3GJUA

Crystal structure of a putative aminotransferase (mll7127) from mesorhizobium loti maff303099 at 1.55 a resolution
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
458
structure length
457
Chain Sequence
GMLNQSNELNAWDRDHFFHPSTHMGTHARGESPTRIMAGGEGVTVWDNNGRKSIDAFAGLYCVNVGYGRQKIADAIATQAKNLAYYHAYVGHGTEASITLAKMIIDRAPKGMSRVYFGLSGSDANETNIKLIWYYNNVLGRPEKKKIISRWRGYHGSGVMTGSLTGLDLFHNAFDLPRAPVLHTEAPYYFRRTDRSMSEEQFSQHCADKLEEMILAEGPETIAAFIGEPILGTGGIVPPPAGYWEKIQAVLKKYDVLLVADEVVTGFGRLGTMFGSDHYGIKPDLITIAGLTSAYAPLSGVIVADRVWQVLVQGSDKLGSLGHGWTYSAHPICVAAGVANLELIDEMDLVTNAGETGAYFRAELAKAVGGHKNVGEVRGDGMLAAVEFVADKDDRVFFDASQKIGPQVATALAASGVIGRAMPQGDILGFAPPLCLTREQADIVVSKTADAVKSVFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative aminotransferase
publication title Crystal structure of putative aminotransferase (NP_107505.1) from Mesorhizobium loti at 1.55 A resolution
rcsb
source organism Mesorhizobium loti
molecule tags Transferase
total genus 164
structure length 457
sequence length 458
ec nomenclature
pdb deposition date 2009-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00202 Aminotran_3 Aminotransferase class-III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 3gjuA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3gjuA01
5DJ9A 1BT4A 1W7LA 4BMKA 2DR1A 1C7NA 4F5KA 1ASGA 3BB8A 1CQ8A 1UU2A 4FFCA 4RM1A 2CJDA 1ASBA 1M32A 3DXVA 1BQDA 2W7MA 2ZY5A 1LKCA 3WKSA 1YIZA 1AHXA 3UAKA 2RFVA 2W7EA 3H7FA 4WYDA 1BS0A 3H14A 2O7CA 3QM2A 3BN1A 3W1JA 1M0QA 3A9XA 3VAXA 1AKAA 5K8BA 3D6KA 1QGNA 2DKBA 4ZWMA 4BA5A 4RKCA 1KMKA 3DXWA 1B4XA 2DKJA 2R5EA 3QGUA 1C9CA 1X28A 3HBXA 2OATA 3B1EA 3ISLA 4R8DA 3WKRA 5D95A 3LV2A 4WBTA 4A6RA 3JWBA 1GEWA 5HXXA 1DKAA 2W7KA 1TOKA 3N5MA 1ZODA 2HUFA 5FT5A 1GC0A 1TOGA 3R4TA 4ZDPA 2YCTA 1C0NA 3VK3A 3AEJC 3JW9A 3CQ6A 5G4JA 4AZJA 5E5IA 2BWNA 2CH2A 1N31A 3EI6A 1X29A 1ZOBA 1Y4IA 2YKVA 2BYJA 1BW0A 3AENA 4ITGA 2GSAA 1D7RA 1DGDA 1C4KA 3RCHB 3GZDA 1SPAA 3PDBA 4WP0A 2AATA 3AOVA 2VGZA 1CZCA 2DGMA 1V2FA 4ADCA 3K7YA 1YJYA 4MQQA 4UHOA 1QJ5A 2YCPA 3EIAA 3MAFA 4N0WA 1MDOA 3JWAA 3QPGA 3MC6C 4CBRA 2ZY2A 3DR4A 3FTBA 2VGUA 4DGTA 1ELQA 1WKGA 2VGWA 2D7YA 2W7GA 4P7YA 4BA4A 4XQ2A 3HMUA 3QHXA 5D5SA 3UE8A 1CS1A 3USFA 4K2IA 4E1OA 4LC3A 4E3QA 4W1XA 1BKGA 3P1TA 5DJ1A 1TOIA 1UU1A 1N2TA 1BQAA 2V1PA 3CAIA 2ZYJA 3EI7A 3WGBA 4UOYA 4A0HA 1JF9A 5EUEA 1E5FA 3FQ7A 1O61A 1O62A 3ATHA 4W91A 2QLRA 1CJ0A 3GWPA 1ARTA 2HUUA 2VLFA 3AEMA 2QA3A 2DGKA 5F8VA 1SFFA 1X0MA 2YRRA 3FQ8A 2YCNA 4ADEA 1GC2A 3PA9A 1C7GA 1QZ9A 2W8VA 5M4BA 4M2KA 4JE5A 1M0NA 1QITA 1PMOA 3GZCA 4MKKA 2W8UA 2W7HA 1W3UA 3CBFA 2C44A 2BI1A 2CSTA 4RKDA 5FT6A 3AELA 1D7VA 2YRIA 4K2BA 5G2PA 4F5IA 4EB7A 2D66A 3QN6A 3RUYA 3AENB 1AHFA 1WYTB 1IBJA 1G4VA 2NMPA 1AAMA 4CXRA 4B9BA 2BIAA 3PDBB 4RLGA 2HZPA 1KKJA 4EU1A 2GQNA 1T3IA 5FT4A 4IX8A 1TATA 1OHYA 2C7TA 1PFFA 2WK7A 1D7UA 3FZ6A 1DJEA 3FDBA 4E3RA 1RV4A 3ELEA 4UHNA 4HVKA 2BIGA 3ZRRA 3ZRQA 2VMTA 1AY5A 1AJSA 4FL0A 1B9IA 3GBXA 1ARGA 4WB0A 3E2FA 4R5FA 4WXGA 5DB5A 3WGCA 5M46A 4CXQA 1AKBA 2VLHA 1WKHA 1YIYA 3PAAA 1V2EA 2Q7WA 3CQ4A 3IHJA 2BYLA 1AY4A 9AATA 4OBVA 2W8WA 4AO4A 3VK2A 2JISA 2JJEA 2ZJGA 5I92A 1AMSA 1JS6A 1RV3A 2EGYA 2W8JA 4O6ZA 1YJZA 1GEXA 4GE4A 3UWCA 3F9TA 4JEZA 4ZDOA 2WK9A 1OXPA 4XJMA 1ASMA 4ZWVA 4K2MA 3NU7A 4Y0HA 2AY3A 5G09A 3DYDA 4GRXA 1BJOA 1OXOA 2VMNA 3FVSA 3TCMA 2EPJA 2HUIA 4U2HA 1ELUA 2VGTA 1AY8A 1S08A 1DGEA 2G6WA 5EUDA 1H0CA 1AHEA 1O4SA 4HF8A 4NOGA 4TN4A 4WYFA 3WY7A 4GDYA 5E3KA 4MQPA 1Z3ZA 4RITA 4N0BA 3MADA 2ZY4A 5LHAA 2GMUA 3KKIA 2W8TA 4OBUA 3II0A 2AY6A 2FQ6A 3EI9A 4W1VA 3I16A 3BCBA 2D63A 3JZLA 1VEFA 2W7IA 3LY1A 1M7YA 4OTLA 2ZC0A 2VMYA 3B1CA 1ASCA 2ORDA 2X3LA 3GJUA 3HT4A 3FD0A 3FQAA 4A0FA 2HOZA 4A0RA 1JS3A 1SZSA 3G7QA 2Z1ZA 2AEVA 1V72A 3WCOA 4F5GA 1BJ4A 4OCAA 1AJSB 2EO5A 3FFRA 5G4IA 3I5TA 3PIUA 4WB0B 4TV7A 4JE5D 1WYTA 3AEJA 1N8PA 2OQXA 4WYGA 1UKJA 3R9AA 4RIZA 4A00A 4E77A 3F0HA 1UU0A 3PGYA 3BV0A 2V0YA 3PPLA 5EAVA 2YKYA 3RBLA 2VGVA 1TOJA 2VGSA 1ASDA 4A0GA 4AOAA 3EZ1A 4F5HA 3MKJA 3GR9A 3NX3A 1M6SA 2CY8A 4ZSYA 1V2DA 3A9YA 1QISA 4ZAHA 3IF2A 4LW2A 3ASBA 3EUCA 4PIWA 1MLZA 1ORDA 2WK8A 1Z7DA 3WX9A 2E54A 1OHWA 3QBOA 1GCKA 1S09A 4M2MA 3LVJA 1BJOB 3ASAA 3ZZJA 2BI3A 2W7DA 3DU4A 4TMRA 1I43A 2CJHA 3MC6A 3GSBA 1BJWA 4KXKA 4A72A 5TF5A 1J04A 1IUGA 1GC3A 3OP7A 3PDXA 3PD6B 4UQVA 1PG8A 3K28A 3RQ1A 1IX7A 4F4EA 3A8UX 1MLYA 4GE9A 2DOUA 2GB3A 2AY2A 2CJGA 3A2BA 4R2NA 3NYUA 4IXSA 2VYCA 5IWQA 4JEVA 3NNKA 1AIBA 2W7FA 1ASAA 3LVKA 3AOWA 1IJIA 1VJOA 2AY7A 3KE3A 1W7MA 4ZDLA 1CL2A 2BWPA 3AATA 3I4JA 4MY5A 2D5YA 2BI9A 4MGRA 5EUNA 2VMVA 3LG0A 1RVUA 2VMZA 1ARHA 4OYTA 3LVMA 2FNIA 3FVXA 2CINA 3JTXA 4OC9A 4CVQA 4OT8A 1DJUA 2W7JA 1AICA 1EG5A 1FC4A 1EQBA 3B46A 1FG3A 3E2YA 4WYAA 1RVYA 2ZSMA 3WZFA 2QMAA 3QI6A 1M0PA 3MEBA 2QBTA 4Y0IA 2VMWA 4QGRA 5C6UA 4ATQA 1GD9A 2AY4A 2VMQA 1B5OA 4WYEA 3TFTA 3K40A 3DC1A 1B5PA 3ZZKA 4A6TA 3E2ZA 3B1DA 2FM1A 1IAYA 2BI2A 4M2JA 4Q75A 2XH1A 4LNMA 4LNJA 4JEXA 2FNUA 1ASFA 2YKXA 1U08A 3FZ7A 5M49A 3BWNC 5G0AA 2VIBA 1WYUA 3ZRPA 4H51A 1MAQA 1ASLA 1DTYA 1PMMA 1QIRA 3L8AA 2VMUA 1D2FA 1LW4A 2Z61A 4EFFA 4R5ZA 5M4DA 4F5MA 5BJ3A 1DFOA 3E6GA 3DZZA 2VI9A 3BWNA 2DGLA 2CH1A 1B9HA 3FKDA 2ZP7A 4IW7A 4LW4A 2O0RA 4Y0DA 2PB0A 3BCAA 3VK4A 3Q8NA 1BJNA 3A9ZA 1AMRA 4ATPA 5HDMA 3FZ8A 1X2AA 4Q6RA 1GDEA 1GBNA 2D7ZA 2Z9XA 4JEYA 4IXZA 4ADBA 1ARIA 1SF2A 3HVYA 3HL2A 3AEPA 1WYVA 4IYOA 4XJPA 3HQTA 3P6KA 2FN6A 1W23A 1W7NA 3ACZA 3PD6A 3DRDA 1JG8A 4KYOA 1I29A 1IAXA 1KL1A 4L0OA 1SZKA 1DJ9A 2AY9A 3WLXA 2D65A 1G7XA 2EZ1A 4IXOA 3GETA 5HHYA 5EIGA 4LNLA 1IVRA 3ELPA 2OKJA 1MDZA 2HOXA 2R5CA 3TFUA 4F5JA 3TATA 2F8JA 4ITXA 2OKKA 2X5FA 1O69A 4UHMA 1H1CA 1TPLA 2OGEA 3MBBA 2AEUA 1CQ7A 3E2ZB 1AIAA 1GEYA 4PVFA 2X5DA 5DX5A 1IX8A 3W1HA 3JU7A 1ASEA 1M0OA 1MGVA 2PO3A 2YHKA 1S0AA 1AX4A 3EI8A 1WYUB 1IX6A 3EI5A 3AV7A 2BHXA 7AATA 1OHVA 1AAWA 4JF1A 2Z9WA 1G7WA 3G8MA 5BJ4A 4ZLVA 2Z1YA 2GMSA 1G4XA 4GE7A 3DR7A 3HDOA 2YOBA 3KGXA 4A6UA 1C7OA 2EH6A 2XBNA 3DODA 2BWOA 5EQCA 5G2QA 