3GJXC

Crystal structure of the nuclear export complex crm1-snurportin1-rangtp
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
171
structure length
171
Chain Sequence
VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGLEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Snurportin-1
publication title Crystal Structure of the Nuclear Export Receptor CRM1 in Complex with Snurportin1 and RanGTP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 47
structure length 171
sequence length 171
chains with identical sequence F
ec nomenclature
pdb deposition date 2009-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3gjxC00
3T34A 2GJ9A 1TTTA 5K8IA 1DG3A 2C77A 2QAJA 1Z6AA 2BKUA 3QQ5A 4IHQA 4IOLA 4Q7KA 3QKTA 5BXQC 4E22A 2BIFA 2BJVA 2VP6A 3IBYA 4FWIB 1W2HA 1V5WA 1HH4A 3THXB 1F48A 1GL7A 5F98A 3EPHA 1N0WA 1IBRA 2FE4A 5TV2A 4GDFA 1IY1A 2QAGC 3FFBA 2NZ8A 2Z43A 3TR0A 2ZU0C 2ANCA 2MSEB 3BJIC 1M7HA 2XJ9A 2N1BA 4PHFA 2B6HA 4TLDA 3RWOA 2FOLA 3U2QA 3TVTA 4LX0A 4F38A 1TADA 3QUSA 1XDBA 3ND9A 2RGCA 3CRRA 4M1YA 1Z08A 1YZUA 3U7FB 1JR3E 3IKJA 3P20A 2FA9A 2V54A 2KB0A 5G3YA 2F6RA 2XSZA 3KJGA 3WP1B 4DWJA 4NONA 4LY6A 4AG6A 5J4LA 2CVHA 1XXHA 4JJZA 2QP4A 2GF0A 2DBYA 3ADCA 1R7RA 1YVDA 3N2EA 4DLVA 1N0VC 2BMEA 5FBLB 5FUXA 3K0CA 5AUPB 3ZVMA 2J0VA 4YDSA 1GTVA 1VYVA 2F3TA 1W4AA 1XRJA 4JSYA 1I2MA 1T8UA 1NVWQ 4Q4HA 4RFVA 4KVAA 1C9KA 2GBLC 2R6GA 1X1RA 4JBXA 4PO9A 2F55A 2X77A 1DO0A 2RGDA 1XWIA 1IXSB 3THOA 3UMSA 3THYA 2OV2A 3VKHA 4ILEA 3KUDA 1Y63A 4MYUA 1W0KD 3A8TA 4UJ3A 1N5IA 3NVAA 2FFAA 3RC3A 3D7MA 4GL2A 1ELOA 4PO1A 3NBZC 2ZI9A 2GNOA 1I4DD 1MABA 3GEHA 3HU3A 4PANA 3GJ6A 4R2IA 3TUZC 2JLXA 2GXAA 2R44A 2EWWA 1RYFA 1E9CA 1AQYA 1EK0A 1Z47A 2J5XA 4LV5B 2HDNB 3K9NA 3QEJA 4B35A 1WRBA 4DC9A 4EUNA 1OXSC 3TR5A 3VTKA 3U7HB 4A0FA 1A2BA 4C0QC 3TGPA 3X1DA 2GK7A 3CBQA 1OXXK 1QRAA 1X1SA 1RRFA 3GD7A 3TW8B 3RYTC 3GLGE 4N3NA 5EUMA 4FIDA 1WBBA 3FGNA 2BMJA 4EQ6B 3AF0A 5GJWC 3D6TB 2VP9A 5KSPA 3OE7D 4LHXA 1MO3A 3T12A 4FXPA 3B2EA 4LYFA 2Q3FA 4URZR 4M0LA 2ANBA 2D74A 2W58A 1NLFA 5FI0B 3LO5A 4PHHA 3SEAA 5JWHA 2IL1A 2Z5FA 2VHUA 1OXTA 4I1UA 1TQ2A 2HT1A 1SVSA 3EPKA 3CZQA 3LV8A 3MWYW 1UKEA 2ZVPX 5H70A 3OAAD 2R65A 4RFSB 4HLUA 4AYTA 1PUJA 3K9GA 1W46A 1HE8B 5C2JB 4ZIRB 2V1UA 2H17A 3BGWA 4TT3A 3KQNA 1CULC 1FMLA 4MUAA 4A6XA 2YOFA 5E7MA 1I4LD 1N5LA 1JBKA 1Q3TA 4Q1FA 1AQUA 4B2PA 1EFRA 2WJJA 3TAUA 1MH1A 4WXRA 1DAFA 5CJ2A 5SZHB 3L0OA 1ZINA 2OCAA 2HUPA 4ASUA 4RD2A 2ZE6A 1U94A 1K6MA 2AN9A 4ZKDA 3U3JA 3MGCA 2R6FA 1XPUA 1U90A 5AWFC 4EPTA 2ORIA 4TLAA 2AD1A 3I5YA 1NJFA 4BFWA 5FBWB 4D26A 2G77B 1X3SA 1RYHA 3I3SR 3LQRA 2QT0A 4IOKA 3L0PA 2QP3A 1IN8A 2NIPA 2J46A 1JEEA 1OIXA 1TQ4A 4G3XA 2PX3A 3TRFA 1T8TA 4IOMA 4URXR 2P65A 3CWZA 4TWZA 1II8B 1EESA 2YKGA 3DL0A 2QTFA 3MD0A 4XTRA 4XVRA 1DEKA 2QUZA 1VHTA 1FTNA 2FSHA 3EARA 4BZQA 3B5JA 2IUUA 1G17A 2A5FA 1E9RA 4WOPA 1OH5A 4UJ5A 2J0SA 4CW7A 3NDPA 5JSZA 3AVXA 2ZRCA 1M8PA 1ZM9A 3T5DA 3JVUA 2NO0A 4NBSA 2IYZA 4C0AC 3E1SA 1GNRA 4Z8YA 3SFVA 1ANKA 3TQCA 2OXRA 3G0HA 4D81A 1KO4A 3NEJA 3H0KA 1F60A 2VRWA 3AP3A 1NKTA 5JS8A 4UNPA 1KHTA 4MH0R 3TBKA 2H18A 2V4ZA 1B23P 4GBMA 4TYWA 3EIQA 1CR2A 1Q1BA 3PUYA 4O3MA 1NLZA 1UBGA 4GSYA 4A8JA 2VPPA 3VHLB 3QPVA 2NG1A 5ANRB 3MWKA 3AB3A 3I1FA 4NE2A 1G6OA 1ZU4A 5DIFA 3SQXA 4F4CA 1II0A 1YZNA 3M0EA 3RHFA 3M4YA 4PR0A 1Q3HA 3GJ5A 4F4JA 1P3JA 5FR1A 4JL6A 4IVQA 1QVAA 3IQWA 3WYAA 4EPVA 1G291 4RVCA 4E09A 1W36C 2OLKA 3U4QA 3GLHB 3SHWA 4A2WA 1OXUA 1Q22A 3TSOA 1RE0A 4TMTA 1NG1A 3U60B 3FMPB 5B64A 1JQJC 2UKDA 3CM0A 4B71A 1W4RA 2D06A 1U98A 2ZSEA 4PX9A 4V0ME 1OJLA 3NHBA 1IN6A 5HCIA 4C7OA 1NVVQ 5DLQC 1KK2A 2WMOB 3T15A 2HJGA 3FMFA 5KTYA 4IEIA 4PHGA 3WYGA 4Z1MD 3SYLA 2ZETA 3VR5A 1N3BA 1AJEA 821PA 3CX6A 3K53A 2GKSA 3LVQE 3TAHA 1CBUA 4ZI2A 3KQHA 2CCKA 3L0SA 1DAHA 4YC7A 1ZUNB 4I1OA 3C5CA 2JLVA 4B43A 3C41J 3Q3JB 1XFAA 4F4IA 1EXMA 4B3CA 2QSYA 1R8QA 3KDSE 4P3YA 3HU2A 2ERXA 4ZDJA 121PA 2ZRBA 3LNCA 1KKLA 1T9HA 2CL6X 3VQTA 2JJ2A 5DYIA 2CE2X 5EP1A 1HQCA 1UBCA 2QI9C 2JAQA 3QBVA 2IC5A 3ONWA 3SZRA 2C78A 3WNBA 3ZJYA 3QPUA 2BBWA 1CP2A 2G88A 2GZAA 4OI0A 4QL3A 5AJWA 4CEHA 3PG5A 3WBJA 4MRSA 4PPFA 4IFEA 1YZGA 1E99A 4YMSA 1W36D 4KLZA 4D0GA 4AI6A 1HURA 3ZVRA 5KPJA 1N6NA 5KSZA 3KFVA 3AF1A 2GJSA 4JLPA 4QGHA 3RS4A 4Q47A 2MSCB 1E0JA 2MMCA 2IS2A 1NRJB 3I73A 1RRCA 5TDHA 1VCNA 4NYMR 3OIVA 2ZM5A 1FP6A 2Q9BA 1BYIA 2BJWA 3K0SA 3ZH9B 2J1LA 3BRWD 3KJEA 2IWHA 1XCGB 3IUYA 4BFSA 5BW8A 4M1KA 3U44B 2FEOA 4G5SA 1G6HA 2CBZA 3IO5A 4PZLA 5K8LA 1TQ6A 3ZZUA 3A1VA 1ZNXA 4RSGA 2A2ZA 4PZYA 1EFTA 5FOVA 1CR0A 2JASA 5J4YA 1QHIA 1EX7A 2DR3A 5JRZA 2ZTSA 4QG7A 1TX4B 1P60A 1VG1A 3Q8XB 2YHSA 2QZ4A 4WVFA 3QI2A 4KCGA 3AVYA 3WRYC 1W1WA 4C0SA 3VNVA 4QBGB 2FMXA 1P9WA 3VNUA 2GA8A 1VYUA 3NWJA 4RZ2A 4L8GA 1FX0B 2G0NA 3AVVA 2H8KA 4DLUA 4WZBE 4OL0A 1SHZA 4IKEA 3I92A 4BASA 2EU8A 2ZUDA 3QVUA 1CEEA 5CIQA 3AKCA 2HCBA 1KSGA 1KSHA 4DCSA 1OB5A 1KOFA 3EIEA 3FE2A 4OYHA 5FH9A 3AV0B 1OIWA 3TW4A 