3GJRB

Caspase-3 binds diverse p4 residues in peptides
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
92
structure length
92
Chain Sequence
KIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Caspase-3 binds diverse P4 residues in peptides as revealed by crystallography and structural modeling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords Caspase-3 subunit p17
total genus 19
structure length 92
sequence length 92
chains with identical sequence D
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2009-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 3gjrB00
1RHMB 2CJYB 2C2OB 3P4UB 1PAUB 1SC4B 5IC6B 2H5JB 4ZVOB 5K20B 3GJRB 3EDQB 2H5IB 1IBCB 3EDRB 3NS7B 1I51B 1RHKB 1QDUB 2C2MB 2C2ZB 4ZVTB 3R7BB 1BMQB 1NMEB 2C1EB 3KJQB 1RWKB 4DCJB 1RWVB 1SC1B 2QLJB 2H65B 5IC4B 2CJXB 2H4YB 2H48B 1RHRB 4LSZB 1SC3B 1QTNB 4ZVUB 3R7SB 2H51B 1RHQB 2HBZB 4ZVPB 2QL7B 2CNNB 2CNKB 2H4WB 2HBYB 2CDRB 3KJFB 4JB8B 2HBQB 2QL5B 3R5JB 2Y0BB 3RJMB 2CNOB 1RE1B 1RWNB 3IBFB 1RHJB 3GJQB 1RWWB 4ZVQB 2QLFB 2HBRB 1RWMB 4DCOB 2QLBB 2XYHB 3D6FB 3GJTB 4ZVSB 2QL9B 1RWOB 1RHUB 3IBCB 3SIPB 1F9EB 2C2KB 2P2CB 1ICEB 1I3OB 3QNWB 4DCPB 2DKOB 2CNLB 2XZTB 2H54B 1RWXB 1RWPB 3D6MB 3R6GB 2XYGB 3GJSB 2FQQB 4ZVRB 3R6LB 3D6HB 2XZDB 2Y1LB 2XYPB 3R7NB 3KJNB 1PYOB 3P45B 1GFWB
chains in the Genus database with same CATH superfamily
1IJEB 2B5JA 3QWUA 4EBDA 4C8YA 3DHXA 1FWLA 4E98A 1P9QC 1RAIB 1SC4B 2PC6A 3DM2A 4NE9C 2L41A 4DLEA 2CQHA 4OYMA 5HVFA 5B7WA 1L5UA 4Y2MA 1S99A 3A4TA 5JVHQ 4FYDA 2JVRA 1NDPA 3C19A 1VCTA 3HSGA 4TLRA 4URSA 3J81j 1IBLF 4FF2A 2Z2YB 4F36A 1DQ9A 3A8EA 3D1HA 3NS6A 3R27A 3UVJA 2YNHA 3S8SA 2GAGC 4OZ0A 4CIOA 5HLFA 1GXTA 3CF5Q 2KRBA 3VQSA 4UTGA 5IFMA 4OX8A 5H9EJ 3FBEA 4H4KC 1PILA 2V2VA 1DBDA 1MROA 2WVDA 5ADZA 3IAS9 5I42A 2JEGA 1JLBB 4ZLPA 2R8IA 2GGPB 3KMQA 1JWWA 2VQFF 4DLGA 3NOGA 2HIYA 3RAXA 5KOXA 3ZTPA 2CJKA 2ACYA 4LSNB 2VFRA 2KL8A 4FYYB 1S1XB 1EIYB 2FC9A 2DH9A 1CJKB 1WTFA 1HBMB 2CQPA 4GMKA 2FVPA 4FKXA 1KP6A 3DC2A 2COLA 5KFUA 5ETVA 1YZ6A 3N4WA 4C3KA 4C6AA 4DPTA 5IS2A 4ZPTR 4DPYA 2DNHA 4WK1A 5IT9U 2EFNA 2ROPA 3DMJB 3V6HA 1HNXJ 1TMJA 3RAMA 2EG1A 4BWJA 3SQOP 4U95A 2DT9A 2YTCA 5IT9Y 3BSNA 2KJWA 3ZC4A 5KFKA 4NLGA 2YKNB 1VK8A 2IY5B 4YS2A 4ECWA 1KLMB 1TAQA 3CJQA 1MLAA 2AX1A 2OPSA 3P96A 2RDIA 4TY8B 5IOLA 3ETMA 4BLGA 1U1KA 2PE8A 1VC6A 2I1RA 4LF1A 1JB0C 1JKHB 3S01A 5C42A 3NAHA 3HP6A 4I0WA 5ETKA 3V4MA 5LSRA 4WP3A 2HGMA 3ADAC 1GTHA 3GCWP 3Q8SB 2MQPA 4DV1J 3RB0A 1L3SA 3W5ZA 5ETLA 1VLYA 2QFIA 3FZBA 3KLVA 1Z2ZA 4QCLA 2JFKA 5GAGI 2CWKA 5THWA 2BMBA 3TJAA 4W90B 2PGCA 1M5VC 2LU2A 3KUEA 2HSEB 2OPRA 1LFPA 1IBMF 1DTTA 4NRUA 1SL0A 1N32J 2IM0A 3TVKA 1X31C 1YJUA 2BJ3A 1RWWB 2KXHA 2RRBA 5CCMA 2RQCA 1D9AA 1JJ2R 2BANB 2HBRB 2LA4A 1FWPA 1WHVA 4HI2A 1XK8A 4C8KA 2CXEA 4YOEA 2IVYA 4A8XA 3T1AA 4CZCA 1FRJA 1URNA 3D67A 4RBTA 1C2PA 1JNRB 3QGGA 3RB3A 3PYGA 3PRDA 4QPXA 1H74A 2DJWA 3PHTA 1BHNA 1C1BB 3DXSX 1RB0A 3OJUA 1CJUB 1RHUB 3MM7A 5KT2A 4YR3A 2AGPA 1JLEB 3MOZA 3D3CJ 1WDTA 3E3XA 4O4GB 5L1KA 4WZQA 3GYNA 3N0VA 5ETPA 5C2CA 3AJ2A 4IFVA 4NRTA 4ED2A 1RWXB 4K0KJ 2WB1D 2DR5A 2PMZD 1X4GA 1BQNB 1EAYC 2B6AB 1S1VA 1TQLA 4C0OC 2VHGA 2NUUG 4I2PA 4X62J 3MPUB 4C11A 1S10A 3PEHA 1HR0F 1FT8A 1P1TA 1Q4RA 5KG7A 5FJ4A 2ROEA 2CZ9A 3ZTQA 2QN6B 1JXEA 2QRRA 3KWMA 4LSNA 1HWIA 3IFEA 5A8KA 3OR2B 1X5SA 4UOCA 4DMZA 3OHBA 4GKJJ 2ZHAA 1MNEA 3M6XA 2GGPA 4DV2F 4O23A 4EO6A 4RJVA 4Y2IA 1XC9A 2WW8A 3IWLA 3EDQB 4DV4F 2NPIA 5J1EA 5BYSA 5I3UB 2QZ8A 2VICA 4Z2XA 2Q6BA 2ATLA 2AYGA 4LFCJ 1UWAA 2PO4A 2BQ3A 5DJBA 4QWEA 3CNQP 2ZUAA 1WG1A 9ATCB 5KFXA 3CCWA 2VC1A 4CT8A 2VB6A 3EMTA 1K47A 3ENAA 4HHHA 4Q0BA 2AIRB 2EG2A 4L74A 3IR7B 2XWXA 2BACA 1U2RA 3OSNA 2XBPA 2OPQB 3CJTA 3M8PA 2J0SD 2HVIA 3HT0A 4FXVA 1N48A 2UXBJ 4DUYF 3D0HE 3BSOA 2VL1A 1RKIA 4WTOB 4PZVA 2E44A 2V5HG 3MMCA 5C7PA 1VQ6S 5H9FK 1DY3A 2C3OA 2BRKA 2EFOA 4WFNQ 3J7YI 4CO1A 1LQ9A 4DCJB 5K8PA 2J7WA 4I6WA 3D2WA 1HPZB 1RAEB 2HRUA 3O2IA 4QZVB 4URQU 1FJ7A 2ZJRQ 1WSVA 1GMUA 4IH7A 2CJBA 2H48B 3GR0A 2FYXA 2ABYA 1DLOB 1FE4A 1H72C 1W2IA 3C6TB 2GFFA 3FQKA 4ZVUB 2R7RA 1MU2A 5IWAF 3BQ2A 2YWHA 2DNRA 5IQQA 2AF6A 3RRGA 3MCMA 2HHUA 1ZM4A 2W2PP 1U7LA 2E1RA 4H4MA 4PPDA 1VMBA 4Q44A 1K1QA 3HM9A 1LW2A 1DURA 2IYGA 4R8UA 1VGYA 4L72B 5CYJA 1RT2B 3QT7A 3NCRA 3NGSA 4Q7AA 4CYUB 1CJVB 1HW8A 2W24A 5KFRA 4RNFA 3H98A 3B6BA 2VG6A 2CKWA 3CJSA 3POTA 2HS3A 4JB8B 4B9LA 2Y0BB 2V4RA 5C25B 2FB0A 2LDIA 4WIQA 5HANA 2HVZA 2HMIA 3NAIA 2DCLA 2E5HA 1T0TV 4DV7F 1Y4ZB 4CO4A 5EWEA 3GJQB 1LKZA 2ZD1B 3ZXWA 2BVZA 4DU8A 1BGXT 2CVIA 2JHEA 2E66A 5D77A 1JLGB 3PR5B 3G82A 4WP8A 2DNMA 3VQTA 2RT3A 1GEHA 1R31A 2QLBB 3CDEA 2LQBA 4Y6IA 4YB5A 4CH7A 1HYSB 1N6QA 1UVNA 3RBXA 4E2FB 2FZCB 3I9V9 1TZ0A 4K4TA 5A8RA 4B3MJ 4EO8A 5LMUF 5AT1B 1WOSA 2V69A 5DDQC 1KD1T 2J76E 4KPCA 2I5JB 2IM3A 3CB4A 4TYAA 3W66A 1R6YA 1WEYA 4H54A 3CMES 3D3BJ 4KB7A 4DG1B 4USUA 3MEGB 3GIIA 4PYDA 4WJBA 1NSKL 4OZ2A 3FSYA 4DR3F 3H5XA 1TUVA 2P8IA 5KFEA 1RWPB 1U8WA 1Z1ZA 2EBEA 2IHR1 1OIAA 4YB7A 3T5KA 3HX9A 4KYZA 1KLMA 1RLDA 2DNZA 1FJCA 2W7PA 2KVIA 3C66A 5F8LA 1TVRB 5K9FA 4R5PB 3CJ3A 2HG4A 1NO8A 1XNQF 4N41A 1OQ3A 2NXUA 3CJKA 2XZDB 1HMVA 2Y1LB 3LUYA 2VOOA 1MWQA 1IKWB 1YZ7A 2P5VA 3Q8YA 3OHAA 1N32F 3UN3A 3K5NA 2I8EA 2E5LJ 2UU9F 3P4UB 2L3MA 1S6PA 2W7AA 4F04B 3N5FA 1FO1A 1IBMJ 4WU2A 2GJFA 3CW2C 3EZ5A 4PXDA 4CH0S 4DR6J 2ALYB 2VH7A 4QR0A 3PDNA 2CPEA 3R5GA 3VAFA 1X0PA 4WU3A 3IWXA 4JI1F 2Z8QA 4PWDB 1MWZA 1IBCB 1OMSA 4X66F 2IJNA 2YXLA 2J8SA 4DSIA 4C8LA 5IXUA 5BR8J 2C2MB 3PHEA 4ZPCA 2X1BA 1VRUB 4JI8F 5E0OA 1TL1A 3R3TA 2JEFA 1HBNB 3C6UB 3MM9B 1WKLA 3G87A 1FKAF 4PUOB 2PT0A 4P74A 3K5MA 4RNHA 1JIHA 2WZ1A 3MEKA 4P7TA 2JX2A 1TL7B 3LAMA 3PJWA 4ZVGA 4C2MA 3FEZA 2V8VA 2VFTA 2W01A 4HR2A 1B64A 1ZBTA 3GCXP 3OPKA 2MYFA 4KFBA 4NLDA 1YX2A 1RCOB 3KLEA 1AZSA 5G0RB 1K8AT 1HA1A 1X60A 2VC0A 4KV8A 2DRBA 3W65A 4RX6A 2WB4A 3BV8A 1M1GA 3WZ0A 2H3EB 5KG0A 4D3HA 3MM6B 1XMOJ 1M90T 2MJUA 1IKXA 4NCGB 3MXHP 1YTYA 5FDLB 3BO3A 3Q23A 3VF0B 4WFBQ 2M8DB 1IR0A 3A13A 5F9NA 2YNFB 4DPWA 3WC2A 1C4CA 5HI7A 5LL6d 3NGKA 2HQIA 2MDAA 3BH6B 1CS4B 4L73A 4OHXA 5HMYA 3VAGA 2W2NP 1Q82T 3C3LA 1EETA 2HBZB 2WRMA 5A8WB 2GS8A 5L9NA 2GNKA 3FK4A 4NLOA 2QL7B 1Y3JA 3KUGA 2XMUA 4AL5A 4DR5J 3EXCX 4EZ6A 4OHZA 4G3IA 2HHXA 2VBWA 5K8MA 1K0TA 1S7HA 4LF6J 2YH1A 2J9DE 3AOCA 4M5IA 3PJ9A 3AODA 5HVGA 3QZ7A 1JJHA 5DGBA 4DX6A 3M2UA 1S1TA 4LR9A 3IGNA 1F9HA 3FBFA 2DNQA 1HIYA 2E1MC 2CQGA 3HVAA 3M1VA 4J9MA 1QVFR 1KEKA 3KFWX 2VBYA 1NKCA 2VG5B 3VZHA 4J37A 2W8LA 3IC1A 4IRKA 1S1XA 2AYMA 2Y0SD 3ISNC 1S0OA 2ZEJA 1J27A 1KHWA 2DNNA 3ZZOA 4DCOB 4DU7A 4MK7A 1EZZB 4WPAA 5KFIA 3TO8A 4N8OA 3SCLE 4RNOA 2DHXA 4ES1A 3KLIB 4JI5F 4TU7A 4A46A 1LW2B 5LOQA 2YQ3A 4ECYA 2UUBJ 2NXEA 3NLCA 3QO9A 1FEEA 3GFXA 3C2PA 2X1FA 1U6FA 4NA2A 1CBKA 3W8PA 3CVKA 2R7WA 3Q8UA 4RKUC 2F4VJ 2ERRA 2XHWA 3PJXA 5HLFB 4CLYA 2CPDA 1YJTA 3R6GB 1YG0A 2DYAA 3W8GA 5EGYA 4X4QA 2UXBF 4X4NA 2JSXA 1R0AA 5T14A 2GMJA 3DKDA 3V2UC 1VQLS 4RW9B 4DQPA 4MYTA 2ADCA 1ROFA 2RH3A 3EM1A 2IC3A 2CQBA 2D69A 3K8WA 3ZTOA 2XULA 4J9LA 3SYZA 2G4BA 4F2RA 1FXRA 3ETOA 4XO0A 5J1EB 5I3UA 2D1CA 1GFWB 3Q2SC 4UUXA 1DZ5A 1NK5A 2CJYB 3FBBA 3LF0A 4GRSA 1NPPA 1NSAA 2JC1A 1S1WA 1FESA 2KN4A 2Y3YA 2H5JB 1SVDA 4YB6A 5F3TA 4QWBA 5HMWA 4LFCF 3A8KA 4C98A 1FNOA 1RXOB 3B82A 3CJ0A 5CYQA 2AJFE 4KHRA 4DV5J 3I0RB 2MB0B 1PG5B 1LXJA 1YBUA 3HHEA 2IBKA 1ZM3A 1JJCB 4DPUA 3OLBA 1TP7A 3JSMB 3CSKA 1F3VA 4KKOB 1RQ0A 3HHDA 2I5JA 3HZGA 1X4FA 4K4YA 1P1LA 2CG4A 2M88A 2E7XA 1B7FA 1OYDA 1GTEA 3MWBA 1D3WA 3CD5A 2KT5A 1M1HA 2RMLA 3D0GE 1BUXA 3GMGA 4NMXA 4EK2A 5CAAA 5I4MA 3W9IA 2VFSA 5GMKa 1HNVB 2ZH9A 1KHVA 4ENOA 2QGFB 1S77D 2QMXA 4UF4A 5H1SV 3F73A 3Q8VA 4YEAA 2J6UA 2AJ4A 2ZE2B 1KTVA 4XAKA 4DFMA 4ANEA 1L3VA 2LVWA 1BMQB 3PR4A 3VAHA 1HLWA 1Q81T 2C1EB 3PTWA 3OUYA 2FY8A 1HNWJ 3N5BA 3DNCA 1UVJA 3EZOA 3N28A 4U8YA 4L6V3 4LT6A 3BGRB 4C3MA 3E2EA 4ZLNA 2DIVA 1LK5A 1FHTA 4IKAA 5LXRA 2ZC3A 2M7SA 2J8AA 3CJKB 1FF2A 1WORA 4F0KA 1Q5YA 3L95X 4G1PA 3TWZA 5DDOC 1LFWA 3TVZA 4ID8A 1OPZA 2WVEA 3MR2A 1LWEB 4B3RF 2XSJA 2J6TA 3BYRA 1YWXA 4QBUA 3A1YG 3DOMA 1H2UX 4PG4A 3A12A 5ETSA 2FHOB 2ALZA 4LFAJ 4O44A 4X66J 1YGYA 1FK9A 3CPWR 3BBBA 2M70A 3TQEA 5BXIA 2PMWA 3DOLB 3HFZB 2JLEA 3M8QB 2N82B 3HFVA 2RD5C 3QGHA 4NLVA 3OVAA 2DD8S 4YDXA 1XMQJ 3H4DA 4UY8T 3CXCR 2KT2A 3OD2A 2ZKTA 4NCGA 3MFHA 3H5UA 3SDEB 1A9NB 1OSCA 4RUHA 1AUDA 2BV3A 2QL5B 3N6MA 4FF1A 1ZH5A 1LWCA 1P9YA 5KG2A 3I87A 4DZDA 2JOQA 4OZ1A 2I9SA 4QWAA 4U7UK 1G4CA 1AZSB 4ED6A 3LALA 5DQGA 3AAWB 1WSRA 4PQUB 2RAQA 2ZUGA 3D68A 3JQMA 5E7OB 4CO5A 4F4XA 1ZTWA 1TK8A 1VR6A 4F2SA 1UMJA 1XNQJ 2AYEA 1FDAA 2ZNYA 3ENWA 4HTIA 2CA9A 4J9QA 4J7CA 3K2YA 2DO4A 4U96A 1OPIA 1Z2LA 4ZVSB 2OH2A 3O44A 1FFSB 1VI7A 2AX0A 3TVYA 4ECXA 1VBYA 4DR4F 4RW6A 1RWOB 4CLKA 4C0BA 3RW7A 2BQUA 2CQ0A 3KLFA 2V50A 2K1RB 1N36J 3FVYA 1BC6A 1V5VA 3ONQA 4OI0A 1APSA 2CZ4A 4LF8J 1NK4A 3T5HA 1FVSA 3JB9k 1ZAXA 4PAAA 4HKQA 5KFYA 5AE3A 2BABA 2YNGB 4FNIA 1PBAA 2V8PA 4N5SA 2WVBA 4A8WA 4A4JA 1CULB 5EWFA 3BN7A 1F1BB 2KH9A 3QJJA 1KS2A 1HNIA 3GR1A 2FUG9 3JYTA 4IH5A 4B3RJ 2VJUA 4JV5J 5HP1B 1WC5A 4DJBA 3Q8RB 2FGCA 1QUPA 2MKCA 2NZ4A 5KT7A 3K58A 4YY3J 1VQKS 3GZ7A 1YRTA 1HMVB 3EX7B 2R2TA 2RS8A 4RNMA 4JI6J 4LREA 2MJNA 1XN9A 4R5PA 2CQ3A 2ZBQA 1FWKA 4WFZA 1AB8A 4ZK7M 3UR0A 3IAM9 5IT0A 4M5GA 1VJQA 2B5JB 2KZMA 2ZVSA 1BQMA 1LEOA 4A8KA 3HFKA 3IRXB 4IH6A 4ZA1A 3ZZTA 4YHHJ 3T1HF 3KHLA 1X5OA 2ZNZA 1NHKL 2VD3A 4ILMA 4W98A 3NKYA 3SCKE 1UETA 1B3TA 4EWTA 1TU0B 1PO6A 4DFJA 1JLCB 5LMNF 2OP5A 5F41A 3ZTRA 1U24A 4P71A 4B3TF 1UJ4A 4YQWA 4YUDA 1VQSA 2Y8YA 4Q8FA 4QU7A 3G4SS 2ZITA 5DO2A 1U0SA 2W9BA 4V19X 2DY1A 4IG0B 4ES2A 4U7UD 2VQEF 1Q5VA 5KAKA 2W2QP 1Q8IA 4MJKA 1TKDA 2N7YA 3DYAB 3MD3A 4Y0FA 3B8HA 3GFZA 1I94F 2XMTA 1G2EA 5CZXA 2V8GA 3NNAA 1JMTA 2AU0A 2HHSA 4OLPA 3OR2A 5LT5A 2H65B 1Q79A 2XI2A 4OZ3A 3ULHA 2Z2MA 3UCGA 1V3SA 1OO0B 1HQEA 2J7KA 2RUGA 4QYRA 1VBXA 3Q2TC 2ATCB 3FQLA 1WF2A 1PCAA 4ZN3A 2D7SA 1RDRA 1NUEA 4DL7A 1FE0A 2ZM6F 1WC0A 3V6KA 3RBEA 1F6TA 5JVGQ 1D0EA 2MSTA 4OV6A 3BBFA 4IG3B 1N54B 3MPDA 2FHMA 5E3QA 1BQMB 1UZHA 3LGNA 3DLGA 3AD7C 2HLUA 4NXNF 2XZWA 3FCHA 4HH0A 3C16B 2BZ2A 2HNDA 3LP1A 2ZHBA 2GO8A 2V34A 1QM9A 3OFEA 3H42A 2CZVC 1YRUA 2OJ3A 1RUSA 2UUBF 1Y0HA 3W5XA 3L4BC 2CDRB 5KFGA 3U02A 3RAQA 1U1MA 1C0UA 1H73A 4RWXA 2YPZA 2RKIB 1WUUA 3MTKA 4Y2KA 3UCUP 2Z4PA 2KYZA 4DFKA 1PSDA 1URRA 3M8YA 1S0NA 1SI9A 4YHHF 1HPZA 2AYBA 4G1QA 1RT6A 1S72S 3IG1B 1FRKA 2ASYA 