4XEWA 4EB5A 4WLHA 4OMAA 2VMPA 3M5UA 1ZC9A 2R0TA 2VMXA 5F9SA 4ZSWA 2HOYA 2HORA 4XJLA 3F6TA 4W1WA 4XJOA 5EFSA 4F5LA 2BI5A 3GZDC 2TPLA 1VP4A 3TQXA 1LC7A 4EMYA 4PFNA 4P3MA 4XK1A 1XEYA 2OGAA 2R2NA 3BCXA 1TARA 2JJGA 1ARSA 1WYVB 4IYOB 2Z9VA 2VMRA 3L44A 3NUIA 1CZEA 3B8XA 1LK9A 3CQ5A 1YOOA 2D61A 4PFFA 4RJ0A 1YNUA 4WLJA 4AZKA 1SVVA 4WXFA 3T32A 4RJYA 1J32A 4MKJA 1AKCA 2CFBA 1LC8A 1MDXA 1XI9A 4ZM4A 3KGWA 3NTJA 1B8GA 1KMJA 3FSLA 4J5UA 1LC5A 1D7SA 3NRAA 3NUBA 5EIGB 5AX8A 5JAYA 2R5CB 8AATA 2AY1A 4BHDA 4B98A 4JEWA 1S06A 3E9KA 4J8LA 3RBFA 3BC8A 4BQ0A 1CQ6A 3LWSA 4MQRA 3VOMA 2JGTA 4DBCA 4ZM3A 1S07A 1YAAA 2FYFA 1YJSA 3AEMC 2Z20A 2X8UA 1P3WA 4W5KA 2W7LA 2CANA 3PJ0A 3FCRA 1KKPA 1AJRA 2EZ2A 2VMSA 4WD2A 3FFHA 1LW5A 2E7JA 2VMOA 5J8QA 3EZSA 3N75A 1MAPA 3RI6A 4W8IA 4ADDA 4WYCA 2QB2A 3E77A 4Q76A 3NYTA 3NYSA 3AEOA 2ZSLA 3FDDA 2VIAA 3EIBA 1TASA 1EJIA 4ISYA 4RAEA 1FG7A 2VI8A 4AH3A 2HP2A 4IY7A 4CBSA 1GC4A 2PB2A 2QB3A 3WCNA 4I8AA 1AHGA 3MAUA 1AMQA 1ASNA 2CTZA 2O1BA 2ZUKA 2WKAA 3LVLB 2JJHA 3NDNA 3OKSA 4MSOA 2E7UA 4U1TA 1LS3A 1WSTA 3BS8A 4WXBA 1I48A 2ZY3A 1I41A 4JF0A 2AY8A 4Q31A 2BIEA 4XAUA 3COGA 1E5EA 5EAAA 2YKUA 1AHYA 4AO9A 2JG2A 5LH9A 2HP1A 4GEBA 3VP6A 2Z9UA 4KAMA 3HLMA 1ECXA 3MAFB 2D64A 5FT8A 4DQ6A 2E7IA 3ECDA 2JJFA 5E4ZA 1TOEA 2AY5A 3G0TA 3N0LA 4F5FA 3FRKA 1QJ3A 2C0RA 1SZUA 4ZASA 1AMAA 1CL1A 2C81A 1OATA 3NU8A 2CB1A 3RCHA 2Z67A 4GSAA 3BWOA 3W1IA 1M4NA 1KL2A 3FVUA 2BKWA
chains in the Genus database with same CATH superfamily
5DJ9A 1BT4A 1W7LA 4BMKA 2DR1A 1C7NA 4F5KA 1ASGA 3BB8A 1CQ8A 1UU2A 4FFCA 4RM1A 2CJDA 1ASBA 1M32A 3DXVA 1BQDA 2W7MA 2ZY5A 1LKCA 3WKSA 1YIZA 1AHXA 3UAKA 2RFVA 2W7EA 3H7FA 4WYDA 1BS0A 3H14A 2O7CA 3QM2A 3BN1A 3W1JA 1M0QA 3A9XA 3VAXA 1AKAA 5K8BA 3H9XA 5KTBA 3D6KA 1QGNA 2DKBA 4ZWMA 4BA5A 4RKCA 1KMKA 3DXWA 1B4XA 2DKJA 2R5EA 3QGUA 1C9CA 1X28A 3HBXA 2OATA 3B1EA 3ISLA 4R8DA 3WKRA 5D95A 3LV2A 4WBTA 4A6RA 3JWBA 1GEWA 5HXXA 1DKAA 2W7KA 1TOKA 3N5MA 2KFPA 1ZODA 2HUFA 5FT5A 1GC0A 1TOGA 3R4TA 4ZDPA 2YCTA 1C0NA 3VK3A 3AEJC 3JW9A 3CQ6A 5G4JA 4AZJA 3N4RA 5E5IA 2BWNA 2CH2A 1N31A 3EI6A 1X29A 1ZOBA 1Y4IA 2YKVA 2BYJA 1BW0A 3AENA 4ITGA 2GSAA 1D7RA 2A1VA 1DGDA 1C4KA 3RCHB 3GZDA 1SPAA 3PDBA 4WP0A 2AATA 3AOVA 2VGZA 1CZCA 2DGMA 2WB6A 1V2FA 4ADCA 3K7YA 1YJYA 4MQQA 4UHOA 1QJ5A 2YCPA 3EIAA 3MAFA 4N0WA 1MDOA 3JWAA 3QPGA 3MC6C 4CBRA 2ZY2A 3DR4A 2EYQA 3FTBA 2VGUA 4DGTA 1ELQA 1WKGA 2VGWA 2D7YA 2W7GA 4P7YA 4BA4A 4XQ2A 3HMUA 3QHXA 5D5SA 3UE8A 1CS1A 3USFA 4K2IA 4E1OA 4LC3A 4E3QA 4W1XA 1BKGA 3P1TA 5DJ1A 1TOIA 1UU1A 1N2TA 1BQAA 2V1PA 3CAIA 2ZYJA 3EI7A 3WGBA 4UOYA 4A0HA 1JF9A 5EUEA 1E5FA 3FQ7A 1O61A 1O62A 3ATHA 4W91A 2QLRA 1CJ0A 3GWPA 1ARTA 2HUUA 2VLFA 3AEMA 2QA3A 2DGKA 5F8VA 1SFFA 1X0MA 2YRRA 3FQ8A 2YCNA 4ADEA 1GC2A 3PA9A 1C7GA 1QZ9A 2W8VA 5M4BA 4M2KA 4JE5A 3N4SA 1M0NA 1QITA 1PMOA 3GZCA 4MKKA 2W8UA 2W7HA 1W3UA 3CBFA 2C44A 2BI1A 2CSTA 4RKDA 5FT6A 3AELA 1D7VA 2YRIA 4K2BA 5G2PA 4F5IA 4EB7A 2D66A 3QN6A 3RUYA 3AENB 1AHFA 1WYTB 1IBJA 1G4VA 2NMPA 1AAMA 4CXRA 4B9BA 2BIAA 2FKIA 3PDBB 4RLGA 2HZPA 1KKJA 4EU1A 2GQNA 1T3IA 5FT4A 4IX8A 1TATA 1OHYA 2C7TA 1PFFA 2WK7A 1D7UA 3FZ6A 1DJEA 3FDBA 4E3RA 1RV4A 3ELEA 4UHNA 4HVKA 2BIGA 3ZRRA 3ZRQA 2VMTA 1AY5A 1AJSA 4FL0A 1B9IA 3GBXA 1ARGA 4WB0A 3E2FA 4R5FA 4WXGA 5DB5A 3WGCA 5M46A 4CXQA 1AKBA 2VLHA 1WKHA 1YIYA 3PAAA 1V2EA 2Q7WA 3CQ4A 3IHJA 2BYLA 1AY4A 9AATA 4OBVA 2W8WA 4AO4A 3VK2A 2JISA 2JJEA 2ZJGA 5I92A 1AMSA 1JS6A 1RV3A 2EGYA 2W8JA 4O6ZA 1YJZA 1GEXA 4GE4A 3UWCA 3F9TA 4JEZA 4ZDOA 2WK9A 1OXPA 4XJMA 4H63Q 1ASMA 4ZWVA 4K2MA 3NU7A 4Y0HA 2AY3A 5G09A 3DYDA 4GRXA 1BJOA 1OXOA 2VMNA 3FVSA 3TCMA 2EPJA 2HUIA 4U2HA 1ELUA 2VGTA 1AY8A 1S08A 1DGEA 2G6WA 5EUDA 1H0CA 1AHEA 1O4SA 4HF8A 4NOGA 4TN4A 4WYFA 3WY7A 4GDYA 5E3KA 4MQPA 1Z3ZA 4RITA 4N0BA 3MADA 2ZY4A 5LHAA 2G7JA 2GMUA 3KKIA 2W8TA 4OBUA 3II0A 2AY6A 2QSRA 2FQ6A 3EI9A 4W1VA 3I16A 3BCBA 2D63A 3JZLA 1VEFA 2W7IA 3LY1A 1M7YA 4OTLA 2ZC0A 2VMYA 3B1CA 1ASCA 2ORDA 2X3LA 3GJUA 3HT4A 3FD0A 3FQAA 4A0FA 2HOZA 4A0RA 1JS3A 1SZSA 3G7QA 2Z1ZA 2AEVA 1V72A 3WCOA 4F5GA 1BJ4A 4OCAA 1AJSB 2EO5A 3FFRA 5G4IA 3I5TA 3PIUA 4WB0B 4TV7A 4JE5D 1WYTA 3AEJA 1N8PA 2OQXA 4WYGA 1UKJA 3R9AA 4RIZA 4A00A 4E77A 3F0HA 1UU0A 3PGYA 3BV0A 2V0YA 3PPLA 5EAVA 2YKYA 3RBLA 2VGVA 1TOJA 2VGSA 1ASDA 4A0GA 4AOAA 3EZ1A 4F5HA 3MKJA 3GR9A 3NX3A 1M6SA 2CY8A 4ZSYA 1V2DA 3A9YA 1QISA 4ZAHA 3IF2A 4LW2A 3ASBA 3EUCA 4PIWA 1MLZA 1ORDA 2WK8A 1Z7DA 3WX9A 2E54A 1OHWA 3QBOA 1GCKA 1S09A 4M2MA 4K05A 3LVJA 1BJOB 3ASAA 3ZZJA 2BI3A 2W7DA 3DU4A 4TMRA 1I43A 2CJHA 3MC6A 3GSBA 1BJWA 4KXKA 4A72A 5TF5A 1J04A 1IUGA 1GC3A 3OP7A 3PDXA 3PD6B 4UQVA 1PG8A 3K28A 3RQ1A 1IX7A 4F4EA 3A8UX 1MLYA 4GE9A 2DOUA 2GB3A 2AY2A 2CJGA 3A2BA 4R2NA 3NYUA 4IXSA 2VYCA 5IWQA 4JEVA 3NNKA 1AIBA 2W7FA 1ASAA 3LVKA 3AOWA 1IJIA 1VJOA 2AY7A 3KE3A 1W7MA 4ZDLA 1CL2A 2BWPA 3AATA 3I4JA 4MY5A 2D5YA 2BI9A 4MGRA 5EUNA 2VMVA 3LG0A 1RVUA 2VMZA 1ARHA 4OYTA 3LVMA 2FNIA 3FVXA 2CINA 3JTXA 4OC9A 4CVQA 4OT8A 1DJUA 2W7JA 1AICA 1EG5A 1FC4A 3N7NA 1EQBA 3B46A 1FG3A 3E2YA 4WYAA 1RVYA 2ZSMA 3WZFA 2QMAA 3QI6A 1M0PA 3MEBA 2QBTA 4Y0IA 2VMWA 4QGRA 5C6UA 4ATQA 1GD9A 2AY4A 2VMQA 1B5OA 4WYEA 3TFTA 3K40A 3DC1A 1B5PA 3ZZKA 4A6TA 3E2ZA 3B1DA 2FM1A 1IAYA 2BI2A 4M2JA 4Q75A 2XH1A 4LNMA 4LNJA 4JEXA 2FNUA 1ASFA 2YKXA 1U08A 3FZ7A 5M49A 3BWNC 5G0AA 2VIBA 1WYUA 3ZRPA 4H51A 1MAQA 1ASLA 1DTYA 1PMMA 1QIRA 3L8AA 2VMUA 1D2FA 1LW4A 2Z61A 4EFFA 4R5ZA 5M4DA 4F5MA 5BJ3A 1DFOA 3E6GA 3DZZA 2VI9A 3BWNA 2DGLA 2CH1A 1B9HA 3FKDA 2ZP7A 4IW7A 4LW4A 2O0RA 4Y0DA 2PB0A 3BCAA 3VK4A 3Q8NA 1BJNA 3A9ZA 1AMRA 4ATPA 5HDMA 3FZ8A 1X2AA 4Q6RA 1GDEA 1GBNA 2D7ZA 2Z9XA 4JEYA 4IXZA 4ADBA 1ARIA 1SF2A 3HVYA 3HL2A 3AEPA 1WYVA 4IYOA 4XJPA 3HQTA 3P6KA 2FN6A 1W23A 1W7NA 3ACZA 3PD6A 3DRDA 1JG8A 4KYOA 1I29A 1IAXA 1KL1A 4L0OA 1SZKA 1DJ9A 2AY9A 3WLXA 2D65A 1G7XA 2EZ1A 4IXOA 3GETA 5HHYA 5EIGA 4LNLA 1IVRA 3ELPA 2OKJA 1MDZA 2HOXA 2R5CA 3TFUA 4F5JA 3TATA 2F8JA 4ITXA 2OKKA 2X5FA 1O69A 4UHMA 1H1CA 1TPLA 2OGEA 3MBBA 2AEUA 1CQ7A 3E2ZB 1AIAA 1GEYA 4PVFA 2X5DA 5DX5A 