1E0KA 2WICA 1GWNA 3L43A 3PUXA 5SZJA 1C1YA 4OHWA 4EAQA 3LDAA 3NH6A 1U0JA 4Y0VA 1ZD1A 2ZRLA 4LHYA 4JIMA 5DE3A 2XXAA 1M7GA 4IDNA 3U3KA 1NIPA 3RWMB 1E9AA 1MOZA 1UJ2A 2CNWA 3A58B 2ZJBA 4DZZA 1NBMA 3LAWA 4Q5IA 5JECA 1VG9B 2QAGB 1JR3D 1GITA 2ZI4A 2W6IA 1CLUA 4URVR 3ASYA 2JDID 5B57C 1A4RA 1Z2AA 4DVGA 2ODBA 2REBA 3NH9A 2ZRNA 2G9NA 2O8EA 1B0UA 1S1CA 1CKEA 1UM8A 5DN6A 3VR2A 4LSGA 4BLTA 3ZDQA 1US8A 3LXRA 1OLOA 1HYQA 521PA 2CK3A 2YV5A 1P5ZB 3DKPA 3MMPA 4G5GA 3E70C 4TL8A 3HYRA 2WJYA 2ZSFA 1HT2E 1DBSA 4ZCLA 1RRPA 1VPLA 4QHYA 1ZMXA 3A36A 3HWSA 2J7PD 1G1MA 5F9FA 1ZM7A 2XX3A 2PJZA 1F2TB 2P2LA 3OEHA 1TAGA 2ZUCA 2J9RA 4A15A 1FOEB 1AS0A 1G9XA 2REXB 3QXSA 3LXXA 3T1VA 1FP7A 5CM9C 2DB3A 5KU1A 3I4LA 3T1TA 1XD2B 4KAXA 1A7JA 4GNKA 4JYCA 3PEVA 1E6CA 3SDZA 3KTAA 3MG9A 4F93B 4LHZA 3O8RA 3D3QA 3HDTA 4V03A 4A6PA 1G8FA 2VEDA 4PC1A 1JECA 4NYJQ 1P62B 3TVDA 4U7DA 4GP6A 3NXSA 4DIDA 4JJKA 4HAXA 1ZAKA 2ZR7A 4A0HA 1Z0AA 4UXJA 4C9BA 4AY2A 3ADKA 4ESVA 1E2MA 1Z22A 4LJYA 4RD1A 3HYTA 2O8BB 4N0DA 3RNLA 4OK5A 1OH7A 3C14C 3X2SA 4IW3B 4B2IA 3VR4A 3MJHA 2QRZA 5H8WA 4TYQA 2EYUA 4FCVA 4DSTA 2FX3A 4FN5A 1MR3F 1R0YA 2ZQ5A 4HZUB 5AJYA 4G5RA 3UMFA 3B9PA 3U3OA 2VP4A 3RRZA 4QBHA 3IHWA 3M1IA 5EE1A 2IK8A 3NBYC 3P4XA 2ZIAA 4I99A 1SXJA 2OAQ1 3QXHA 4EPYA 4OQXA 4DDTA 4BQSA 5J40A 3CKLA 1CRQA 3CB4A 4XD7A 4ZCMA 2ZREA 3CRQA 4R7ZA 1E2LA 4KU4A 3U7EB 1G3QA 1DAEA 5E3HA 3AVTA 1BO6A 2GF9A 3BFKA 1ZM4A 1VIAA 4M2LA 3T35A 4Z51A 4DEYA 4EPXA 5KNDA 1EWQA 1S8FA 4BFZA 1P72A 4ZPXA 5KDOA 5DI3A 2FH5B 1R2QA 3SFZA 2JCSA 1OYYA 3EWAA 2WJGA 3KQUA 2EFHB 2G0TA 4BEBA 5JRJA 1JAHA 3VFDA 1M74A 4LBWA 4PO8A 1NVXQ 1XD8A 2DFKB 2IYUA 4LUCA 1IY2A 5FOSA 3SBDA 3B1YA 4TL7A 1E96A 3HPRA 2ZI7A 4QNRA 2IYXA 1Z6YA 3F5FA 2BV3A 3CF0A 3K9LA 1Z83A 2OAP1 3RS7A 5J47A 2F1HA 1IY0A 2IS4A 3IPXA 4TSFD 1RIFA 5IDVA 1VKJA 5EXPA 1W7AA 4UKDA 4ZDWA 1KI6A 4Q18A 4Q00A 4D80A 2ZJ5A 1DS6A 4V0KA 1H8ED 2HV8A 5LB4A 1Z6XA 1AZSC 2AKAB 1G7RA 5AK0A 2Q21A 1XMSA 3SHFA 2NO1A 5C18A 2QPAA 5JEEA 5ELXA 2C04A 3QEOA 3THXA 1KAGA 2A5JA 2NQ2C 1M6NA 2O0HA 4LYAA 3QJYA 2QMHA 4R2HA 3J81k 2C9YA 4CRWB 4G1UC 2CJWB 1J7KA 1RVDA 1F6BA 1TQDA 2QQ0A 2R2AA 1GM5A 1OYWA 1DAIA 2CL0X 2XTMA 3CRVA 1A1VA 2A7QA 1ZP6A 2WKPA 5AJXA 2J0UB 2H16A 3PUVA 2XNDD 3ZIAA 2N46A 4TMXA 1E69A 2V6IA 5D3MA 1FTSA 1E94E 2VP5A 2A5GA 1OT3A 4GOXA 2PJRA 4QHTA 4JLBA 2PLRA 2C95A 3BB3A 2PZEA 3BOSA 2NMVA 3AVPA 4B74A 5J4HA 2ZRJA 4I1SA 2FFBA 3TK1A 4D4JA 3SOPA 1U0HC 4EFMA 4Q4AB 4M9XA 1UDWA 4DIEA 1G4UR 5DHAA 2QQEA 4US2R 2AHOA 1FPMA 4BECA 3BERA 4GOKA 2GXUA 5FL7A 3R9IA 4WA7A 2DWOA 1DAKA 2OO7A 4NCIA 3C4JA 1KO7A 4X8LA 4V0LA 2QY9A 1H8HA 2C98A 3QNUA 3U5ZB 3B82A 4XSHA 5BWMA 3ICQB 2GEUA 4JT4A 3SN6A 3OEEA 1T0HB 3GLIB 1XP8A 2GCOB 2WVJA 3IIJA 3L2OB 2H1LA 1HE1C 3U7GA 2IF2A 4LJ9A 2WPDA 1P9RA 1KY2A 2GVDC 1FQJA 2C96A 2O8DB 1OE0A 4XOIA 4IDHA 4DSOA 2IYWA 1LY1A 3WYFA 3ADDA 2FFQA 2ZXUA 5CITA 5LD2B 2NPFA 5FTMA 4M22A 4EJSA 4DJTA 1G64A 3VR3A 4O2RA 3QKUA 1P9NA 2JLSA 4N0EA 3OESA 5CLLA 3HR8A 1E32A 4PQYA 2B8WA 3B13B 5DISB 4TTPA 2ZE5A 3VR1A 3T06B 4BFXA 4KV9A 5HE8A 1OW3B 4OHYA 2X2FA 5KPDA 3PUZA 4FINA 3R7WB 2OFXA 1BKDR 2W0SA 5L3SA 2VHJA 2XOKA 1EFHA 4JLMA 4V0NA 3BH0A 2RMKA 3CNLA 3N5CA 1ZW6A 1G41A 2PCLA 4JLNA 5JZVA 3EPLA 4ZV4A 1E2NA 4D0LB 2O0KA 4BWYA 1TUEA 2L0XA 4KYIB 4EQ6A 4GMDA 3DEFA 4PC2A 5EZ6B 4DSNA 3PIRA 3P32A 2IYYA 2J0QA 2XB2A 2WV9A 2HLDA 3NC1C 2PZGA 4B47A 5DHFA 4G0NA 1J8YF 3THWB 5HKKA 2XZLA 1LW7A 2QA5A 4QXAA 3QPWA 4KBGA 4NMMA 5TXGA 3UPUA 4DXAA 1U8ZA 2WSSA 3HU1A 4Q1DA 4X8HA 2XITA 1NSFA 2VYFA 4PQRA 2FV8A 1UKYA 4PAQA 3SJAA 1GDDA 5GJBA 4EKDA 2JLQA 3GLGA 1D9ZA 5AJVB 3KXKA 1KO8A 4LJ8A 4UXIA 1Y3AA 4TN1A 4XIGS 5EE9A 1QHGA 1U8YA 2QTHA 1E9EA 4HLDA 4BFYA 4D0NA 2QPOA 2UZ3A 4Q9KA 2DY1A 5JBQA 4R71A 5TARA 1WCV1 1W44A 1AA9A 1G5RA 1OH6A 4URWR 1NLYA 2RGAA 3K09C 2BBOA 4FCWA 4DDWA 1IAQA 3O8BA 3BORA 1PUIA 3SS8A 4DUGA 4A82A 4NYIQ 1D2NA 2JLWA 1ZUIA 4HB2A 4P4SA 2ZS9A 4QGGA 2JGNA 1GIAA 2ODEA 4Q4LA 3IIKA 4KYUA 3KJIA 2E1RA 3LVRE 1BMFD 2AK2A 2V7QD 1G20E 5AUQA 1OFUX 1TU4A 1KO5A 1KZ7B 2ZI3A 1C4OA 1S1MA 3UG7A 3O8DA 1MRSA 4GRAA 3MCAA 1E2KA 3DZ8A 4URYR 3DPUA 3QF4B 2CVFA 2GZHA 2QORA 3S1AB 3LX8A 5JFGA 3X1WA 3VU9B 3FHOA 1G5TA 3GFOA 1E1QA 1ZD8A 2ZRAA 4HAYA 3KZ1E 2VSXA 4JL8A 4TL6A 2IHYA 2AR7A 1OHHA 1T3LA 2B92A 2XTNA 4BLRA 1FW6A 2IYLD 2WOJA 3K8YA 4PSVA 4JVNA 3ZS9A 5L3QB 3Q7QA 3CNOA 3CH4B 4BEJA 4OQFA 4HDQB 3H2YA 1NMXA 2RGNA 4MGZR 3G82C 5G40A 4DRZA 1S0UA 4C30A 2W0MA 1NN1A 2ZRPA 3KB2A 1FL9A 2N42A 1NMYA 2D7CA 2QN6A 1FNMA 2AD5A 4YXWA 1W0JA 2R6CA 3WY9A 2IXGA 4I1VA 3TNFA 8OHMA 1GNQA 1G3IA 2UZIR 4FD2A 4H1VA 4AIIA 2VF7A 3PXGA 4YMVA 4GOJA 2ONJA 1G4AE 4JVLA 3FTQA 3L8YA 2GCNA 1LV7A 2IT1A 1VDZA 4E03A 1DTSA 1N0UA 2Y8EA 2E9SA 1IXZA 1GVNB 3CH5A 4KVGA 1PVOA 2PEZA 1AS3A 2EFDB 3KL4A 1GNPA 1NN3A 1HA3A 4UNQA 2ZRGA 4CEIA 1ETUA 3KQKA 4S2EA 4DSUA 4Q4JA 1A2KC 1G18A 3E5HA 1EGAA 5FTJA 4A9AA 5BYJA 2BEKA 1J99A 2OILA 1NN0A 2RB4A 2ZROA 3I32A 4MRNA 4TZ6A 4TMKA 1QHNA 5KSYA 4LWZA 1XXHB 