2JH3A 3CJ8A 2LEAA 3RUBL 4QIFA 4OYWA 2DPIA 4KC5A 4B17A 2WAQD 5FLXY 2EKNA 3NS5A 2DHSA 3ILJA 4QQBA 4TN2A 3RGIA 2Z2LA 2QSWA 4HYKA 2FJWA 2DHHA 1G7CB 4KGMA 2BJ8A 1LW0B 4Z7YA 2B8PA 3EZUA 4ZPWR 3TAMA 4X65F 1RTDB 2NLWA 2QYGA 5AXKA 4DR5F 4QJVA 4L76A 3PW7A 3W7BA 5K8OA 2HFNA 2BEFA 1IWGA 2H1YA 4WCEQ 2BE7D 5D15A 4LF7J 2WOMA 2MGZB 4OYBA 1ICEB 2G1HA 3EUNA 3QWPA 2NUHA 3TP2A 3D1QA 3UE2A 1SIZA 1QY7A 4DV3J 1GXUA 4USKA 5CYQB 4PWWA 2AZ3A 4C8MA 1YJWS 4B9NA 4KH0B 2BUNA 2ZJPQ 3EPIA 1U6BA 3CCES 3LWMA 2UVWA 3BO4A 1SXLA 3KNGA 1N6QB 2D3UA 4HL9A 2HAIA 4ED3A 3J81Y 3R6LB 3Q0AA 1QTMA 2GIFA 4LJMA 3FZ2A 3GG0A 3MM8B 4ICLB 3RRKA 1AFJA 3VGSA 4N56A 3CE8A 3HHLD 2WONB 4TYBA 2DGWA 2LEPA 3U7JA 3FRYA 4NLQA 4YY3F 4FKYA 3O8WA 3BGFA 4USTA 3KJVA 1SKRA 1TFYA 1UVIA 4U9RA 1NJXA 1R43A 1YLXA 2P9GA 2EFPA 3DN9A 2I6WA 2CWXA 2YNGA 3DOMB 1RT1A 3W9HA 4ETZA 2R4FA 4C9DA 4DV1F 1S12A 2FLLA 4USVA 3TQ1A 3MAAB 3MMBA 5HQMA 1EX8A 3DI6A 2ZM6J 3QPIA 2FLOA 3PX0A 3PYEA 4PWUA 2ZFHA 3EDRB 2LXUA 3KLGA 3U1NA 1RACB 3HHLC 1OSDA 3AOAA 2WSFC 5FD1A 4GC6A 4JI3J 2JL9A 3HMJG 3HHKA 3DRRA 5D0HA 1IKVB 3TJ9A 3MECB 1RT1B 5F0WA 2X1GA 1CJUA 3MM7B 3Q86A 4BBYA 4ED1A 3AB2B 1A6LA 1F9FA 1WC1A 4HEA9 4AT1B 4DR2F 2XO6A 1TR0A 2ASLA 1Y5LB 1KSPA 1F5BA 4TQRA 4X4OA 3LP2B 4OHWA 2BANA 2BBEA 3EVOA 1HQUB 1PJ6A 4DV2J 2DVIA 4NXMJ 4OYAA 4F02A 1VBKA 1S1TB 2W4PA 3HSZA 4ZCKA 1NK7A 2KFZA 5CYMB 1MN9A 3WX4A 2HFUA 2IRXA 4ECUA 3TUZC 2FHJA 1N8RT 2J0QD 1X9SA 3WX8A 3QAEA 3IS9B 1ZYQA 2EC0A 4I67A 4JYAF 5KFHA 3M6WA 1U8SA 1RP5A 2EFGA 2QO3A 3DLEA 3JTOA 2R7TA 5KT5A 2OPPA 2KFYA 2HRYA 3RTVA 2KXFA 5E3RA 1RHRB 1Q53A 3CGIA 2FHJD 4FF3A 2FTRA 4F25A 2BJ1A 1RKJA 4IOAQ 4K4SA 1RT5B 1S97A 5KG3A 2EPIA 2BE2B 4QIWD 4J90A 3H40A 4NYOA 5L1LA 1F0XA 3V4IA 1SQGA 1FD2A 3AXMA 1NCLA 4OI3A 3PKMA 1FX2A 4CTAA 4B9TA 5M2UA 5ETNA 4OYPA 1HNWF 1LWEA 3MM6A 3PYFA 2V9WA 2EK6A 3W3SA 3K5PA 4K50A 2HWTA 4B9MA 1LWCB 2NCKL 1NRKA 3IGVA 3ISZA 2J9CA 2KO1A 1GK8A 4ZCLA 4NLPA 1W26A 2M3DA 2HNYA 3CEDA 3R5JB 4F4AA 3HPOA 1U4BA 3BSCA 2B7BB 1RAGB 5DM6Q 1T7PA 2FDNA 3IBFB 1JLAA 2DRAA 5AXMA 3FJ2A 2HWIA 1CJKA 5BR8F 2HIQA 5LXYA 3T19A 2FJBB 2Q66A 3DRYA 2VG6B 1N5QA 3NEKA 3OUYB 2FZKB 3LGHA 4KQZA 1DTQA 2MZSA 3OTCA 2IPOB 5F8JA 1WC6A 2YWWA 3DOKB 3GJTB 4MK9A 2AQ4A 3UN2A 2IM1A 4A8MP 2OAUA 4GKKJ 3AA9A 2IBOA 3W1YC 5H9EK 4ZP7A 2EW9A 4C97A 3V6DB 4IRCA 1XMOF 3GWCA 1S79A 2PFDA 2RUSA 2ZVIA 3PACA 4HDGA 4LIWA 5HROB 2VPZB 4FVCA 2HWHA 2JC0A 4UUWA 4CO3A 1FI4A 3GILA 3H20A 3PRBA 3S7RA 1S9EB 2VG5A 1HNIB 3OL6A 1QAIA 4NA1A 4K4UA 5A6PA 4OI2A 2DY9A 1AA1B 1VQ9S 3OW2R 4PG7A 1SV5B 5AXLA 5K8NA 3BGLA 5J2QB 1TUGB 3QFWA 4CO2A 4F7VA 1EARA 1DQAA 3UPFA 1IBKJ 3W2VB 5AE2A 3MMJA 3BGOP 4LQ9A 3MMCB 4F4WA 4EEYA 1DTTB 4FZVA 1TVRA 2FVRA 3DRSB 4W4MA 1S48A 2BKNA 2RHQB 3H2VE 4IDKB 2PI5A 7FDRA 1WKKA 2LCWA 3N79A 4WP9A 2IFXA 1B70B 2OELA 4M5MA 1ZPWX 3KLHA 4RU2A 1FNMA 1ELOA 2HHTA 1E6VA 1NDCA 3QYYA 1KQGB 2W4CA 2H5IB 3DGPB 4DN9A 4FYVB 1Y10A 4PXCA 3MHYA 4IFYB 3I31A 4LBPA 4RBVA 3Q89A 4IO1A 4EYIB 4CT9A 1NNDA 1IXKA 3MPYA 3IBWA 3ITHB 4M5NA 1VRTB 4HT5A 3ZNUA 5A8RB 2IAJA 1SJFA 2OI2A 4PG5A 2KM8C 4GVBB 2LLZA 7AT1B 4X65J 4FVMA 3SCJE 2L9NA 4DQIA 2UUWA 3FRZA 2UUAJ 5LM7E 4DXLA 3D54A 3VAIA 3E01A 3Q8PB 1UKUA 5DDPC 4X4PA 4XIUA 4YP3A 4ELUA 4LF7F 2AJ0A 3M05A 1QAYA 3R9LA 1QAJA 1V5IB 3BF4A 4CRJA 2C2EA 1QUVA 1WD6A 4HDHA 4Y2CA 2LQ8A 2A3JA 2B0GA 4DZ6A 5LSLA 4IOBA 1FK9B 2A0FB 4C3LA 2HNZA 3RW6A 3KK1B 1NZAA 3RBZA 3TAMB 5HVHA 1CLFA 4NL5A 4HI1A 4DL4A 5B0EA 4EZ9A 2XS2A 4FS2A 4KGVB 2W7OA 1PIEA 3UD3P 2ZH3A 1EP4A 4O4GA 3MAAA 3MMBB 1H6KX 3CIZA 6FDRA 1RCXB 3TANA 1S1UB 3T1YJ 1N0UA 1M1KT 2AMCB 2CQIA 2EFVA 2C3YA 1LV5A 2K3IA 4FYWB 1VC0A 1X4EA 2F5GA 2LU1A 3BREA 4DX5A 1FEHA 3TZXA 3G8TA 1R3NA 3W60A 2RQMA 3JAMU 3NNHA 3MI7X 5K5MA 1XEZA 2OD4A 4AL7A 2HZCA 3GTYX 4L75A 4I2QB 4DN0A 2R2SA 2DTJA 4AQYF 4ICLA 2HRTA 4JP8A 2MQQA 3BKTA 1T94A 2GO9A 3LGMA 1RE1B 3PIOQ 2XLJA 3OFGA 2ZH6A 4CM0A 3CULA 1GH8A 3PY8A 3M8ZA 2MZTA 3MTJA 2V4JB 4YDDB 2XCPA 3V4IB 1N5YA 4PRFA 4IFYA 3M9OB 1BXNA 3GG1A 4X4RA 4DUYJ 5HN0A 4MTPA 1JXVA 2FLPA 4BDPA 3UNYA 2MGZA 4ZLJA 1M5SA 1RBOB 2AWZA 3KKFA 1FKOA 1A7GE 3D6FB 2NXCA 4UOHA 2HYIB 2GVDA 3KLHB 1ZA2B 4KGXB 2V4JA 4O44B 5GADU 5D4OA 3DDIA 4YR0A 2NREA 2EI5A 2JVOA 2EC2A 3IBCB 3NWRA 1IJFB 4W92B 4GKJF 1FJEB 2F3JA 5A6WA 3AA8A 1TKXB 1VFJA 4KGZB 1PJ7A 1U0HA 1WOPA 2V8DA 4PEOA 4AE5A 5FLXU 1SIWB 2K7JA 4JI0F 3KK3A 3J80Y 3KLEB 1RT3B 2IC3B 3MCOA 3VVUA 2FVSA 2RF2A 2Z58B 4KGKA 1LOUA 1CQNA 1GMWA 2G2ZA 3NGDA 3HT3A 2X51A 2W25A 2G13A 4ILRA 4M1KA 4AD6A 3KK2A 2V9KA 2XMJA 4MFBA 3KHRA 2R2UA 3KG4A 3GFYA 1QD1A 4CYUA 4EFAC 1TMMA 4RR5A 4F0MA 1AROP 1J2VA 3M2RA 3Q8QB 4LMZA 4CDIA 3P8BB 1LK7A 3MDFA 1CC8A 4WFYA 3UO0A 5I42B 5CH7B 3ZZPA 3BJYA 3F56A 3DI6B 4M63A 3CMQA 3GJRB 2V8HA 3M32A 4UOGA 3BDPA 3DOKA 4KJIA 5EN1A 4J9KA 3I32A 4Y2AA 4WFXA 3D5MA 1F5AA 2K7KA 4ANCA 3DCAA 2XM3A 6AT1B 5L1JA 3FMBA 2EFQA 1FDBA 3EGNA 3CWJA 2XWYA 2APOA 3BGUA 4ZMMA 4DR2J 1G6BA 4O4RA 5DLGA 2LEBA 3I82A 3QRPA 4DUZF 2E7WA 2BKOA 2G9OA 1D9DA 1SQEA 2HQDA 3NNCA 1E6YA 3NCPA 1DQ8A 4NLYA 2QC3A 1T9WA 5A0YB 2CDQA 1PC5A 1BE4A 2ZC4A 3H59A 3OTDA 3G96A 2XCAA 4DFPA 1TL5A 4CO0A 3R5AA 1W25A 1O0PA 3IRWP 2CQCA 2F1FA 2VFVA 2X3DA 4LRDA 4V1Ak 1UJ5A 1P6TA 1HWUA 1UFKA 2RIJA 3AJDA 4EGLA 4DOZA 5AJ3J 1N5SA 2V2QA 5EX3A 1N52B 1VQ8S 3HSJA 1H38A 4N8NA 3VAJA 4F4ZA 5J2PB 5EUHA 1T9YA 4J9UE 1IBKF 4I6AA 1I5OB 2PEBA 5E41A 1B4SA 5JMNA 3MFIA 1MSWD 3MEEA 3LANA 4NZ7A 2XO7A 3BYPA 5HAOA 4Y28C 4ZIVA 1HBOA 2E5LF 1GNKA 4KT0C 2E1PA 2ZWOA 1S9GB 1RHQB 1IWAA 3D0IE 1JQGA 2LP4A 3NP5A 3OXFA 3GONA 4Y34A 3G8SA 2B9XA 2LECA 4DV3F 3NBPB 1FRIA 1N33J 1YSJA 3J81U 4MK8A 3CT9A 2VIHA 3KOAA 4B08A 4TXSA 3TYTA 3CC2S 2NYIA 4DI6A 1NHUA 5KFFA 3G8QA 3JYTB 4NEZA 3KJFB 3HCXA 1TV6A 3R5CA 3VWSA 1HWKA 2CNOB 2PA3A 1JLFB 3KUHA 5HSPA 2GMHA 1R27B 4AYBD 5GAHI 1KFSA 1IKYA 2R8HA 4C8OA 1CPZA 2C28A 1YBAA 1SCJB 4QW8A 5HMZA 3TEHB 3C16A 2D41A 4RU9A 4N76A 3CDWA 3TA1A 1X5TA 4OI4A 3J7Z5 3K59A 1YKWA 1WACA 4QR1A 1NK8A 1WI8A 3V6JA 4JI4J 4PWDA 1HQ2A 1YBTA 3SQGA 1IKYB 1S5ZA 4DV4J 2HVDA 3EVMA 4U8VA 2DB1A 3OFHA 5A76A 4DV5F 1CG2A 3KK2B 4I64A 2M2BA 3MCNA 2VKRA 1HW9A 1N88A 5GVQA 1U6ZA 2OSRA 2P2CB 4TLQA 1GMVA 1OY6A 2JEIA 4ZDNA 4B3OB 1TELA 2IYIA 1KONA 4MIAA 2B4PA 3F44A 3W63A 1ZS6A 2CNLB 1BLUA 4ZOSA 4B3SJ 2H54B 3QMQA 1ZAVA 5E3AA 4DHVA 2VPWB 3OTBA 2WSEC 3GYXB 5HJYA 4DV7J 1YQHA 2DITA 1HNVA 2ILYA 3GIRA 2WVCA 2YQ0A 3OFFA 4OI1A 1D8YA 2OIHA 1S76D 2BJDA 1DJ0A 2AJ2A 4UZCA 5B0GA 4Z7CA 3ITHA 4ZVHA 1RAHB 1XR5A 3BPDA 1C0TB 2OPQA 3M8PB 4LR8A 4M5DA 3AD9C 1S6UA 3GSDA 3VAKA 3K17A 3C46A 2B56A 3CD6S 2GHWA 1VHFA 2YWFA 2DR6A 2JJ4D 4K8RA 2KVQE 3TUJC 1TL1B 2HQ3A 4ECVA 4Q2LA 2PIIA 2KU7A 4WYLA 5GAGU 1NKEA 4HACA 2E9TA 1BWEA 1SL2A 2M9KA 2LDYA 1C0TA 2QTWA 1K44A 1IR2A 3HSDA 4M8LA 3NGTA 3JSBA 4RW7A 2B6AA 3DHWC 5LJ3Y 2CIMA 3EGWB 3DRSA 3ZFVA 1NK9A 4NZ6A 2WW4A 3KDOA 3MPWA 5HBMA 2L9WA 2M52A 2YNIA 4JV0A 4FDFA 4KAIA 2XS7A 3RB4A 1WEXA 2V6AA 4LFBF 1NHVA 2ZKUA 4H4OB 4J9SA 5D78A 1EJ7L 2HMIB 1R0AB 3A3NB 5ETOA 1TL3B 3R2CJ 4ZHRB 2JWNA 4FP9A 3TZWA 3UD5A 2DR7A 1G3OA 2LQ9A 3A8JA 3AB4B 3MR6A 1S9EA 1H0HB 4EUVA 4I2PB 4NLXA 2G0IA 3W5YA 3QQCD 1SL1A 4OZJA 3IRXA 1S49A 2VJVA 2XEXA 4K4XA 2F7VA 5KFNA 3TZZA 2MXYA 1ZTTA 2F8EX 2H5EA 3C15A 2QLJB 3AJ1A 5T41A 3L3CA 2CPZA 2YX4A 1AYEA 1ULRA 1RISA 5KFPA 1DTQB 2Y9HA 2ZH8A 5BYQA 1ZETA 4ZN1A 2D3O1 4KBIA 1KOOA 3IMQJ 3VALA 2GX8A 1SC3B 2B4VA 1OY9A 3LOUA 1KQKA 5KFTA 3ZZ0A 3JSMA 2QLWA 2K06A 2CADA 3MR5A 3HD1A 4AXJA 4KPYA 5F8GA 1CC7A 2H51B 3CCSS 1X4HA 2BX6A 3GV7B 2N3LA 2ZJQQ 1RU1A 2L48A 3GFHA 1KDNA 3BSAA 3I6PA 4TVAB 4DPXA 2J9EA 5LSOA 1U09A 2ROGA 3MUVP 1J5OB 5EWGA 3GV8B 4OIXA 1UVLA 3NL0A 2RSQA 4DSEA 4Y3CA 3MR7A 4PQAA 3OL7A 1R8PA 3C14A 2HHVA 1VRTA 1FXDA 1SC6A 1U1LA 1NK6A 1HD1A 2IMWP 3N9UC 4C4WA 1MWYA 3DMJA 4A8FA 3M2VB 2OFGX 3OV7A 3MUTP 3UWTA 1FX4A 2ILZA 1FKOB 1E6VB 2B3TB 3RU0A 2YX1A 2HVEA 2OGUA 2YNFA 3QGIA 5L38A 1GX6A 3JAMY 3SV3A 2ZZNA 4ZS6A 3TX0A 3TARA 4B9UA 3DU6A 3SCIE 4CLZA 4QYZK 1HBUB 4LRCA 2CPIA 2P9CA 3PCOB 1RWMB 2F9JA 3DLEB 4OHYA 1FVQA 2U2FA 3D9BA 1JLQA 4KO0A 4C0HA 2YKQA 4EBCA 4G1IA 3RYLA 2R7VA 1A0OB 1GT8A 2DBBA 1T9XA 2DHGA 3GYGA 2KB2A 2KYXA 2QL9B 2X7IA 3QATA 1VQOS 4H4MB 1S4FA 4K4VA 2VQFJ 4V19J 5D8HB 1SJ4P 3TEGA 1O51A 3HJFA 1HWJA 2SXLA 4X64J 3QIPA 1AFIA 1FDNA 1V9OA 2VBXA 3PYDA 1N36F 3Q22A 2ZBCA 2ZOMA 3PX4A 4MIWA 3UVJB 2XC9A 3BEGB 2ZBPA 4USHA 2NZCA 3QZ8A 1H2TZ 2F8HA 1VLOA 2MLXA 2HURA 1SH2A 1Y5NB 3D6MB 3M1VB 4U67Q 3AXKA 2E5JA 1RT7B 4CLSA 5KOWA 1VDHA 2A2DA 2FZGB 3JXOA 5CD4H 1HHTP 1FFWB 3G9CA 2BJ9A 3D6HB 5KT6A 2BJ7A 4RL1A 5L9XA 4A8OA 4RUAA 3JSRA 3V6DA 5J1NA 4PR6A 1YIJS 2ZOFA 3TI0A 1XMQF 3P45B 2B9WA 2QJ3A 1HNZF 1JLEA 5RUBA 1PAUB 4X64F 3G2XA 5HK4A 1YVFA 2NS1B 3MMAB 1EETB 2HNZB 3T9ZA 4LQ3A 1Q7LB 5LMUJ 1SKSA 2UXCF 5LJ5Y 2BE9B 2UV8A 2M0GB 3CTRA 1RTIA 2KHDA 4A8SA 1SJ3P 5D0RA 1Q0NA 2XG8A 2ZH4A 3AH6A 4A48A 1QVGR 2BOPA 2OEKA 2ZE2A 4OYZA 1I51B 3F0NA 3HDSA 3NOCA 1V6HA 1WELA 2QA2A 1Y11A 3H5SA 1NB2A 4TY9A 4DR3J 4QU6A 4ZJOA 4HHUA 4B3SF 2CQDA 5F8IA 1RHKB 2OTJS 2DO0A 4P75A 5BYRA 3LA0A 2GQQA 4ID5A 2QMWA 3TOQA 3HD2A 3SXLA 1SB6A 4QIEA 3W2WB 4B3TJ 3M30B 3CMAS 4DF4A 2E9ZA 3ZNJ1 1H7WA 2LKZA 1KVJA 3LQVA 2GHVC 3MZIA 4PG6A 4O3PA 4OX9F 4DV0J 2A18A 2C3MA 4CNYA 2GQ2A 3MEGA 1NMEB 3DGPA 1VQMS 3FGVA 3O1LA 1R8HA 2L08A 1OS5A 3M8QA 5JXSA 3I4PA 2IDLA 3TW0A 1RWUA 1KN6A 1HI0P 3AQOA 1MG7A 2KM8B 3FMWA 2YPYA 5D0EA 2VPXB 3SQGB 2N3OA 1RTHB 5L8RC 4USMA 1T02A 3QO9B 4RO0A 6FD1A 2FJEB 2D9OA 4LSLB 2IVFB 3BO2A 1U02A 4RNNA 3ET6A 1FERA 2CQ4A 3I9ZA 3OLAA 2DHAA 3W61A 2GVZA 1TKZA 1NPRA 3T1HJ 2V67A 2XY6A 1NJYA 2KZZA 3IR6B 4XPCA 5DQIA 4YFUA 2PFFB 4X4VA 4F3OA 3R7SB 4G1QB 4X62F 1PGZA 1X7VA 1S6QA 2V68A 3BN4A 4DUTA 2YBVA 4RUBA 2W9AA 3RR8A 4ELVA 5C25A 4JI4F 2GZOA 3UDVA 5D4NA 3H0PA 3QIPB 2BM0A 4OMFG 1N4LA 3MM5B 4ZP6A 2RQ4A 3TUIC 3NBPA 3OXGA 2HLTA 3HHLA 1YJRA 4ECRA 3ICLA 3IA0A 2AT1B 2YNIB 5CD4A 2AEJA 2GIRA 3GLJA 1R6VA 4P2SA 4LUBA 5GMEA 3ET6B 4OYXA 2MQMA 2DISA 3HVTB 3VCDA 5KTQA 3PO5A 3WBZA 1I94J 1N0VC 2C2NA 3CD0A 1FKPA 2Q1LA 5E3CA 5IQ6A 3IN5A 1WWHA 1X8DA 2BKPA 5KFLA 4AXIA 4RW6B 5A8WA 4ZP9A 1C1CB 2OMOA 2BE2A 4ZCIA 1UA1A 3EGVA 4NI2B 2JNJA 4DG1A 2UVRA 2WVFA 2DGQA 4JI2F 5E2QA 4Y00A 4JI5J 4OZNA 1UVMA 2DEJA 3US5A 4PQUA 2V0NA 3VR1A 3M30A 5MAOA 1TL4A 1T9UA 4X84A 3ENVA 4USWA 3UDEA 1F9EB 1U25A 4ZPDA 5GAEI 2BQRA 4CLLA 2L9DA 2MKJA 2AGQA 1X0FA 1G1XA 4DR6F 5T7LB 4R25A 3M8RA 3EE3A 3M6UA 1U45A 2J6SA 2LYVA 5CYMA 3J7ZT 3ELHA 2Z0GA 1E6YB 3VHQA 1T03B 4ZJQA 4LF6F 5AJ3F 3R2DJ 