1IX8A 3W1HA 3JU7A 1ASEA 1M0OA 1MGVA 2PO3A 2YHKA 1S0AA 1AX4A 3EI8A 1WYUB 1IX6A 3EI5A 3AV7A 2BHXA 7AATA 1OHVA 1AAWA 4JF1A 2Z9WA 1G7WA 3G8MA 5BJ4A 4ZLVA 2Z1YA 2GMSA 1G4XA 4GE7A 3DR7A 3HDOA 2YOBA 3KGXA 4A6UA 1C7OA 2EH6A 2XBNA 3DODA 2BWOA 5EQCA 5G2QA 4XEWA 4EB5A 4WLHA 4OMAA 2VMPA 3M5UA 1ZC9A 2R0TA 2VMXA 5F9SA 4ZSWA 2HOYA 2HORA 4XJLA 3F6TA 4W1WA 4XJOA 5EFSA 4F5LA 3N4XA 2BI5A 3GZDC 2TPLA 1VP4A 3TQXA 1LC7A 4EMYA 4PFNA 4P3MA 4XK1A 1XEYA 2OGAA 2R2NA 3BCXA 1TARA 2JJGA 1ARSA 1WYVB 4IYOB 2Z9VA 2VMRA 3L44A 3NUIA 1CZEA 3B8XA 1LK9A 3CQ5A 1YOOA 2D61A 4PFFA 4RJ0A 1YNUA 4WLJA 4AZKA 1SVVA 4WXFA 3T32A 4RJYA 1J32A 4MKJA 1AKCA 2CFBA 1LC8A 1MDXA 1XI9A 4ZM4A 3KGWA 3NTJA 1B8GA 1KMJA 3FSLA 4J5UA 1LC5A 1D7SA 3NRAA 3NUBA 5EIGB 5AX8A 5JAYA 2R5CB 8AATA 2AY1A 4BHDA 4B98A 4JEWA 1S06A 3E9KA 4J8LA 3RBFA 3BC8A 4BQ0A 1CQ6A 3LWSA 4MQRA 3VOMA 2JGTA 4DBCA 4ZM3A 1S07A 1YAAA 2FYFA 1YJSA 3AEMC 2Z20A 2X8UA 1P3WA 4W5KA 2W7LA 2CANA 3PJ0A 3FCRA 1KKPA 1AJRA 2EZ2A 2VMSA 4WD2A 3FFHA 1LW5A 2E7JA 2VMOA 5J8QA 3EZSA 3N75A 1MAPA 3RI6A 4W8IA 4ADDA 4WYCA 2QB2A 3E77A 4Q76A 3NYTA 3NYSA 3AEOA 2ZSLA 3FDDA 2VIAA 3EIBA 1TASA 1EJIA 4ISYA 4RAEA 1FG7A 2VI8A 4AH3A 2HP2A 4IY7A 4CBSA 1GC4A 2PB2A 2QB3A 3WCNA 4I8AA 1AHGA 3MAUA 1AMQA 1ASNA 2CTZA 2O1BA 2ZUKA 2WKAA 3LVLB 2JJHA 3NDNA 3OKSA 4MSOA 2E7UA 4U1TA 1LS3A 1WSTA 3BS8A 4WXBA 1I48A 2ZY3A 1KAFA 1I41A 4JF0A 2AY8A 4Q31A 2BIEA 4XAUA 3COGA 1E5EA 5EAAA 2YKUA 1AHYA 4AO9A 2JG2A 5LH9A 2HP1A 4GEBA 3VP6A 2Z9UA 4KAMA 3HLMA 1ECXA 3MAFB 2D64A 5FT8A 4DQ6A 2E7IA 3ECDA 2JJFA 5E4ZA 1TOEA 2AY5A 3G0TA 3N0LA 4F5FA 3FRKA 1QJ3A 2C0RA 1SZUA 4ZASA 1AMAA 1CL1A 2C81A 1OATA 3NU8A 2CB1A 3RCHA 2Z67A 4GSAA 3BWOA 3W1IA 1M4NA 1KL2A 3FVUA 2BKWA
chains in the Genus database with same CATH topology
5DJ9A 1BT4A 1W7LA 4BMKA 2DR1A 1C7NA 4F5KA 1ASGA 3BB8A 1CQ8A 1UU2A 4FFCA 4RM1A 2CJDA 1ASBA 1M32A 3DXVA 1BQDA 2W7MA 2ZY5A 1LKCA 3WKSA 1YIZA 1AHXA 3UAKA 2RFVA 2W7EA 3H7FA 4WYDA 1BS0A 3H14A 2O7CA 3QM2A 3BN1A 3W1JA 1M0QA 3A9XA 3VAXA 1AKAA 5K8BA 3H9XA 5KTBA 3D6KA 1QGNA 2DKBA 4ZWMA 4BA5A 4RKCA 1KMKA 3DXWA 1B4XA 2DKJA 2R5EA 3QGUA 1C9CA 1X28A 3HBXA 2OATA 3B1EA 3ISLA 4R8DA 3WKRA 5D95A 3LV2A 4WBTA 4A6RA 3JWBA 1GEWA 5HXXA 1DKAA 2W7KA 1TOKA 3N5MA 2KFPA 1ZODA 2HUFA 5FT5A 1GC0A 1TOGA 3R4TA 4ZDPA 2YCTA 1C0NA 3VK3A 3AEJC 3JW9A 3CQ6A 5G4JA 4AZJA 3N4RA 5E5IA 2BWNA 2CH2A 1N31A 3EI6A 1X29A 1ZOBA 1Y4IA 2YKVA 2BYJA 1BW0A 3AENA 4ITGA 2GSAA 1D7RA 2A1VA 1DGDA 1C4KA 3RCHB 3GZDA 1SPAA 3PDBA 4WP0A 2AATA 3AOVA 2VGZA 1CZCA 2DGMA 2WB6A 1V2FA 4ADCA 3K7YA 1YJYA 4MQQA 4UHOA 1QJ5A 2YCPA 3EIAA 3MAFA 4N0WA 1MDOA 3JWAA 3QPGA 3MC6C 4CBRA 2ZY2A 3DR4A 2EYQA 3FTBA 2VGUA 4DGTA 1ELQA 1WKGA 2VGWA 2D7YA 2W7GA 4P7YA 4BA4A 4XQ2A 3HMUA 3QHXA 5D5SA 3UE8A 1CS1A 3USFA 4K2IA 4E1OA 4LC3A 4E3QA 4W1XA 1BKGA 3P1TA 5DJ1A 1TOIA 1UU1A 1N2TA 1BQAA 2V1PA 3CAIA 2ZYJA 3EI7A 3WGBA 4UOYA 4A0HA 1JF9A 5EUEA 1E5FA 3FQ7A 1O61A 1O62A 3ATHA 4W91A 2QLRA 1CJ0A 3GWPA 1ARTA 2HUUA 2VLFA 3AEMA 2QA3A 2DGKA 5F8VA 1SFFA 1X0MA 2YRRA 3FQ8A 2YCNA 4ADEA 1GC2A 3PA9A 1C7GA 1QZ9A 2W8VA 5M4BA 4M2KA 4JE5A 3N4SA 1M0NA 1QITA 1PMOA 3GZCA 4MKKA 2W8UA 2W7HA 1W3UA 3CBFA 2C44A 2BI1A 2CSTA 4RKDA 5FT6A 3AELA 1D7VA 2YRIA 4K2BA 5G2PA 4F5IA 4EB7A 2D66A 3QN6A 3RUYA 3AENB 1AHFA 1WYTB 1IBJA 1G4VA 2NMPA 1AAMA 4CXRA 4B9BA 2BIAA 2FKIA 3PDBB 4RLGA 2HZPA 1KKJA 4EU1A 2GQNA 1T3IA 5FT4A 4IX8A 1TATA 1OHYA 2C7TA 1PFFA 2WK7A 1D7UA 3FZ6A 1DJEA 3FDBA 4E3RA 1RV4A 3ELEA 4UHNA 4HVKA 2BIGA 3ZRRA 3ZRQA 2VMTA 1AY5A 1AJSA 4FL0A 1B9IA 3GBXA 1ARGA 4WB0A 3E2FA 4R5FA 4WXGA 5DB5A 3WGCA 5M46A 4CXQA 1AKBA 2VLHA 1WKHA 1YIYA 3PAAA 1V2EA 2Q7WA 3CQ4A 3IHJA 2BYLA 1AY4A 9AATA 4OBVA 2W8WA 4AO4A 3VK2A 2JISA 2JJEA 2ZJGA 5I92A 1AMSA 1JS6A 1RV3A 2EGYA 2W8JA 4O6ZA 1YJZA 1GEXA 4GE4A 3UWCA 3F9TA 4JEZA 4ZDOA 2WK9A 1OXPA 4XJMA 4H63Q 1ASMA 4ZWVA 4K2MA 3NU7A 4Y0HA 2AY3A 5G09A 3DYDA 4GRXA 1BJOA 1OXOA 2VMNA 3FVSA 3TCMA 2EPJA 2HUIA 4U2HA 1ELUA 2VGTA 1AY8A 1S08A 1DGEA 2G6WA 5EUDA 1H0CA 1AHEA 1O4SA 4HF8A 4NOGA 4TN4A 4WYFA 3WY7A 4GDYA 5E3KA 4MQPA 1Z3ZA 4RITA 4N0BA 3MADA 2ZY4A 5LHAA 2G7JA 2GMUA 3KKIA 2W8TA 4OBUA 3II0A 2AY6A 2QSRA 2FQ6A 3EI9A 4W1VA 3I16A 3BCBA 2D63A 3JZLA 1VEFA 2W7IA 3LY1A 1M7YA 4OTLA 2ZC0A 2VMYA 3B1CA 1ASCA 2ORDA 2X3LA 3GJUA 3HT4A 3FD0A 3FQAA 4A0FA 2HOZA 4A0RA 1JS3A 1SZSA 3G7QA 2Z1ZA 2AEVA 1V72A 3WCOA 4F5GA 1BJ4A 4OCAA 1AJSB 2EO5A 3FFRA 5G4IA 3I5TA 3PIUA 4WB0B 4TV7A 4JE5D 1WYTA 3AEJA 1N8PA 2OQXA 4WYGA 1UKJA 3R9AA 4RIZA 4A00A 4E77A 3F0HA 1UU0A 3PGYA 3BV0A 2V0YA 3PPLA 5EAVA 2YKYA 3RBLA 2VGVA 1TOJA 2VGSA 1ASDA 4A0GA 4AOAA 3EZ1A 4F5HA 3MKJA 3GR9A 3NX3A 1M6SA 2CY8A 4ZSYA 1V2DA 3A9YA 1QISA 4ZAHA 3IF2A 4LW2A 3ASBA 3EUCA 4PIWA 1MLZA 1ORDA 2WK8A 1Z7DA 3WX9A 2E54A 1OHWA 3QBOA 1GCKA 1S09A 4M2MA 4K05A 3LVJA 1BJOB 3ASAA 3ZZJA 2BI3A 2W7DA 3DU4A 4TMRA 1I43A 2CJHA 3MC6A 3GSBA 1BJWA 4KXKA 4A72A 5TF5A 1J04A 1IUGA 1GC3A 3OP7A 3PDXA 3PD6B 4UQVA 1PG8A 3K28A 3RQ1A 1IX7A 4F4EA 3A8UX 1MLYA 4GE9A 2DOUA 2GB3A 2AY2A 2CJGA 3A2BA 4R2NA 3NYUA 4IXSA 2VYCA 5IWQA 4JEVA 3NNKA 1AIBA 2W7FA 1ASAA 3LVKA 3AOWA 1IJIA 1VJOA 2AY7A 3KE3A 1W7MA 4ZDLA 1CL2A 2BWPA 3AATA 3I4JA 4MY5A 2D5YA 2BI9A 4MGRA 5EUNA 2VMVA 3LG0A 1RVUA 2VMZA 1ARHA 4OYTA 3LVMA 2FNIA 3FVXA 2CINA 3JTXA 4OC9A 4CVQA 4OT8A 1DJUA 2W7JA 1AICA 1EG5A 1FC4A 3N7NA 1EQBA 3B46A 1FG3A 3E2YA 4WYAA 1RVYA 2ZSMA 3WZFA 2QMAA 3QI6A 1M0PA 3MEBA 2QBTA 4Y0IA 2VMWA 4QGRA 5C6UA 4ATQA 1GD9A 2AY4A 2VMQA 1B5OA 4WYEA 3TFTA 3K40A 3DC1A 1B5PA 3ZZKA 4A6TA 3E2ZA 3B1DA 2FM1A 1IAYA 2BI2A 4M2JA 4Q75A 2XH1A 4LNMA 4LNJA 4JEXA 2FNUA 1ASFA 2YKXA 1U08A 3FZ7A 5M49A 3BWNC 5G0AA 2VIBA 1WYUA 3ZRPA 4H51A 1MAQA 1ASLA 1DTYA 1PMMA 1QIRA 3L8AA 2VMUA 1D2FA 1LW4A 2Z61A 4EFFA 4R5ZA 5M4DA 4F5MA 5BJ3A 1DFOA 3E6GA 3DZZA 2VI9A 3BWNA 2DGLA 2CH1A 1B9HA 3FKDA 2ZP7A 4IW7A 4LW4A 2O0RA 4Y0DA 2PB0A 3BCAA 3VK4A 3Q8NA 1BJNA 3A9ZA 1AMRA 4ATPA 5HDMA 3FZ8A 1X2AA 4Q6RA 1GDEA 1GBNA 2D7ZA 2Z9XA 4JEYA 4IXZA 4ADBA 1ARIA 1SF2A 3HVYA 3HL2A 3AEPA 1WYVA 4IYOA 4XJPA 3HQTA 3P6KA 2FN6A 1W23A 1W7NA 3ACZA 3PD6A 3DRDA 1JG8A 4KYOA 