3KKPA 4ACAA 2P0EA 3A1SA 3I61A 1JAIA 2ZJAA 4U02A 5IRCD 2REOA 2QP9X 1JXOA 1XMVA 2ZRMA 3CWQA 2B8TA 4G01B 4KFTA 1D5CA 1ZNZA 1SHKA 4Q4HB 5JS7A 4FWTA 4NCJA 4MUBA 1Z2CA 2BCGY 4R9UC 4JVSB 1FMJA 1NI3A 4Q19A 1VTKA 1UEIA 1Z5ZA 2OT3B 3KXIA 5E7IA 1VG0B 2ZS8A 3THYB 4CVNA 2IEZA 4JBYA 1IXRC 2PT5A 5EQTA 4EDHA 2K5UA 1NSTA 1D2MA 2P5TB 2HYDA 1MABB 2NZJA 3EC1A 2AX4A 2BEJA 3K0EA 3LX5A 4YDHB 2FG5A 1OKKD 2YINC 4Z54A 3PEYA 3TE6A 1O87A 1G7SA 2WJIA 4M8NE 3FYHA 4UXHA 3GLHE 4POAA 3ZD6A 3C7KA 2HYIC 3VAAA 1ZC3A 1FZQA 2PBRA 1ZIOA 1JJ7A 2ODNA 4BFTA 1MT0A 3QXXA 1OFTA 4L9WA 2CEAA 2ORVA 5G3ZA 5DI9A 1ZVQA 2WJVA 1TUIA 4NH0A 3Q85A 1DADA 1XTRA 4N1AA 2JIZD 1U9IA 1KMQA 2V55B 4AYXA 4QM6A 4AKGA 1KO1A 1Q12A 5LD2C 2QE7D 3ND8A 2JLYA 1RFLA 4JS0A 1VMAA 3RLFA 3K70C 2VHQA 4H1UA 1E2PA 2ONKA 4P31A 5AJZA 3DMNA 4FMCF 1JALA 3QY0A 3SYKA 4MKFA 1OXVA 1E9DA 4PSAA 4D25A 1Z8FA 1DO2A 2NPIA 2GHIA 3CF2A 2J59A 4HLQB 5DYGA 1TNDA 3UG6A 4DB4A 2P6RA 4JMPA 4QJ4A 5CDFE 1I4TD 4JLAA 5G53C 1LNZA 1E79D 3SR0A 4BLPA 3IEVA 1N6LA 2GXSA 2ZE8A 2OCYC 3B85A 2O5VA 4OK3A 3CPJB 1E1RD 3QKRA 5J5CA 2A9KA 4K46A 4MITA 2CL7X 3HR7A 1F2UB 2ZYTX 1VCIA 1UAAA 3B1XA 3OFND 4LCBA 3ASZA 4GZLA 1G8YA 3PQCA 1OH8A 2AK3A 1COWD 5IF9A 1Z0JA 1PJRA 2EFCB 2KE5A 4R98A 4B6EA 1N6OA 1WXQA 2F1JA 3TJZA 2GESA 4OQMA 2OUKA 3GJ3A 2GXQA 3BB1A 4PQFA 4ZI3A 1R5BA 1UDXA 1QF9A 2I1VB 2ZS7A 5FPHA 1IN7A 1PV4A 4BFUA 3BBPA 4GP7A 1KMHB 4CGZA 1N25A 3W8RA 5FOTA 4IDPA 4RCZA 1W0KA 4C0JA 5IK2D 1R0WA 2G1KA 2QL6A 3CZPA 3P27A 1XB2A 5KNCA 1RRGA 3PFIA 1ZNWA 4ERNA 2Q9CA 2O8CB 1Z6GA 3REGA 3KB1A 1Q1ZA 4L4UA 3T5GA 5EP2A 2PT7A 3K70D 1Z0KA 1NN5A 3AP1A 5JSZB 4II7A 4C0HA 1IOZA 3AM1A 3B9QA 4PTLA 5A0FA 4BZXA 2P5SA 4MKIA 4WAUA 4B6FA 4DDUA 4W5HA 1SVIA 5KNBA 1YR9A 1HEIA 2CCGA 1KI7A 2CHVA 3RS2A 1A82A 1W49A 4OI2A 5GADl 2YWFA 4MRPA 1YRBA 1QHHA 2IA5A 3T61A 3OE7A 3FPAA 4A0GA 2GAAA 2D7DA 4RCYA 1CXZA 3ICEA 4BRWA 4IFBA 2BOVA 2I4IA 1R8SA 4A8JB 4MGIR 1LVGA 1AIPA 3DHWC 1SGWA 3W5IA 3V00A 1A5TA 2MMGA 2WKQA 4QFMA 5HR5A 4DLXA 4GZMA 1Q1EA 3GLFA 3OAAA 1V43A 2VP0A 1UKVY 3LLUA 2XAUA 1SKQA 4PC6A 2VF8A 3GFPA 2GBLA 2EW1A 3UMRA 2E87A 3BK7A 2ZAOA 2IXFA 3FKQA 4PAMA 4B3DA 3FKSD 1TF2A 2Z4RA 3CONA 5GJCA 3TKLA 4C0LA 1DELA 4DT1B 2EFEB 2EQBA 2X19A 621PA 2A78A 2AWNA 4CT4B 2YOHA 3IGFA 2DFLA 3EPJA 1HQYE 3AUXA 4QRHA 2WWIA 4C7OB 4JKIA 2QNRA 3EZFA 1NKSA 4C0KA 1J70A 5F3WB 1JQLB 1KI8A 4FMBB 3IHLA 4HZUA 1TL7C 1VCMA 2ZJZA 4US1R 4OHZA 2VSOA 3PCRB 4B76A 4AKEA 2VSFA 4KFRA 1VHLA 4QJ3A 1JPNA 2AKYA 4DLRA 1R6BX 4NZYA 3KQLA 3HPQA 3TH5A 2FPLA 4BUJA 3X1XA 1YQTA 5KO2A 1ZM3A 3W8NA 2OBLA 3W3AA 4CF7A 2OE2A 3PENA 2ZJ2A 1KDTA 2JJ1D 1GILA 2FN4A 2WAXA 2WWGA 4M9ZA 3U61B 2W6JD 2WWXA 4KBFA 5KYKA 1GUAA 4FCTA 2WWHA 2WZQA 2NO7A 4CEJA 1KAOA 4TYYA 1SZPA 3N2IA 3DZDA 4NTZA 3FMOB 4TTQA 5BYKA 2IUTA 4DCVA 3CF6R 3MWLA 4QJ5A 5FPTA 1E9SA 3VX4A 3RSOA 3QG1A 4P4UA 3K0CC 1G8GA 4XH9B 4CEHB 4L9SA 4NP6A 1R5OA 4TMWA 2BC9A 1S4QA 2KJQA 2ZVQX 4PXAA 3B1ZA 4DKXA 3TLXA 3WMEA 3NG1A 1TPZA 3RRYA 1T6NA 2X8AA 2F43A 2G3YA 1YJ5A 3CR8A 1P6XA 3BH6A 4PC7A 2A3RA 4XSGA 1NVVR 4KO8A 1Z63A 4HUQB 5DSZA 1OSNA 4KODA 4A2QA 2LWIA 1RJ9B 1L8QA 2OCBA 5IHPA 2C03A 2NGRA 5CM8B 2ZRDA 4KLNA 2JA1A 3OIWA 1JB1A 2XJ4A 1CJMA 1J2JA 4KJZA 3FB4A 5CK4A 1Z28A 4LJ7A 1TF5A 3IDQA 4XWOA 5C4GB 4JKYA 1MRNA 2GTPA 5J4KA 2BM0A 1YR8A 2CJWA 2TMKA 5FI1B 2C2HA 1M2OB 2KWIA 4JT2A 5JJLA 2C5LA 2IS1A 2ZSAA 1TF7A 3B1VA 4HB4A 4TQ9A 1KZGB 1XJQA 2J0UA 3FHTA 3NDBB 2ZRIA 2HT6A 2RKOA 3MUFA 3SJCA 3OIUA 1W4CA 2AFIE 4P0TA 5A5GA 4OKSA 4GI7A 4Q9LA 2XSZD 1ZJ6A 2B21A 2RGEA 1SVMA 1XMIA 2Q9AA 4RD0A 1XMJA 1D2EA 4IDOA 4IVPA 2VA8A 5JEDA 3U6KA 2IW3A 3IILA 4DBLC 1GG2A 1J90A 2R8RA 4Q4AA 4RD3A 4ZKEA 2DYKA 3DO6A 1G8HA 3OF5A 4Z1MA 5HPYB 3GJXC 1CJTC 4F92B 4EPRA 4LBVA 4A1FA 3W5JA 1L7VC 2D3WA 4YQFA 1CJUC 3GCGA 1SULA 4DCNA 3K1JA 5FBRB 4HLUC 1UPTA 2HCJB 2O8FB 3K0FA 2JJ8A 1OPXA 2VBCA 2X2EA 1T3HA 2QSZA 3BWDD 2KSQA 4HAWA 4UNNA 2GCOA 1E9FA 1CF4A 3AQ4A 5JCZA 2FPKA 1KSFX 5C46F 3W6PA 2HEIA 4Q02A 1ZIPA 2H7VA 2GCPA 1CR4A 2ZR0A 4ARZA 3TSZA 4ZO4A 1NF3A 2W2TA 3OIYA 1XU4A 3WMFA 4F7WA 2O8EB 4TTRA 1OV4A 1S3SA 1ZYUA 3BAFA 5FOWA 4OQLA 4IXMA 4CYMA 2QGNA 4HAZA 3K0AA 4QGFA 4WXPA 4B32A 1G8PA 5FTLA 5UKDA 3F8TA 1XEXA 2GK6A 3N70A 2ZITA 2Z83A 4OI4A 3B8HA 5LB2A 3CRW1 3MRSA 1NP6A 4U5XA 2JLZA 4OQNA 3ADBA 1K5GA 4JLDA 1PLLA 3I8SA 5FFMA 1GKIA 1IQPA 5CLQA 3GJ7A 2Z6VA 4LRWA 3KKNA 4IOJA 5CYPA 5P21A 3R7WA 3NIBA 2G1JA 4YMUA 4RJLA 2QBYB 1KI3A 1EFUA 2OFOA 5FBQB 1U2RA 5JWOA 1UKZA 5HCNA 2DWQA 5C1BA 4AYWA 4Z8XA 5GVSA 1XPRA 1K8RA 2BM1A 4MA4A 1YE8A 4OBEA 1PLJA 4DHEA 5E7JA 5JI2E 4CIDA 4TZ0A 2YWGA 3GLIE 5JLJA 1MKYA 4PPNA 2FF7A 4W5JA 1XCMA 4GFDA 5LBIA 1X86B 3C5HA 2F1IA 3H4MA 4M4SA 1GSIA 4O0MA 2W83A 4LV8B 5F2EA 3THWA 2QU8A 4NHOA 1OF1A 1XNJA 5JHHB 4LV6A 1GKUB 1G7CA 2EWVA 3NHAA 2XB4A 4TT3D 4C2TA 1Q21A 3B60A 2CLSA 3LY5A 4PPQA 1YR6A 4DLWA 2YWHA 4HAUA 4CT5A 1EFRD 2AL7A 3UK6A 4C3ZA 4C0BA 1KK0A 4HI0E 4A8JC 3Q9LA 3VMFA 2CXXA 3T1OA 4CZ2A 4JLKA 4TLCA 5FL3A 3U6BA 4ASUD 