2IJFA 1K73T 1WNEA 4P72A 1CS4A 1REGX 2FQQB 3V81B 2BW7A 4LBIA 4C8NA 1HI8A 1HBMA 4K4WA 4ED8A 3LPEA 3M9MB 4ECZA 2LXFA 3CCMS 1GXLA 3GU0A 4NLWA 2PD1A 4WWSA 5ETTA 3GSIA 1T95A 2IJRA 1TK5A 2HFSA 3KJNB 4RBUA 2XQCA 5C2GA 3FCWA 2XSJB 4ZPAA 4J9OA 1W7WA 4FBUA 2FIUA 3L9ZA 5IC6B 2CPHA 5D6GA 2DCUB 3RZAA 5ETRA 3OL8A 3PVXA 4NLTA 4F8RA 1IR1A 5A2QY 3Q24A 1M5HA 2X3GA 4KFBB 4ZVEA 2Z2ZA 1UL3A 1T05A 1AW0A 3HJVA 3PNIA 5A2QU 1HQUA 3QJLA 2MQNA 4JI6F 3MEDB 2HFZA 3UD4P 1U2FA 4CM2A 5DDRC 5DS7A 2HAFA 4F26A 1HBNA 3C6UA 2BDPA 3DLHA 1TL3A 3HF5A 1VRUA 2RRNA 2WONA 3LH2S 3OQ2A 4JI0J 3RBDA 2MKIA 1S1VB 3G86A 4ZPVR 5HROA 5HQLA 1REVA 1BQNA 4DX7A 2X1AA 3CC7S 2C2ZB 5HBMB 1UPPA 3BBCA 2YQ1A 3KMSA 4GVBA 1WG4A 4J5OA 4DV0F 4NYZA 5D3GA 4QYZJ 2J9DA 1HBOB 1S7IA 2E5IA 4WXOA 4ALZA 3UDCA 3KJQB 4WIIA 3K8VA 2NR0A 1HBUA 3G71S 2B4OA 3I0SB 3ISND 2CG8A 1HNZJ 5IZHA 3HULA 4WTYA 5FIIA 3KJVB 4P2MA 3KTQA 2CPYA 4JYAJ 2P6SA 1RADB 3UDLA 5IV4A 4JV2A 1KFDA 3K5LA 2KJVA 2VG7A 3CJ2A 1BQXA 4PG8A 3MM8A 4LSZB 3GQCA 1T9TA 5L1IA 5DQHA 1R8AA 1T03A 2YKOA 2FC8A 1X4AA 1EKRA 4LRAA 3C14B 5B0FA 1B7YB 3S6EA 2AKWB 4M94A 3CDAA 4IG0A 2RU3A 4LFAF 4LVOP 2A6OA 4LF5J 1XBWA 4OJ3A 4JI3F 1N33F 4PXEA 4G6VB 3QSYB 4P6QA 1YJNS 3HLUA 2AHOB 3D7SB 3MPVA 1FXLA 1FRLA 2RJZA 2DH8A 4ZKAA 4FXWA 4WZMA 3ZTSA 4K7QA 4AUKA 1ACMB 1TKTA 2GHPA 2QSFA 1QJHA 1JKHA 1Y9OA 3DRXA 4P2XA 1YJ9S 4FPRA 4A47A 2IRYA 5DLFA 1RBAA 2G1DA 1VQ4S 1HNXF 4M95A 1LW0A 4CLWA 3O5TB 1D09B 5CQGA 2MMYA 5IM0B 3GIKA 2VKZG 4DL5A 1WTBA 2DPJA 4DF8A 2N7CA 1TUWA 3JQKA 2FVQA 3T1YF 3DLKA 3K0JA 1ZM9A 3ZZRA 1MMNA 4LSLA 4OI6A 1QE1A 2RE1A 5KFZA 2UUCF 1N5TA 2KXNB 1XJWB 1DHMA 2KHCA 2HHWA 3MD1A 3KK1A 2OO4A 3VGVA 1SUQB 5GAEU 3GIMA 3W9JA 4QW9A 1IBLJ 4O3RA 2VF3A 4I56A 4NOHA 1D8ZA 4GKKF 2QX0A 3ILLA 1NPKA 1CULA 2ZDPA 1BD6A 3AOBA 2RHSB 5U47A 1F2HA 1JLAB 2RDJA 1NM2A 3QT8A 5AXNA 2F65A 1CSJA 1WHYA 5GADI 3T41A 2ZWPA 3PV8A 4EMDA 4ZCMA 4KIAA 1QSYA 5EDWA 2MHEA 2NXJA 2GVZB 2H9ZA 2DR8A 2N4CA 1HR0J 2V2KA 4DBQA 3JTNA 3M6VA 2KFNA 4UQGA 1U0HB 5IWAJ 1XWLA 4X2BA 3OL9A 2V94A 3NGRA 4TU8A 4ERDA 4NLRA 2W9BB 3I55S 1WC3A 4PKDB 2KTQA 5DRKA 1SJ1A 3WC0A 3X1LB 5L46A 3CDUA 3QJPA 3VGUA 4CP5A 4Q2MA 1RSCA 1JLCA 1IQZA 4P9SA 4ZLLA 4OV1A 2DXFA 3I0RA 4XPEA 1O6XA 8AT1B 1K1SA 4ZVOB 4NLUA 2EXUA 2O1PA 4TNOA 1KLNA 2IA0A 3E01B 1N5YB 5L39A 1L3TA 3SSSA 5HO4A 1VQPS 2OD6A 2Y8WA 2MY8A 2RNEA 4I1TA 2XMWA 5DG7A 2V2ZA 4QOTA 5H9FJ 2BW2A 3W2VA 4OJHA 5A0YA 4CLFA 4ED4A 1JLGA 4N47A 8ATCB 2CYYA 3NS7B 4CQ1A 2FPHX 4NXNJ 2VUGA 3NXZA 1T8EA 4O3SA 2AGOA 5SUHA 2KG1A 2R9LA 2ZHOA 3LP2A 1QDUB 4CWBA 2A6MA 3QAUA 1SQFA 3I5CA 3HKWA 1YRXA 2ZH1A 2JFDA 1KOHA 2VDHA 4MYUA 5KFAA 4I4BA 1XIQA 1T3OA 3E51A 5F9LA 2CJAA 4ZVTB 5KFQA 2DR9A 4Q8EA 3CUNA 4N77A 2GW8A 4RW4B 1NKBA 2ZBRA 3DRRB 1SH0A 3DRPA 2XTJP 3FFIB 1SBRA 2O01C 2QV6A 4K5RA 4ZP8A 5K14B 2CFXA 3T6BA 4R8UB 4ECSA 4NPOA 3QLHA 5IM0A 2C3PA 3KG0A 3KLIA 4MAKA 2BRLA 1S6OA 3FFIA 5K14A 5M2RA 2MQOA 3SSQA 1J5EF 1VIOA 3IG1A 4L3NA 5J2QA 3K89A 2BR0A 1W2BR 5J2MB 4IYQA 1NU4A 3PG9A 3TX8A 3G6ES 2VA3A 2CJXB 3KLGB 1SJRA 2C3UA 1UW9A 1PJ5A 4LR7A 3DFEA 4MH8A 3AD8C 5AE1A 2M5YA 3MF5A 3VZIA 2F8MA 1SUQA 1XR6A 4MIBA 4USIA 3R1HA 1PAEX 1IM4A 2DGTA 2XSFA 4LIRA 2AP6A 5LMNJ 3IM9A 4EBEA 1MW7A 1RBLA 3CC4S 1NXIA 2KG0A 1XTZA 4NLSA 4F0HA 3HXMA 4IFVB 1ZOTA 4NASA 2CNNB 3NG8A 2HZAA 3BZQA 4DR7J 1JLQB 4KO0B 3B4DA 1RTHA 2VG7B 4ANDA 1YDLA 4DV6J 2O67A 2GVDB 3EJMA 4MKAA 5C24B 4X4SA 1N34F 5KFVA 1VQYA 2VDIA 5G4DA 1NJIT 3OR1B 3QSIA 1RAAB 4RPFA 1RYRA 3ZZZA 2LQ5A 2CRLA 2O66A 2GA7A 4CNZA 2HQCA 2Q43A 3MOJB 1EKSA 3IXQA 1CQMA 2HNYB 5FDLA 4ZVQB 2UXDJ 4DL0C 1EQMA 3HI9A 5DG9A 4R0JA 3DDKA 2VZ9A 3EPGA 2QT7A 1LWFB 2D9PA 4K2JA 4WK3A 4JV5F 3D1OA 1RLCL 3CJRA 3FDSA 5DETA 2DEIA 3L7UA 4DR7F 3HHLB 2E9RX 1U1NA 2QEXS 4DWIA 2R7UA 2XNQA 1RT6B 1SV5A 2E29A 2VONA 4E0DA 3KXDA 3QNWB 4MKVA 3A8IA 1KQFB 1KVIA 1RT5A 4DCPB 2RB7A 2HQGA 1FCAA 4WFAQ 3PIPQ 3RB6A 2FJVA 1C0UB 2J5AA 3BPSP 5DM7Q 4CCHA 1S6QB 3UI3A 2J0WA 2QMUB 2XY5A 3JTPA 5KFOA 1ZZFA 4TY8A 5B0AA 4IR9A 3SMZA 2VU5A 2AV5A 2Z57B 2UU9J 4RW8B 2AEMA 4B9SA 4A8QA 1TTHB 4ZITA 2GJ2A 2XYPB 5KG5A 5KT4A 4JI8J 3LW5C 3A3OB 5I3PA 2MZ1A 3T9NA 1JLFA 1H7XA 2EBGA 1FRMA 4CLTA 1RK8A 1TKTB 2O5DA 1J5EJ 4DDFA 1HI1A 2J0XA 5KFSA 3PW2A 1HARA 1UWBB 1IUJA 2JEJA 4QWDA 5GMDA 1NLKL 3M8WA 3PM9A 1UFLA 5HATA 3UN5A 5KFCA 2KDOA 3BR8A 2HS0A 3EGZA 1HFEL 2D3ZA 3E8OA 1RA6A 1FTRA 3BKFA 3K5OA 4M5JA 2JLGA 1UCNA 1T05B 2UVVA 4LBHA 4BHQA 1DRZA 4LF9F 1U48A 4UW2A 2DXDA 2PEHA 4DEZA 2BA9A 2YVSA 4F3MA 3NRBA 4DUZJ 1RTJA 4DS5A 1U1QA 5B0DA 3H7HB 2NXNA 2IMOA 4NCBA 2R7SA 4CTAB 4NCAA 5JJBA 3KLFB 4ER8A 1N56A 3RR7A 2XMKA 4XDCA 1VK3A 4O3NA 1Y3KA 4PCQA 3R8YA 4EU0A 2U1AA 4U7CA 3AQPA 2VODA 4I6YA 1WKJA 3R7BB 2WOMB 4NI2A 3G6VA 3FUYA 1SH3A 4J91A 3PKYA 3M8SA 3PW0A 2OLWA 2ZOGA 3SZ2A 2Q6CA 5D4PA 1UZDA 4DSFA 3RRHA 1NH7A 1FFGB 2JDJA 1HHSA 2DNGA 2MZQA 1D1UA 1IKXB 1SC1B 3HVTA 2YKPA 5HJXA 3FNNA 1RABB 1S1WB 2DGOA 2OPSB 4MT1A 2C22A 1P27B 4XTTA 2RDDA 5DZ6A 4ZIWA 2YKNA 4K5SA 3NGUA 3NY0A 2MY7A 1ZA1B 3EXYA 3PZPA 3G82B 4OLOA 2MKSA 1TFWA 4J9PA 1IVZA 2C42A 1QTNB 4GVLA 2IVMA 5CHCB 5DG8A 1F3FA 1SJQA 4ED7A 3CO9A 1WC4A 3L7PA 4HH1A 4Z37A 3CIMA 3H90A 1UWBA 3N6LA 1Q8KA 2WSCC 3THPA 4Q43A 2EKYA 4QPTA 1FJGJ 3P5TL 3D28A 1TAUA 4IUFA 2HPUA 3ILOA 3LP0B 3W62A 2DIUA 3OVSA 2XGPA 4OZLA 1IQTA 2XNRA 3MEDA 4ZJLA 3R1LA 2B4UA 3LPYA 1UFWA 2QA1A 4ETXA 5C5JA 4DQSA 1PYTA 1UTAA 3BS9A 2HHPA 3LO3A 3HO1A 1XQIA 2HBYB 3CCTA 1XR7A 4DPOA 3TAPA 4NA3A 2E5GA 3DLKB 1V3RA 3MGJA 2GIQA 2HBQB 3QGPA 1FDDA 4OX6A 4BCAA 1MROB 3HVRA 2RRAA 4ECTA 4UZBA 3NWGA 3DLJA 1NJZA 2UUCJ 1L3UA 2VA2A 3KNAA 2HFVA 2GV1A 2W2MP 4A8YA 2D3OR 5CABA 2B43A 3L09A 2O3DA 2IIHA 3J80U 3BQ0A 4K0KF 4XK8C 1GX5A 1OY8A 2NSCA 3G6XA 1YITS 3P6YC 2RKIA 4YN3B 2K3KA 1RJJA 2A1BA 1RYSA 4JI2J 1WF1A 1RZMA 2PDAA 2YH0A 1KTQA 4H4OA 4RWWA 2Y1JA 1R0CB 4IRDA 2N4DA 1WJ9A 2EEYA 3DGVA 3JS9A 2UZAA 3KK3B 3H8YA 1JX4A 2BYCA 3IP0A 1H2VZ 2ZZTA 2DXEA 3BM7A 3IM8A 4UY85 2XB2D 1QAXA 4DL3A 1EHWA 2ADBA 1RT4A 4LF4J 1S9GA 3FEYB 3JSYA 4PYAA 4B3OA 3I96A 2B7CB 1I3OB 5ETQA 4CH1A 4DSJA 4B02A 1OWXA 4M5KA 3SDEA 2VOPA 2LMIA 2HGNA 2Y1RI 2MKKA 1RTIB 1WHXA 3IO1A 4FN5A 4KKOA 1VYAA 4S0MA 3MM9A 5B0CA 4PUOA 5J1PA 2VFUA 2DGVA 2YY3A 3I5BA 4LRBA 4P73A 3TJ8A 1YJVA 2CJQA 2VQEJ 1PBUA 1RAOA 3T3FA 4OL8A 1FKPB 2VPYB 2GMLA 5BJRA 1UJ6A 3M32B 2NYHA 1RHMB 3U1MA 4DQRA 1OQ6A 1RTZA 3GE9A 3A3PB 1JK9B 3B78A 1REVB 3CCZA 5G0RA 2CVEA 5K20B 2LA6A 4GO5X 2C2DA 1LWXA 1UEKA 1X4DA 1HHQA 2HQFA 1M5KC 1BWVA 2PN6A 2PI4A 4FF4A 1Q8BA 2I0XA 1TL7A 2I38A 1NDKA 2HK3A 4NX9A 5D0GA 2ZH2A 3PX6A 2AJ1A 2DNKA 3TR5A 4C7QA 2R8KA 4HT7A 1H3DA 1FRHA 4N7TA 4KSEB 1PC4A 3ENQA 4PPZA 3H25A 5J2MA 3H2UB 4LF8F 3OJSA 4KHPF 5GAHU 2KKHA 3AT1B 2QA4G 1QLNA 1TKZB 1CEZA 3QLHB 2ZDOA 1XNRJ 2HZVA 4BC7A 3F41A 3J7YU 2K1RA 3QFHA 2Q3PA 4Q5VA 4FPIA 4IOCQ 1VQ7S 4QIGA 4RUCA 2EK1A 2DGUA 3OTOF 5DGAA 2ASJA 1R8BA 2YNHB 2FHKA 5KFWA 2DNYA 1UAWA 1RWKB 2BOAA 3UR3C 1UW4A 4M5HA 2R8GA 3OBIA 2XMVA 1D9FA 5KT3A 4UT4A 4J9VA 3DDNA 1VJWA 4IQXA 1XERA 3B54A 3L7OA 5C24A 3CCUS 1KKHA 2DRDA 4FXDA 2H4YB 1H98A 1R8CA 2KRRA 2HFOA 4Y65A 2WBMA 4ID5B 2NPFA 1GAOA 4AFFA 1Q7YT 2E1CA 1QSSA 3AHPA 3B4MA 3EWGA 3HZEA 3PEJA 3D66A 1VOMA 4GO7X 5E5NA 3H5YA 3TAQA 2FVCA 3HKZD 3CCQS 2AD9A 2KI2A 1QSLA 4DSLA 2DGSA 5MLCV 2XS5A 3WQPA 4DQQA 1FNXH 2ACMA 2FY1A 3MEEB 1U26A 1KRPA 2W9CA 2WBRA 3TZYA 2XLKA 1VBZA 1S57A 4JI1J 2OFHX 3Q83A 2H4WB 1VISA 4O3OA 2QIFA 3ILIA 1C1CA 2W9CB 4OHVA 4OJGA 5ITHA 4TKTA 1CJVA 2OHDA 4NWBA 4NZ0A 2JZ5A 4KY3A 4KHMA 2LQJA 1RT2A 4JUZA 1ZAWA 2UUTA 3M9NB 1NJWA 4LF2A 2QA4S 3FBCA 3NCQA 1S9FA 2BJEA 1N5VA 3BH7B 1T9VA 2MZRA 4KV8B 3BR9A 4P7VA 3IWNC 5B08A 5IV3A 8RUCA 4QIVA 3PW5A 3AFGA 5B0BA 4HVZA 2B8QA 2ZD1A 5A8KB 2MPUA 2Z30B 4X4TA 4I2QA 1MMDA 1RT7A 3BGRA 4ED0A 5HMXA 1PYSB 4J9NA 3VAMA 3FKBA 1WF0A 2F9DA 1KR4A 2YKMB 4EI2A 2UXDF 1IM6A 3MAHA 3U1LA 2Z56B 1KWMA 1SKUB 2YX7A 3RG6A 1KNZA 2MLYA 3SIPB 2MSSA 4C8ZA 4Q45A 1KQSR 1ZZNA 2HHHF 5J2NB 1JNZB 2M4MA 2HNDB 1EB0A 1HKAA 3LP1B 4XDDA 1N34J 1YK9A 1MMLA 2XZTB 5ETMA 3VV2B 2ASDA 1FD8A 1K9MT 1T11A 1NK0A 4RW8A 3EYZA 2ZH7A 3IR5B 2XYGB 2DGXA 5KG1A 2YWGA 4WYWA 3T5LA 3GJSB 3PW4A 2DK2A 3PRVA 4F67A 2IM2A 4O0NA 2BM1A 3CJ5A 4ZVRB 4RW4A 5M2PA 2B9YA 2XMMA 3WDOA 1C1BA 3X3UA 2XY7A 1NB7A 4OJ1A 1CVJA 2HVHA 4HTJA 1S6PB 1HQEB 2RU9A 2EVZA 3OTEA 3QT5A 3OVBA 3KYLA 2UUAF 2C2OB 1JXLA 5KFDA 1NSPA 1UP1A 2CPFA 4MKYA 4FNHA 1VIXA 4U6PA 1KBRA 1LXNA 2PMHA 1RTJB 2IA6A 3CCVS 4ECQA 2J7UA 1NAQA 2OPRB 3CD7A 3CJ4A 4KR0B 2K2PA 1SPBP 4DS4A 2IAJB 1J5OA 4JI7F 4F4YA 4RW7B 1X4BA 3CCJS 1HWLA 2G0CA 1R89A 1VRQC 1RU2A 2Q79A 3J7AN 5CCLA 4DR1J 1U2CA 2P9EA 4WF9Q 1VHIA 2V4QA 1AXQA 1NDLA 2F40A 1SKWA 1F5CA 1PKUA 4URGA 3OR1A 3KDNA 4PXBA 4TQSA 2R7XA 3N6NA 4ZPBA 2OMLA 3MMAA 5CZVA 3I0SA 1C4AA 3FEXB 3OT9A 3U27A 2W1BA 5HQ8A 2QFJA 2EWHA 2BXJA 2RILA 3ZZUA 3I5AA 4ITSA 3CO0P 4IDKA 3UNGC 2CAJA 1VQ5S 2CPXA 3FSIA 1HYSA 1NBEB 2E1AA 3C15B 3TNVA 1S0MA 1ZPVA 4WE1B 3SV4A 1BY9A 2R3VA 3UQSA 3J7A1 2QLXA 4K4ZA 3KHHA 2IRUA 5KFBA 3MAQA 2G2YA 2YKAA 3GIJA 4JI7J 1RWVB 2AZ1A 4KH1B 4IQMA 3VVTA 1B99A 2DNPA 2XI3A 1I6JA 2MQ8A 3P5BP 4RW9A 3K57A 4DR1F 5HP1A 1DFDA 3W64A 4OYIA 5SZTA 1F2GA 3SFGA 3PXGa 2HEKA 2JLFA 2OKQA 4ZHRA 3THTA 3KHGA 2MEWA 4LVNP 2YWKA 1IKVA 3TA0A 4CLPA 3DLLQ 3LAKA 3P49B 4ZVFA 1EP4B 1QE1B 4OYOA 1Y00A 5D4LA 4ES3A 3QBCA 5F8HA 4K2XA 3NMRA 2GC8A 2HHHJ 4WE1A 1K0VA 2OSQA 4P2FA 3WIUA 4HLBA 3R5DA 2R8JA 2CNKB 1M5OC 4UQTA 1FJGF 1RAFB 1S4EA 1UVKA 2ZZMA 2HHQA 1NEEA 4OX9J 4GC7A 3LP0A 1AT1B 3N01A 1FTCA 2RVJA 3V81A 5KG4A 3BDEA 1RHJB 4D3GA 3QIDA 3UCZP 1U1RA 4PABA 2M8HA 1MN7A 1WG5A 4OX7A 3M2UB 1UEUA 1VS3A 4M5DB 1NSQA 1OJ4A 3LWLA 4DL6A 5CA5A 2OTLS 4ELTA 3QRQA 2MKYA 2R7QA 2LFVA 3DYAA 2QLFB 7FD1A 5DZ7A 5F8MA 3THVA 3EVWA 2AEFA 3OTOJ 4FS1A 2VASA 3K7RA 2P6TA 1WDDA 4L3KA 3DLBA 2GAHC 2HK2A 3HHNB 4B3MF 4DSKA 1UA0A 4H4KA 1HL6A 1UPMB 2B51A 2UV8G 1Q8LA 4R0EA 2XLIA 3H4BA 1VC5A 1HD0A 3PFEA 3TA2A 2C2KB 3R97A 4F4KA 4LF9J 1U1OA 4M5LA 5I3QA 4WKRA 3DOLA 4NMLA 3MCSA 3EICA 2GJIA 2ZH5A 3D6TB 2OUGA 2CPJA 2CQ2A 2RS2A 1WEZA 1M0SA 3QRRA 2GCFA 4QR2A 4CLUA 3O3LA 1WHWA 4O0IA 4BS2A 4NEYA 2F4FA 4WKYA 1RI7A 1Q16B 2HS4A 2HW3A 1JLBA 2CJ9A 2WHOA 4RZRA 2GQCA 1R0BG 4HHJA 2A2CA 2G2OA 3M2RB 3I56S 1S0VA 1O8BA 2OEJA 4NYPA 3R7NB 3SBMA 4ILLA 2XMAA 4JOUA 2KT3A 2W2OP 3GPAA 4WXWA 1B0PA 4MFBB 1AUSL 5JUMA 4LF4F 1WI6A 1B0TA 1VQNS 4NXMF 1ITPA 1EQ0A 2MTLA 2W8KA 3GB0A 1YI2S 5F3ZA 3M7VA 1U49A 3BQ1A 3T5JA 4FBTA 2RQKA 1RT3A 1Z4UA 3OSPA 3FCVA 4BWMA 3FSXA 2QYCA 3ZZYA 