1I29A 1IAXA 1KL1A 4L0OA 1SZKA 1DJ9A 2AY9A 3WLXA 2D65A 1G7XA 2EZ1A 4IXOA 3GETA 5HHYA 5EIGA 4LNLA 1IVRA 3ELPA 2OKJA 1MDZA 2HOXA 2R5CA 3TFUA 4F5JA 3TATA 2F8JA 4ITXA 2OKKA 2X5FA 1O69A 4UHMA 1H1CA 1TPLA 2OGEA 3MBBA 2AEUA 1CQ7A 3E2ZB 1AIAA 1GEYA 4PVFA 2X5DA 5DX5A 1IX8A 3W1HA 3JU7A 1ASEA 1M0OA 1MGVA 2PO3A 2YHKA 1S0AA 1AX4A 3EI8A 1WYUB 1IX6A 3EI5A 3AV7A 2BHXA 7AATA 1OHVA 1AAWA 4JF1A 2Z9WA 1G7WA 3G8MA 5BJ4A 4ZLVA 2Z1YA 2GMSA 1G4XA 4GE7A 3DR7A 3HDOA 2YOBA 3KGXA 4A6UA 1C7OA 2EH6A 2XBNA 3DODA 2BWOA 5EQCA 5G2QA 4XEWA 4EB5A 4WLHA 4OMAA 2VMPA 3M5UA 1ZC9A 2R0TA 2VMXA 5F9SA 4ZSWA 2HOYA 2HORA 4XJLA 3F6TA 4W1WA 4XJOA 5EFSA 4F5LA 3N4XA 2BI5A 3GZDC 2TPLA 1VP4A 3TQXA 1LC7A 4EMYA 4PFNA 4P3MA 4XK1A 1XEYA 2OGAA 2R2NA 3BCXA 1TARA 2JJGA 1ARSA 1WYVB 4IYOB 2Z9VA 2VMRA 3L44A 3NUIA 1CZEA 3B8XA 1LK9A 3CQ5A 1YOOA 2D61A 4PFFA 4RJ0A 1YNUA 4WLJA 4AZKA 1SVVA 4WXFA 3T32A 4RJYA 1J32A 4MKJA 1AKCA 2CFBA 1LC8A 1MDXA 1XI9A 4ZM4A 3KGWA 3NTJA 1B8GA 1KMJA 3FSLA 4J5UA 1LC5A 1D7SA 3NRAA 3NUBA 5EIGB 5AX8A 5JAYA 2R5CB 8AATA 2AY1A 4BHDA 4B98A 4JEWA 1S06A 3E9KA 4J8LA 3RBFA 3BC8A 4BQ0A 1CQ6A 3LWSA 4MQRA 3VOMA 2JGTA 4DBCA 4ZM3A 1S07A 1YAAA 2FYFA 1YJSA 3AEMC 2Z20A 2X8UA 1P3WA 4W5KA 2W7LA 2CANA 3PJ0A 3FCRA 1KKPA 1AJRA 2EZ2A 2VMSA 4WD2A 3FFHA 1LW5A 2E7JA 2VMOA 5J8QA 3EZSA 3N75A 1MAPA 3RI6A 4W8IA 4ADDA 4WYCA 2QB2A 3E77A 4Q76A 3NYTA 3NYSA 3AEOA 2ZSLA 3FDDA 2VIAA 3EIBA 1TASA 1EJIA 4ISYA 4RAEA 1FG7A 2VI8A 4AH3A 2HP2A 4IY7A 4CBSA 1GC4A 2PB2A 2QB3A 3WCNA 4I8AA 1AHGA 3MAUA 1AMQA 1ASNA 2CTZA 2O1BA 2ZUKA 2WKAA 3LVLB 2JJHA 3NDNA 3OKSA 4MSOA 2E7UA 4U1TA 1LS3A 1WSTA 3BS8A 4WXBA 1I48A 2ZY3A 1I41A 4JF0A 2AY8A 4Q31A 2BIEA 4XAUA 3COGA 1E5EA 5EAAA 2YKUA 1AHYA 4AO9A 2JG2A 5LH9A 2HP1A 4GEBA 3VP6A 2Z9UA 4KAMA 3HLMA 1ECXA 3MAFB 2D64A 5FT8A 4DQ6A 2E7IA 3ECDA 2JJFA 5E4ZA 1TOEA 2AY5A 3G0TA 3N0LA 4F5FA 3FRKA 1QJ3A 2C0RA 1SZUA 4ZASA 1AMAA 1CL1A 2C81A 1OATA 3NU8A 2CB1A 3RCHA 2Z67A 4GSAA 3BWOA 3W1IA 1M4NA 1KL2A 3FVUA 2BKWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DJ9 A;  1BT4 A;  1W7L A;  4BMK A;  2DR1 A;  1C7N A;  4F5K A;  1ASG A;  3BB8 A;  1CQ8 A;  1UU2 A;  4FFC A;  4RM1 A;  2CJD A;  1ASB A;  1M32 A;  3DXV A;  1BQD A;  2W7M A;  2ZY5 A;  1LKC A;  3WKS A;  1YIZ A;  1AHX A;  3UAK A;  2RFV A;  2W7E A;  3H7F A;  4WYD A;  1BS0 A;  3H14 A;  2O7C A;  3QM2 A;  3BN1 A;  3W1J A;  1M0Q A;  3A9X A;  3VAX A;  1AKA A;  5K8B A;  3D6K A;  1QGN A;  2DKB A;  4ZWM A;  4BA5 A;  4RKC A;  1KMK A;  3DXW A;  1B4X A;  2DKJ A;  2R5E A;  3QGU A;  1C9C A;  1X28 A;  3HBX A;  2OAT A;  3B1E A;  3ISL A;  4R8D A;  3WKR A;  5D95 A;  3LV2 A;  4WBT A;  4A6R A;  3JWB A;  1GEW A;  5HXX A;  1DKA A;  2W7K A;  1TOK A;  3N5M A;  1ZOD A;  2HUF A;  5FT5 A;  1GC0 A;  1TOG A;  3R4T A;  4ZDP A;  2YCT A;  1C0N A;  3VK3 A;  3AEJ C;  3JW9 A;  3CQ6 A;  5G4J A;  4AZJ A;  5E5I A;  2BWN A;  2CH2 A;  1N31 A;  3EI6 A;  1X29 A;  1ZOB A;  1Y4I A;  2YKV A;  2BYJ A;  1BW0 A;  3AEN A;  4ITG A;  2GSA A;  1D7R A;  1DGD A;  1C4K A;  3RCH B;  3GZD A;  1SPA A;  3PDB A;  4WP0 A;  2AAT A;  3AOV A;  2VGZ A;  1CZC A;  2DGM A;  1V2F A;  4ADC A;  3K7Y A;  1YJY A;  4MQQ A;  4UHO A;  1QJ5 A;  2YCP A;  3EIA A;  3MAF A;  4N0W A;  1MDO A;  3JWA A;  3QPG A;  3MC6 C;  4CBR A;  2ZY2 A;  3DR4 A;  3FTB A;  2VGU A;  4DGT A;  1ELQ A;  1WKG A;  2VGW A;  2D7Y A;  2W7G A;  4P7Y A;  4BA4 A;  4XQ2 A;  3HMU A;  3QHX A;  5D5S A;  3UE8 A;  1CS1 A;  3USF A;  4K2I A;  4E1O A;  4LC3 A;  4E3Q A;  4W1X A;  1BKG A;  3P1T A;  5DJ1 A;  1TOI A;  1UU1 A;  1N2T A;  1BQA A;  2V1P A;  3CAI A;  2ZYJ A;  3EI7 A;  3WGB A;  4UOY A;  4A0H A;  1JF9 A;  5EUE A;  1E5F A;  3FQ7 A;  1O61 A;  1O62 A;  3ATH A;  4W91 A;  2QLR A;  1CJ0 A;  3GWP A;  1ART A;  2HUU A;  2VLF A;  3AEM A;  2QA3 A;  2DGK A;  5F8V A;  1SFF A;  1X0M A;  2YRR A;  3FQ8 A;  2YCN A;  4ADE A;  1GC2 A;  3PA9 A;  1C7G A;  1QZ9 A;  2W8V A;  5M4B A;  4M2K A;  4JE5 A;  1M0N A;  1QIT A;  1PMO A;  3GZC A;  4MKK A;  2W8U A;  2W7H A;  1W3U A;  3CBF A;  2C44 A;  2BI1 A;  2CST A;  4RKD A;  5FT6 A;  3AEL A;  1D7V A;  2YRI A;  4K2B A;  5G2P A;  4F5I A;  4EB7 A;  2D66 A;  3QN6 A;  3RUY A;  3AEN B;  1AHF A;  1WYT B;  1IBJ A;  1G4V A;  2NMP A;  1AAM A;  4CXR A;  4B9B A;  2BIA A;  3PDB B;  4RLG A;  2HZP A;  1KKJ A;  4EU1 A;  2GQN A;  1T3I A;  5FT4 A;  4IX8 A;  1TAT A;  1OHY A;  2C7T A;  1PFF A;  2WK7 A;  1D7U A;  3FZ6 A;  1DJE A;  3FDB A;  4E3R A;  1RV4 A;  3ELE A;  4UHN A;  4HVK A;  2BIG A;  3ZRR A;  3ZRQ A;  2VMT A;  1AY5 A;  1AJS A;  4FL0 A;  1B9I A;  3GBX A;  1ARG A;  4WB0 A;  3E2F A;  4R5F A;  4WXG A;  5DB5 A;  3WGC A;  5M46 A;  4CXQ A;  1AKB A;  2VLH A;  1WKH A;  1YIY A;  3PAA A;  1V2E A;  2Q7W A;  3CQ4 A;  3IHJ A;  2BYL A;  1AY4 A;  9AAT A;  4OBV A;  2W8W A;  4AO4 A;  3VK2 A;  2JIS A;  2JJE A;  2ZJG A;  5I92 A;  1AMS A;  1JS6 A;  1RV3 A;  2EGY A;  2W8J A;  4O6Z A;  1YJZ A;  1GEX A;  4GE4 A;  3UWC A;  3F9T A;  4JEZ A;  4ZDO A;  2WK9 A;  1OXP A;  4XJM A;  1ASM A;  4ZWV A;  4K2M A;  3NU7 A;  4Y0H A;  2AY3 A;  5G09 A;  3DYD A;  4GRX A;  1BJO A;  1OXO A;  2VMN A;  3FVS A;  3TCM A;  2EPJ A;  2HUI A;  4U2H A;  1ELU A;  2VGT A;  1AY8 A;  1S08 A;  1DGE A;  2G6W A;  5EUD A;  1H0C A;  1AHE A;  1O4S A;  4HF8 A;  4NOG A;  4TN4 A;  4WYF A;  3WY7 A;  4GDY A;  5E3K A;  4MQP A;  1Z3Z A;  4RIT A;  4N0B A;  3MAD A;  2ZY4 A;  5LHA A;  2GMU A;  3KKI A;  2W8T A;  4OBU A;  3II0 A;  2AY6 A;  2FQ6 A;  3EI9 A;  4W1V A;  3I16 A;  3BCB A;  2D63 A;  3JZL A;  1VEF A;  2W7I A;  3LY1 A;  1M7Y A;  4OTL A;  2ZC0 A;  2VMY A;  3B1C A;  1ASC A;  2ORD A;  2X3L A;  3GJU A;  3HT4 A;  3FD0 A;  3FQA A;  4A0F A;  2HOZ A;  4A0R A;  1JS3 A;  1SZS A;  3G7Q A;  2Z1Z A;  2AEV A;  1V72 A;  3WCO A;  4F5G A;  1BJ4 A;  4OCA A;  1AJS B;  2EO5 A;  3FFR A;  5G4I A;  3I5T A;  3PIU A;  4WB0 B;  4TV7 A;  4JE5 D;  1WYT A;  3AEJ A;  1N8P A;  2OQX A;  4WYG A;  1UKJ A;  3R9A A;  4RIZ A;  4A00 A;  4E77 A;  3F0H A;  1UU0 A;  3PGY A;  3BV0 A;  2V0Y A;  3PPL A;  5EAV A;  