4DB2A 1MO5A 1W2GA 4TMVA 5KDLA 1T5IA 2CE7A 4FMCB 1CR1A 4Q66C 4B3BA 2ZR9A 5D3QA 3EA5A 1YHNA 1XTKA 5AUNB 2FU5C 3BFXA 1SXJB 2YNMA 4AC9A 3UXMA 2WBLC 5J4VA 1N6PA 4XTCS 2OCPA 3KJHA 3AKDA 2JLRA 3OZXA 1WQ1R 1JR3A 4QOSA 4Y0AA 2JDIA 3GEIA 3K70B 4P4TA 1NL3A 1KY3A 3DVLA 2ZRHA 3BS4A 5EZ5A 3Q5DA 1KI9A 3H84A 4M9SA 1G3UA 2OM2A 1ESMA 1WE2A 2OXCA 2IS6A 2RAPA 3RS0A 2WHXA 1QZXA 1WP9A 3F3YA 3QF4A 1JXMA 4NYJR 4QC2A 3QBTA 3AP2A 4Q9JA 4DDVA 5K8TA 2FNAA 2ZRKA 4D6PA 1AK2A 5FPKA 4OHVA 3SE0A 3I62A 2WIBA 3DOEA 4Q1EA 3QE0A 5C4MA 4RKFA 3GP8A 4TYNA 1GAJA 1YZTA 1KKMA 1MO4A 2RGXA 4LPKA 4MQBA 2J7PA 2GJAA 4Q7JB 1X6VA 3LRPA 3X1ZA 2AXNA 2KBFA 1G3RA 1E0SA 3A37A 2Q3HA 1KI6B 2OFWA 2BKEA 2WMNB 3R20A 4ON9A 3DKVA 1N6RA 2O52A 3KKOA 5FTKA 4L16A 3QENA 1FUKA 5SZIA 3AVOA 1H65A 3D31A 4LBZA 4ABYA 2ZJ8A 1NY6A 3I72A 2PMDA 4UQOA 1II9A 3LBHA 421PA 2PLFA 3EG5A 4HLCA 3B1WA 2J41A 2ZSBA 2BMFA 2CMKA 2GEDA 3KKMA 4JVMA 2IYRA 4A36A 2D4HA 4RFSA 1P2TA 2HF9A 1DARA 3V4FA 5EP3A 5TVKA 2OLJA 2ZRFA 3EZ9A 4QGAA 4ZIRA 3DMDA 1BS1A 2IYVA 2Q6TA 3LH5A 4HEJA 3CR7A 3SC3A 1ZBDA 5D3MB 1IM2A 1XTQA 5E95A 2NO6A 1E2EA 3X1YA 5FPYA 3BE4A 3AVWA 2ZYWX 1YU9A 2J45A 1TU3A 2CLDX 1DPFA 2HXSA 2DHRA 4XWKA 3MJRA 1N6KA 2WTUA 5CIWA 1ZCBA 2EVWX 2P3SA 2YOGA 5H1YA 5IT5A 1S2MA 2FEMA 1SVLA 4PAOA 4Q9HA 1ZUHA 1G3MA 2OG2A 3EC2A 4GMXA 1DVRA 2ZANA 1GL9B 2VHCA 3ZZTA 2AFHE 3WNCA 1G16A 3WHKA 1AKEA 2X1VA 2J7KA 5CB6A 6Q21A 3BH7A 1P61B 2QG6A 1L2TA 3W6OA 3PJRA 2QM7A 3LQQA 3QKSB 1MO6A 4TMZA 2GJKA 2FGJA 3UATA 5JHGB 1II8A 1XCPA 4NCKA 3AVUA 3G5UA 1AM4D 1S9HA 2PEYA 2PL3A 1IJEA 1DE0A 4D4MA 1OFIA 1X8KA 2JJ2D 4PHTA 4EJSB 2W00A 2ZEJA 1QBKC 2BMDA 1BOFA 3L8ZA 5LPNA 4M1MA 4Q48A 4NKRA 4QBFA 2QEQA 5L3RA 3MAAC 1VIYA 3W3ZB 3CO5A 4HB0A 2BWJA 2WSMA 1N6HA 2FSGA 2R6AA 2YC2C 4KITB 4V02A 1EX6A 1JPJA 2GWHA 4JYBA 1KGDA 5L3SB 1TEVA 4TSFA 2CLCX 1KNXA 1MV5A 2BDTA 1UADA 3R8CA 4LJ6A 2LKCA 3NEYA 2LCFA 3RDPA 2FDCA 2B7CA 3DOFA 4JLJA 1E98A 1UEJA 3CRMA 4V0OA 3VKWA 1XXHE 1AS2A 1XF9A 3ZGXA 1UBEA 2FSIA 1H8EA 3ZZ0A 2ZJOA 5EXSA 3KFXA 2QT1A 4X8OA 3LW8A 1WBDA 4KSBA 1LF0A 5E4FA 1QHXA 3BD9A 2R62A 1E2DA 3AKYA 4RKEA 2GJ8A 1R0ZA 1EG7A 4Q1BA 3AH8A 3LBIA 4TYPA 3RS5A 1N5KA 4MKGA 4US0R 1CU1A 1E2GA 3FMIA 4EIWA 1R10A 1SKYE 1T91A 3NC0C 3Q72A 3WP0A 4LC0A 1DOAA 1XEWX 4U00A 1UFQA 2VH5R 4D4LA 3AVQA 2GETA 2V1XA 2XNDA 5HTKA 2IWRA 4DCTA 5FOUA 1Z29A 4AG5A 4OJKA 4BE7B 3EA0A 1F3OA 3GLHA 2WJHA 5KDDA 2GDJA 2XTZA 4S35A 3GLGB 1GKYA 5DNYB 2CHGA 3CIOA 4FI3C 1SVOA 3PV0A 4M53A 2KI5A 5JMTA 5EE0A 4ZDIA 5KOYA 2ZYUX 2LKDA 2QMUA 3AGPA 4NYMQ 1XPOA 1KTVA 5JWRA 2V9PA 3CNNA 1M7BA 1D9XA 2FFHA 3EZ2A 3A1TA 1QDEA 4ZCIA 3L82B 3LWNA 5HZKA 4MRVA 4GPTA 1F2UA 4P4SB 3B78A 5AUOB 2ZSDA 3RRMA 1ESNA 3WXMA 1SKYB 3NBXX 2ZI5A 2IXEA 1PLKA 1QHSA 2CNWD 2VLIA 1WB9A 1Z6TA 4WBSA 3V9PA 1BH2A 3R9WA 3AUYA 1KI1A 4D2IA 1NBMD 3ZD7A 2XZPA 2OZEA 1YKSA 2BBSA 2W6ID 1KMHA 4W5WA 1CS4C 4KFSA 4V0MA 2ZUBA 5CDFA 721PA 1E4VA 5G41A 1KDOA 4Q01A 1L4YA 2F9LA 4LC1A 1CRPA 1JI0A 2Z0MA 4LYHA 3TMKA 5DN6D 1NJGA 2YJTD 4A0RA 4HAVA 1LS1A 2DPXA 3PR1A 4G5OA 3W90A 2O8CA 2GAOA 4MDFA 2CK3D 2VL7A 2P6NA 3BXZA 4LBYA 4Q9IA 2JATA 5HZHA 3GMTA 3A4NA 1VCOA 4K81B 4EFLA 3I5XA 1SXJC 2HJVA 4MYHA 3GEEA 1D8TA 1E2IA 3DM9B 4LYJA 5F9HA 4QM7A 1FQKA 2C9OA 2FJUA 1Q20A 3ECCA 4TLEA 4RZXA 4FMDF 1F5NA 1U0LA 3OEHD 4HYYA 4L5BA 1XEWY 4QBIA 3REFA 2OHFA 2VTKA 3A6PC 5H68A 5FUVA 2HXYA 3IEUA 2PH1A 2WWWA 1CJVC 3ETLA 3NBFA 2VO1A 3QIAA 4KXFB 1OIVA 2V6JA 1XTIA 2GRJA 2ZJYA 2PZFA 2I3BA 3R8FA 4BPBA 3QF7A 3ZLJA 3U44A 3FHCB 4HATA 1U81A 4ESHA 4NYIR 4ZDKA 3GPLA 1QG2A 2XEXA 4X8MA 3RC8A 2ECKA 1RZ3A 2O0JA 1AGPA 4AK9A 3T1QA 3PEUA 4TQAA 1DAGA 4NL4H 3TUIC 3ZYCA 4CEIB 1QHYA 2WAYA 3WRXC 2VIIA 4AURA 4KI0A 3UWKA 1DAMA 1IONA 4MKHA 1SVWA 5CK5A 4Q4JB 4PPGA 5FOXA 1CJKC 1RW4A 2ORWA 1J8MF 4MYTA 5EE5B 3RABA 1FX0A 1GRRA 3Q7PA 1RPZA 5GJVC 4DT1A 3AF2A 4IJMA 5M04A 3KKQA 3PEWA 2Q3MA 1KNQA 1E4YA 4Q1CA 1VYTA 1JNYA 3BIFA 1SVKA 1WA5A 1FFHA 3A1UA 1Z07A 2G83A 4M1SA 3JZMA 2C99A 5EP4A 1TMKA 1KDRA 2W2XA 3AKEA 3H1TA 4P33A 4BGDA 4WZ6A 2BHRA 3E2IA 4I81A 2OSBA 1JR6A 1SXJD 1E3MA 1AZTA 1G21E 1BMFA 5L8VA 2V7QA 4XD7D 3IIMA 3BFVA 3CX8A 2ATXA 2DFNA 3WHLA 4A92A 4CDGA 5FR2A 3M6AA 2PX0A 2IBMA 2PMKA 2QAGA 1LFDB 1FNNA 4JSTA 1RC8A 4B44A 4W7SA 1M1YE 3Q5EA 1XX6A 4LPSA 1E2QA 3VHXA 1XJCA 2RH5A 1N5JA 3CPHA 4JBWA 3CPEA 3SI7A 1EWRA 1W5TA 2GEVA 3A4MA 4LHWA 3RRNA 4HDOB 1S3GA 3TIFA 1E0AA 1SQ5A 1N6IA 2VHTA 4MGYR 1HUQA 4UNRA 3QOFA 1XZQA 3RSLA 4HUTA 3A4LA 1XD9A 5EJEA 2NOAA 4IXNA 4M21A 1YR7A 1NMZA 3W6NA 4DEXA 3TUJC 4DLYA 4A2PA 3EWSA 4Q21A 1F2TA 3HP1A 4HSEA 1KJZA 3RVBA 1CTQA 1KJWA 1P75A 5DO9A 4XVUA 1O3YA 4HDCA 4XJXA 1Q0UA 1XD2A 1EFCA 4Q03A 2WKRA 3D8BA 3U3MA 5B58C 3K09A 4EJSC 5JI3E 2NTYC 1NG9A 1ZRHA 4HUQA 1KI4A 1Z06A 2QM8A 1RJ9A 2I1QA 3BC1A 2H92A 2IX3A 3U4QB 1YZQA 3SU8A 4AWXA 2SHKA 2YC4C 3UKDA 3EXAA 3PUWA 3R9XA 1LB1B 1YZKA 2FZLA 3AF3A 3OHMA 5BQ5A 3ZIAD 3EAQA 2RCNA 4HZIA 1KDPA 4AKHA 2YYZA 2GVZC 5BN4A 221PA 2O8BA 1G7TA 3LA6A 3C16C 3LW7A 1Z3IX 