3M8Q B;  4WTO B;  3BGR B;  2CQB A;  2ZH1 A;  3SV4 A;  3HHL A;  2DYA A;  4ILR A;  1S57 A;  2QT7 A;  1GMV A;  3M1V A;  4J37 A;  3N0V A;  2C3M A;  2QLF B;  3HJV A;  4F7V A;  2OI2 A;  1HNI A;  3TUJ C;  3BB5 A;  1B7F A;  3IBW A;  1JLG A;  2C3P A;  4ID8 A;  2NYI A;  3DDN A;  3QT6 A;  4I68 A;  4OZN A;  1HPZ A;  1RHR B;  4BCA A;  2AX1 A;  2MQM A;  4C9D A;  4M5I A;  1DY3 A;  5LJ3 Y;  4Q44 A;  1Q8L A;  2VG6 B;  5ETM A;  3UVJ B;  1KFS A;  2KHC A;  4JV5 F;  3HVT A;  2AKW B;  2IVM A;  1FRH A;  3BEG B;  4O4R A;  3T1Y F;  3K2Y A;  2VKR A;  5A6W A;  3EZ5 A;  3ZZU A;  1Y5L B;  3CDW A;  4XDD A;  1U1N A;  2R7X A;  1CJK A;  4OIX A;  1URN A;  3QIP B;  3TZZ A;  2GJI A;  2IYG A;  4M95 A;  2QYG A;  3KLF A;  1SCJ B;  1CPZ A;  3T5L A;  3A8I A;  2QV6 A;  5CD4 A;  2HW3 A;  1UVN A;  3G82 B;  1DQ8 A;  1TEL A;  1WOP A;  3GSI A;  4DPO A;  1EET A;  4RUA A;  2ZH9 A;  5FJ4 A;  2Q6B A;  2VC1 A;  4ILM A;  1NZ8 A;  1RLD A;  1S6Q A;  2ASD A;  4ZCK A;  1FER A;  4DV2 F;  1QE1 B;  4B3T F;  1QUV A;  1NU4 A;  5LT5 A;  5KFN A;  1HWK A;  1U49 A;  3QJL A;  5D8H B;  1M5P C;  1H2U X;  3ADA C;  2NXJ A;  4KV8 B;  4ED5 A;  1RIS A;  2FY8 A;  4K7Q A;  1WI8 A;  3W8P A;  5KFQ A;  4KHP F;  1N56 A;  4LIR A;  1TUG B;  2Y8W A;  3IWX A;  5L38 A;  3OXF A;  2KZZ A;  1VQS A;  3A4T A;  2QSW A;  4W98 A;  2AJ4 A;  3ULH A;  3HM9 A;  3PEJ A;  2W24 A;  4GC7 A;  1IBM F;  3QRP A;  1TKD A;  2VQE J;  3H2U B;  4NLQ A;  4PYA A;  2WOM B;  3WQP A; 
#chains in the Genus database with same CATH homology
 2DKO B;  2CJY B;  4DCP B;  1RWK B;  2C2M B;  2CJX B;  3D6H B;  1PYO B;  5K20 B;  4LSZ B;  1SC3 B;  3GJT B;  1SC1 B;  2XYH B;  3D6F B;  3NS7 B;  3EDQ B;  1F9E B;  3R7N B;  3GJQ B;  1RWV B;  2QLB B;  1QDU B;  2CNL B;  3R6L B;  2HBY B;  2XYP B;  2C2Z B;  2XZT B;  4DCJ B;  1PAU B;  2H65 B;  1ICE B;  2H5J B;  1RWW B;  3KJQ B;  1RHQ B;  2QLJ B;  4ZVR B;  1RHJ B;  2XYG B;  3QNW B;  4ZVQ B;  1RWM B;  3IBF B;  5IC6 B;  2CDR B;  2H4Y B;  3R7B B;  4ZVO B;  2H48 B;  2H4W B;  3GJS B;  2H5I B;  3GJR B;  1RHK B;  2C2K B;  3IBC B;  1I51 B;  1IBC B;  2Y1L B;  3EDR B;  2QLF B;  4ZVP B;  5IC4 B;  1RE1 B;  1RHR B;  1NME B;  3P45 B;  1RWP B;  2C2O B;  3R5J B;  1BMQ B;  2CNK B;  1RWX B;  1GFW B;  2CNN B;  2HBQ B;  1SC4 B;  4ZVS B;  2P2C B;  1RWN B;  2H51 B;  3R6G B;  2HBR B;  1RWO B;  2Y0B B;  4ZVU B;  1QTN B;  1I3O B;  2C1E B;  3KJF B;  3R7S B;  2QL7 B;  2QL5 B;  1RHU B;  3P4U B;  1RHM B;  2H54 B;  4JB8 B;  2QL9 B;  4ZVT B;  3SIP B;  4DCO B;  2CNO B;  2XZD B;  3D6M B;  2FQQ B;  2HBZ B;  3RJM B;  3KJN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...