2YKY A;  3RBL A;  2VGV A;  1TOJ A;  2VGS A;  1ASD A;  4A0G A;  4AOA A;  3EZ1 A;  4F5H A;  3MKJ A;  3GR9 A;  3NX3 A;  1M6S A;  2CY8 A;  4ZSY A;  1V2D A;  3A9Y A;  1QIS A;  4ZAH A;  3IF2 A;  4LW2 A;  3ASB A;  3EUC A;  4PIW A;  1MLZ A;  1ORD A;  2WK8 A;  1Z7D A;  3WX9 A;  2E54 A;  1OHW A;  3QBO A;  1GCK A;  1S09 A;  4M2M A;  3LVJ A;  1BJO B;  3ASA A;  3ZZJ A;  2BI3 A;  2W7D A;  3DU4 A;  4TMR A;  1I43 A;  2CJH A;  3MC6 A;  3GSB A;  1BJW A;  4KXK A;  4A72 A;  5TF5 A;  1J04 A;  1IUG A;  1GC3 A;  3OP7 A;  3PDX A;  3PD6 B;  4UQV A;  1PG8 A;  3K28 A;  3RQ1 A;  1IX7 A;  4F4E A;  3A8U X;  1MLY A;  4GE9 A;  2DOU A;  2GB3 A;  2AY2 A;  2CJG A;  3A2B A;  4R2N A;  3NYU A;  4IXS A;  2VYC A;  5IWQ A;  4JEV A;  3NNK A;  1AIB A;  2W7F A;  1ASA A;  3LVK A;  3AOW A;  1IJI A;  1VJO A;  2AY7 A;  3KE3 A;  1W7M A;  4ZDL A;  1CL2 A;  2BWP A;  3AAT A;  3I4J A;  4MY5 A;  2D5Y A;  2BI9 A;  4MGR A;  5EUN A;  2VMV A;  3LG0 A;  1RVU A;  2VMZ A;  1ARH A;  4OYT A;  3LVM A;  2FNI A;  3FVX A;  2CIN A;  3JTX A;  4OC9 A;  4CVQ A;  4OT8 A;  1DJU A;  2W7J A;  1AIC A;  1EG5 A;  1FC4 A;  1EQB A;  3B46 A;  1FG3 A;  3E2Y A;  4WYA A;  1RVY A;  2ZSM A;  3WZF A;  2QMA A;  3QI6 A;  1M0P A;  3MEB A;  2QBT A;  4Y0I A;  2VMW A;  4QGR A;  5C6U A;  4ATQ A;  1GD9 A;  2AY4 A;  2VMQ A;  1B5O A;  4WYE A;  3TFT A;  3K40 A;  3DC1 A;  1B5P A;  3ZZK A;  4A6T A;  3E2Z A;  3B1D A;  2FM1 A;  1IAY A;  2BI2 A;  4M2J A;  4Q75 A;  2XH1 A;  4LNM A;  4LNJ A;  4JEX A;  2FNU A;  1ASF A;  2YKX A;  1U08 A;  3FZ7 A;  5M49 A;  3BWN C;  5G0A A;  2VIB A;  1WYU A;  3ZRP A;  4H51 A;  1MAQ A;  1ASL A;  1DTY A;  1PMM A;  1QIR A;  3L8A A;  2VMU A;  1D2F A;  1LW4 A;  2Z61 A;  4EFF A;  4R5Z A;  5M4D A;  4F5M A;  5BJ3 A;  1DFO A;  3E6G A;  3DZZ A;  2VI9 A;  3BWN A;  2DGL A;  2CH1 A;  1B9H A;  3FKD A;  2ZP7 A;  4IW7 A;  4LW4 A;  2O0R A;  4Y0D A;  2PB0 A;  3BCA A;  3VK4 A;  3Q8N A;  1BJN A;  3A9Z A;  1AMR A;  4ATP A;  5HDM A;  3FZ8 A;  1X2A A;  4Q6R A;  1GDE A;  1GBN A;  2D7Z A;  2Z9X A;  4JEY A;  4IXZ A;  4ADB A;  1ARI A;  1SF2 A;  3HVY A;  3HL2 A;  3AEP A;  1WYV A;  4IYO A;  4XJP A;  3HQT A;  3P6K A;  2FN6 A;  1W23 A;  1W7N A;  3ACZ A;  3PD6 A;  3DRD A;  1JG8 A;  4KYO A;  1I29 A;  1IAX A;  1KL1 A;  4L0O A;  1SZK A;  1DJ9 A;  2AY9 A;  3WLX A;  2D65 A;  1G7X A;  2EZ1 A;  4IXO A;  3GET A;  5HHY A;  5EIG A;  4LNL A;  1IVR A;  3ELP A;  2OKJ A;  1MDZ A;  2HOX A;  2R5C A;  3TFU A;  4F5J A;  3TAT A;  2F8J A;  4ITX A;  2OKK A;  2X5F A;  1O69 A;  4UHM A;  1H1C A;  1TPL A;  2OGE A;  3MBB A;  2AEU A;  1CQ7 A;  3E2Z B;  1AIA A;  1GEY A;  4PVF A;  2X5D A;  5DX5 A;  1IX8 A;  3W1H A;  3JU7 A;  1ASE A;  1M0O A;  1MGV A;  2PO3 A;  2YHK A;  1S0A A;  1AX4 A;  3EI8 A;  1WYU B;  1IX6 A;  3EI5 A;  3AV7 A;  2BHX A;  7AAT A;  1OHV A;  1AAW A;  4JF1 A;  2Z9W A;  1G7W A;  3G8M A;  5BJ4 A;  4ZLV A;  2Z1Y A;  2GMS A;  1G4X A;  4GE7 A;  3DR7 A;  3HDO A;  2YOB A;  3KGX A;  4A6U A;  1C7O A;  2EH6 A;  2XBN A;  3DOD A;  2BWO A;  5EQC A;  5G2Q A;  4XEW A;  4EB5 A;  4WLH A;  4OMA A;  2VMP A;  3M5U A;  1ZC9 A;  2R0T A;  2VMX A;  5F9S A;  4ZSW A;  2HOY A;  2HOR A;  4XJL A;  3F6T A;  4W1W A;  4XJO A;  5EFS A;  4F5L A;  2BI5 A;  3GZD C;  2TPL A;  1VP4 A;  3TQX A;  1LC7 A;  4EMY A;  4PFN A;  4P3M A;  4XK1 A;  1XEY A;  2OGA A;  2R2N A;  3BCX A;  1TAR A;  2JJG A;  1ARS A;  1WYV B;  4IYO B;  2Z9V A;  2VMR A;  3L44 A;  3NUI A;  1CZE A;  3B8X A;  1LK9 A;  3CQ5 A;  1YOO A;  2D61 A;  4PFF A;  4RJ0 A;  1YNU A;  4WLJ A;  4AZK A;  1SVV A;  4WXF A;  3T32 A;  4RJY A;  1J32 A;  4MKJ A;  1AKC A;  2CFB A;  1LC8 A;  1MDX A;  1XI9 A;  4ZM4 A;  3KGW A;  3NTJ A;  1B8G A;  1KMJ A;  3FSL A;  4J5U A;  1LC5 A;  1D7S A;  3NRA A;  3NUB A;  5EIG B;  5AX8 A;  5JAY A;  2R5C B;  8AAT A;  2AY1 A;  4BHD A;  4B98 A;  4JEW A;  1S06 A;  3E9K A;  4J8L A;  3RBF A;  3BC8 A;  4BQ0 A;  1CQ6 A;  3LWS A;  4MQR A;  3VOM A;  2JGT A;  4DBC A;  4ZM3 A;  1S07 A;  1YAA A;  2FYF A;  1YJS A;  3AEM C;  2Z20 A;  2X8U A;  1P3W A;  4W5K A;  2W7L A;  2CAN A;  3PJ0 A;  3FCR A;  1KKP A;  1AJR A;  2EZ2 A;  2VMS A;  4WD2 A;  3FFH A;  1LW5 A;  2E7J A;  2VMO A;  5J8Q A;  3EZS A;  3N75 A;  1MAP A;  3RI6 A;  4W8I A;  4ADD A;  4WYC A;  2QB2 A;  3E77 A;  4Q76 A;  3NYT A;  3NYS A;  3AEO A;  2ZSL A;  3FDD A;  2VIA A;  3EIB A;  1TAS A;  1EJI A;  4ISY A;  4RAE A;  1FG7 A;  2VI8 A;  4AH3 A;  2HP2 A;  4IY7 A;  4CBS A;  1GC4 A;  2PB2 A;  2QB3 A;  3WCN A;  4I8A A;  1AHG A;  3MAU A;  1AMQ A;  1ASN A;  2CTZ A;  2O1B A;  2ZUK A;  2WKA A;  3LVL B;  2JJH A;  3NDN A;  3OKS A;  4MSO A;  2E7U A;  4U1T A;  1LS3 A;  1WST A;  3BS8 A;  4WXB A;  1I48 A;  2ZY3 A;  1I41 A;  4JF0 A;  2AY8 A;  4Q31 A;  2BIE A;  4XAU A;  3COG A;  1E5E A;  5EAA A;  2YKU A;  1AHY A;  4AO9 A;  2JG2 A;  5LH9 A;  2HP1 A;  4GEB A;  3VP6 A;  2Z9U A;  4KAM A;  3HLM A;  1ECX A;  3MAF B;  2D64 A;  5FT8 A;  4DQ6 A;  2E7I A;  3ECD A;  2JJF A;  5E4Z A;  1TOE A;  2AY5 A;  3G0T A;  3N0L A;  4F5F A;  3FRK A;  1QJ3 A;  2C0R A;  1SZU A;  4ZAS A;  1AMA A;  1CL1 A;  2C81 A;  1OAT A;  3NU8 A;  2CB1 A;  3RCH A;  2Z67 A;  4GSA A;  3BWO A;  3W1I A;  1M4N A;  1KL2 A;  3FVU A;  2BKW A; 
#chains in the Genus database with same CATH topology