5KFJA 4OZ5A 1YJ7A 4O3QA 2R7OA 4YB1P 4JV1A 2PA8D 5T7LA 4G65A 1KVKA 2FD2A 1IN0A 2VV5A 2JRSA 2WK4A 2XHCA 3DLGB 4LFBJ 2DNOA 4BC9A 4YR2A 4USJC 4MKBA 1TK0A 1Y7PA 3JQJA 3SI8A 1XMBA 3BKUA 4J9RA 4HACB 4I69A 4TU9A 4OQJA 2CUYA 1T3NA 5KG6A 4DX8H 3D4JA 1Q95G 4KTQA 4Q0BB 2I2YA 3HVWA 1GQEA 4AQYJ 5J2PA 2DNLA 4KE5A 4ATNA 2XGQA 4DR4J 4KHPJ 2R42A 4X4UA 3CCLS 3NMAA 1NZ8A 2DH7A 2RF2B 2D74B 5KFMA 4P52A 1XNRF 1IKWA 3WIVA 1RTDA 2W4DA 1U1PA 3W2WA 2FGOA 5F8NA 2HGLA 1M5PC 2AW0A 2MKHA 1WOOA 3DM2B 1RT4B 3M4XA 4LRFA 2R2RA 4DV6F 1TKXA 5IC4B 1X9WA 1KC8T 1CJTA 4ED5A 4C48A 2VBZA 3UW1A 1DARA 4WBFA 2FLNA 9RUBA 3TUPA 3GV5B 4B9VA 5E33A 1NH8A 3MUMP 3UFCX 1Y5IB 2MLZA 5IT4A 4EYHB 5CXTA 2OEMA 1FRXA 1V3ZA 2HKEA 3POTB 3VGTA 4C11B 4CI0B 3DU5A 4ZVPB 1P8GA 3T6JA 3PO4A 3SFUA 4UOFA 5F0UA 2IDEA 3PFOA 5D3GB 1UEVA 2G0JA 2K8GA 3C8YA 3IS9A 3KG1A 4JBCA 1RGVA 2V63A 4IO9Q 4AL6A 1ZM2A 3OXLA 3AY0A 3RJMB 3FC9A 3SEOA 3TRGA 5J2NA 4IG3A 1RWNB 1RA7A 1FA0A 3SSRA 2UXCJ 4I7FB 2POKA 1DLOA 3C6TA 4I68A 3MM5A 4RLEA 4IR1A 1TV6B 1U47A 5B09A 2ZBIA 1F60B 2A10A 4YMEA 2WCXA 2FJAB 1X4CA 2CQ1A 5EHHA 2YKMA 4MMOA 4F3QA 3QT6A 1Q1KA 3CCRS 1YHQS 3G6YA 2XYHB 4E8UA 3DXBA 3P3DA 3MECA 4P10A 1S1UA 2NQPA 4I7FA 1I1GA 2MHNA 2FJXA 1O5JA 2FJDB 2PSZA 2MQLA 3MURP 2WTFA 2NSBA 1Q78A 4FYXB 1CJTB 4DL2A 1Q86T 1LNQA 4F50A 1X5PA 2QG9B 2MZJA 1B0VA 1L3KA 1LWFA 3R5BA 3BB5A 3CDBA 3I4HX 4K59A 2C2RA 1S59A 2YWEA 2LXIA 1OYEA 5E3PA 3DRPB 1MU2B 3S1TA 1RAJA 3V5RA 2DKOB 3VTIA 4QWCA 1X9MA 2QE5A 2F4VF 1GMWD 2B9EA 1R7IA 2F63A 2UP1A 5EX0A 3GP9A 4LF5F 3LTOA 4OFZA 3M2VA 4KRWA 2E7VA 3H2LA 5C42B 3ZO7A 2AJQA 2OPPB 3WHIA 1JJ4A 2Y1IA 3O6QA 1DAXA 3HK2A 3MR3A 1PYOB 5HL7Q 2UVUA
chains in the Genus database with same CATH topology
1RHMB 2CJYB 2C2OB 3P4UB 1PAUB 1SC4B 5IC6B 2H5JB 4ZVOB 5K20B 3GJRB 3EDQB 2H5IB 1IBCB 3EDRB 3NS7B 1I51B 1RHKB 1QDUB 2C2MB 2C2ZB 4ZVTB 3R7BB 1BMQB 1NMEB 2C1EB 3KJQB 1RWKB 4DCJB 1RWVB 1SC1B 2QLJB 2H65B 5IC4B 2CJXB 2H4YB 2H48B 1RHRB 4LSZB 1SC3B 1QTNB 4ZVUB 3R7SB 2H51B 1RHQB 2HBZB 4ZVPB 2QL7B 2CNNB 2CNKB 2H4WB 2HBYB 2CDRB 3KJFB 4JB8B 2HBQB 2QL5B 3R5JB 2Y0BB 3RJMB 2CNOB 1RE1B 1RWNB 3IBFB 1RHJB 3GJQB 1RWWB 4ZVQB 2QLFB 2HBRB 1RWMB 4DCOB 2QLBB 2XYHB 3D6FB 3GJTB 4ZVSB 2QL9B 1RWOB 1RHUB 3IBCB 3SIPB 1F9EB 2C2KB 2P2CB 1ICEB 1I3OB 3QNWB 4DCPB 2DKOB 2CNLB 2XZTB 2H54B 1RWXB 1RWPB 3D6MB 3R6GB 2XYGB 3GJSB 2FQQB 4ZVRB 3R6LB 3D6HB 2XZDB 2Y1LB 2XYPB 3R7NB 3KJNB 1PYOB 3P45B 1GFWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RHM B;  2CJY B;  2C2O B;  3P4U B;  1PAU B;  1SC4 B;  5IC6 B;  2H5J B;  4ZVO B;  5K20 B;  3GJR B;  3EDQ B;  2H5I B;  1IBC B;  3EDR B;  3NS7 B;  1I51 B;  1RHK B;  1QDU B;  2C2M B;  2C2Z B;  4ZVT B;  3R7B B;  1BMQ B;  1NME B;  2C1E B;  3KJQ B;  1RWK B;  4DCJ B;  1RWV B;  1SC1 B;  2QLJ B;  2H65 B;  5IC4 B;  2CJX B;  2H4Y B;  2H48 B;  1RHR B;  4LSZ B;  1SC3 B;  1QTN B;  4ZVU B;  3R7S B;  2H51 B;  1RHQ B;  2HBZ B;  4ZVP B;  2QL7 B;  2CNN B;  2CNK B;  2H4W B;  2HBY B;  2CDR B;  3KJF B;  4JB8 B;  2HBQ B;  2QL5 B;  3R5J B;  2Y0B B;  3RJM B;  2CNO B;  1RE1 B;  1RWN B;  3IBF B;  1RHJ B;  3GJQ B;  1RWW B;  4ZVQ B;  2QLF B;  2HBR B;  1RWM B;  4DCO B;  2QLB B;  2XYH B;  3D6F B;  3GJT B;  4ZVS B;  2QL9 B;  1RWO B;  1RHU B;  3IBC B;  3SIP B;  1F9E B;  2C2K B;  2P2C B;  1ICE B;  1I3O B;  3QNW B;  4DCP B;  2DKO B;  2CNL B;  2XZT B;  2H54 B;  1RWX B;  1RWP B;  3D6M B;  3R6G B;  2XYG B;  3GJS B;  2FQQ B;  4ZVR B;  3R6L B;  3D6H B;  2XZD B;  2Y1L B;  2XYP B;  3R7N B;  3KJN B;  1PYO B;  3P45 B;  1GFW B; 
#chains in the Genus database with same CATH topology
 1IJE B;  2B5J A;  3QWU A;  4EBD A;  4C8Y A;  3DHX A;  1FWL A;  4E98 A;  1P9Q C;  1RAI B;  1SC4 B;  2PC6 A;  3DM2 A;  4NE9 C;  2L41 A;  4DLE A;  2CQH A;  4OYM A;  5HVF A;  5B7W A;  1L5U A;  4Y2M A;  1S99 A;  3A4T A;  5JVH Q;  4FYD A;  2JVR A;  1NDP A;  3C19 A;  1VCT A;  3HSG A;  4TLR A;  4URS A;  3J81 j;  1IBL F;  4FF2 A;  2Z2Y B;  4F36 A;  1DQ9 A;  3A8E A;  3D1H A;  3NS6 A;  3R27 A;  3UVJ A;  2YNH A;  3S8S A;  2GAG C;  4OZ0 A;  4CIO A;  5HLF A;  1GXT A;  3CF5 Q;  2KRB A;  3VQS A;  4UTG A;  5IFM A;  4OX8 A;  5H9E J;  3FBE A;  4H4K C;  1PIL A;  2V2V A;  1DBD A;  1MRO A;  2WVD A;  5ADZ A;  3IAS 9;  5I42 A;  2JEG A;  1JLB B;  4ZLP A;  2R8I A;  2GGP B;  3KMQ A;  1JWW A;  2VQF F;  4DLG A;  3NOG A;  2HIY A;  3RAX A;  5KOX A;  3ZTP A;  2CJK A;  2ACY A;  4LSN B;  2VFR A;  2KL8 A;  4FYY B;  1S1X B;  1EIY B;  2FC9 A;  2DH9 A;  1CJK B;  1WTF A;  1HBM B;  2CQP A;  4GMK A;  2FVP A;  4FKX A;  1KP6 A;  3DC2 A;  2COL A;  5KFU A;  5ETV A;  1YZ6 A;  3N4W A;  4C3K A;  4C6A A;  4DPT A;  5IS2 A;  4ZPT R;  4DPY A;  2DNH A;  4WK1 A;  5IT9 U;  2EFN A;  2ROP A;  3DMJ B;  3V6H A;  1HNX J;  1TMJ A;  3RAM A;  2EG1 A;  4BWJ A;  3SQO P;  4U95 A;  2DT9 A;  2YTC A;  5IT9 Y;  3BSN A;  2KJW A;  3ZC4 A;  5KFK A;  4NLG A;  2YKN B;  1VK8 A;  2IY5 B;  4YS2 A;  4ECW A;  1KLM B;  1TAQ A;  3CJQ A;  1MLA A;  2AX1 A;  2OPS A;  3P96 A;  2RDI A;  4TY8 B;  5IOL A;  3ETM A;  4BLG A;  1U1K A;  2PE8 A;  1VC6 A;  2I1R A;  4LF1 A;  1JB0 C;  1JKH B;  3S01 A;  5C42 A;  3NAH A;  3HP6 A;  4I0W A;  5ETK A;  3V4M A;  5LSR A;  4WP3 A;  2HGM A;  3ADA C;  1GTH A;  3GCW P;  3Q8S B;  2MQP A;  4DV1 J;  3RB0 A;  1L3S A;  3W5Z A;  5ETL A;  1VLY A;  2QFI A;  3FZB A;  3KLV A;  1Z2Z A;  4QCL A;  2JFK A;  5GAG I;  2CWK A;  5THW A;  2BMB A;  3TJA A;  4W90 B;  2PGC A;  1M5V C;  2LU2 A;  3KUE A;  2HSE B;  2OPR A;  1LFP A;  1IBM F;  1DTT A;  4NRU A;  1SL0 A;  1N32 J;  2IM0 A;  3TVK A;  1X31 C;  1YJU A;  2BJ3 A;  1RWW B;  2KXH A;  2RRB A;  5CCM A;  2RQC A;  1D9A A;  1JJ2 R;  2BAN B;  2HBR B;  2LA4 A;  1FWP A;  1WHV A;  4HI2 A;  1XK8 A;  4C8K A;  2CXE A;  4YOE A;  2IVY A;  4A8X A;  3T1A A;  4CZC A;  1FRJ A;  1URN A;  3D67 A;  4RBT A;  1C2P A;  1JNR B;  3QGG A;  3RB3 A;  3PYG A;  3PRD A;  4QPX A;  1H74 A;  2DJW A;  3PHT A;  1BHN A;  1C1B B;  3DXS X;  1RB0 A;  3OJU A;  1CJU B;  1RHU B;  3MM7 A;  5KT2 A;  4YR3 A;  2AGP A;  1JLE B;  3MOZ A;  3D3C J;  1WDT A;  3E3X A;  4O4G B;  5L1K A;  4WZQ A;  3GYN A;  3N0V A;  5ETP A;  5C2C A;  3AJ2 A;  4IFV A;  4NRT A;  4ED2 A;  1RWX B;  4K0K J;  2WB1 D;  2DR5 A;  2PMZ D;  1X4G A;  1BQN B;  1EAY C;  2B6A B;  1S1V A;  1TQL A;  4C0O C;  2VHG A;  2NUU G;  4I2P A;  4X62 J;  3MPU B;  4C11 A;  1S10 A;  3PEH A;  1HR0 F;  1FT8 A;  1P1T A;  1Q4R A;  5KG7 A;  5FJ4 A;  2ROE A;  2CZ9 A;  3ZTQ A;  2QN6 B;  1JXE A;  2QRR A;  3KWM A;  4LSN A;  1HWI A;  3IFE A;  5A8K A;  3OR2 B;  1X5S A;  4UOC A;  4DMZ A;  3OHB A;  4GKJ J;  2ZHA A;  1MNE A;  3M6X A;  2GGP A;  4DV2 F;  4O23 A;  4EO6 A;  4RJV A;  4Y2I A;  1XC9 A;  2WW8 A;  3IWL A;  3EDQ B;  4DV4 F;  2NPI A;  5J1E A;  5BYS A;  5I3U B;  2QZ8 A;  2VIC A;  4Z2X A;  2Q6B A;  2ATL A;  2AYG A;  4LFC J;  1UWA A;  2PO4 A;  2BQ3 A;  5DJB A;  4QWE A;  3CNQ P;  2ZUA A;  1WG1 A;  9ATC B;  5KFX A;  3CCW A;  2VC1 A;  4CT8 A;  2VB6 A;  3EMT A;  1K47 A;  3ENA A;  4HHH A;  4Q0B A;  2AIR B;  2EG2 A;  4L74 A;  3IR7 B;  2XWX A;  2BAC A;  1U2R A;  3OSN A;  2XBP A;  2OPQ B;  3CJT A;  3M8P A;  2J0S D;  2HVI A;  3HT0 A;  4FXV A;  1N48 A;  2UXB J;  4DUY F;  3D0H E;  3BSO A;  2VL1 A;  1RKI A;  4WTO B;  4PZV A;  2E44 A;  2V5H G;  3MMC A;  5C7P A;  1VQ6 S;  5H9F K;  1DY3 A;  2C3O A;  2BRK A;  2EFO A;  4WFN Q;  3J7Y I;  4CO1 A;  1LQ9 A;  4DCJ B;  5K8P A;  2J7W A;  4I6W A;  3D2W A;  1HPZ B;  1RAE B;  2HRU A;  3O2I A;  4QZV B;  4URQ U;  1FJ7 A;  2ZJR Q;  1WSV A;  1GMU A;  4IH7 A;  2CJB A;  2H48 B;  3GR0 A;  2FYX A;  2ABY A;  1DLO B;  1FE4 A;  1H72 C;  1W2I A;  3C6T B;  2GFF A;  3FQK A;  4ZVU B;  2R7R A;  1MU2 A;  5IWA F;  3BQ2 A;  2YWH A;  2DNR A;  5IQQ A;  2AF6 A;  3RRG A;  3MCM A;  2HHU A;  1ZM4 A;  2W2P P;  1U7L A;  2E1R A;  4H4M A;  4PPD A;  1VMB A;  4Q44 A;  1K1Q A;  3HM9 A;  1LW2 A;  1DUR A;  2IYG A;  4R8U A;  1VGY A;  4L72 B;  5CYJ A;  1RT2 B;  3QT7 A;  3NCR A;  3NGS A;  4Q7A A;  4CYU B;  1CJV B;  1HW8 A;  2W24 A;  5KFR A;  4RNF A;  3H98 A;  3B6B A;  2VG6 A;  2CKW A;  3CJS A;  3POT A;  2HS3 A;  4JB8 B;  4B9L A;  2Y0B B;  2V4R A;  5C25 B;  2FB0 A;  2LDI A;  4WIQ A;  5HAN A;  2HVZ A;  2HMI A;  3NAI A;  2DCL A;  2E5H A;  1T0T V;  4DV7 F;  1Y4Z B;  4CO4 A;  5EWE A;  3GJQ B;  1LKZ A;  2ZD1 B;  3ZXW A;  2BVZ A;  4DU8 A;  1BGX T;  2CVI A;  2JHE A;  2E66 A;  5D77 A;  1JLG B;  3PR5 B;  3G82 A;  4WP8 A;  2DNM A;  3VQT A;  2RT3 A;  1GEH A;  1R31 A;  2QLB B;  3CDE A;  2LQB A;  4Y6I A;  4YB5 A;  4CH7 A;  1HYS B;  1N6Q A;  1UVN A;  3RBX A;  4E2F B;  2FZC B;  3I9V 9;  1TZ0 A;  4K4T A;  5A8R A;  4B3M J;  4EO8 A;  5LMU F;  5AT1 B;  1WOS A;  2V69 A;  5DDQ C;  1KD1 T;  2J76 E;  4KPC A;  2I5J B;  2IM3 A;  3CB4 A;  4TYA A;  3W66 A;  1R6Y A;  1WEY A;  4H54 A;  3CME S;  3D3B J;  4KB7 A;  4DG1 B;  4USU A;  3MEG B;  3GII A;  4PYD A;  4WJB A;  1NSK L;  4OZ2 A;  3FSY A;  4DR3 F;  3H5X A;  1TUV A;  2P8I A;  5KFE A;  1RWP B;  1U8W A;  1Z1Z A;  2EBE A;  2IHR 1;  1OIA A;  4YB7 A;  3T5K A;  3HX9 A;  4KYZ A;  1KLM A;  1RLD A;  2DNZ A;  1FJC A;  2W7P A;  2KVI A;  3C66 A;  5F8L A;  1TVR B;  5K9F A;  4R5P B;  3CJ3 A;  2HG4 A;  1NO8 A;  1XNQ F;  4N41 A;  1OQ3 A;  2NXU A;  3CJK A;  2XZD B;  1HMV A;  2Y1L B;  3LUY A;  2VOO A;  1MWQ A;  1IKW B;  1YZ7 A;  2P5V A;  3Q8Y A;  3OHA A;  1N32 F;  3UN3 A;  3K5N A;  2I8E A;  2E5L J;  2UU9 F;  3P4U B;  2L3M A;  1S6P A;  2W7A A;  4F04 B;  3N5F A;  1FO1 A;  1IBM J;  4WU2 A;  2GJF A;  3CW2 C;  3EZ5 A;  4PXD A;  4CH0 S;  4DR6 J;  2ALY B;  2VH7 A;  4QR0 A;  3PDN A;  2CPE A;  3R5G A;  3VAF A;  1X0P A;  4WU3 A;  3IWX A;  4JI1 F;  2Z8Q A;  4PWD B;  1MWZ A;  1IBC B;  1OMS A;  4X66 F;  2IJN A;  2YXL A;  2J8S A;  4DSI A;  4C8L A;  5IXU A;  5BR8 J;  2C2M B;  3PHE A;  4ZPC A;  2X1B A;  1VRU B;  4JI8 F;  5E0O A;  1TL1 A;  3R3T A;  2JEF A;  1HBN B;  3C6U B;  3MM9 B;  1WKL A;  3G87 A;  1FKA F;  4PUO B;  2PT0 A;  4P74 A;  3K5M A;  4RNH A;  1JIH A;  2WZ1 A;  3MEK A;  4P7T A;  2JX2 A;  1TL7 B;  3LAM A;  3PJW A;  4ZVG A;  4C2M A;  3FEZ A;  2V8V A;  2VFT A;  2W01 A;  4HR2 A;  1B64 A;  1ZBT A;  3GCX P;  3OPK A;  2MYF A;  4KFB A;  4NLD A;  1YX2 A;  1RCO B;  3KLE A;  1AZS A;  5G0R B;  1K8A T;  1HA1 A;  1X60 A;  2VC0 A;  4KV8 A;  2DRB A;  3W65 A;  4RX6 A;  2WB4 A;  3BV8 A;  1M1G A;  3WZ0 A;  2H3E B;  5KG0 A;  4D3H A;  3MM6 B;  1XMO J;  1M90 T;  