2BVNA 4L15A 4WZAE 1KK3A 4O2LA 3TSWA 2FGKA 3UWOA 1S96A 5LDDC 1JJVA 1PZNA 4KSCA 4M1OA 4E07A 3C15C 3L0IB 1LF5A 3QKRB 3P26A 4H9GA 4B34A 2WWYA 3QG5A 5FTNA 2C9CA 4TL9A 4B48A 5TB5A 5FL7D 1VG8A 1I2DA 5AR1A 5FUYA 4DLZA 1TEXA 2FPMA 2QPTA 2B7BA 3FFAA 2MSDB 4IRUB 3KUCA 1GP2A 1P2SA 1H8HD 3ZVNA 1KK1A 3QXCA 5KSOA 2IYTA 3FOZA 3OEED 3ZS8A 5A4JA 4NCHA 3EW9A 4D82A 1DG1G 2RGGA 2FZ4A 1P4SA 4AD8A 4RZUA 1ZC4A 4KFUA 2WPDD 1CIPA 4O25A 3RS3A 3CLVA 2IEYA 2O8FA 3UIEA 5TMPA 1P2VA 2D62A 3EIHA 3UANA 1KIMA 4EPWA 2QGZA 2YWEA 4JL5A 4W9MC 2F3RA 5FUWA 1LS6A 1G5PA 3NKVA 3EZ6A 4EFNA 5SZKB 2ZPTX 5JCPA 1T4GA 1QVRA 1OKKA 1W5SA 2ATVA 3IBGA 3O8CA 3GLFE 3CW2A 4WIAA 5FBVB 2ZI6A 2CDNA 4HB3A 2WM9B 3CUEF 3NTUA 4A4DA 3GFTA 1AKYA 2QRNA 1R4AA 1GRQA 2HF8A 4P32A 4OI1A 4IEEA 2XOKD 3JZAA 4LJAA 2H5EA 3VR6A 1QHHB 1OB2A 3IQXA 2J3EA 2QMOA 4JZKA 3P4YA 1L4UA 1JEDA 1W47A 2P67A 1WF3A 3O47A 4JLVA 1XZPA 1X8JA 3AEZA 4F91B 4TQUS 2JIZA 3EASA 1GOTA 1M34E 5HE9A 4IVRA 4OHXA 1ODFA 2XNSA 1U99A 2QBYA 2QE7A 4PZZA 2HLDD 3WBKA 2JLUA 1HV8A 3SYNA 3RANA 1E9BA 1K5DA 1ZCAA 5HKKD 4PFSA 1S9DA 2A5DA 4M1TA 3GLFB 2XZOA 3GJ0A 1HY3A 4B3XA 2EYQA 1FUUA 4IDQA 2G6BA 1ONBA 1GL6A 3QSYA 5EUQB 1HT1E 2WSSD 1NBME 3RAPR 2QENA 1NIJA 2YVUA 3GJ4A 2RGNC 3AF4A 4NDZA 4PC3A 4BLQA 2QROA 4LGMA 1QG4A 2BCJQ 1E79A 4C2UA 3A1WA 1NNEA 4MDEA 4ITRC 1Z0IA 2XGJA 4Q7MB 1XJ0A 4E5UA 4Q7LA 1E1RA 2CCJA 1YZLA 2ZYVX 3QVVA 5KUTA 2EFGA 3OFNA 1P2UA 2IYQA 3GJ8A 4DLSA 1COWA 2XXAB 4WW0A 4DUGD 3VKGA 4QNMA 2A30A 2KBEA 2IUSA 4B2LA 3VX3A 3MWJA 4G5QA 4NU0A 2F7SA 3SJZA 3LLMA 3GLIA 4YONB 3SBEA 4DCUA 2WIAA 3MSXA 1T0JB 2FSFA 1WMSA 2ZU6A 4KHZA 5CB8A 3FDIA 3LBNA 1KI2A 4LDJA 2O8DA 3DDCA 1R0XA 5IK2A 1T5LA 2ERYA 5CYOA 5GVRA 5CJPA 4RD6A 5BN3A 2R9VA 2VP2A 4D4KA 1US8B 4CEJB 1W4BA 4RZ3A 4RD4A 2JEOA 2ODWA 3QXJA 2AWOA 4AKIA 1VECA 1W48A 4NCNA 1E1QD 3ZQJA 3PITA 1WDTA 2ASEA 3KXLA 3PVSA 1OHHD 4BFVA 3DM5A 2VQSA 5DGXA 1D6JA 4UNSA 4ACBA 3H86A 3SQWA 2WOOA 4NPHA 4K8OA 1GFIA 3AGQA 1BYUA 5EXXA 2OBMA 1E2HA 4MYCA 5TY0A 2V8OA 3EZ7A 2F43B 4YXWD 1W0JD 3KTAB 4OJQA 3MLEA 1Q57A 1T3SA 2D2FA 4LOAA 4M1WA 5JJIA 3U3RA 1Z0FA 2IHBA 3V4RA 1HTWA 1YRAA 1XTSA 3P1JA 4BLOA 2NO9A 1KSJA 1P73A 1UBFA 3ZQ6A 2YZ2A 1SXJE 2ZE7A 4M9QA 1BIFA 1RKBA 5EXTA 2OBNA 2ZAMA 5JJKA 1E2JA 1UF9A 3B7GA 3CX7A 1Q1QA 4B3FX 5L3VA 3W9YA 2DFTA 4BRUA 2H57A 3SNHA 4LJ5A 2RHDA 2V3CC 2PCJA 3F0TA 4J0QA 4URUR 2R6DA 3WMGA 3I8XA 1U8AA 3FKSA 4FMDB 1XEFA 4MGKR 2F1RA 1GRNA 1ZD9A 1OFHA 2RHMA 4C4PA 3JVVA 2FWRA 2UVQA 2F9MA 1IJFA 3LD9A 4GT1A 1E2FA 1N2CE 5DH9A 4MRRA 1U9IC 4OK6A 1KYIA 4LZZA 4BZPA 2OEPA 5EE3A 4QKQA 4JLOA 4YLGA 1X8LA 1GZSA 5B30A 5K8UA 3LFUA 1XBTA 1ZU5A 1ZM2A 4B33A 5BN5A 2AXPA 1IHUA 2GZDA 3MFYA 3KX2A 4PSKA 3SJBA 3WNDA 1P7CA 4BLSA 3ZVLA 5B2ZA 1AGRA 4YMWA 4B3GA 2BBTA 4FW9A 3K0FB 4DLTA 4LK2A 3EX7C 1AN0A 1IN5A 2DCUA 2P6UA 2CHQA 2A5YB 4XWAA 2RGBA 3B6EA 3FWYA 2WWFA 4LI0A 1Q44A 1ZNYA 2W2VA 4XVQA 5DI3B 3QKSA 2C8VA 2JJ1A 4Q1AA 2Z4SA 4LHVA 2W6JA 3TQFA 2J87A 1NY5A 3K9HA 3IO3A 4TLBA 3HJNA 4ARZB 4YMTA 1R5NA 2IF0A 3S1AA 5FPSA 1NVUQ 4QHSA 3VU9A 2QMEA 1Z0DA 4RY2A 3W34A 3GQBA 3K0AB 3IPYA 2DWPA 2QTVB 2GILA 1XTJA 3FVQA 1XEXB 4LJ4A 1IN4A 3C8UA 2D2EA 1KJYA 1LTQA 5L3QA 4B73A 2OESA 3BB4A 4B75A 5KHOC 2Q0HA 2IYSA 1W36B 1G19A 4I4LA
chains in the Genus database with same CATH superfamily
3T34A 1G38A 1SHUX 3OM1A 4OQZA 4IG9A 4UM7A 3G85A 2QAJA 1XVTA 5F1YA 5LQRA 1Z6AA 1CRLA 3BMXA 3QQ5A 1ZOOA 3ZDCA 1NUPA 2EBFX 5BXQC 4ZU6X 4N39A 1KEKA 1ADGA 3UOWA 2DHEA 4LA4A 4F1JA 1NUAA 3V8PA 1KJ9A 5TE9A 3TRDA 2PBFA 4KSYA 2JBAA 4RLQA 3NP7A 1PW7A 3EDRA 1MAAA 4XIYA 4BQIA 2FE4A 1FU8A 5KVAA 1IY1A 1F8XA 5FPQA 2QAGC 3FFBA 3QEMA 2OPHA 1ZOPA 3Q98A 4J43A 2N9UA 1V7ZA 3ELWA 4URFA 5EHIA 5IJ0B 1YFJA 5LP6F 3ZV6A 2XCSB 3L40A 2MSEB 1YBMA 1NHWA 4GGMX 1E1CB 4XWWA 4ARIA 1JAYA 4X20B 3U39A 2Q41A 3QVTA 5C5EA 4UUBA 3TXAA 2BI4A 1WJGA 2RGCA 3FYTA 4M1YA 5EY5B 4YYEA 1YZUA 3I28A 1RXVA 3IKJA 3GCZA 2OHGA 2FA9A 1KRWA 2H1WA 4C7KA 2VG8A 2VNHA 4DC0A 2J32A 3KJGA 1BAPA 3U4DA 4AG6A 1UR5A 3UWPA 3NHPA 4JJZA 1XXHA 2Y27A 1ZXBA 3JARA 5C1PA 1R7RA 4DLVA 3GZTB 1FMFA 1N0VC 5IG2A 4Y9DA 4MVCA 4QU0A 1ZONA 3C7CB 2LD4A 3K0CA 4EYEA 2NSDA 4YDSA 3RPEA 4GE3A 5TRTA 2F3TA 2QU7A 4C01A 1OU0A 1TYAE 3TLCA 2P9ZA 5GGXA 2IYOA 4N03A 2AF4C 1YV9A 4MW9A 3HA7A 4NV3A 5TJ9A 3MUEA 4KVAA 1JF8A 1F8UA 2R6GA 4JBXA 3BGVA 1L5OA 3TQQA 2AB0A 1NFRA 2RGDA 4DY4A 1XWIA 3THRA 2COUA 4GYYA 4MV6A 2LCQA 3THYA 5EZQA 3BMNA 1YXMA 3KUDA 1Y63A 1AXEA 3VKVA 4L6AA 1XRSB 3ZKWA 2CVQA 3A8TA 4FHZA 1L9KA 3K6SA 2H4XA 2N0SA 1AKVA 3SKXA 5DIZA 2DFVA 5JYEA 3NBZC 5IP5A 1QVZA 3KZNA 3VVMA 1OVGA 1XVAA 3TUZC 3H42B 2JLXA 2RONA 1RYFA 1E9CA 1AQYA 1EK0A 1R3DA 2J5XA 3I2IA 5DDIP 3QEJA 4EUNA 1ES9A 4LAFA 1IZ0A 1UJ5A 4CJXA 1VXOA 1ZMBA 3DBLA 1CQIB 4GRDA 1F2DA 1GFZA 2GK7A 3TW8B 1QRAA 2XUAA 5KJFA 2F3SA 5EUMA 2QR5A 3NAMA 4QG3A 5KNBD 4QZVA 1CJCA 3AILA 1N5RA 1BXGA 1VRVA 2QL9A 3AF0A 4AS1A 4KGVA 3FCSB 1PL8A 2VP9A 4RF3A 4ATNA 2B5WA 4EGJA 2AS0A 1J1UA 2YIDA 1RC1A 3S29A 1NZJA 2OZKA 