 5DJ9 A;  1BT4 A;  1W7L A;  4BMK A;  2DR1 A;  1C7N A;  4F5K A;  1ASG A;  3BB8 A;  1CQ8 A;  1UU2 A;  4FFC A;  4RM1 A;  2CJD A;  1ASB A;  1M32 A;  3DXV A;  1BQD A;  2W7M A;  2ZY5 A;  1LKC A;  3WKS A;  1YIZ A;  1AHX A;  3UAK A;  2RFV A;  2W7E A;  3H7F A;  4WYD A;  1BS0 A;  3H14 A;  2O7C A;  3QM2 A;  3BN1 A;  3W1J A;  1M0Q A;  3A9X A;  3VAX A;  1AKA A;  5K8B A;  3H9X A;  5KTB A;  3D6K A;  1QGN A;  2DKB A;  4ZWM A;  4BA5 A;  4RKC A;  1KMK A;  3DXW A;  1B4X A;  2DKJ A;  2R5E A;  3QGU A;  1C9C A;  1X28 A;  3HBX A;  2OAT A;  3B1E A;  3ISL A;  4R8D A;  3WKR A;  5D95 A;  3LV2 A;  4WBT A;  4A6R A;  3JWB A;  1GEW A;  5HXX A;  1DKA A;  2W7K A;  1TOK A;  3N5M A;  2KFP A;  1ZOD A;  2HUF A;  5FT5 A;  1GC0 A;  1TOG A;  3R4T A;  4ZDP A;  2YCT A;  1C0N A;  3VK3 A;  3AEJ C;  3JW9 A;  3CQ6 A;  5G4J A;  4AZJ A;  3N4R A;  5E5I A;  2BWN A;  2CH2 A;  1N31 A;  3EI6 A;  1X29 A;  1ZOB A;  1Y4I A;  2YKV A;  2BYJ A;  1BW0 A;  3AEN A;  4ITG A;  2GSA A;  1D7R A;  2A1V A;  1DGD A;  1C4K A;  3RCH B;  3GZD A;  1SPA A;  3PDB A;  4WP0 A;  2AAT A;  3AOV A;  2VGZ A;  1CZC A;  2DGM A;  2WB6 A;  1V2F A;  4ADC A;  3K7Y A;  1YJY A;  4MQQ A;  4UHO A;  1QJ5 A;  2YCP A;  3EIA A;  3MAF A;  4N0W A;  1MDO A;  3JWA A;  3QPG A;  3MC6 C;  4CBR A;  2ZY2 A;  3DR4 A;  2EYQ A;  3FTB A;  2VGU A;  4DGT A;  1ELQ A;  1WKG A;  2VGW A;  2D7Y A;  2W7G A;  4P7Y A;  4BA4 A;  4XQ2 A;  3HMU A;  3QHX A;  5D5S A;  3UE8 A;  1CS1 A;  3USF A;  4K2I A;  4E1O A;  4LC3 A;  4E3Q A;  4W1X A;  1BKG A;  3P1T A;  5DJ1 A;  1TOI A;  1UU1 A;  1N2T A;  1BQA A;  2V1P A;  3CAI A;  2ZYJ A;  3EI7 A;  3WGB A;  4UOY A;  4A0H A;  1JF9 A;  5EUE A;  1E5F A;  3FQ7 A;  1O61 A;  1O62 A;  3ATH A;  4W91 A;  2QLR A;  1CJ0 A;  3GWP A;  1ART A;  2HUU A;  2VLF A;  3AEM A;  2QA3 A;  2DGK A;  5F8V A;  1SFF A;  1X0M A;  2YRR A;  3FQ8 A;  2YCN A;  4ADE A;  1GC2 A;  3PA9 A;  1C7G A;  1QZ9 A;  2W8V A;  5M4B A;  4M2K A;  4JE5 A;  3N4S A;  1M0N A;  1QIT A;  1PMO A;  3GZC A;  4MKK A;  2W8U A;  2W7H A;  1W3U A;  3CBF A;  2C44 A;  2BI1 A;  2CST A;  4RKD A;  5FT6 A;  3AEL A;  1D7V A;  2YRI A;  4K2B A;  5G2P A;  4F5I A;  4EB7 A;  2D66 A;  3QN6 A;  3RUY A;  3AEN B;  1AHF A;  1WYT B;  1IBJ A;  1G4V A;  2NMP A;  1AAM A;  4CXR A;  4B9B A;  2BIA A;  2FKI A;  3PDB B;  4RLG A;  2HZP A;  1KKJ A;  4EU1 A;  2GQN A;  1T3I A;  5FT4 A;  4IX8 A;  1TAT A;  1OHY A;  2C7T A;  1PFF A;  2WK7 A;  1D7U A;  3FZ6 A;  1DJE A;  3FDB A;  4E3R A;  1RV4 A;  3ELE A;  4UHN A;  4HVK A;  2BIG A;  3ZRR A;  3ZRQ A;  2VMT A;  1AY5 A;  1AJS A;  4FL0 A;  1B9I A;  3GBX A;  1ARG A;  4WB0 A;  3E2F A;  4R5F A;  4WXG A;  5DB5 A;  3WGC A;  5M46 A;  4CXQ A;  1AKB A;  2VLH A;  1WKH A;  1YIY A;  3PAA A;  1V2E A;  2Q7W A;  3CQ4 A;  3IHJ A;  2BYL A;  1AY4 A;  9AAT A;  4OBV A;  2W8W A;  4AO4 A;  3VK2 A;  2JIS A;  2JJE A;  2ZJG A;  5I92 A;  1AMS A;  1JS6 A;  1RV3 A;  2EGY A;  2W8J A;  4O6Z A;  1YJZ A;  1GEX A;  4GE4 A;  3UWC A;  3F9T A;  4JEZ A;  4ZDO A;  2WK9 A;  1OXP A;  4XJM A;  4H63 Q;  1ASM A;  4ZWV A;  4K2M A;  3NU7 A;  4Y0H A;  2AY3 A;  5G09 A;  3DYD A;  4GRX A;  1BJO A;  1OXO A;  2VMN A;  3FVS A;  3TCM A;  2EPJ A;  2HUI A;  4U2H A;  1ELU A;  2VGT A;  1AY8 A;  1S08 A;  1DGE A;  2G6W A;  5EUD A;  1H0C A;  1AHE A;  1O4S A;  4HF8 A;  4NOG A;  4TN4 A;  4WYF A;  3WY7 A;  4GDY A;  5E3K A;  4MQP A;  1Z3Z A;  4RIT A;  4N0B A;  3MAD A;  2ZY4 A;  5LHA A;  2G7J A;  2GMU A;  3KKI A;  2W8T A;  4OBU A;  3II0 A;  2AY6 A;  2QSR A;  2FQ6 A;  3EI9 A;  4W1V A;  3I16 A;  3BCB A;  2D63 A;  3JZL A;  1VEF A;  2W7I A;  3LY1 A;  1M7Y A;  4OTL A;  2ZC0 A;  2VMY A;  3B1C A;  1ASC A;  2ORD A;  2X3L A;  3GJU A;  3HT4 A;  3FD0 A;  3FQA A;  4A0F A;  2HOZ A;  4A0R A;  1JS3 A;  1SZS A;  3G7Q A;  2Z1Z A;  2AEV A;  1V72 A;  3WCO A;  4F5G A;  1BJ4 A;  4OCA A;  1AJS B;  2EO5 A;  3FFR A;  5G4I A;  3I5T A;  3PIU A;  4WB0 B;  4TV7 A;  4JE5 D;  1WYT A;  3AEJ A;  1N8P A;  2OQX A;  4WYG A;  1UKJ A;  3R9A A;  4RIZ A;  4A00 A;  4E77 A;  3F0H A;  1UU0 A;  3PGY A;  3BV0 A;  2V0Y A;  3PPL A;  5EAV A;  2YKY A;  3RBL A;  2VGV A;  1TOJ A;  2VGS A;  1ASD A;  4A0G A;  4AOA A;  3EZ1 A;  4F5H A;  3MKJ A;  3GR9 A;  3NX3 A;  1M6S A;  2CY8 A;  4ZSY A;  1V2D A;  3A9Y A;  1QIS A;  4ZAH A;  3IF2 A;  4LW2 A;  3ASB A;  3EUC A;  4PIW A;  1MLZ A;  1ORD A;  2WK8 A;  1Z7D A;  3WX9 A;  2E54 A;  1OHW A;  3QBO A;  1GCK A;  1S09 A;  4M2M A;  4K05 A;  3LVJ A;  1BJO B;  3ASA A;  3ZZJ A;  2BI3 A;  2W7D A;  3DU4 A;  4TMR A;  1I43 A;  2CJH A;  3MC6 A;  3GSB A;  1BJW A;  4KXK A;  4A72 A;  5TF5 A;  1J04 A;  1IUG A;  1GC3 A;  3OP7 A;  3PDX A;  3PD6 B;  4UQV A;  1PG8 A;  3K28 A;  3RQ1 A;  1IX7 A;  4F4E A;  3A8U X;  1MLY A;  4GE9 A;  2DOU A;  2GB3 A;  2AY2 A;  2CJG A;  3A2B A;  4R2N A;  3NYU A;  4IXS A;  2VYC A;  5IWQ A;  4JEV A;  3NNK A;  1AIB A;  2W7F A;  1ASA A;  3LVK A;  3AOW A;  1IJI A;  1VJO A;  2AY7 A;  3KE3 A;  1W7M A;  4ZDL A;  1CL2 A;  2BWP A;  3AAT A;  3I4J A;  4MY5 A;  2D5Y A;  2BI9 A;  4MGR A;  5EUN A;  2VMV A;  3LG0 A;  1RVU A;  2VMZ A;  1ARH A;  4OYT A;  3LVM A;  2FNI A;  3FVX A;  2CIN A;  3JTX A;  4OC9 A;  4CVQ A;  4OT8 A;  1DJU A;  2W7J A;  1AIC A;  1EG5 A;  1FC4 A;  3N7N A;  1EQB A;  3B46 A;  1FG3 A;  3E2Y A;  4WYA A;  1RVY A;  2ZSM A;  3WZF A;  2QMA A;  3QI6 A;  1M0P A;  3MEB A;  2QBT A;  4Y0I A;  2VMW A;  4QGR A;  5C6U A;  4ATQ A;  1GD9 A;  2AY4 A;  2VMQ A;  1B5O A;  4WYE A;  3TFT A;  3K40 A;  3DC1 A;  1B5P A;  3ZZK A;  4A6T A;  3E2Z A;  3B1D A;  2FM1 A;  1IAY A;  2BI2 A;  4M2J A;  4Q75 A;  2XH1 A;  4LNM A;  4LNJ A;  4JEX A;  2FNU A;  1ASF A;  2YKX A;  1U08 A;  3FZ7 A;  5M49 A;  3BWN C;  5G0A A;  2VIB A;  1WYU A;  3ZRP A;  4H51 A;  1MAQ A;  1ASL A;  1DTY A;  1PMM A;  1QIR A;  3L8A A;  2VMU A;  1D2F A;  1LW4 A;  2Z61 A;  4EFF A;  4R5Z A;  5M4D A;  4F5M A;  5BJ3 A;  1DFO A;  3E6G A;  3DZZ A;  2VI9 A;  3BWN A;  2DGL A;  2CH1 A;  1B9H A;  3FKD A;  2ZP7 A;  4IW7 A;  4LW4 A;  2O0R A;  4Y0D A;  2PB0 A;  3BCA A;  3VK4 A;  3Q8N A;  1BJN A;  3A9Z A;  1AMR A;  4ATP A;  5HDM A;  3FZ8 A;  1X2A A;  4Q6R A;  1GDE A;  1GBN A;  2D7Z A;  2Z9X A;  4JEY A;  4IXZ A;  4ADB A;  1ARI A;  1SF2 A;  3HVY A;  3HL2 A;  3AEP A;  1WYV A;  4IYO A;  4XJP A;  3HQT A;  3P6K A;  2FN6 A;  1W23 A;  1W7N A;  3ACZ A;  3PD6 A;  3DRD A;  1JG8 A;  4KYO A;  1I29 A;  1IAX A;  1KL1 A;  4L0O A;  1SZK A;  1DJ9 A;  2AY9 A;  3WLX A;  2D65 A;  1G7X A;  2EZ1 A;  4IXO A;  3GET A;  5HHY A;  5EIG A;  4LNL A;  1IVR A;  3ELP A;  2OKJ A;  1MDZ A;  2HOX A;  2R5C A;  3TFU A;  4F5J A;  3TAT A;  2F8J A;  4ITX A;  2OKK A;  2X5F A;  1O69 A;  4UHM A;  1H1C A;  1TPL A;  2OGE A;  3MBB A;  2AEU A;  1CQ7 A;  3E2Z B;  1AIA A;  1GEY A;  4PVF A;  2X5D A;  