2MJU A;  1IKX A;  4NCG B;  3MXH P;  1YTY A;  5FDL B;  3BO3 A;  3Q23 A;  3VF0 B;  4WFB Q;  2M8D B;  1IR0 A;  3A13 A;  5F9N A;  2YNF B;  4DPW A;  3WC2 A;  1C4C A;  5HI7 A;  5LL6 d;  3NGK A;  2HQI A;  2MDA A;  3BH6 B;  1CS4 B;  4L73 A;  4OHX A;  5HMY A;  3VAG A;  2W2N P;  1Q82 T;  3C3L A;  1EET A;  2HBZ B;  2WRM A;  5A8W B;  2GS8 A;  5L9N A;  2GNK A;  3FK4 A;  4NLO A;  2QL7 B;  1Y3J A;  3KUG A;  2XMU A;  4AL5 A;  4DR5 J;  3EXC X;  4EZ6 A;  4OHZ A;  4G3I A;  2HHX A;  2VBW A;  5K8M A;  1K0T A;  1S7H A;  4LF6 J;  2YH1 A;  2J9D E;  3AOC A;  4M5I A;  3PJ9 A;  3AOD A;  5HVG A;  3QZ7 A;  1JJH A;  5DGB A;  4DX6 A;  3M2U A;  1S1T A;  4LR9 A;  3IGN A;  1F9H A;  3FBF A;  2DNQ A;  1HIY A;  2E1M C;  2CQG A;  3HVA A;  3M1V A;  4J9M A;  1QVF R;  1KEK A;  3KFW X;  2VBY A;  1NKC A;  2VG5 B;  3VZH A;  4J37 A;  2W8L A;  3IC1 A;  4IRK A;  1S1X A;  2AYM A;  2Y0S D;  3ISN C;  1S0O A;  2ZEJ A;  1J27 A;  1KHW A;  2DNN A;  3ZZO A;  4DCO B;  4DU7 A;  4MK7 A;  1EZZ B;  4WPA A;  5KFI A;  3TO8 A;  4N8O A;  3SCL E;  4RNO A;  2DHX A;  4ES1 A;  3KLI B;  4JI5 F;  4TU7 A;  4A46 A;  1LW2 B;  5LOQ A;  2YQ3 A;  4ECY A;  2UUB J;  2NXE A;  3NLC A;  3QO9 A;  1FEE A;  3GFX A;  3C2P A;  2X1F A;  1U6F A;  4NA2 A;  1CBK A;  3W8P A;  3CVK A;  2R7W A;  3Q8U A;  4RKU C;  2F4V J;  2ERR A;  2XHW A;  3PJX A;  5HLF B;  4CLY A;  2CPD A;  1YJT A;  3R6G B;  1YG0 A;  2DYA A;  3W8G A;  5EGY A;  4X4Q A;  2UXB F;  4X4N A;  2JSX A;  1R0A A;  5T14 A;  2GMJ A;  3DKD A;  3V2U C;  1VQL S;  4RW9 B;  4DQP A;  4MYT A;  2ADC A;  1ROF A;  2RH3 A;  3EM1 A;  2IC3 A;  2CQB A;  2D69 A;  3K8W A;  3ZTO A;  2XUL A;  4J9L A;  3SYZ A;  2G4B A;  4F2R A;  1FXR A;  3ETO A;  4XO0 A;  5J1E B;  5I3U A;  2D1C A;  1GFW B;  3Q2S C;  4UUX A;  1DZ5 A;  1NK5 A;  2CJY B;  3FBB A;  3LF0 A;  4GRS A;  1NPP A;  1NSA A;  2JC1 A;  1S1W A;  1FES A;  2KN4 A;  2Y3Y A;  2H5J B;  1SVD A;  4YB6 A;  5F3T A;  4QWB A;  5HMW A;  4LFC F;  3A8K A;  4C98 A;  1FNO A;  1RXO B;  3B82 A;  3CJ0 A;  5CYQ A;  2AJF E;  4KHR A;  4DV5 J;  3I0R B;  2MB0 B;  1PG5 B;  1LXJ A;  1YBU A;  3HHE A;  2IBK A;  1ZM3 A;  1JJC B;  4DPU A;  3OLB A;  1TP7 A;  3JSM B;  3CSK A;  1F3V A;  4KKO B;  1RQ0 A;  3HHD A;  2I5J A;  3HZG A;  1X4F A;  4K4Y A;  1P1L A;  2CG4 A;  2M88 A;  2E7X A;  1B7F A;  1OYD A;  1GTE A;  3MWB A;  1D3W A;  3CD5 A;  2KT5 A;  1M1H A;  2RML A;  3D0G E;  1BUX A;  3GMG A;  4NMX A;  4EK2 A;  5CAA A;  5I4M A;  3W9I A;  2VFS A;  5GMK a;  1HNV B;  2ZH9 A;  1KHV A;  4ENO A;  2QGF B;  1S77 D;  2QMX A;  4UF4 A;  5H1S V;  3F73 A;  3Q8V A;  4YEA A;  2J6U A;  2AJ4 A;  2ZE2 B;  1KTV A;  4XAK A;  4DFM A;  4ANE A;  1L3V A;  2LVW A;  1BMQ B;  3PR4 A;  3VAH A;  1HLW A;  1Q81 T;  2C1E B;  3PTW A;  3OUY A;  2FY8 A;  1HNW J;  3N5B A;  3DNC A;  1UVJ A;  3EZO A;  3N28 A;  4U8Y A;  4L6V 3;  4LT6 A;  3BGR B;  4C3M A;  3E2E A;  4ZLN A;  2DIV A;  1LK5 A;  1FHT A;  4IKA A;  5LXR A;  2ZC3 A;  2M7S A;  2J8A A;  3CJK B;  1FF2 A;  1WOR A;  4F0K A;  1Q5Y A;  3L95 X;  4G1P A;  3TWZ A;  5DDO C;  1LFW A;  3TVZ A;  4ID8 A;  1OPZ A;  2WVE A;  3MR2 A;  1LWE B;  4B3R F;  2XSJ A;  2J6T A;  3BYR A;  1YWX A;  4QBU A;  3A1Y G;  3DOM A;  1H2U X;  4PG4 A;  3A12 A;  5ETS A;  2FHO B;  2ALZ A;  4LFA J;  4O44 A;  4X66 J;  1YGY A;  1FK9 A;  3CPW R;  3BBB A;  2M70 A;  3TQE A;  5BXI A;  2PMW A;  3DOL B;  3HFZ B;  2JLE A;  3M8Q B;  2N82 B;  3HFV A;  2RD5 C;  3QGH A;  4NLV A;  3OVA A;  2DD8 S;  4YDX A;  1XMQ J;  3H4D A;  4UY8 T;  3CXC R;  2KT2 A;  3OD2 A;  2ZKT A;  4NCG A;  3MFH A;  3H5U A;  3SDE B;  1A9N B;  1OSC A;  4RUH A;  1AUD A;  2BV3 A;  2QL5 B;  3N6M A;  4FF1 A;  1ZH5 A;  1LWC A;  1P9Y A;  5KG2 A;  3I87 A;  4DZD A;  2JOQ A;  4OZ1 A;  2I9S A;  4QWA A;  4U7U K;  1G4C A;  1AZS B;  4ED6 A;  3LAL A;  5DQG A;  3AAW B;  1WSR A;  4PQU B;  2RAQ A;  2ZUG A;  3D68 A;  3JQM A;  5E7O B;  4CO5 A;  4F4X A;  1ZTW A;  1TK8 A;  1VR6 A;  4F2S A;  1UMJ A;  1XNQ J;  2AYE A;  1FDA A;  2ZNY A;  3ENW A;  4HTI A;  2CA9 A;  4J9Q A;  4J7C A;  3K2Y A;  2DO4 A;  4U96 A;  1OPI A;  1Z2L A;  4ZVS B;  2OH2 A;  3O44 A;  1FFS B;  1VI7 A;  2AX0 A;  3TVY A;  4ECX A;  1VBY A;  4DR4 F;  4RW6 A;  1RWO B;  4CLK A;  4C0B A;  3RW7 A;  2BQU A;  2CQ0 A;  3KLF A;  2V50 A;  2K1R B;  1N36 J;  3FVY A;  1BC6 A;  1V5V A;  3ONQ A;  4OI0 A;  1APS A;  2CZ4 A;  4LF8 J;  1NK4 A;  3T5H A;  1FVS A;  3JB9 k;  1ZAX A;  4PAA A;  4HKQ A;  5KFY A;  5AE3 A;  2BAB A;  2YNG B;  4FNI A;  1PBA A;  2V8P A;  4N5S A;  2WVB A;  4A8W A;  4A4J A;  1CUL B;  5EWF A;  3BN7 A;  1F1B B;  2KH9 A;  3QJJ A;  1KS2 A;  1HNI A;  3GR1 A;  2FUG 9;  3JYT A;  4IH5 A;  4B3R J;  2VJU A;  4JV5 J;  5HP1 B;  1WC5 A;  4DJB A;  3Q8R B;  2FGC A;  1QUP A;  2MKC A;  2NZ4 A;  5KT7 A;  3K58 A;  4YY3 J;  1VQK S;  3GZ7 A;  1YRT A;  1HMV B;  3EX7 B;  2R2T A;  2RS8 A;  4RNM A;  4JI6 J;  4LRE A;  2MJN A;  1XN9 A;  4R5P A;  2CQ3 A;  2ZBQ A;  1FWK A;  4WFZ A;  1AB8 A;  4ZK7 M;  3UR0 A;  3IAM 9;  5IT0 A;  4M5G A;  1VJQ A;  2B5J B;  2KZM A;  2ZVS A;  1BQM A;  1LEO A;  4A8K A;  3HFK A;  3IRX B;  4IH6 A;  4ZA1 A;  3ZZT A;  4YHH J;  3T1H F;  3KHL A;  1X5O A;  2ZNZ A;  1NHK L;  2VD3 A;  4ILM A;  4W98 A;  3NKY A;  3SCK E;  1UET A;  1B3T A;  4EWT A;  1TU0 B;  1PO6 A;  4DFJ A;  1JLC B;  5LMN F;  2OP5 A;  5F41 A;  3ZTR A;  1U24 A;  4P71 A;  4B3T F;  1UJ4 A;  4YQW A;  4YUD A;  1VQS A;  2Y8Y A;  4Q8F A;  4QU7 A;  3G4S S;  2ZIT A;  5DO2 A;  1U0S A;  2W9B A;  4V19 X;  2DY1 A;  4IG0 B;  4ES2 A;  4U7U D;  2VQE F;  1Q5V A;  5KAK A;  2W2Q P;  1Q8I A;  4MJK A;  1TKD A;  2N7Y A;  3DYA B;  3MD3 A;  4Y0F A;  3B8H A;  3GFZ A;  1I94 F;  2XMT A;  1G2E A;  5CZX A;  2V8G A;  3NNA A;  1JMT A;  2AU0 A;  2HHS A;  4OLP A;  3OR2 A;  5LT5 A;  2H65 B;  1Q79 A;  2XI2 A;  4OZ3 A;  3ULH A;  2Z2M A;  3UCG A;  1V3S A;  1OO0 B;  1HQE A;  2J7K A;  2RUG A;  4QYR A;  1VBX A;  3Q2T C;  2ATC B;  3FQL A;  1WF2 A;  1PCA A;  4ZN3 A;  2D7S A;  1RDR A;  1NUE A;  4DL7 A;  1FE0 A;  2ZM6 F;  1WC0 A;  3V6K A;  3RBE A;  1F6T A;  5JVG Q;  1D0E A;  2MST A;  4OV6 A;  3BBF A;  4IG3 B;  1N54 B;  3MPD A;  2FHM A;  5E3Q A;  1BQM B;  1UZH A;  3LGN A;  3DLG A;  3AD7 C;  2HLU A;  4NXN F;  2XZW A;  3FCH A;  4HH0 A;  3C16 B;  2BZ2 A;  2HND A;  3LP1 A;  2ZHB A;  2GO8 A;  2V34 A;  1QM9 A;  3OFE A;  3H42 A;  2CZV C;  1YRU A;  2OJ3 A;  1RUS A;  2UUB F;  1Y0H A;  3W5X A;  3L4B C;  2CDR B;  5KFG A;  3U02 A;  3RAQ A;  1U1M A;  1C0U A;  1H73 A;  4RWX A;  2YPZ A;  2RKI B;  1WUU A;  3MTK A;  4Y2K A;  3UCU P;  2Z4P A;  2KYZ A;  4DFK A;  1PSD A;  1URR A;  3M8Y A;  1S0N A;  1SI9 A;  4YHH F;  1HPZ A;  2AYB A;  4G1Q A;  1RT6 A;  1S72 S;  3IG1 B;  1FRK A;  2ASY A;  2JH3 A;  3CJ8 A;  2LEA A;  3RUB L;  4QIF A;  4OYW A;  2DPI A;  4KC5 A;  4B17 A;  2WAQ D;  5FLX Y;  2EKN A;  3NS5 A;  2DHS A;  3ILJ A;  4QQB A;  4TN2 A;  3RGI A;  2Z2L A;  2QSW A;  4HYK A;  2FJW A;  2DHH A;  1G7C B;  4KGM A;  2BJ8 A;  1LW0 B;  4Z7Y A;  2B8P A;  3EZU A;  4ZPW R;  3TAM A;  4X65 F;  1RTD B;  2NLW A;  2QYG A;  5AXK A;  4DR5 F;  4QJV A;  4L76 A;  3PW7 A;  3W7B A;  5K8O A;  2HFN A;  2BEF A;  1IWG A;  2H1Y A;  4WCE Q;  2BE7 D;  5D15 A;  4LF7 J;  2WOM A;  2MGZ B;  4OYB A;  1ICE B;  2G1H A;  3EUN A;  3QWP A;  2NUH A;  3TP2 A;  3D1Q A;  3UE2 A;  1SIZ A;  1QY7 A;  4DV3 J;  1GXU A;  4USK A;  5CYQ B;  4PWW A;  2AZ3 A;  4C8M A;  1YJW S;  4B9N A;  4KH0 B;  2BUN A;  2ZJP Q;  3EPI A;  1U6B A;  3CCE S;  3LWM A;  2UVW A;  3BO4 A;  1SXL A;  3KNG A;  1N6Q B;  2D3U A;  4HL9 A;  2HAI A;  4ED3 A;  3J81 Y;  3R6L B;  3Q0A A;  1QTM A;  2GIF A;  4LJM A;  3FZ2 A;  3GG0 A;  3MM8 B;  4ICL B;  3RRK A;  1AFJ A;  3VGS A;  4N56 A;  3CE8 A;  3HHL D;  2WON B;  4TYB A;  2DGW A;  2LEP A;  3U7J A;  3FRY A;  4NLQ A;  4YY3 F;  4FKY A;  3O8W A;  3BGF A;  4UST A;  3KJV A;  1SKR A;  1TFY A;  1UVI A;  4U9R A;  1NJX A;  1R43 A;  1YLX A;  2P9G A;  2EFP A;  3DN9 A;  2I6W A;  2CWX A;  2YNG A;  3DOM B;  1RT1 A;  3W9H A;  4ETZ A;  2R4F A;  4C9D A;  4DV1 F;  1S12 A;  2FLL A;  4USV A;  3TQ1 A;  3MAA B;  3MMB A;  5HQM A;  1EX8 A;  3DI6 A;  2ZM6 J;  3QPI A;  2FLO A;  3PX0 A;  3PYE A;  4PWU A;  2ZFH A;  3EDR B;  2LXU A;  3KLG A;  3U1N A;  1RAC B;  3HHL C;  1OSD A;  3AOA A;  2WSF C;  5FD1 A;  4GC6 A;  4JI3 J;  2JL9 A;  3HMJ G;  3HHK A;  3DRR A;  5D0H A;  1IKV B;  3TJ9 A;  3MEC B;  1RT1 B;  5F0W A;  2X1G A;  1CJU A;  3MM7 B;  3Q86 A;  4BBY A;  4ED1 A;  3AB2 B;  1A6L A;  1F9F A;  1WC1 A;  4HEA 9;  4AT1 B;  4DR2 F;  2XO6 A;  1TR0 A;  2ASL A;  1Y5L B;  1KSP A;  1F5B A;  4TQR A;  4X4O A;  3LP2 B;  4OHW A;  2BAN A;  2BBE A;  3EVO A;  1HQU B;  1PJ6 A;  4DV2 J;  2DVI A;  4NXM J;  4OYA A;  4F02 A;  1VBK A;  1S1T B;  2W4P A;  3HSZ A;  4ZCK A;  1NK7 A;  2KFZ A;  5CYM B;  1MN9 A;  3WX4 A;  2HFU A;  2IRX A;  4ECU A;  3TUZ C;  2FHJ A;  1N8R T;  2J0Q D;  1X9S A;  3WX8 A;  3QAE A;  3IS9 B;  1ZYQ A;  2EC0 A;  4I67 A;  4JYA F;  5KFH A;  3M6W A;  1U8S A;  1RP5 A;  2EFG A;  2QO3 A;  3DLE A;  3JTO A;  2R7T A;  5KT5 A;  2OPP A;  2KFY A;  2HRY A;  3RTV A;  2KXF A;  5E3R A;  1RHR B;  1Q53 A;  3CGI A;  2FHJ D;  4FF3 A;  2FTR A;  4F25 A;  2BJ1 A;  1RKJ A;  4IOA Q;  4K4S A;  1RT5 B;  1S97 A;  5KG3 A;  2EPI A;  2BE2 B;  4QIW D;  4J90 A;  3H40 A;  4NYO A;  5L1L A;  1F0X A;  3V4I A;  1SQG A;  1FD2 A;  3AXM A;  1NCL A;  4OI3 A;  3PKM A;  1FX2 A;  4CTA A;  4B9T A;  5M2U A;  5ETN A;  4OYP A;  1HNW F;  1LWE A;  3MM6 A;  3PYF A;  2V9W A;  2EK6 A;  3W3S A;  3K5P A;  4K50 A;  2HWT A;  4B9M A;  1LWC B;  2NCK L;  1NRK A;  3IGV A;  3ISZ A;  2J9C A;  2KO1 A;  1GK8 A;  4ZCL A;  4NLP A;  1W26 A;  2M3D A;  2HNY A;  3CED A;  3R5J B;  4F4A A;  3HPO A;  1U4B A;  3BSC A;  2B7B B;  1RAG B;  5DM6 Q;  1T7P A;  2FDN A;  3IBF B;  1JLA A;  2DRA A;  5AXM A;  3FJ2 A;  2HWI A;  1CJK A;  5BR8 F;  2HIQ A;  5LXY A;  3T19 A;  2FJB B;  2Q66 A;  3DRY A;  2VG6 B;  1N5Q A;  3NEK A;  3OUY B;  2FZK B;  3LGH A;  4KQZ A;  1DTQ A;  2MZS A;  3OTC A;  2IPO B;  5F8J A;  1WC6 A;  2YWW A;  3DOK B;  3GJT B;  4MK9 A;  2AQ4 A;  3UN2 A;  2IM1 A;  4A8M P;  2OAU A;  4GKK J;  3AA9 A;  2IBO A;  3W1Y C;  5H9E K;  4ZP7 A;  2EW9 A;  4C97 A;  3V6D B;  4IRC A;  1XMO F;  3GWC A;  1S79 A;  2PFD A;  2RUS A;  2ZVI A;  3PAC A;  4HDG A;  4LIW A;  5HRO B;  2VPZ B;  4FVC A;  2HWH A;  2JC0 A;  4UUW A;  4CO3 A;  1FI4 A;  3GIL A;  3H20 A;  3PRB A;  3S7R