2R97A 1Q5PA 2QX6A 1CYEA 1TM5E 3CYFA 3WMWA 2VUTA 3HUFA 3USES 1NLFA 1TUBA 3QELB 2BKAA 4Z49A 5LKRA 3SEAA 3SYRA 1IVNA 5ALHA 1P80A 4I1UA 3VO9A 4LDNA 1SVSA 2AC4A 1VL5A 3MEQA 3QRWA 5CH8A 2D5CA 1TFRA 2HQSA 3DE3X 1YJBA 1MQSA 2PMBA 3LV8A 1WM1A 5CNMA 3U4CA 1QG6A 2H2FA 2GPNA 3LX4A 3CUVA 2ZVPX 5H70A 2P9TA 4CQMD 5EAIA 2QVBA 2R65A 3WDSA 5JUWA 5DNAA 1TAUA 3AESA 1PUJA 4JXZA 3K9GA 3QTTA 3H7AA 4P98A 4DA8A 5CA0F 5CYGA 2O7NA 2Z08A 3KQNA 4HWRA 3DEHA 1XT6A 1V1RA 3PSAA 4D8VA 3OVMA 1WW8A 1JBKA 1GU1A 1Q3TA 4B45A 4BDTA 1OV6A 3VO8A 2YY5A 3AO0B 3RRXA 3ZY6A 4EKIA 3DDZX 1PJQA 2I78A 3PKIA 5CJ2A 4TVOA 5SZHB 2A7XA 4L95C 1U3CA 3TG8A 3UMBA 2ZJFA 4GWLA 2VJKA 2L17A 4RD2A 1UPCA 2BM9A 1U94A 2GD0A 2WW8A 1U02A 2FZ5A 1SCJA 1REQA 1U90A 2ASVA 2Q45A 4PINA 2ORIA 4IFIA 4O5OA 4KH0A 5EEGA 5ECWA 3ZOKA 1RWVA 4M83A 4IDCA 2BW0A 2G77B 4ND3A 1NVAA 1X3SA 2Q8QA 8ADHA 5BORA 2Y4NA 1NTOA 3C7DB 2VK1A 1QMPA 1TQ4A 2PX3A 1Z5VA 5BVGB 1SXHA 2XT0A 4R5MA 1F51E 3D59A 4TWZA 2X23A 2RHJA 2C97A 1B6TA 3FRHA 3TOSA 1T2NA 1E5LA 3IP1A 4IR7A 3OC6A 3ZHYA 1OI2A 3BE6A 4OEHA 3C6QA 1U1IA 1YMQA 3OUZA 4UTOA 5ENZA 3BMCA 3JSAA 3VHQA 1G17A 4ND6A 1R6AA 4ZWNA 4AN4A 1OH5A 1EGVB 1RYDA 3VOTA 2HK7A 3UJ9A 4CW7A 5JAPA 4RA6A 2R86A 4BKRA 2G80A 2HMWA 3RUCA 1M8PA 4CTJA 3QQPA 3WQHA 5B3JC 3FXAA 2Q50A 3JVUA 4NBSA 3ZU3A 4C0AC 2ODPA 1M6VA 1QYDA 5JCOC 1EJ0A 2DRIA 2W4QA 2Z2IA 1XCBA 1ANKA 2ZSUA 3O2JA 3UZUA 1BU8A 2CDRA 1MQ8B 2C88A 3FSRA 1IUOA 3EGCA 3S2SA 4DMLA 3G0HA 1TJPB 1WKVA 3GFVA 3NEJA 1OBCA 3HYSA 1FPQA 1U8FO 1F60A 5JS8A 3A1CA 4DQKA 4EA8A 1UWKA 4UNPA 5FV4A 3ZH2A 2VWHA 2O2CA 2PZJA 3HBLA 4KQIA 5A5FA 4B4DA 3EIQA 5DJ5A 1XDSA 3MJEA 2HTFA 1NJ8A 3O0DA 4O3MA 1NLZA 5LQAA 4HAIA 1SQFA 2J4FA 3C7AA 3VHLB 1ETHA 3QFFA 1QP4A 2NG1A 3FVVA 4QLAA 4MGHA 5ANRB 3H2ZA 1QF7A 2FW0A 2XCOA 1ONOA 3I4FA 5F64A 3W8EA 4YHHB 3OT1A 4I1IA 2ODQA 1LX7A 3ZHVA 5CG1A 3M0EA 4NEHB 3RHFA 3TOZA 3WG9A 4PR0A 2J3LA 4ANFA 1ZL2A 2DQYA 3GK3A 5HMLA 2QSJA 3NRCA 1EK2A 2OB2A 4K9PA 1JGTA 4WKOA 1DIBA 1EEXB 3K1ZA 3L46A 4IXWA 5C52B 1G291 4RVCA 1O97D 3UC5A 3ZNNA 5AFSA 2IELA 3CSSA 4EFKA 3U4QA 5DSXA 3V7NA 3JR7A 2QTMA 1Q22A 3F8SA 1T9AA 1CUHA 2JD2A 1RI4A 1VSTA 2XUKA 1JQJC 1SZDA 5B64A 4FDVA 5AW2A 2Y99A 4ABTA 2I6QA 3PGA1 4HQ0A 4Y7CA 5ITWA 1TVKA 5HF6A 3ZHXA 4J0FA 1PG5A 4FHGA 3ME5A 4G5FA 1OJLA 3RFFA 1D03A 3H9QA 5AHRA 1IN6A 2A1UA 1IG0A 1UK8A 1CDEA 1YFZA 1Z35A 4MLDA 2O05A 5DLQC 3D3WA 3IAM6 3T15A 2HJGA 3NKLA 2LRHA 1EAMA 4IEIA 4K9MA 4X45A 4L7VA 5FI3A 4P3PA 3SYLA 2ZETA 5I4CA 1T6YA 4DV3B 4IL5A 1S89A 1YS7A 4NBUA 3HWRA 4RORA 4JMLA 1CBUA 2Y05A 4TV8A 3PHGA 3FSGD 2ONYA 3AJDA 6GPBA 2CFRA 1Z8HA 1C1DA 4HNQA 2WF7A 3MPOA 2V0CA 5HRAA 1XMOB 3IAEA 3NX4A 3I83A 5CD1A 5HS6A 2QSYA 1R8QA 3NT4A 3T3DA 3HU2A 3GUVA 3L02A 4ZDJA 2HRQA 2W42A 5CDUA 3QKWA 4YWHA 2GS9A 1U1EA 3LCMA 1V5FA 3LNCA 1KAEA 5JR3A 4J1SA 2HHHB 2VTBA 3VQTA 2JJ2A 1SRRA 1KDZA 4WZAA 3OQNA 3EEYA 3ORRA 2QI9C 2IC5A 4FNMA 1BQ3A 1TLFA 4MQ5A 2BBWA 1CP2A 1M76A 5E9JA 3OJ0A 2MINB 4EB8A 1SBZA 1J20A 4LNUB 5JYDA 1F7VA 1W36D 4KLZA 1O9GA 5TT0A 1A8IA 4AI6A 3W4IA 1N6NA 1F6DA 1EP2B 2GJSA 3BICA 2H1CA 1P81A 1N2HA 4JLPA 3OOYA 4QGHA 4HTFA 2MSCB 1PF7E 4Q47A 4WT7A 5FQNA 5HKBA 4MPPA 2IS2A 4P58A 3RCBA 1NRJB 3B89A 3I73A 3SSNA 5CU7A 1ZXLA 4YRJA 1VCNA 5JXHA 4JU8A 4QBKA 3JR3A 4RANA 2GTIA 2NZUG 3FFXA 4AICA 1FP6A 2Q9BA 3LQ2A 4E3ZA 1MC5A 2PUWA 4X62B 2J1LA 3JQEA 1AQNA 2GF2A 2GK3A 3BRWD 1TM2A 5KKAA 2PFSA 2ZUWA 1TAQA 4BFSA 5BW8A 2FEOA 1ZR4A 1WBBA 1JHQA 4TQGA 1H4QA 4BNZA 4G5SA 4XOUA 1W29A 1RXIA 4OLHA 4DC1A 2HJSA 5K8LA 1U6JA 4OATA 3ZZUA 1RR6A 2QVXX 5AVWA 1L4EA 5DU2A 1RZRD 1EFTA 2WD7A 5IKMA 4Z7JA 4OYRA 4KACA 1JU3A 3FI0A 1FYWA 1TIPA 1TX4B 4C3VA 1L4BA 4UBMA 1VG1A 1QYRA 1D6MA 2G63A 4YXFA 2YTZA 3KEQA 4I8XA 2BEWA 3Q7EA 1W1WA 4C0SA 3GDGA 2XKJE 2QRKA 4RHUA 3VNUA 2GA8A 4B85A 1E7MA 1JZQA 4NECA 2JIMA 2EP8A 4RULA 1FX0B 4JC5A 3V1NA 2H8KA 2XCQA 4DLUA 3G8AA 4HN9A 3SLGA 4B7AA 1Z45A 1SHZA 3OJOA 2AG5A 3QVUA 3RG2A 5CIQA 4ZVQA 1VPTA 5AKKA 5FWNA 1YTUA 4W7IA 3T3EA 1OB5A 1P4AA 1OZ0A 3FE2A 3NS7A 4MI3A 1I7LA 1VA4A 5JVDF 5KQRA 5KNCD 3D6JA 1RSZA 1E0KA 2WICA 5EYPA 4B7XA 1N9GB 3EVFA 1YRWA 4EGQA 2KM1A 3LDAA 3CCFA 4Y0VA 2ZRLA 1U3VA 4JIMA 2A5LA 2XGSA 4RFLA 3ACBA 4A6EA 1ZUD1 2IODA 3L0ZA 2X0DA 3TJMA 1MOZA 2BUBA 2YDXA 3O4FA 1TO6A 4P4GA 1RYBA 3EAFA 4TWJA 2P2ZA 3NCTA 3ZE0B 4NOJA 1I2BA 1NE7A 2CGEA 4GKVA 5JXJA 3F5SA 3O03A 3AUAA 1JR3D 2HA6A 2HSZA 3NKFA 1R4ZA 3R6TA 5HG0A 3TRHA 1J9EA 2W6IA 4WQMA 4NJEB 2G8NA 3RTDA 4CKCA 2J6IA 4GOND 4WZBB 3DBRB 1CFZA 1O5OA 2G9NA 1Q17A 4MVJP 2XF8A 4LKRA 3X2FA 1V0JA 1KETA 2O8EA 2G7MC 1S1CA 5HUQA 2EP7A 2JVIA 3QYJA 4QREA 5DN6A 4BO8A 5JFTA 3VR2A 1YQEA 4LSGA 3SR3A 4BLTA 3GFRA 1US8A 1R8XA 3LXRA 1OLOA 3VZPA 3ZDQA 2P7HA 1P5ZB 1B8UA 1JG7A 1RWMA 2OGZA 2CF5A 3E70C 3MMPA 3QE4A 4G1MB 1E6WA 4KUGA 1FP4A 2I22A 3HYRA 4WXEA 2CY0A 3C1AA 3UCFA 1DBSA 1VPLA 4RMNA 3ZU2A 1HQDA 4NBRA 4HDNA 4QHYA 3ZWOA 1ZMXA 2PBLA 4B87A 3TGWA 4HOYA 3HWSA 2BFBA 3QK7A 1G1MA 2C2BA 3MCTA 4H16A 5FIUA 4M55A 2O3UA 2XX3A 