5DX5 A;  1IX8 A;  3W1H A;  3JU7 A;  1ASE A;  1M0O A;  1MGV A;  2PO3 A;  2YHK A;  1S0A A;  1AX4 A;  3EI8 A;  1WYU B;  1IX6 A;  3EI5 A;  3AV7 A;  2BHX A;  7AAT A;  1OHV A;  1AAW A;  4JF1 A;  2Z9W A;  1G7W A;  3G8M A;  5BJ4 A;  4ZLV A;  2Z1Y A;  2GMS A;  1G4X A;  4GE7 A;  3DR7 A;  3HDO A;  2YOB A;  3KGX A;  4A6U A;  1C7O A;  2EH6 A;  2XBN A;  3DOD A;  2BWO A;  5EQC A;  5G2Q A;  4XEW A;  4EB5 A;  4WLH A;  4OMA A;  2VMP A;  3M5U A;  1ZC9 A;  2R0T A;  2VMX A;  5F9S A;  4ZSW A;  2HOY A;  2HOR A;  4XJL A;  3F6T A;  4W1W A;  4XJO A;  5EFS A;  4F5L A;  3N4X A;  2BI5 A;  3GZD C;  2TPL A;  1VP4 A;  3TQX A;  1LC7 A;  4EMY A;  4PFN A;  4P3M A;  4XK1 A;  1XEY A;  2OGA A;  2R2N A;  3BCX A;  1TAR A;  2JJG A;  1ARS A;  1WYV B;  4IYO B;  2Z9V A;  2VMR A;  3L44 A;  3NUI A;  1CZE A;  3B8X A;  1LK9 A;  3CQ5 A;  1YOO A;  2D61 A;  4PFF A;  4RJ0 A;  1YNU A;  4WLJ A;  4AZK A;  1SVV A;  4WXF A;  3T32 A;  4RJY A;  1J32 A;  4MKJ A;  1AKC A;  2CFB A;  1LC8 A;  1MDX A;  1XI9 A;  4ZM4 A;  3KGW A;  3NTJ A;  1B8G A;  1KMJ A;  3FSL A;  4J5U A;  1LC5 A;  1D7S A;  3NRA A;  3NUB A;  5EIG B;  5AX8 A;  5JAY A;  2R5C B;  8AAT A;  2AY1 A;  4BHD A;  4B98 A;  4JEW A;  1S06 A;  3E9K A;  4J8L A;  3RBF A;  3BC8 A;  4BQ0 A;  1CQ6 A;  3LWS A;  4MQR A;  3VOM A;  2JGT A;  4DBC A;  4ZM3 A;  1S07 A;  1YAA A;  2FYF A;  1YJS A;  3AEM C;  2Z20 A;  2X8U A;  1P3W A;  4W5K A;  2W7L A;  2CAN A;  3PJ0 A;  3FCR A;  1KKP A;  1AJR A;  2EZ2 A;  2VMS A;  4WD2 A;  3FFH A;  1LW5 A;  2E7J A;  2VMO A;  5J8Q A;  3EZS A;  3N75 A;  1MAP A;  3RI6 A;  4W8I A;  4ADD A;  4WYC A;  2QB2 A;  3E77 A;  4Q76 A;  3NYT A;  3NYS A;  3AEO A;  2ZSL A;  3FDD A;  2VIA A;  3EIB A;  1TAS A;  1EJI A;  4ISY A;  4RAE A;  1FG7 A;  2VI8 A;  4AH3 A;  2HP2 A;  4IY7 A;  4CBS A;  1GC4 A;  2PB2 A;  2QB3 A;  3WCN A;  4I8A A;  1AHG A;  3MAU A;  1AMQ A;  1ASN A;  2CTZ A;  2O1B A;  2ZUK A;  2WKA A;  3LVL B;  2JJH A;  3NDN A;  3OKS A;  4MSO A;  2E7U A;  4U1T A;  1LS3 A;  1WST A;  3BS8 A;  4WXB A;  1I48 A;  2ZY3 A;  1KAF A;  1I41 A;  4JF0 A;  2AY8 A;  4Q31 A;  2BIE A;  4XAU A;  3COG A;  1E5E A;  5EAA A;  2YKU A;  1AHY A;  4AO9 A;  2JG2 A;  5LH9 A;  2HP1 A;  4GEB A;  3VP6 A;  2Z9U A;  4KAM A;  3HLM A;  1ECX A;  3MAF B;  2D64 A;  5FT8 A;  4DQ6 A;  2E7I A;  3ECD A;  2JJF A;  5E4Z A;  1TOE A;  2AY5 A;  3G0T A;  3N0L A;  4F5F A;  3FRK A;  1QJ3 A;  2C0R A;  1SZU A;  4ZAS A;  1AMA A;  1CL1 A;  2C81 A;  1OAT A;  3NU8 A;  2CB1 A;  3RCH A;  2Z67 A;  4GSA A;  3BWO A;  3W1I A;  1M4N A;  1KL2 A;  3FVU A;  2BKW A; 
#chains in the Genus database with same CATH homology
 5DJ9 A;  1BT4 A;  1W7L A;  4BMK A;  2DR1 A;  1C7N A;  4F5K A;  1ASG A;  3BB8 A;  1CQ8 A;  1UU2 A;  4FFC A;  4RM1 A;  2CJD A;  1ASB A;  1M32 A;  3DXV A;  1BQD A;  2W7M A;  2ZY5 A;  1LKC A;  3WKS A;  1YIZ A;  1AHX A;  3UAK A;  2RFV A;  2W7E A;  3H7F A;  4WYD A;  1BS0 A;  3H14 A;  2O7C A;  3QM2 A;  3BN1 A;  3W1J A;  1M0Q A;  3A9X A;  3VAX A;  1AKA A;  5K8B A;  3H9X A;  5KTB A;  3D6K A;  1QGN A;  2DKB A;  4ZWM A;  4BA5 A;  4RKC A;  1KMK A;  3DXW A;  1B4X A;  2DKJ A;  2R5E A;  3QGU A;  1C9C A;  1X28 A;  3HBX A;  2OAT A;  3B1E A;  3ISL A;  4R8D A;  3WKR A;  5D95 A;  3LV2 A;  4WBT A;  4A6R A;  3JWB A;  1GEW A;  5HXX A;  1DKA A;  2W7K A;  1TOK A;  3N5M A;  2KFP A;  1ZOD A;  2HUF A;  5FT5 A;  1GC0 A;  1TOG A;  3R4T A;  4ZDP A;  2YCT A;  1C0N A;  3VK3 A;  3AEJ C;  3JW9 A;  3CQ6 A;  5G4J A;  4AZJ A;  3N4R A;  5E5I A;  2BWN A;  2CH2 A;  1N31 A;  3EI6 A;  1X29 A;  1ZOB A;  1Y4I A;  2YKV A;  2BYJ A;  1BW0 A;  3AEN A;  4ITG A;  2GSA A;  1D7R A;  2A1V A;  1DGD A;  1C4K A;  3RCH B;  3GZD A;  1SPA A;  3PDB A;  4WP0 A;  2AAT A;  3AOV A;  2VGZ A;  1CZC A;  2DGM A;  2WB6 A;  1V2F A;  4ADC A;  3K7Y A;  1YJY A;  4MQQ A;  4UHO A;  1QJ5 A;  2YCP A;  3EIA A;  3MAF A;  4N0W A;  1MDO A;  3JWA A;  3QPG A;  3MC6 C;  4CBR A;  2ZY2 A;  3DR4 A;  2EYQ A;  3FTB A;  2VGU A;  4DGT A;  1ELQ A;  1WKG A;  2VGW A;  2D7Y A;  2W7G A;  4P7Y A;  4BA4 A;  4XQ2 A;  3HMU A;  3QHX A;  5D5S A;  3UE8 A;  1CS1 A;  3USF A;  4K2I A;  4E1O A;  4LC3 A;  4E3Q A;  4W1X A;  1BKG A;  3P1T A;  5DJ1 A;  1TOI A;  1UU1 A;  1N2T A;  1BQA A;  2V1P A;  3CAI A;  2ZYJ A;  3EI7 A;  3WGB A;  4UOY A;  4A0H A;  1JF9 A;  5EUE A;  1E5F A;  3FQ7 A;  1O61 A;  1O62 A;  3ATH A;  4W91 A;  2QLR A;  1CJ0 A;  3GWP A;  1ART A;  2HUU A;  2VLF A;  3AEM A;  2QA3 A;  2DGK A;  5F8V A;  1SFF A;  1X0M A;  2YRR A;  3FQ8 A;  2YCN A;  4ADE A;  1GC2 A;  3PA9 A;  1C7G A;  1QZ9 A;  2W8V A;  5M4B A;  4M2K A;  4JE5 A;  3N4S A;  1M0N A;  1QIT A;  1PMO A;  3GZC A;  4MKK A;  2W8U A;  2W7H A;  1W3U A;  3CBF A;  2C44 A;  2BI1 A;  2CST A;  4RKD A;  5FT6 A;  3AEL A;  1D7V A;  2YRI A;  4K2B A;  5G2P A;  4F5I A;  4EB7 A;  2D66 A;  3QN6 A;  3RUY A;  3AEN B;  1AHF A;  1WYT B;  1IBJ A;  1G4V A;  2NMP A;  1AAM A;  4CXR A;  4B9B A;  2BIA A;  2FKI A;  3PDB B;  4RLG A;  2HZP A;  1KKJ A;  4EU1 A;  2GQN A;  1T3I A;  5FT4 A;  4IX8 A;  1TAT A;  1OHY A;  2C7T A;  1PFF A;  2WK7 A;  1D7U A;  3FZ6 A;  1DJE A;  3FDB A;  4E3R A;  1RV4 A;  3ELE A;  4UHN A;  4HVK A;  2BIG A;  3ZRR A;  3ZRQ A;  2VMT A;  1AY5 A;  1AJS A;  4FL0 A;  1B9I A;  3GBX A;  1ARG A;  4WB0 A;  3E2F A;  4R5F A;  4WXG A;  5DB5 A;  3WGC A;  5M46 A;  4CXQ A;  1AKB A;  2VLH A;  1WKH A;  1YIY A;  3PAA A;  1V2E A;  2Q7W A;  3CQ4 A;  3IHJ A;  2BYL A;  1AY4 A;  9AAT A;  4OBV A;  2W8W A;  4AO4 A;  3VK2 A;  2JIS A;  2JJE A;  2ZJG A;  5I92 A;  1AMS A;  1JS6 A;  1RV3 A;  2EGY A;  2W8J A;  4O6Z A;  1YJZ A;  1GEX A;  4GE4 A;  3UWC A;  3F9T A;  4JEZ A;  4ZDO A;  2WK9 A;  1OXP A;  4XJM A;  4H63 Q;  1ASM A;  4ZWV A;  4K2M A;  3NU7 A;  4Y0H A;  2AY3 A;  5G09 A;  3DYD A;  4GRX A;  1BJO A;  1OXO A;  2VMN A;  3FVS A;  3TCM A;  2EPJ A;  2HUI A;  4U2H A;  1ELU A;  2VGT A;  1AY8 A;  1S08 A;  1DGE A;  2G6W A;  5EUD A;  1H0C A;  1AHE A;  1O4S A;  4HF8 A;  4NOG A;  4TN4 A;  4WYF A;  3WY7 A;  4GDY A;  5E3K A;  