A;  1S9E B;  2VG5 A;  1HNI B;  3OL6 A;  1QAI A;  4NA1 A;  4K4U A;  5A6P A;  4OI2 A;  2DY9 A;  1AA1 B;  1VQ9 S;  3OW2 R;  4PG7 A;  1SV5 B;  5AXL A;  5K8N A;  3BGL A;  5J2Q B;  1TUG B;  3QFW A;  4CO2 A;  4F7V A;  1EAR A;  1DQA A;  3UPF A;  1IBK J;  3W2V B;  5AE2 A;  3MMJ A;  3BGO P;  4LQ9 A;  3MMC B;  4F4W A;  4EEY A;  1DTT B;  4FZV A;  1TVR A;  2FVR A;  3DRS B;  4W4M A;  1S48 A;  2BKN A;  2RHQ B;  3H2V E;  4IDK B;  2PI5 A;  7FDR A;  1WKK A;  2LCW A;  3N79 A;  4WP9 A;  2IFX A;  1B70 B;  2OEL A;  4M5M A;  1ZPW X;  3KLH A;  4RU2 A;  1FNM A;  1ELO A;  2HHT A;  1E6V A;  1NDC A;  3QYY A;  1KQG B;  2W4C A;  2H5I B;  3DGP B;  4DN9 A;  4FYV B;  1Y10 A;  4PXC A;  3MHY A;  4IFY B;  3I31 A;  4LBP A;  4RBV A;  3Q89 A;  4IO1 A;  4EYI B;  4CT9 A;  1NND A;  1IXK A;  3MPY A;  3IBW A;  3ITH B;  4M5N A;  1VRT B;  4HT5 A;  3ZNU A;  5A8R B;  2IAJ A;  1SJF A;  2OI2 A;  4PG5 A;  2KM8 C;  4GVB B;  2LLZ A;  7AT1 B;  4X65 J;  4FVM A;  3SCJ E;  2L9N A;  4DQI A;  2UUW A;  3FRZ A;  2UUA J;  5LM7 E;  4DXL A;  3D54 A;  3VAI A;  3E01 A;  3Q8P B;  1UKU A;  5DDP C;  4X4P A;  4XIU A;  4YP3 A;  4ELU A;  4LF7 F;  2AJ0 A;  3M05 A;  1QAY A;  3R9L A;  1QAJ A;  1V5I B;  3BF4 A;  4CRJ A;  2C2E A;  1QUV A;  1WD6 A;  4HDH A;  4Y2C A;  2LQ8 A;  2A3J A;  2B0G A;  4DZ6 A;  5LSL A;  4IOB A;  1FK9 B;  2A0F B;  4C3L A;  2HNZ A;  3RW6 A;  3KK1 B;  1NZA A;  3RBZ A;  3TAM B;  5HVH A;  1CLF A;  4NL5 A;  4HI1 A;  4DL4 A;  5B0E A;  4EZ9 A;  2XS2 A;  4FS2 A;  4KGV B;  2W7O A;  1PIE A;  3UD3 P;  2ZH3 A;  1EP4 A;  4O4G A;  3MAA A;  3MMB B;  1H6K X;  3CIZ A;  6FDR A;  1RCX B;  3TAN A;  1S1U B;  3T1Y J;  1N0U A;  1M1K T;  2AMC B;  2CQI A;  2EFV A;  2C3Y A;  1LV5 A;  2K3I A;  4FYW B;  1VC0 A;  1X4E A;  2F5G A;  2LU1 A;  3BRE A;  4DX5 A;  1FEH A;  3TZX A;  3G8T A;  1R3N A;  3W60 A;  2RQM A;  3JAM U;  3NNH A;  3MI7 X;  5K5M A;  1XEZ A;  2OD4 A;  4AL7 A;  2HZC A;  3GTY X;  4L75 A;  4I2Q B;  4DN0 A;  2R2S A;  2DTJ A;  4AQY F;  4ICL A;  2HRT A;  4JP8 A;  2MQQ A;  3BKT A;  1T94 A;  2GO9 A;  3LGM A;  1RE1 B;  3PIO Q;  2XLJ A;  3OFG A;  2ZH6 A;  4CM0 A;  3CUL A;  1GH8 A;  3PY8 A;  3M8Z A;  2MZT A;  3MTJ A;  2V4J B;  4YDD B;  2XCP A;  3V4I B;  1N5Y A;  4PRF A;  4IFY A;  3M9O B;  1BXN A;  3GG1 A;  4X4R A;  4DUY J;  5HN0 A;  4MTP A;  1JXV A;  2FLP A;  4BDP A;  3UNY A;  2MGZ A;  4ZLJ A;  1M5S A;  1RBO B;  2AWZ A;  3KKF A;  1FKO A;  1A7G E;  3D6F B;  2NXC A;  4UOH A;  2HYI B;  2GVD A;  3KLH B;  1ZA2 B;  4KGX B;  2V4J A;  4O44 B;  5GAD U;  5D4O A;  3DDI A;  4YR0 A;  2NRE A;  2EI5 A;  2JVO A;  2EC2 A;  3IBC B;  3NWR A;  1IJF B;  4W92 B;  4GKJ F;  1FJE B;  2F3J A;  5A6W A;  3AA8 A;  1TKX B;  1VFJ A;  4KGZ B;  1PJ7 A;  1U0H A;  1WOP A;  2V8D A;  4PEO A;  4AE5 A;  5FLX U;  1SIW B;  2K7J A;  4JI0 F;  3KK3 A;  3J80 Y;  3KLE B;  1RT3 B;  2IC3 B;  3MCO A;  3VVU A;  2FVS A;  2RF2 A;  2Z58 B;  4KGK A;  1LOU A;  1CQN A;  1GMW A;  2G2Z A;  3NGD A;  3HT3 A;  2X51 A;  2W25 A;  2G13 A;  4ILR A;  4M1K A;  4AD6 A;  3KK2 A;  2V9K A;  2XMJ A;  4MFB A;  3KHR A;  2R2U A;  3KG4 A;  3GFY A;  1QD1 A;  4CYU A;  4EFA C;  1TMM A;  4RR5 A;  4F0M A;  1ARO P;  1J2V A;  3M2R A;  3Q8Q B;  4LMZ A;  4CDI A;  3P8B B;  1LK7 A;  3MDF A;  1CC8 A;  4WFY A;  3UO0 A;  5I42 B;  5CH7 B;  3ZZP A;  3BJY A;  3F56 A;  3DI6 B;  4M63 A;  3CMQ A;  3GJR B;  2V8H A;  3M32 A;  4UOG A;  3BDP A;  3DOK A;  4KJI A;  5EN1 A;  4J9K A;  3I32 A;  4Y2A A;  4WFX A;  3D5M A;  1F5A A;  2K7K A;  4ANC A;  3DCA A;  2XM3 A;  6AT1 B;  5L1J A;  3FMB A;  2EFQ A;  1FDB A;  3EGN A;  3CWJ A;  2XWY A;  2APO A;  3BGU A;  4ZMM A;  4DR2 J;  1G6B A;  4O4R A;  5DLG A;  2LEB A;  3I82 A;  3QRP A;  4DUZ F;  2E7W A;  2BKO A;  2G9O A;  1D9D A;  1SQE A;  2HQD A;  3NNC A;  1E6Y A;  3NCP A;  1DQ8 A;  4NLY A;  2QC3 A;  1T9W A;  5A0Y B;  2CDQ A;  1PC5 A;  1BE4 A;  2ZC4 A;  3H59 A;  3OTD A;  3G96 A;  2XCA A;  4DFP A;  1TL5 A;  4CO0 A;  3R5A A;  1W25 A;  1O0P A;  3IRW P;  2CQC A;  2F1F A;  2VFV A;  2X3D A;  4LRD A;  4V1A k;  1UJ5 A;  1P6T A;  1HWU A;  1UFK A;  2RIJ A;  3AJD A;  4EGL A;  4DOZ A;  5AJ3 J;  1N5S A;  2V2Q A;  5EX3 A;  1N52 B;  1VQ8 S;  3HSJ A;  1H38 A;  4N8N A;  3VAJ A;  4F4Z A;  5J2P B;  5EUH A;  1T9Y A;  4J9U E;  1IBK F;  4I6A A;  1I5O B;  2PEB A;  5E41 A;  1B4S A;  5JMN A;  3MFI A;  1MSW D;  3MEE A;  3LAN A;  4NZ7 A;  2XO7 A;  3BYP A;  5HAO A;  4Y28 C;  4ZIV A;  1HBO A;  2E5L F;  1GNK A;  4KT0 C;  2E1P A;  2ZWO A;  1S9G B;  1RHQ B;  1IWA A;  3D0I E;  1JQG A;  2LP4 A;  3NP5 A;  3OXF A;  3GON A;  4Y34 A;  3G8S A;  2B9X A;  2LEC A;  4DV3 F;  3NBP B;  1FRI A;  1N33 J;  1YSJ A;  3J81 U;  4MK8 A;  3CT9 A;  2VIH A;  3KOA A;  4B08 A;  4TXS A;  3TYT A;  3CC2 S;  2NYI A;  4DI6 A;  1NHU A;  5KFF A;  3G8Q A;  3JYT B;  4NEZ A;  3KJF B;  3HCX A;  1TV6 A;  3R5C A;  3VWS A;  1HWK A;  2CNO B;  2PA3 A;  1JLF B;  3KUH A;  5HSP A;  2GMH A;  1R27 B;  4AYB D;  5GAH I;  1KFS A;  1IKY A;  2R8H A;  4C8O A;  1CPZ A;  2C28 A;  1YBA A;  1SCJ B;  4QW8 A;  5HMZ A;  3TEH B;  3C16 A;  2D41 A;  4RU9 A;  4N76 A;  3CDW A;  3TA1 A;  1X5T A;  4OI4 A;  3J7Z 5;  3K59 A;  1YKW A;  1WAC A;  4QR1 A;  1NK8 A;  1WI8 A;  3V6J A;  4JI4 J;  4PWD A;  1HQ2 A;  1YBT A;  3SQG A;  1IKY B;  1S5Z A;  4DV4 J;  2HVD A;  3EVM A;  4U8V A;  2DB1 A;  3OFH A;  5A76 A;  4DV5 F;  1CG2 A;  3KK2 B;  4I64 A;  2M2B A;  3MCN A;  2VKR A;  1HW9 A;  1N88 A;  5GVQ A;  1U6Z A;  2OSR A;  2P2C B;  4TLQ A;  1GMV A;  1OY6 A;  2JEI A;  4ZDN A;  4B3O B;  1TEL A;  2IYI A;  1KON A;  4MIA A;  2B4P A;  3F44 A;  3W63 A;  1ZS6 A;  2CNL B;  1BLU A;  4ZOS A;  4B3S J;  2H54 B;  3QMQ A;  1ZAV A;  5E3A A;  4DHV A;  2VPW B;  3OTB A;  2WSE C;  3GYX B;  5HJY A;  4DV7 J;  1YQH A;  2DIT A;  1HNV A;  2ILY A;  3GIR A;  2WVC A;  2YQ0 A;  3OFF A;  4OI1 A;  1D8Y A;  2OIH A;  1S76 D;  2BJD A;  1DJ0 A;  2AJ2 A;  4UZC A;  5B0G A;  4Z7C A;  3ITH A;  4ZVH A;  1RAH B;  1XR5 A;  3BPD A;  1C0T B;  2OPQ A;  3M8P B;  4LR8 A;  4M5D A;  3AD9 C;  1S6U A;  3GSD A;  3VAK A;  3K17 A;  3C46 A;  2B56 A;  3CD6 S;  2GHW A;  1VHF A;  2YWF A;  2DR6 A;  2JJ4 D;  4K8R A;  2KVQ E;  3TUJ C;  1TL1 B;  2HQ3 A;  4ECV A;  4Q2L A;  2PII A;  2KU7 A;  4WYL A;  5GAG U;  1NKE A;  4HAC A;  2E9T A;  1BWE A;  1SL2 A;  2M9K A;  2LDY A;  1C0T A;  2QTW A;  1K44 A;  1IR2 A;  3HSD A;  4M8L A;  3NGT A;  3JSB A;  4RW7 A;  2B6A A;  3DHW C;  5LJ3 Y;  2CIM A;  3EGW B;  3DRS A;  3ZFV A;  1NK9 A;  4NZ6 A;  2WW4 A;  3KDO A;  3MPW A;  5HBM A;  2L9W A;  2M52 A;  2YNI A;  4JV0 A;  4FDF A;  4KAI A;  2XS7 A;  3RB4 A;  1WEX A;  2V6A A;  4LFB F;  1NHV A;  2ZKU A;  4H4O B;  4J9S A;  5D78 A;  1EJ7 L;  2HMI B;  1R0A B;  3A3N B;  5ETO A;  1TL3 B;  3R2C J;  4ZHR B;  2JWN A;  4FP9 A;  3TZW A;  3UD5 A;  2DR7 A;  1G3O A;  2LQ9 A;  3A8J A;  3AB4 B;  3MR6 A;  1S9E A;  1H0H B;  4EUV A;  4I2P B;  4NLX A;  2G0I A;  3W5Y A;  3QQC D;  1SL1 A;  4OZJ A;  3IRX A;  1S49 A;  2VJV A;  2XEX A;  4K4X A;  2F7V A;  5KFN A;  3TZZ A;  2MXY A;  1ZTT A;  2F8E X;  2H5E A;  3C15 A;  2QLJ B;  3AJ1 A;  5T41 A;  3L3C A;  2CPZ A;  2YX4 A;  1AYE A;  1ULR A;  1RIS A;  5KFP A;  1DTQ B;  2Y9H A;  2ZH8 A;  5BYQ A;  1ZET A;  4ZN1 A;  2D3O 1;  4KBI A;  1KOO A;  3IMQ J;  3VAL A;  2GX8 A;  1SC3 B;  2B4V A;  1OY9 A;  3LOU A;  1KQK A;  5KFT A;  3ZZ0 A;  3JSM A;  2QLW A;  2K06 A;  2CAD A;  3MR5 A;  3HD1 A;  4AXJ A;  4KPY A;  5F8G A;  1CC7 A;  2H51 B;  3CCS S;  1X4H A;  2BX6 A;  3GV7 B;  2N3L A;  2ZJQ Q;  1RU1 A;  2L48 A;  3GFH A;  1KDN A;  3BSA A;  3I6P A;  4TVA B;  4DPX A;  2J9E A;  5LSO A;  1U09 A;  2ROG A;  3MUV P;  1J5O B;  5EWG A;  3GV8 B;  4OIX A;  1UVL A;  3NL0 A;  2RSQ A;  4DSE A;  4Y3C A;  3MR7 A;  4PQA A;  3OL7 A;  1R8P A;  3C14 A;  2HHV A;  1VRT A;  1FXD A;  1SC6 A;  1U1L A;  1NK6 A;  1HD1 A;  2IMW P;  3N9U C;  4C4W A;  1MWY A;  3DMJ A;  4A8F A;  3M2V B;  2OFG X;  3OV7 A;  3MUT P;  3UWT A;  1FX4 A;  2ILZ A;  1FKO B;  1E6V B;  2B3T B;  3RU0 A;  2YX1 A;  2HVE A;  2OGU A;  2YNF A;  3QGI A;  5L38 A;  1GX6 A;  3JAM Y;  3SV3 A;  2ZZN A;  4ZS6 A;  3TX0 A;  3TAR A;  4B9U A;  3DU6 A;  3SCI E;  4CLZ A;  4QYZ K;  1HBU B;  4LRC A;  2CPI A;  2P9C A;  3PCO B;  1RWM B;  2F9J A;  3DLE B;  4OHY A;  1FVQ A;  2U2F A;  3D9B A;  1JLQ A;  4KO0 A;  4C0H A;  2YKQ A;  4EBC A;  4G1I A;  3RYL A;  2R7V A;  1A0O B;  1GT8 A;  2DBB A;  1T9X A;  2DHG A;  3GYG A;  2KB2 A;  2KYX A;  2QL9 B;  2X7I A;  3QAT A;  1VQO S;  4H4M B;  1S4F A;  4K4V A;  2VQF J;  4V19 J;  5D8H B;  1SJ4 P;  3TEG A;  1O51 A;  3HJF A;  1HWJ A;  2SXL A;  4X64 J;  3QIP A;  1AFI A;  1FDN A;  1V9O A;  2VBX A;  3PYD A;  1N36 F;  3Q22 A;  2ZBC A;  2ZOM A;  3PX4 A;  4MIW A;  3UVJ B;  2XC9 A;  3BEG B;  2ZBP A;  4USH A;  2NZC A;  3QZ8 A;  1H2T Z;  2F8H A;  1VLO A;  2MLX A;  2HUR A;  1SH2 A;  1Y5N B;  3D6M B;  3M1V B;  4U67 Q;  3AXK A;  2E5J A;  1RT7 B;  4CLS A;  5KOW A;  1VDH A;  2A2D A;  2FZG B;  3JXO A;  5CD4 H;  1HHT P;  1FFW B;  3G9C A;  2BJ9 A;  3D6H B;  5KT6 A;  2BJ7 A;  4RL1 A;  5L9X A;  4A8O A;  4RUA A;  3JSR A;  3V6D A;  5J1N A;  4PR6 A;  1YIJ S;  2ZOF A;  3TI0 A;  1XMQ F;  3P45 B;  2B9W A;  2QJ3 A;  1HNZ F;  1JLE A;  5RUB A;  1PAU B;  4X64 F;  3G2X A;  5HK4 A;  1YVF A;  2NS1 B;  3MMA B;  1EET B;  2HNZ B;  3T9Z A;  4LQ3 A;  1Q7L B;  5LMU J;  1SKS A;  2UXC F;  5LJ5 Y;  2BE9 B;  2UV8 A;  2M0G B;  3CTR A;  1RTI A;  2KHD A;  4A8S A;  1SJ3 P;  5D0R A;  1Q0N A;  2XG8 A;  2ZH4 A;  3AH6 A;  4A48 A;  1QVG R;  2BOP A;  2OEK A;  2ZE2 A;  4OYZ A;  1I51 B;  3F0N A;  3HDS A;  3NOC A;  1V6H A;  1WEL A;  2QA2 A;  1Y11 A;  3H5S A;  1NB2 A;  4TY9 A;  4DR3 J;  4QU6 A;  4ZJO A;  4HHU A;  4B3S F;  2CQD A;  5F8I A;  1RHK B;  2OTJ S;  2DO0 A;  4P75 A;  5BYR A;  3LA0 A;  2GQQ A;  4ID5 A;  2QMW A;  3TOQ A;  3HD2 A;  3SXL A;  1SB6 A;  4QIE A;  3W2W B;  4B3T J;  3M30 B;  3CMA S;  4DF4 A;  2E9Z A;  3ZNJ 1;  1H7W A;  2LKZ A;  1KVJ A;  3LQV A;  2GHV C;  3MZI A;  4PG6 A;  4O3P A;  4OX9 F;  4DV0 J;  2A18 A;  2C3M A;  4CNY A;  2GQ2 A;  3MEG A;  1NME B;  3DGP A;  1VQM S;  3FGV A;  3O1L A;  1R8H A;  2L08 A;  1OS5 A;  3M8Q A;  5JXS A;  3I4P A;  2IDL A;  3TW0 A;  1RWU A;  1KN6 A;  1HI0 P;  3AQO A;  1MG7 A;  2KM8 B;  3FMW A;  2YPY A;  5D0E A;  2VPX B;  3SQG B;  2N3O A;  1RTH B;  5L8R C;  4USM A;  1T02 A;  3QO9 B;  4RO0 A;  6FD1 A;  2FJE B;  2D9O A;  4LSL B;  2IVF