4TLMB 2P2LA 3FF4A 1E8NA 3OEHA 4A15A 2J9RA 4R01A 2DPMA 1FOEB 3ZTWA 3EVCA 2IEIA 3KYCA 4XVHA 2HA3A 3QXSA 1RXSA 4QTUB 2I6XA 3W2HA 4I50B 5KU1A 4DS3A 1U7OA 1XD2B 3H83A 4KAXA 4KIJA 4AUNA 4IWXA 1DGQA 3T38A 1M54A 1JG2A 1UQTA 2JFNA 2RBKA 2Z5GA 5P8WA 3QITA 1SU8A 2OB1A 4G4SO 2VEDA 4PC1A 5JMPA 4NYJQ 1P62B 1D7OA 1T35A 4GP6A 3R7DA 3ZD9A 4U7DA 3AHHA 1IAVA 1NSYA 4HAXA 3U7QB 1ZAKA 4GE0A 4JXKA 2PSSA 1AOXA 1CJSA 3R9XB 4ARAA 2QXYA 1Z0AA 1L7OA 3NJRA 2Z9DA 2PGAA 3ADKA 4UXJA 3R7AA 3TQRA 4UCFA 3W79A 4MUGA 3WFJA 3GLTA 1Z22A 1XU7A 2QUKA 4Q3AA 2CLHB 4RD1A 4C4AA 2X2OA 3HYTA 1E77A 4N0DA 1BW9A 1OY1A 3C14C 4B2IA 1A5AB 5BPHA 3V1UA 1MW8X 1F9AA 4LF9B 5FPPA 4FB5A 2RHBA 3UYKA 4DSZA 3QLTA 3DFIA 2WUFA 1RI2A 2NACA 2G28A 4FCVA 4UEKA 5BQ3A 3ANNA 1WXIA 1MR3F 1PI3A 4HZUB 3RV3A 4BRZA 3TX6A 4KWCA 4P83A 4ZEVA 3WLSA 3VOBA 4PGHA 4O29A 4RY9A 4INPA 1K63A 3QHAA 1J33A 1XCJA 4AX4A 3A32A 3MAJA 1KYVA 2YASA 3E81A 3LPAA 1T8SA 3MTIA 3G8CA 3B5IA 4JJAA 3KS9A 5JNSA 1GA4A 1U4SA 2AOUB 2CC2A 1SXJA 3WGIA 3UB4A 3OLCX 5E6SB 3N07A 3PHIA 1XAIA 4NARA 2BTQB 2O0MA 4O02B 1DXYA 3FUUA 2PA0A 3C3XA 4OA8A 1DG9A 5J40A 3DE5X 3TCNA 4GNRA 4OFXA 1RMQA 1K8YB 3CRQA 4KU4A 4Y1EA 2ZZMA 3AVTA 4ETWA 5FWYB 5K6TA 4JFRA 2GF9A 4WRRA 1UJCA 4NNJA 1ZXXA 1EWQA 1WDKA 1KR2A 4RO0A 4ZPXA 3L9WA 4KRGA 2DULA 2VKTA 3FTNA 2OK7A 3Q15C 2G17A 1A5SB 1BH6A 1IZ7A 1OYYA 3RJZA 3KQUA 2ZIXA 3CF4A 2EFHB 3B9RA 4G85A 5B37A 3VFDA 4PO8A 1NVXQ 5E1OA 2DFKB 2XQFA 3DKIA 5FX2A 4XDHA 3CC8A 3R5HA 1YC2A 2VHZA 4DXHA 5KOHA 3UY4A 2D0OB 4TPKA 5HIJA 4C04A 1Z6YA 3L7BA 4N8EA 3EK2A 1I6MA 4MR9B 2OAP1 2QTVA 2VK2A 4FFBA 1JYSA 3FBWA 4XW2A 1T9GS 4I8DA 3AJ8A 4TKZA 4K9RA 5KMGA 2IS4A 3ENQA 1A97A 3BIOA 1KIAA 4FN4A 1RIFA 1V9CA 2JFPA 4RLHA 5IDVA 1VQ1A 3DAFA 1LK5A 1SOWA 1VE7A 1W7AA 3ZBPA 2O3RA 3E3AA 3EJWA 3IPLA 3GP5A 4D80A 1FBTA 1IG3A 1RQGA 2VXYA 1DS6A 4CDMA 1S2OA 1YRHA 2WILA 5FXMA 4RVDA 3C74A 1RM0A 3AI7A 1AZSC 2DT5A 3JATB 2Q21A 1U63A 1PBTA 1SKMA 3B7WA 3FVTA 2CFSA 3QEOA 4TUYA 1KAGA 2O0HA 2Q4RA 1B0PA 1M6NA 3ESBA 4AKTA 4NWIA 2FOXA 3FX2A 5JXIA 4G1UC 2CJWB 2ICAA 3M5WA 2VTVA 1P6QA 1WXFA 2QRVB 4UHEA 2YIMA 1OYWA 2XTMA 2CL0X 1JPUA 2VYQA 3DSRA 4KDFA 2I1LA 5CIYA 2H16A 2YZKA 4FFRA 2IXDA 4XUDA 4DQXA 4UDNA 2PSJA 4YCCA 5DWDA 1Y33E 4TMXA 2V6IA 1FTSA 5D5HA 4F9TA 2EDAA 2JFZA 2UVPB 1OT3A 3E0XA 1NFQA 4GOXA 1EAYA 1Y8ZA 3L7OA 4JLBA 2UU9B 2PZEA 2NT3A 3BOSA 3B8EA 3AVPA 4ZPJA 3PD7A 5HK8A 2ZRJA 1RP1A 4I1SA 3ZV3A 2J5QA 3TK1A 3C48A 3HI4A 1U0HC 3SOPA 4D4JA 4EG3A 1KFCB 5L4NA 3L77A 5DHAA 2C0PA 5LQNA 3ZU4A 4US2R 2AHOA 4XASA 4DCCA 1SUCA 2XVAA 2O2JA 3AZQA 3BTSA 5BR8B 2H5IA 3PF8A 4ZRMA 2ZWAA 3EHDA 3MWFA 3JAMA 1HETA 3KQMA 4JEUA 2ZUTA 4GBED 3HKBB 3EZGA 4U8GA 2GEUA 3PHBE 4IJUA 1TJ4A 5KDOA 4JC8A 4XYMA 2NV2B 2GCOB 2WVJA 3PNOA 3QV2A 2X7XA 1HXHA 2DBVO 2VDRB 2BPOA 1FTWA 3LGSA 1ULBA 2XNJA 2IF2A 4FFOA 1P9RA 1KY2A 3AHEA 4PNZA 5C3UA 1EXVA 1FQJA 4PCVA 3IXMA 2Y1CA 1QQAA 1E1DA 3AW8A 3FD8A 2JFVA 4XOIA 3PFNA 2WAAA 4F97A 5AW8A 2WB4A 1J0BA 4PGMA 2XVXA 2XT6A 4M22A 4L27A 1LPSA 4XUEA 5E9QA 1U2PA 2OYRA 2CXNA 3VR3A 3HI6A 1KHHA 2GM3A 1P9NA 2JLSA 3A04A 1JQ5A 3HR8A 4GM4A 4PNEA 1YS1X 2B8WA 2XWJI 3B13B 3JVIA 5LP6C 3VR1A 3VJLA 4BFXA 5HE8A 3CLRC 3NEAA 2CF6A 1UC8A 3PUZA 4WY2A 4X92A 3RO7A 3ANTA 3QX8A 2G9VA 4TRMA 3ZNPA 4D99A 4JLMA 2HA5A 1X2EA 3U09A 1RU3A 2YCBA 4ZMBA 3TW8A 2FPIB 1UC4B 4IWNA 5IWAB 2QZZA 1ZK3A 3N5CA 1ZW6A 2PCLA 4TS4A 1XK6A 4CCWA 4F9GA 3IXQA 5JZVA 1PL7A 1E2NA 2G5GX 3BREA 4BWYA 1TUEA 3O8OA 4KYIB 3QVGA 2EZ9A 4Q3EA 4WOBA 3RK0A 1FNCA 4P5DA 4DCMA 4FUQA 4PIVA 5IVPA 5KB3A 1HPLA 2MSWA 3QMPA 1FCJA 3KJFA 1V41E 2FLKA 3E3OA 1EWVA 2WV9A 1CZUA 2CW5A 3M4JA 4NPAA 5DNUA 4PTYA 3UOGA 3I2YX 5KS2A 1J8YF 4F5DA 2P69A 1BDMA 3UUEA 1LW7A 2QA5A 3E2PA 5K3FB 5BY2A 4YCBA 3QPWA 3UPUA 2UYOA 4UU8A 3SM3A 2LPMA 1A9ZA 4UEOA 5JSYA 3HU1A 4YACA 2GAIA 2NXJA 1R9NA 5SY4A 4BZWA 2N1MA 4TV8F 2RG7A 1DKUA 2TMYA 2VYFA 3SJAA 3UOAB 1U0EA 2WYWA 4NOLA 3HNPA 2GZRA 3FSJX 4Y6SA 4M8IA 4EKDA 2WE8A 3O1LA 1NXSA 2GERA 4XWYA 5AXBA 3VPCA 4JCOA 5EE9A 2J8ZA 4XIGS 2QTHA 4S1TA 4RTKA 3LWDA 4LWQA 4AJ9A 4D0NA 2QPOA 1XLUA 4Q9KA 3WGZA 5M3BA 4R71A 4XSVA 5LQCA 4OMFG 2DSTA 1AA9A 1U7UA 2AZ4A 4QULA 4URWR 1OH6A 3NVKI 4UARA 2VJNA 4XM1A 1JG3A 4D42A 4RKQA 1WB6A 4A82A 4WCFC 4NYIQ 1D2NA 5G0VA 1ONSA 5HHTA 3BWMA 3X3HA 4RTRA 5ARCA 4QU8A 4I4IA 1EIWA 2ZS9A 4QGGA 3A9CA 2JGNA 2AI2A 4DRXA 1GSHA 2X42A 3ESCA 3M2TA 2JLUA 5BRJA 2H2AA 1TGVA 1U3DA 3K1TA 3M1YA 4ND4A 4OHCA 5AHOA 1C0IA 3LVRE 3T7IA 3WWCA 2EBHX 2WZDA 5AUQA 1OFUX 1WSBA 2Q3LA 4P81A 5BW6B 3VC3A 3VSAA 1JXAA 4KR3A 5BNZA 4A2CA 3COPA 2G40A 2P62A 3KU4A 3OJFA 1U7XA 2H63A 3HLKA 3FSEA 3N7AA 4URYR 3VR5H 5BVGA 2X9LA 2WIKA 3EY4A 3NAZA 3S1AB 3LX8A 2PYZA 4GLLA 3VU9B 3PXUA 3FHOA 3GQBB 1IM8A 2RBEA 4V1CA 2ZRAA 4JL8A 4EZBA 1EYZA 2AR7A 3E9RA 4D5EA 2OK8A 1TYDE 2XTNA 1K7EB 1O6FA 3KPJA 1NJSA 4MTLA 3LPCA 1XNQB 4Q9NA 2FUG1 2RGNA 2H4HA 1UDCA 3G82C 1VC2A 4DRZA 2GOYA 1MB0A 1S0UA 1UT6A 1ATZA 2W0MA 3C7TA 3PI6A 5CT4A 5BMVA 4OXKA 2F3QA 1XZKA 1AMUA 1UIMA 