4MQP A;  1Z3Z A;  4RIT A;  4N0B A;  3MAD A;  2ZY4 A;  5LHA A;  2G7J A;  2GMU A;  3KKI A;  2W8T A;  4OBU A;  3II0 A;  2AY6 A;  2QSR A;  2FQ6 A;  3EI9 A;  4W1V A;  3I16 A;  3BCB A;  2D63 A;  3JZL A;  1VEF A;  2W7I A;  3LY1 A;  1M7Y A;  4OTL A;  2ZC0 A;  2VMY A;  3B1C A;  1ASC A;  2ORD A;  2X3L A;  3GJU A;  3HT4 A;  3FD0 A;  3FQA A;  4A0F A;  2HOZ A;  4A0R A;  1JS3 A;  1SZS A;  3G7Q A;  2Z1Z A;  2AEV A;  1V72 A;  3WCO A;  4F5G A;  1BJ4 A;  4OCA A;  1AJS B;  2EO5 A;  3FFR A;  5G4I A;  3I5T A;  3PIU A;  4WB0 B;  4TV7 A;  4JE5 D;  1WYT A;  3AEJ A;  1N8P A;  2OQX A;  4WYG A;  1UKJ A;  3R9A A;  4RIZ A;  4A00 A;  4E77 A;  3F0H A;  1UU0 A;  3PGY A;  3BV0 A;  2V0Y A;  3PPL A;  5EAV A;  2YKY A;  3RBL A;  2VGV A;  1TOJ A;  2VGS A;  1ASD A;  4A0G A;  4AOA A;  3EZ1 A;  4F5H A;  3MKJ A;  3GR9 A;  3NX3 A;  1M6S A;  2CY8 A;  4ZSY A;  1V2D A;  3A9Y A;  1QIS A;  4ZAH A;  3IF2 A;  4LW2 A;  3ASB A;  3EUC A;  4PIW A;  1MLZ A;  1ORD A;  2WK8 A;  1Z7D A;  3WX9 A;  2E54 A;  1OHW A;  3QBO A;  1GCK A;  1S09 A;  4M2M A;  4K05 A;  3LVJ A;  1BJO B;  3ASA A;  3ZZJ A;  2BI3 A;  2W7D A;  3DU4 A;  4TMR A;  1I43 A;  2CJH A;  3MC6 A;  3GSB A;  1BJW A;  4KXK A;  4A72 A;  5TF5 A;  1J04 A;  1IUG A;  1GC3 A;  3OP7 A;  3PDX A;  3PD6 B;  4UQV A;  1PG8 A;  3K28 A;  3RQ1 A;  1IX7 A;  4F4E A;  3A8U X;  1MLY A;  4GE9 A;  2DOU A;  2GB3 A;  2AY2 A;  2CJG A;  3A2B A;  4R2N A;  3NYU A;  4IXS A;  2VYC A;  5IWQ A;  4JEV A;  3NNK A;  1AIB A;  2W7F A;  1ASA A;  3LVK A;  3AOW A;  1IJI A;  1VJO A;  2AY7 A;  3KE3 A;  1W7M A;  4ZDL A;  1CL2 A;  2BWP A;  3AAT A;  3I4J A;  4MY5 A;  2D5Y A;  2BI9 A;  4MGR A;  5EUN A;  2VMV A;  3LG0 A;  1RVU A;  2VMZ A;  1ARH A;  4OYT A;  3LVM A;  2FNI A;  3FVX A;  2CIN A;  3JTX A;  4OC9 A;  4CVQ A;  4OT8 A;  1DJU A;  2W7J A;  1AIC A;  1EG5 A;  1FC4 A;  3N7N A;  1EQB A;  3B46 A;  1FG3 A;  3E2Y A;  4WYA A;  1RVY A;  2ZSM A;  3WZF A;  2QMA A;  3QI6 A;  1M0P A;  3MEB A;  2QBT A;  4Y0I A;  2VMW A;  4QGR A;  5C6U A;  4ATQ A;  1GD9 A;  2AY4 A;  2VMQ A;  1B5O A;  4WYE A;  3TFT A;  3K40 A;  3DC1 A;  1B5P A;  3ZZK A;  4A6T A;  3E2Z A;  3B1D A;  2FM1 A;  1IAY A;  2BI2 A;  4M2J A;  4Q75 A;  2XH1 A;  4LNM A;  4LNJ A;  4JEX A;  2FNU A;  1ASF A;  2YKX A;  1U08 A;  3FZ7 A;  5M49 A;  3BWN C;  5G0A A;  2VIB A;  1WYU A;  3ZRP A;  4H51 A;  1MAQ A;  1ASL A;  1DTY A;  1PMM A;  1QIR A;  3L8A A;  2VMU A;  1D2F A;  1LW4 A;  2Z61 A;  4EFF A;  4R5Z A;  5M4D A;  4F5M A;  5BJ3 A;  1DFO A;  3E6G A;  3DZZ A;  2VI9 A;  3BWN A;  2DGL A;  2CH1 A;  1B9H A;  3FKD A;  2ZP7 A;  4IW7 A;  4LW4 A;  2O0R A;  4Y0D A;  2PB0 A;  3BCA A;  3VK4 A;  3Q8N A;  1BJN A;  3A9Z A;  1AMR A;  4ATP A;  5HDM A;  3FZ8 A;  1X2A A;  4Q6R A;  1GDE A;  1GBN A;  2D7Z A;  2Z9X A;  4JEY A;  4IXZ A;  4ADB A;  1ARI A;  1SF2 A;  3HVY A;  3HL2 A;  3AEP A;  1WYV A;  4IYO A;  4XJP A;  3HQT A;  3P6K A;  2FN6 A;  1W23 A;  1W7N A;  3ACZ A;  3PD6 A;  3DRD A;  1JG8 A;  4KYO A;  1I29 A;  1IAX A;  1KL1 A;  4L0O A;  1SZK A;  1DJ9 A;  2AY9 A;  3WLX A;  2D65 A;  1G7X A;  2EZ1 A;  4IXO A;  3GET A;  5HHY A;  5EIG A;  4LNL A;  1IVR A;  3ELP A;  2OKJ A;  1MDZ A;  2HOX A;  2R5C A;  3TFU A;  4F5J A;  3TAT A;  2F8J A;  4ITX A;  2OKK A;  2X5F A;  1O69 A;  4UHM A;  1H1C A;  1TPL A;  2OGE A;  3MBB A;  2AEU A;  1CQ7 A;  3E2Z B;  1AIA A;  1GEY A;  4PVF A;  2X5D A;  5DX5 A;  1IX8 A;  3W1H A;  3JU7 A;  1ASE A;  1M0O A;  1MGV A;  2PO3 A;  2YHK A;  1S0A A;  1AX4 A;  3EI8 A;  1WYU B;  1IX6 A;  3EI5 A;  3AV7 A;  2BHX A;  7AAT A;  1OHV A;  1AAW A;  4JF1 A;  2Z9W A;  1G7W A;  3G8M A;  5BJ4 A;  4ZLV A;  2Z1Y A;  2GMS A;  1G4X A;  4GE7 A;  3DR7 A;  3HDO A;  2YOB A;  3KGX A;  4A6U A;  1C7O A;  2EH6 A;  2XBN A;  3DOD A;  2BWO A;  5EQC A;  5G2Q A;  4XEW A;  4EB5 A;  4WLH A;  4OMA A;  2VMP A;  3M5U A;  1ZC9 A;  2R0T A;  2VMX A;  5F9S A;  4ZSW A;  2HOY A;  2HOR A;  4XJL A;  3F6T A;  4W1W A;  4XJO A;  5EFS A;  4F5L A;  3N4X A;  2BI5 A;  3GZD C;  2TPL A;  1VP4 A;  3TQX A;  1LC7 A;  4EMY A;  4PFN A;  4P3M A;  4XK1 A;  1XEY A;  2OGA A;  2R2N A;  3BCX A;  1TAR A;  2JJG A;  1ARS A;  1WYV B;  4IYO B;  2Z9V A;  2VMR A;  3L44 A;  3NUI A;  1CZE A;  3B8X A;  1LK9 A;  3CQ5 A;  1YOO A;  2D61 A;  4PFF A;  4RJ0 A;  1YNU A;  4WLJ A;  4AZK A;  1SVV A;  4WXF A;  3T32 A;  4RJY A;  1J32 A;  4MKJ A;  1AKC A;  2CFB A;  1LC8 A;  1MDX A;  1XI9 A;  4ZM4 A;  3KGW A;  3NTJ A;  1B8G A;  1KMJ A;  3FSL A;  4J5U A;  1LC5 A;  1D7S A;  3NRA A;  3NUB A;  5EIG B;  5AX8 A;  5JAY A;  2R5C B;  8AAT A;  2AY1 A;  4BHD A;  4B98 A;  4JEW A;  1S06 A;  3E9K A;  4J8L A;  3RBF A;  3BC8 A;  4BQ0 A;  1CQ6 A;  3LWS A;  4MQR A;  3VOM A;  2JGT A;  4DBC A;  4ZM3 A;  1S07 A;  1YAA A;  2FYF A;  1YJS A;  3AEM C;  2Z20 A;  2X8U A;  1P3W A;  4W5K A;  2W7L A;  2CAN A;  3PJ0 A;  3FCR A;  1KKP A;  1AJR A;  2EZ2 A;  2VMS A;  4WD2 A;  3FFH A;  1LW5 A;  2E7J A;  2VMO A;  5J8Q A;  3EZS A;  3N75 A;  1MAP A;  3RI6 A;  4W8I A;  4ADD A;  4WYC A;  2QB2 A;  3E77 A;  4Q76 A;  3NYT A;  3NYS A;  3AEO A;  2ZSL A;  3FDD A;  2VIA A;  3EIB A;  1TAS A;  1EJI A;  4ISY A;  4RAE A;  1FG7 A;  2VI8 A;  4AH3 A;  2HP2 A;  4IY7 A;  4CBS A;  1GC4 A;  2PB2 A;  2QB3 A;  3WCN A;  4I8A A;  1AHG A;  3MAU A;  1AMQ A;  1ASN A;  2CTZ A;  2O1B A;  2ZUK A;  2WKA A;  3LVL B;  2JJH A;  3NDN A;  3OKS A;  4MSO A;  2E7U A;  4U1T A;  1LS3 A;  1WST A;  3BS8 A;  4WXB A;  1I48 A;  2ZY3 A;  1I41 A;  4JF0 A;  2AY8 A;  4Q31 A;  2BIE A;  4XAU A;  3COG A;  1E5E A;  5EAA A;  2YKU A;  1AHY A;  4AO9 A;  2JG2 A;  5LH9 A;  2HP1 A;  4GEB A;  3VP6 A;  2Z9U A;  4KAM A;  3HLM A;  1ECX A;  3MAF B;  2D64 A;  5FT8 A;  4DQ6 A;  2E7I A;  3ECD A;  2JJF A;  5E4Z A;  1TOE A;  2AY5 A;  3G0T A;  3N0L A;  4F5F A;  3FRK A;  1QJ3 A;  2C0R A;  1SZU A;  4ZAS A;  1AMA A;  1CL1 A;  2C81 A;  1OAT A;  3NU8 A;  2CB1 A;  3RCH A;  2Z67 A;  4GSA A;  3BWO A;  3W1I A;  1M4N A;  1KL2 A;  3FVU A;  2BKW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...