B;  3BO2 A;  1U02 A;  4RNN A;  3ET6 A;  1FER A;  2CQ4 A;  3I9Z A;  3OLA A;  2DHA A;  3W61 A;  2GVZ A;  1TKZ A;  1NPR A;  3T1H J;  2V67 A;  2XY6 A;  1NJY A;  2KZZ A;  3IR6 B;  4XPC A;  5DQI A;  4YFU A;  2PFF B;  4X4V A;  4F3O A;  3R7S B;  4G1Q B;  4X62 F;  1PGZ A;  1X7V A;  1S6Q A;  2V68 A;  3BN4 A;  4DUT A;  2YBV A;  4RUB A;  2W9A A;  3RR8 A;  4ELV A;  5C25 A;  4JI4 F;  2GZO A;  3UDV A;  5D4N A;  3H0P A;  3QIP B;  2BM0 A;  4OMF G;  1N4L A;  3MM5 B;  4ZP6 A;  2RQ4 A;  3TUI C;  3NBP A;  3OXG A;  2HLT A;  3HHL A;  1YJR A;  4ECR A;  3ICL A;  3IA0 A;  2AT1 B;  2YNI B;  5CD4 A;  2AEJ A;  2GIR A;  3GLJ A;  1R6V A;  4P2S A;  4LUB A;  5GME A;  3ET6 B;  4OYX A;  2MQM A;  2DIS A;  3HVT B;  3VCD A;  5KTQ A;  3PO5 A;  3WBZ A;  1I94 J;  1N0V C;  2C2N A;  3CD0 A;  1FKP A;  2Q1L A;  5E3C A;  5IQ6 A;  3IN5 A;  1WWH A;  1X8D A;  2BKP A;  5KFL A;  4AXI A;  4RW6 B;  5A8W A;  4ZP9 A;  1C1C B;  2OMO A;  2BE2 A;  4ZCI A;  1UA1 A;  3EGV A;  4NI2 B;  2JNJ A;  4DG1 A;  2UVR A;  2WVF A;  2DGQ A;  4JI2 F;  5E2Q A;  4Y00 A;  4JI5 J;  4OZN A;  1UVM A;  2DEJ A;  3US5 A;  4PQU A;  2V0N A;  3VR1 A;  3M30 A;  5MAO A;  1TL4 A;  1T9U A;  4X84 A;  3ENV A;  4USW A;  3UDE A;  1F9E B;  1U25 A;  4ZPD A;  5GAE I;  2BQR A;  4CLL A;  2L9D A;  2MKJ A;  2AGQ A;  1X0F A;  1G1X A;  4DR6 F;  5T7L B;  4R25 A;  3M8R A;  3EE3 A;  3M6U A;  1U45 A;  2J6S A;  2LYV A;  5CYM A;  3J7Z T;  3ELH A;  2Z0G A;  1E6Y B;  3VHQ A;  1T03 B;  4ZJQ A;  4LF6 F;  5AJ3 F;  3R2D J;  2IJF A;  1K73 T;  1WNE A;  4P72 A;  1CS4 A;  1REG X;  2FQQ B;  3V81 B;  2BW7 A;  4LBI A;  4C8N A;  1HI8 A;  1HBM A;  4K4W A;  4ED8 A;  3LPE A;  3M9M B;  4ECZ A;  2LXF A;  3CCM S;  1GXL A;  3GU0 A;  4NLW A;  2PD1 A;  4WWS A;  5ETT A;  3GSI A;  1T95 A;  2IJR A;  1TK5 A;  2HFS A;  3KJN B;  4RBU A;  2XQC A;  5C2G A;  3FCW A;  2XSJ B;  4ZPA A;  4J9O A;  1W7W A;  4FBU A;  2FIU A;  3L9Z A;  5IC6 B;  2CPH A;  5D6G A;  2DCU B;  3RZA A;  5ETR A;  3OL8 A;  3PVX A;  4NLT A;  4F8R A;  1IR1 A;  5A2Q Y;  3Q24 A;  1M5H A;  2X3G A;  4KFB B;  4ZVE A;  2Z2Z A;  1UL3 A;  1T05 A;  1AW0 A;  3HJV A;  3PNI A;  5A2Q U;  1HQU A;  3QJL A;  2MQN A;  4JI6 F;  3MED B;  2HFZ A;  3UD4 P;  1U2F A;  4CM2 A;  5DDR C;  5DS7 A;  2HAF A;  4F26 A;  1HBN A;  3C6U A;  2BDP A;  3DLH A;  1TL3 A;  3HF5 A;  1VRU A;  2RRN A;  2WON A;  3LH2 S;  3OQ2 A;  4JI0 J;  3RBD A;  2MKI A;  1S1V B;  3G86 A;  4ZPV R;  5HRO A;  5HQL A;  1REV A;  1BQN A;  4DX7 A;  2X1A A;  3CC7 S;  2C2Z B;  5HBM B;  1UPP A;  3BBC A;  2YQ1 A;  3KMS A;  4GVB A;  1WG4 A;  4J5O A;  4DV0 F;  4NYZ A;  5D3G A;  4QYZ J;  2J9D A;  1HBO B;  1S7I A;  2E5I A;  4WXO A;  4ALZ A;  3UDC A;  3KJQ B;  4WII A;  3K8V A;  2NR0 A;  1HBU A;  3G71 S;  2B4O A;  3I0S B;  3ISN D;  2CG8 A;  1HNZ J;  5IZH A;  3HUL A;  4WTY A;  5FII A;  3KJV B;  4P2M A;  3KTQ A;  2CPY A;  4JYA J;  2P6S A;  1RAD B;  3UDL A;  5IV4 A;  4JV2 A;  1KFD A;  3K5L A;  2KJV A;  2VG7 A;  3CJ2 A;  1BQX A;  4PG8 A;  3MM8 A;  4LSZ B;  3GQC A;  1T9T A;  5L1I A;  5DQH A;  1R8A A;  1T03 A;  2YKO A;  2FC8 A;  1X4A A;  1EKR A;  4LRA A;  3C14 B;  5B0F A;  1B7Y B;  3S6E A;  2AKW B;  4M94 A;  3CDA A;  4IG0 A;  2RU3 A;  4LFA F;  4LVO P;  2A6O A;  4LF5 J;  1XBW A;  4OJ3 A;  4JI3 F;  1N33 F;  4PXE A;  4G6V B;  3QSY B;  4P6Q A;  1YJN S;  3HLU A;  2AHO B;  3D7S B;  3MPV A;  1FXL A;  1FRL A;  2RJZ A;  2DH8 A;  4ZKA A;  4FXW A;  4WZM A;  3ZTS A;  4K7Q A;  4AUK A;  1ACM B;  1TKT A;  2GHP A;  2QSF A;  1QJH A;  1JKH A;  1Y9O A;  3DRX A;  4P2X A;  1YJ9 S;  4FPR A;  4A47 A;  2IRY A;  5DLF A;  1RBA A;  2G1D A;  1VQ4 S;  1HNX F;  4M95 A;  1LW0 A;  4CLW A;  3O5T B;  1D09 B;  5CQG A;  2MMY A;  5IM0 B;  3GIK A;  2VKZ G;  4DL5 A;  1WTB A;  2DPJ A;  4DF8 A;  2N7C A;  1TUW A;  3JQK A;  2FVQ A;  3T1Y F;  3DLK A;  3K0J A;  1ZM9 A;  3ZZR A;  1MMN A;  4LSL A;  4OI6 A;  1QE1 A;  2RE1 A;  5KFZ A;  2UUC F;  1N5T A;  2KXN B;  1XJW B;  1DHM A;  2KHC A;  2HHW A;  3MD1 A;  3KK1 A;  2OO4 A;  3VGV A;  1SUQ B;  5GAE U;  3GIM A;  3W9J A;  4QW9 A;  1IBL J;  4O3R A;  2VF3 A;  4I56 A;  4NOH A;  1D8Z A;  4GKK F;  2QX0 A;  3ILL A;  1NPK A;  1CUL A;  2ZDP A;  1BD6 A;  3AOB A;  2RHS B;  5U47 A;  1F2H A;  1JLA B;  2RDJ A;  1NM2 A;  3QT8 A;  5AXN A;  2F65 A;  1CSJ A;  1WHY A;  5GAD I;  3T41 A;  2ZWP A;  3PV8 A;  4EMD A;  4ZCM A;  4KIA A;  1QSY A;  5EDW A;  2MHE A;  2NXJ A;  2GVZ B;  2H9Z A;  2DR8 A;  2N4C A;  1HR0 J;  2V2K A;  4DBQ A;  3JTN A;  3M6V A;  2KFN A;  4UQG A;  1U0H B;  5IWA J;  1XWL A;  4X2B A;  3OL9 A;  2V94 A;  3NGR A;  4TU8 A;  4ERD A;  4NLR A;  2W9B B;  3I55 S;  1WC3 A;  4PKD B;  2KTQ A;  5DRK A;  1SJ1 A;  3WC0 A;  3X1L B;  5L46 A;  3CDU A;  3QJP A;  3VGU A;  4CP5 A;  4Q2M A;  1RSC A;  1JLC A;  1IQZ A;  4P9S A;  4ZLL A;  4OV1 A;  2DXF A;  3I0R A;  4XPE A;  1O6X A;  8AT1 B;  1K1S A;  4ZVO B;  4NLU A;  2EXU A;  2O1P A;  4TNO A;  1KLN A;  2IA0 A;  3E01 B;  1N5Y B;  5L39 A;  1L3T A;  3SSS A;  5HO4 A;  1VQP S;  2OD6 A;  2Y8W A;  2MY8 A;  2RNE A;  4I1T A;  2XMW A;  5DG7 A;  2V2Z A;  4QOT A;  5H9F J;  2BW2 A;  3W2V A;  4OJH A;  5A0Y A;  4CLF A;  4ED4 A;  1JLG A;  4N47 A;  8ATC B;  2CYY A;  3NS7 B;  4CQ1 A;  2FPH X;  4NXN J;  2VUG A;  3NXZ A;  1T8E A;  4O3S A;  2AGO A;  5SUH A;  2KG1 A;  2R9L A;  2ZHO A;  3LP2 A;  1QDU B;  4CWB A;  2A6M A;  3QAU A;  1SQF A;  3I5C A;  3HKW A;  1YRX A;  2ZH1 A;  2JFD A;  1KOH A;  2VDH A;  4MYU A;  5KFA A;  4I4B A;  1XIQ A;  1T3O A;  3E51 A;  5F9L A;  2CJA A;  4ZVT B;  5KFQ A;  2DR9 A;  4Q8E A;  3CUN A;  4N77 A;  2GW8 A;  4RW4 B;  1NKB A;  2ZBR A;  3DRR B;  1SH0 A;  3DRP A;  2XTJ P;  3FFI B;  1SBR A;  2O01 C;  2QV6 A;  4K5R A;  4ZP8 A;  5K14 B;  2CFX A;  3T6B A;  4R8U B;  4ECS A;  4NPO A;  3QLH A;  5IM0 A;  2C3P A;  3KG0 A;  3KLI A;  4MAK A;  2BRL A;  1S6O A;  3FFI A;  5K14 A;  5M2R A;  2MQO A;  3SSQ A;  1J5E F;  1VIO A;  3IG1 A;  4L3N A;  5J2Q A;  3K89 A;  2BR0 A;  1W2B R;  5J2M B;  4IYQ A;  1NU4 A;  3PG9 A;  3TX8 A;  3G6E S;  2VA3 A;  2CJX B;  3KLG B;  1SJR A;  2C3U A;  1UW9 A;  1PJ5 A;  4LR7 A;  3DFE A;  4MH8 A;  3AD8 C;  5AE1 A;  2M5Y A;  3MF5 A;  3VZI A;  2F8M A;  1SUQ A;  1XR6 A;  4MIB A;  4USI A;  3R1H A;  1PAE X;  1IM4 A;  2DGT A;  2XSF A;  4LIR A;  2AP6 A;  5LMN J;  3IM9 A;  4EBE A;  1MW7 A;  1RBL A;  3CC4 S;  1NXI A;  2KG0 A;  1XTZ A;  4NLS A;  4F0H A;  3HXM A;  4IFV B;  1ZOT A;  4NAS A;  2CNN B;  3NG8 A;  2HZA A;  3BZQ A;  4DR7 J;  1JLQ B;  4KO0 B;  3B4D A;  1RTH A;  2VG7 B;  4AND A;  1YDL A;  4DV6 J;  2O67 A;  2GVD B;  3EJM A;  4MKA A;  5C24 B;  4X4S A;  1N34 F;  5KFV A;  1VQY A;  2VDI A;  5G4D A;  1NJI T;  3OR1 B;  3QSI A;  1RAA B;  4RPF A;  1RYR A;  3ZZZ A;  2LQ5 A;  2CRL A;  2O66 A;  2GA7 A;  4CNZ A;  2HQC A;  2Q43 A;  3MOJ B;  1EKS A;  3IXQ A;  1CQM A;  2HNY B;  5FDL A;  4ZVQ B;  2UXD J;  4DL0 C;  1EQM A;  3HI9 A;  5DG9 A;  4R0J A;  3DDK A;  2VZ9 A;  3EPG A;  2QT7 A;  1LWF B;  2D9P A;  4K2J A;  4WK3 A;  4JV5 F;  3D1O A;  1RLC L;  3CJR A;  3FDS A;  5DET A;  2DEI A;  3L7U A;  4DR7 F;  3HHL B;  2E9R X;  1U1N A;  2QEX S;  4DWI A;  2R7U A;  2XNQ A;  1RT6 B;  1SV5 A;  2E29 A;  2VON A;  4E0D A;  3KXD A;  3QNW B;  4MKV A;  3A8I A;  1KQF B;  1KVI A;  1RT5 A;  4DCP B;  2RB7 A;  2HQG A;  1FCA A;  4WFA Q;  3PIP Q;  3RB6 A;  2FJV A;  1C0U B;  2J5A A;  3BPS P;  5DM7 Q;  4CCH A;  1S6Q B;  3UI3 A;  2J0W A;  2QMU B;  2XY5 A;  3JTP A;  5KFO A;  1ZZF A;  4TY8 A;  5B0A A;  4IR9 A;  3SMZ A;  2VU5 A;  2AV5 A;  2Z57 B;  2UU9 J;  4RW8 B;  2AEM A;  4B9S A;  4A8Q A;  1TTH B;  4ZIT A;  2GJ2 A;  2XYP B;  5KG5 A;  5KT4 A;  4JI8 J;  3LW5 C;  3A3O B;  5I3P A;  2MZ1 A;  3T9N A;  1JLF A;  1H7X A;  2EBG A;  1FRM A;  4CLT A;  1RK8 A;  1TKT B;  2O5D A;  1J5E J;  4DDF A;  1HI1 A;  2J0X A;  5KFS A;  3PW2 A;  1HAR A;  1UWB B;  1IUJ A;  2JEJ A;  4QWD A;  5GMD A;  1NLK L;  3M8W A;  3PM9 A;  1UFL A;  5HAT A;  3UN5 A;  5KFC A;  2KDO A;  3BR8 A;  2HS0 A;  3EGZ A;  1HFE L;  2D3Z A;  3E8O A;  1RA6 A;  1FTR A;  3BKF A;  3K5O A;  4M5J A;  2JLG A;  1UCN A;  1T05 B;  2UVV A;  4LBH A;  4BHQ A;  1DRZ A;  4LF9 F;  1U48 A;  4UW2 A;  2DXD A;  2PEH A;  4DEZ A;  2BA9 A;  2YVS A;  4F3M A;  3NRB A;  4DUZ J;  1RTJ A;  4DS5 A;  1U1Q A;  5B0D A;  3H7H B;  2NXN A;  2IMO A;  4NCB A;  2R7S A;  4CTA B;  4NCA A;  5JJB A;  3KLF B;  4ER8 A;  1N56 A;  3RR7 A;  2XMK A;  4XDC A;  1VK3 A;  4O3N A;  1Y3K A;  4PCQ A;  3R8Y A;  4EU0 A;  2U1A A;  4U7C A;  3AQP A;  2VOD A;  4I6Y A;  1WKJ A;  3R7B B;  2WOM B;  4NI2 A;  3G6V A;  3FUY A;  1SH3 A;  4J91 A;  3PKY A;  3M8S A;  3PW0 A;  2OLW A;  2ZOG A;  3SZ2 A;  2Q6C A;  5D4P A;  1UZD A;  4DSF A;  3RRH A;  1NH7 A;  1FFG B;  2JDJ A;  1HHS A;  2DNG A;  2MZQ A;  1D1U A;  1IKX B;  1SC1 B;  3HVT A;  2YKP A;  5HJX A;  3FNN A;  1RAB B;  1S1W B;  2DGO A;  2OPS B;  4MT1 A;  2C22 A;  1P27 B;  4XTT A;  2RDD A;  5DZ6 A;  4ZIW A;  2YKN A;  4K5S A;  3NGU A;  3NY0 A;  2MY7 A;  1ZA1 B;  3EXY A;  3PZP A;  3G82 B;  4OLO A;  2MKS A;  1TFW A;  4J9P A;  1IVZ A;  2C42 A;  1QTN B;  4GVL A;  2IVM A;  5CHC B;  5DG8 A;  1F3F A;  1SJQ A;  4ED7 A;  3CO9 A;  1WC4 A;  3L7P A;  4HH1 A;  4Z37 A;  3CIM A;  3H90 A;  1UWB A;  3N6L A;  1Q8K A;  2WSC C;  3THP A;  4Q43 A;  2EKY A;  4QPT A;  1FJG J;  3P5T L;  3D28 A;  1TAU A;  4IUF A;  2HPU A;  3ILO A;  3LP0 B;  3W62 A;  2DIU A;  3OVS A;  2XGP A;  4OZL A;  1IQT A;  2XNR A;  3MED A;  4ZJL A;  3R1L A;  2B4U A;  3LPY A;  1UFW A;  2QA1 A;  4ETX A;  5C5J A;  4DQS A;  1PYT A;  1UTA A;  3BS9 A;  2HHP A;  3LO3 A;  3HO1 A;  1XQI A;  2HBY B;  3CCT A;  1XR7 A;  4DPO A;  3TAP A;  4NA3 A;  2E5G A;  3DLK B;  1V3R A;  3MGJ A;  2GIQ A;  2HBQ B;  3QGP A;  1FDD A;  4OX6 A;  4BCA A;  1MRO B;  3HVR A;  2RRA A;  4ECT A;  4UZB A;  3NWG A;  3DLJ A;  1NJZ A;  2UUC J;  1L3U A;  2VA2 A;  3KNA A;  2HFV A;  2GV1 A;  2W2M P;  4A8Y A;  2D3O R;  5CAB A;  2B43 A;  3L09 A;  2O3D A;  2IIH A;  3J80 U;  3BQ0 A;  4K0K F;  4XK8 C;  1GX5 A;  1OY8 A;  2NSC A;  3G6X A;  1YIT S;  3P6Y C;  2RKI A;  4YN3 B;  2K3K A;  1RJJ A;  2A1B A;  1RYS A;  4JI2 J;  1WF1 A;  1RZM A;  2PDA A;  2YH0 A;  1KTQ A;  4H4O A;  4RWW A;  2Y1J A;  1R0C B;  4IRD A;  2N4D A;  1WJ9 A;  2EEY A;  3DGV A;  3JS9 A;  2UZA A;  3KK3 B;  3H8Y A;  1JX4 A;  2BYC A;  3IP0 A;  1H2V Z;  2ZZT A;  2DXE A;  3BM7 A;  3IM8 A;  4UY8 5;  2XB2 D;  1QAX A;  4DL3 A;  1EHW A;  2ADB A;  1RT4 A;  4LF4 J;  1S9G A;  3FEY B;  3JSY A;  4PYA A;  4B3O A;  3I96 A;  2B7C B;  1I3O B;  5ETQ A;  4CH1 A;  4DSJ A;  4B02 A;  1OWX A;  4M5K A;  3SDE A;  2VOP A;  2LMI A;  2HGN A;  2Y1R I;  2MKK A;  1RTI B;  1WHX A;  3IO1 A;  4FN5 A;  4KKO A;  1VYA A;  4S0M A;  3MM9 A;  5B0C A;  4PUO A;  5J1P A;  2VFU A;  2DGV A;  2YY3 A;  3I5B A;  4LRB A;  4P73 A;  3TJ8 A;  1YJV A;  2CJQ A;  2VQE J;  1PBU A;  1RAO A;  3T3F A;  4OL8 A;  1FKP B;  2VPY B;  2GML A;  5BJR A;  1UJ6 A;  3M32 B;  2NYH A;  1RHM B;  3U1M A;  4DQR A;  1OQ6 A;  1RTZ A;  3GE9 A;  3A3P B;  1JK9 B;  3B78 A;  1REV B;  3CCZ A;  5G0R A;  2CVE A;  5K20 B;  2LA6 A;  4GO5 X;  2C2D A;  1LWX A;  1UEK A;  1X4D A;  1HHQ A;  2HQF A;  1M5K C;  1BWV A;  2PN6 A;  2PI4 A;  4FF4 A;  1Q8B A;  2I0X A;  1TL7 A;  2I38 A;  1NDK A;  2HK3 A;  4NX9 A;  5D0G A;  2ZH2 A;  3PX6 A;  2AJ1 A;  2DNK A;  3TR5 A;  4C7Q A;  2R8K A;  4HT7 A;  1H3D A;  1FRH A;  4N7T A;  4KSE B;  1PC4 A;  3ENQ A;  4PPZ A;  3H25 A;  5J2M A;  3H2U B;  4LF8 F;  3OJS A;  4KHP F;  5GAH U;  2KKH A;  3AT1 B;  2QA4 G;  1QLN A;  1TKZ B;  1CEZ A;  3QLH B;  2ZDO A;  1XNR J;  2HZV A;  4BC7 A;  3F41 A;  3J7Y U;  2K1R A;  3QFH A;  2Q3P A;  4Q5V A;  4FPI A;  4IOC Q;  1VQ7 S;  4QIG A;  4RUC A;  2EK1 A;  2DGU A;  3OTO F;  5DGA A;  2ASJ A;  1R8B A;  2YNH B;  2FHK A;  5KFW A;  2DNY A;  1UAW A;  1RWK B;  2BOA A;  3UR3 C;  1UW4 A;  4M5H A;  2R8G A;  3OBI A;  2XMV A;  1D9F A;  5KT3 A;  4UT4 A;  4J9V A;  3DDN A;  1VJW A;  4IQX A;  1XER A;  3B54 A;  3L7O A;  5C24 A;  3CCU S;  1KKH A;  2DRD A;  4FXD A;  2H4Y B;  1H98 A;  1R8C A;  2KRR A;  2HFO A;  4Y65 A;  2WBM A;  4ID5 B;  2NPF A;  1GAO A;  4AFF A;  1Q7Y T;  2E1C A;  1QSS A;  3AHP A;  3B4M A;  3EWG A;  3HZE A;  3PEJ A;  3D66 A;  1VOM A;  4GO7 X;  5E5N A;  3H5Y A;  3TAQ A;  2FVC A;  3HKZ D;  3CCQ S;  2AD9 A;  2KI2 A;  1QSL A;  4DSL A;  2DGS A;  5MLC V;  2XS5 A;  3WQP A;  4DQQ A;  1FNX H;  2ACM A;  2FY1 A;  3MEE B;  1U26 A;  1KRP A;  2W9C A;  2WBR A;  3TZY A;  2XLK A;  1VBZ A;  1S57 A;  4JI1 J;  2OFH X;  3Q83 A;  2H4W B;  1VIS A;  4O3O A;  2QIF A;  3ILI A;  1C1C A;  2W9C B;  4OHV A;  4OJG A;  5ITH A;  4TKT A;  1CJV A;  2OHD A;  4NWB A;  4NZ0 A;  2JZ5 A;  4KY3 A;  4KHM A;  2LQJ A;  1RT2 A;  4JUZ A;  1ZAW A;  2UUT A;  3M9N B;  1NJW A;  4LF2 A;  2QA4 S;  3FBC A;  3NCQ A;  1S9F A;  2BJE A;  1N5V A;  3BH7 B;  1T9V A;  2MZR A;  4KV8 B;  3BR9 A;  4P7V A;  3IWN C;  5B08 A;  5IV3 A;  8RUC A;  4QIV A;  3PW5 A;  3AFG A;  5B0B A;  4HVZ A;  2B8Q A;  2ZD1 A;  5A8K B;  2MPU A;  2Z30 B;  4X4T A;  4I2Q A;  1MMD A;  1RT7 A;  3BGR A;  4ED0 A;  5HMX A;  1PYS B;  4J9N A;  3VAM A;  3FKB A;  1WF0 A;  2F9D A;  1KR4 A;  2YKM B;  4EI2 A;  2UXD F;  1IM6 A;  3MAH A;  3U1L A;  2Z56 B;  1KWM A;  1SKU B;  2YX7 A;  3RG6 A;  1KNZ A;  2MLY A;  3SIP B;  2MSS A;  4C8Z A;  4Q45 A;  1KQS R;  1ZZN A;  2HHH F;  5J2N B;  1JNZ B;  2M4M A;  2HND B;  1EB0 A;  1HKA A;  3LP1 B;  4XDD A;  1N34 J;  1YK9 A;  1MML A;  2XZT B;  5ETM A;  3VV2 B;  2ASD A;  1FD8 A;  1K9M T;  1T11 A;  1NK0 A;  4RW8 A;  3EYZ A;  2ZH7 A;  3IR5 B;  2XYG B;  2DGX A;  5KG1 A;  2YWG A;  4WYW A;  3T5L A;  3GJS B;  3PW4 A;  2DK2 A;  3PRV A;  4F67 A;  2IM2 A;  4O0N A;  2BM1 A;  3CJ5 A;  4ZVR B;  4RW4 A;  5M2P A;  2B9Y A;  2XMM A;  3WDO A;  1C1B A;  3X3U A;  2XY7 A;  1NB7 A;  4OJ1 A;  1CVJ A;  2HVH A;  4HTJ A;  1S6P B;  1HQE B;  2RU9 A;  2EVZ A;  3OTE A;  3QT5 A;  3OVB A;  3KYL A;  2UUA F;  2C2O B;  1JXL A;  5KFD A;  1NSP A;  1UP1 A;  2CPF A;  4MKY A;  4FNH A;  1VIX A;  4U6P A;  1KBR A;  1LXN A;  2PMH A;  1RTJ B;  2IA6 A;  3CCV S;  4ECQ A;  2J7U A;  1NAQ A;  2OPR B;  3CD7 A;  3CJ4 A;  4KR0 B;  2K2P A;  1SPB P;  4DS4 A;  2IAJ B;  1J5O A;  4JI7 F;  4F4Y A;  4RW7 B;  1X4B A;  3CCJ S;  1HWL A;  2G0C A;  1R89 A;  1VRQ C;  1RU2 A;  2Q79 A;  3J7A N;  5CCL A;  4DR1 J;  1U2C A;  2P9E A;  4WF9 Q;  1VHI A;  2V4Q A;  1AXQ A;  1NDL A;  2F40 A;  1SKW A;  1F5C A;  1PKU A;  4URG A;  3OR1 A;  3KDN A;  4PXB A;  4TQS A;  2R7X A;  3N6N A;  4ZPB A;  2OML A;  3MMA A;  5CZV A;  3I0S A;  1C4A A;  3FEX B;  3OT9 A;  3U27 A;  2W1B A;  5HQ8 A;  2QFJ A;  2EWH A;  2BXJ A;  2RIL A;  3ZZU A;  3I5A A;  4ITS A;  3CO0 P;  4IDK A;  3UNG C;  2CAJ A;  1VQ5 S;  2CPX A;  3FSI A;  1HYS A;  1NBE B;  2E1A A;  3C15 B;  3TNV A;  1S0M A;  1ZPV A;  4WE1 B;  3SV4 A;  1BY9 A;  2R3V A;  3UQS A;  3J7A 1;  2QLX A;  4K4Z A;  3KHH A;  2IRU A;  5KFB A;  3MAQ A;  2G2Y A;  2YKA A;  3GIJ A;  4JI7 J;  1RWV B;  2AZ1 A;  4KH1 B;  4IQM A;  3VVT A;  1B99 A;  2DNP A;  2XI3 A;  1I6J A;  2MQ8 A;  3P5B P;  4RW9 A;  3K57 A;  4DR1 F;  5HP1 A;  1DFD A;  3W64 A;  4OYI A;  5SZT A;  1F2G A;  3SFG A;  3PXG a;  2HEK A;  2JLF A;  2OKQ A;  4ZHR A;  3THT A;  3KHG A;  2MEW A;  4LVN P;  2YWK A;  1IKV A;  3TA0 A;  4CLP A;  3DLL Q;  3LAK A;  3P49 B;  4ZVF A;  1EP4 B;  1QE1 B;  4OYO A;  1Y00 A;  5D4L A;  4ES3 A;  3QBC A;  5F8H A;  4K2X A;  3NMR A;  2GC8 A;  2HHH J;  4WE1 A;  1K0V A;  2OSQ A;  4P2F A;  3WIU A;  4HLB A;  3R5D A;  2R8J A;  2CNK B;  1M5O C;  4UQT A;  1FJG F;  1RAF B;  1S4E A;  1UVK A;  2ZZM A;  2HHQ A;  1NEE A;  4OX9 J;  4GC7 A;  3LP0 A;  1AT1 B;  3N01 A;  1FTC A;  2RVJ A;  3V81 A;  5KG4 A;  3BDE A;  1RHJ B;  4D3G A;  3QID A;  3UCZ P;  1U1R A;  4PAB A;  2M8H A;  1MN7 A;  1WG5 A;  4OX7 A;  3M2U B;  1UEU A;  1VS3 A;  4M5D B;  1NSQ A;  1OJ4 A;  3LWL A;  4DL6 A;  5CA5 A;  2OTL S;  4ELT A;  3QRQ A;  2MKY A;  2R7Q A;  2LFV A;  3DYA A;  2QLF B;  7FD1 A;  5DZ7 A;  5F8M A;  3THV A;  3EVW A;  2AEF A;  3OTO J;  4FS1 A;  2VAS A;  3K7R A;  2P6T A;  1WDD A;  4L3K A;  3DLB A;  2GAH C;  2HK2 A;  3HHN B;  4B3M F;  4DSK A;  1UA0 A;  4H4K A;  1HL6 A;  1UPM B;  2B51 A;  2UV8 G;  1Q8L A;  4R0E A;  2XLI A;  3H4B A;  1VC5 A;  1HD0 A;  3PFE A;  3TA2 A;  2C2K B;  3R97 A;  4F4K A;  4LF9 J;  1U1O A;  4M5L A;  5I3Q A;  4WKR A;  3DOL A;  4NML A;  3MCS A;  3EIC A;  2GJI A;  2ZH5 A;  3D6T B;  2OUG A;  2CPJ A;  2CQ2 A;  2RS2 A;  1WEZ A;  1M0S A;  3QRR A;  2GCF A;  4QR2 A;  4CLU A;  3O3L A;  1WHW A;  4O0I A;  4BS2 A;  4NEY A;  2F4F A;  4WKY A;  1RI7 A;  1Q16 B;  2HS4 A;  2HW3 A;  1JLB A;  2CJ9 A;  2WHO A;  4RZR A;  2GQC A;  1R0B G;  4HHJ A;  2A2C A;  2G2O A;  3M2R B;  3I56 S;  1S0V A;  1O8B A;  2OEJ A;  4NYP A;  3R7N B;  3SBM A;  4ILL A;  2XMA A;  4JOU A;  2KT3 A;  2W2O P;  3GPA A;  4WXW A;  1B0P A;  4MFB B;  1AUS L;  5JUM A;  4LF4 F;  1WI6 A;  1B0T A;  1VQN S;  4NXM F;  1ITP A;  1EQ0 A;  2MTL A;  2W8K A;  3GB0 A;  1YI2 S;  5F3Z A;  3M7V A;  1U49 A;  3BQ1 A;  3T5J A;  4FBT A;  2RQK A;  1RT3 A;  1Z4U A;  3OSP A;  3FCV A;  4BWM A;  3FSX A;  2QYC A;  3ZZY A;  5KFJ A;  4OZ5 A;  1YJ7 A;  4O3Q A;  2R7O A;  4YB1 P;  4JV1 A;  2PA8 D;  5T7L A;  4G65 A;  1KVK A;  2FD2 A;  1IN0 A;  2VV5 A;  2JRS A;  2WK4 A;  2XHC A;  3DLG B;  4LFB J;  2DNO A;  4BC9 A;  4YR2 A;  4USJ C;  4MKB A;  1TK0 A;  1Y7P A;  3JQJ A;  3SI8 A;  1XMB A;  3BKU A;  4J9R A;  4HAC B;  4I69 A;  4TU9 A;  4OQJ A;  2CUY A;  1T3N A;  5KG6 A;  4DX8 H;  3D4J A;  1Q95 G;  4KTQ A;  4Q0B B;  2I2Y A;  3HVW A;  1GQE A;  4AQY J;  5J2P A;  2DNL A;  4KE5 A;  4ATN A;  2XGQ A;  4DR4 J;  4KHP J;  2R42 A;  4X4U A;  3CCL S;  3NMA A;  1NZ8 A;  2DH7 A;  2RF2 B;  2D74 B;  5KFM A;  4P52 A;  1XNR F;  1IKW A;  3WIV A;  1RTD A;  2W4D A;  1U1P A;  3W2W A;  2FGO A;  5F8N A;  2HGL A;  1M5P C;  2AW0 A;  2MKH A;  1WOO A;  3DM2 B;  1RT4 B;  3M4X A;  4LRF A;  2R2R A;  4DV6 F;  1TKX A;  5IC4 B;  1X9W A;  1KC8 T;  1CJT A;  4ED5 A;  4C48 A;  2VBZ A;  3UW1 A;  1DAR A;  4WBF A;  2FLN A;  9RUB A;  3TUP A;  3GV5 B;  4B9V A;  5E33 A;  1NH8 A;  3MUM P;  3UFC X;  1Y5I B;  2MLZ A;  5IT4 A;  4EYH B;  5CXT A;  2OEM A;  1FRX A;  1V3Z A;  2HKE A;  3POT B;  3VGT A;  4C11 B;  4CI0 B;  3DU5 A;  4ZVP B;  1P8G A;  3T6J A;  3PO4 A;  3SFU A;  4UOF A;  5F0U A;  2IDE A;  3PFO A;  5D3G B;  1UEV A;  2G0J A;  2K8G A;  3C8Y A;  3IS9 A;  3KG1 A;  4JBC A;  1RGV A;  2V63 A;  4IO9 Q;  4AL6 A;  1ZM2 A;  3OXL A;  3AY0 A;  3RJM B;  3FC9 A;  3SEO A;  3TRG A;  5J2N A;  4IG3 A;  1RWN B;  1RA7 A;  1FA0 A;  3SSR A;  2UXC J;  4I7F B;  2POK A;  1DLO A;  3C6T A;  4I68 A;  3MM5 A;  4RLE A;  4IR1 A;  1TV6 B;  1U47 A;  5B09 A;  2ZBI A;  1F60 B;  2A10 A;  4YME A;  2WCX A;  2FJA B;  1X4C A;  2CQ1 A;  5EHH A;  2YKM A;  4MMO A;  4F3Q A;  3QT6 A;  1Q1K A;  3CCR S;  1YHQ S;  3G6Y A;  2XYH B;  4E8U A;  3DXB A;  3P3D A;  3MEC A;  4P10 A;  1S1U A;  2NQP A;  4I7F A;  1I1G A;  2MHN A;  2FJX A;  1O5J A;  2FJD B;  2PSZ A;  2MQL A;  3MUR P;  2WTF A;  2NSB A;  1Q78 A;  4FYX B;  1CJT B;  4DL2 A;  1Q86 T;  1LNQ A;  4F50 A;  1X5P A;  2QG9 B;  2MZJ A;  1B0V A;  1L3K A;  1LWF A;  3R5B A;  3BB5 A;  3CDB A;  3I4H X;  4K59 A;  2C2R A;  1S59 A;  2YWE A;  2LXI A;  1OYE A;  5E3P A;  3DRP B;  1MU2 B;  3S1T A;  1RAJ A;  3V5R A;  2DKO B;  3VTI A;  4QWC A;  1X9M A;  2QE5 A;  2F4V F;  1GMW D;  2B9E A;  1R7I A;  2F63 A;  2UP1 A;  5EX0 A;  3GP9 A;  4LF5 F;  3LTO A;  4OFZ A;  3M2V A;  4KRW A;  2E7V A;  3H2L A;  5C42 B;  3ZO7 A;  2AJQ A;  2OPP B;  3WHI A;  1JJ4 A;  2Y1I A;  3O6Q A;  1DAX A;  3HK2 A;  3MR3 A;  1PYO B;  5HL7 Q;  2UVU A; 
#chains in the Genus database with same CATH homology
 1RHM B;  2CJY B;  2C2O B;  3P4U B;  1PAU B;  1SC4 B;  5IC6 B;  2H5J B;  4ZVO B;  5K20 B;  3GJR B;  3EDQ B;  2H5I B;  1IBC B;  3EDR B;  3NS7 B;  1I51 B;  1RHK B;  1QDU B;  2C2M B;  2C2Z B;  4ZVT B;  3R7B B;  1BMQ B;  1NME B;  2C1E B;  3KJQ B;  1RWK B;  4DCJ B;  1RWV B;  1SC1 B;  2QLJ B;  2H65 B;  5IC4 B;  2CJX B;  2H4Y B;  2H48 B;  1RHR B;  4LSZ B;  1SC3 B;  1QTN B;  4ZVU B;  3R7S B;  2H51 B;  1RHQ B;  2HBZ B;  4ZVP B;  2QL7 B;  2CNN B;  2CNK B;  2H4W B;  2HBY B;  2CDR B;  3KJF B;  4JB8 B;  2HBQ B;  2QL5 B;  3R5J B;  2Y0B B;  3RJM B;  2CNO B;  1RE1 B;  1RWN B;  3IBF B;  1RHJ B;  3GJQ B;  1RWW B;  4ZVQ B;  2QLF B;  2HBR B;  1RWM B;  4DCO B;  2QLB B;  2XYH B;  3D6F B;  3GJT B;  4ZVS B;  2QL9 B;  1RWO B;  1RHU B;  3IBC B;  3SIP B;  1F9E B;  2C2K B;  2P2C B;  1ICE B;  1I3O B;  3QNW B;  4DCP B;  2DKO B;  2CNL B;  2XZT B;  2H54 B;  1RWX B;  1RWP B;  3D6M B;  3R6G B;  2XYG B;  3GJS B;  2FQQ B;  4ZVR B;  3R6L B;  3D6H B;  2XZD B;  2Y1L B;  2XYP B;  3R7N B;  3KJN B;  1PYO B;  3P45 B;  1GFW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...