4RPCA 5E3JA 1NMYA 2D7CA 1G20B 1QCYA 3KM0A 4W99A 5EIAA 5KAPA 1RCFA 1ULAA 1XE3A 2IXGA 3KKEA 5HBRA 4ZEMA 4M0KA 1K08A 4J0DA 4MA0A 4ZOCA 2YS7A 5C4IA 3YASA 2VF7A 4CF3A 4OAQA 2VOJA 3QX9A 3B6JA 4CM8B 3FAKA 3DC2A 3A1NA 1JFLA 2GCNA 2OP0A 4ND7A 4O33A 3RFTA 3ELBA 1DBVO 2RHTA 4E03A 3AR8A 4UM9D 4POOA 1D7AA 2E9SA 3TLZA 3HVUA 1IXZA 3M5CA 3S6JA 1QIMA 4R2XA 3EVNA 3CVUA 1XUOA 3KL4A 1FU7A 4DBVO 1NONA 3ZW8A 2ZRGA 1EFLA 2GPWA 4GZ6A 2I7TA 4F3KA 2JANA 3IUJA 4L6IA 3ZWPA 4BTVA 4MSUA 3KQKA 3LPNA 3OLZA 2ZULA 3I12A 1A2KC 5ALEA 3FZEA 4DR3B 3E5HA 3LT5A 4WJZA 3ZV4A 4NBTA 3FDJA 4KLRA 5ALJA 5BYJA 2ZJ3A 1C3JA 1VPVA 3A2LA 3NB0A 4MARA 1O5TA 4MUNA 2OILA 3NUQA 3I32A 4OV6B 2FZVA 3IMFA 1BFKA 3RU3A 4LZWA 4TS9A 4E7OA 2H51A 3EA4A 4LG1A 3S1SA 2F8TA 4MWDA 2I7VA 2C5EA 3WAJA 1I1NA 5A3QA 2P0EA 4EI7A 3N8NA 4UMFA 4JI1B 2ZJAA 3J80A 3LO8A 5AXAA 3MXOA 1A96A 1P1JA 2D0DA 2ID9A 3G9ZA 4U02A 5IRCD 1JAXA 1JXOA 1XMVA 2YHIA 4KMMA 3TD6A 2B8TA 5EMKA 1N8SA 4TXMA 1D5CA 5JS7A 4Q4HB 4YRMA 3EN0A 4MUBA 2XYVA 4R9UC 1MENA 1Q84A 3HRKA 3GBVA 1RE1A 2VZEA 3ISVA 4JVSB 4Q19A 4UZSA 5ALRA 4G81A 1VTKA 5B55A 1UEIA 3KXIA 4WN3A 3LC1O 4X6LA 5E7IA 1WABA 2OD2A 2ZS8A 3A25A 3C24A 3DHYA 2P9FA 3FUXA 4LNHA 1BDIA 3ZV7A 1QGZA 3MBKA 4WLEA 5B6PA 5EQTA 1MG0A 1SBTA 2K5UA 1D2MA 1A9RA 3CU5A 2P5TB 1JI3A 2AOTB 2HYDA 3GGJA 4PICA 3DYVA 1MABB 1SC6A 2NZJA 5TC4A 1I10A 3AL3A 3UJDA 1MLDA 3OZWA 4UBLA 1W9HA 2XEDA 4E4TA 3TKAA 4FR2A 3U17A 4YDHB 4BVLA 1EPUA 2FG5A 2B4TO 4PWZA 3PYMA 5C80A 5HFJA 4HBZA 4Z54A 1O87A 1O89A 1G7SA 2XODA 3NUGA 1QS0B 1JQAA 3N6XA 2KLHA 1T0BA 3ZD6A 2VSQA 4AVYA 2HYIC 5L7TA 4JROA 2V6FA 3LGAA 1ZC3A 4BAZA 3MQFA 1Q0QA 3GA0A 4IXDA 3RVQA 1EQAA 2MINA 5H5JA 2X6TA 4K6OA 4RK6A 4BFTA 2ETXA 4L9WA 2CEAA 2PX5A 4KXMA 5JPIA 1TUIA 5AKYA 3M83A 1E7RA 5JLAA 3OUUA 2WTEA 3HXLA 3KEFA 4Y2SA 2J0EA 1NYQA 1U9IA 4L2IA 4U6SA 2V55B 4AG3A 3O5AA 3RFVA 5BT9A 3HK2A 4QM6A 5E0OA 2Q9UA 4P35A 4I5EA 1IMOA 2V7UA 4D9MA 2GPJA 1NF9A 2AI1A 2FRDA 1G66A 2AJBA 1IJBA 2VAPA 4IP0A 5TSDA 1T0UA 1VMAA 2DKFA 2PKYX 3CMMA 4A16A 3K70C 1ISJA 3IBSA 1Y9AA 4W1SA 5AJZA 4CTKA 3OQMA 5IZCA 1QCZA 5JY1A 1R0LA 3KUKA 4KDEA 3WLAA 3ODGA 6Q21A 1N7HA 2WKSA 3NGMA 1D09A 1Z8FA 2AMYA 4FR5A 4G2TA 1XPJA 3W2GA 4R83A 2YXDA 5AQ1A 7ADHA 1R64A 4HLQB 4RJIA 3HZHA 4JMPA 3NHSA 5DLPA 2W98A 3SR0A 5AM3A 1EUCB 5CDFE 4RENA 1OLXB 1IIBA 2ZYAA 4B3IA 3C3KA 2OCYC 2V03A 3B85A 1SHLA 3ECSA 3M1LA 3HJHA 3CPJB 1E1RD 5H80A 1YJXA 5I6DA 5TEWA 4N0MA 4K46A 3OE5A 4MITA 2CL7X 3LLVA 4QJIA 3ZTTA 3CJQA 5F51A 4IRMA 1VCIA 4OOEA 1KMMA 3OFND 5DT2A 3SR4A 3UK0A 3ASZA 4GZLA 1W5BA 2QX7A 3PQCA 1NUHA 1COWD 3AETA 4M99A 1M75A 4K86A 1CVLA 5BRAA 1Z0JA 2EFCB 2IIBA 1SBYA 2WU4A 3ILXA 1B1CA 1WXQA 2F1JA 2I3ZA 1Q7CA 1I7NA 1RQNA 2GESA 3EIOA 3GEDA 3WLRA 3ZWQA 5BNIA 1D2HA 2GXQA 1TZJA 1HDOA 1AGNA 1QV7A 2I1VB 5A06A 3JQFA 2OGUA 1V96A 3WJAA 4BFUA 1YDHA 3BBPA 1KMHB 2ZXFA 2X5XA 4J29A 1XZAA 3W8RA 1Z25A 3FR8A 4F2WA 5FOTA 4IDPA 1W0KA 2WK1A 1ADJA 4C0JA 5IK2D 2EERA 2QL6A 4YX9A 5K1ZA 5F1PA 1YACA 5TPWA 3TQOA 3PDWA 4UUNA 3MINB 5KNCA 4DV4B 1V5GA 1ZNWA 3FY4A 4U6QA 3L6CA 2J4CA 3EVAA 4CG3A 1NI5A 1A9PA 3BWVA 1YF3A 1Z6GA 3REGA 4L4UA 1TJNA 2QJOA 3PUKA 3LDHA 3V8NA 3DBRA 1B6SA 1K92A 1PDWA 4NBVA 2BHLA 3Q7RA 5E1MA 5JSZB 3CLTC 1MRZA 4TUYF 4YJGA 1QIJA 4FYKA 2EL7A 3PA6A 4J0EA 1QTQA 4N49A 3JRNA 4B80A 3B5EA 5JDIC 1LC3A 1U8TA 2FP4B 2FWNA 4H0NA 1N2BA 3UMCA 2YIJA 4OREX 4CL8A 2VCYA 3KQTA 1A82A 5BSWA 5A2GA 5HF9A 3LOUA 3M49A 1PJ4A 1LLUA 1QHHA 3T61A 1YQDA 3CISA 1LSSA 3FPAA 1XTUA 1KU0A 3G88A 5DGCA 2D7DA 2JFHA 3DT9A 3PS9A 4IFBA 4QRIA 4AJLA 1Z18A 1DZ3A 3AFGA 4I66A 2I4IA 3D0KA 3JCZA 4A8JB 1XMQB 1IOVA 3N58A 4HGPA 3CEAA 3HSYA 3P0RA 7GPBA 4DV7B 1NNI1 3N6VA 1Z4OA 3ICPA 3ZV5A 1JTVA 3HYNA 5ALYA 3V00A 5B7NA 1ZK0A 4CR8A 4ER3A 5LNK6 1MTOA 2E1PA 2PX8A 5KWJA 1Q1EA 3GG2A 3GLFA 5JTTA 5TR9A 1W88B 2I6TA 3G1UA 4UOQA 1CX9B 3LLUA 2W8BB 3RAJA 3K16A 3GFPA 3C3CA 3UMRA 4BMDA 1LEHA 2E87A 3BK7A 3FKSD 1KEVA 1G0NA 3U7QA 3FNBA 2Z4RA 2RKWA 3TKLA 3MNFA 3G9XA 3D5EA 3AG5A 2X19A 3OZDA 3PD0A 3GW8A 4MB6A 1RKXA 2A78A 4PNPA 621PA 4J6EA 1JHXA 2YOHA 5IX8A 4HSGA 5EKDA 1ZJ4A 2DFLA 1U2DA 1H85A 3QBJA 1HQYE 3H8SA 4HNHA 4DQVA 3EPJA 4RTLA 1MH9A 3MIIA 2HI0A 3EZFA 3HVKA 1WLYA 3IQIX 4DR4B 1L5GB 5BSFA 3NNDA 1C29B 4C08A 2WC1A 5IABA 4WK4B 3U9TA 1CQZA 2GPAA 3CXUA 4DQDA 3OD1A 4HZUA 4BNHA 3UT5B 2WI8A 2QN7A 3TFOA 2ZJZA 4US1R 4KC0A 4OHZA 4B76A 3DWIA 4PIMA 4PYRA 3O26A 4RU1A 5JNLA 1I6WA 1IZYA 1D0SA 1JPNA 3EUAA 4DLRA 3EXHA 4QJ3A 2XKKA 1OTXA 1R6BX 2HC9A 4NZYA 3A7EA 1J56A 4X7RA 2HFKA 2UYGA 1O54A 4IH1A 2FPLA 2JL1A 4MA5A 5BP7A 3RW9A 3PJEA 3CZ9A 3I1YA 3M6XA 5KO2A 2V7VA 3JD4A 2OBLA 3BA1A 3SY8A 3W8NA 3BN3A 1ORRA 3TVYA 2CT8A 1VHWA 5KBYA 2ZJ2A 2JJ1D 2OCDA 2VQDA 3Q3GE 3T7TA 3JQGA 2DLCX 3G49A 3HUUA 1Z5OA 4KBFA 1QFXA 3UWMA 2WWHA 2Q4BA 2VF5X 3R5SA 1NW7A 1P2DA 1DOZA 2NO7A 4NS4A 3DTVB 5TS2A 2FFRA 2IIQA 3KVOA 4AQDA 1RAFA 4W4TA 2ZWVA 4DMUB 1H2XA 1YC5A 3FMOB 1VRCA 3CVWA 4B9EA 3HE3A 4RHXA 3N8KA 1E9SA 4GH5A 1E3JA 3GFBA 3RSOA 1PR5A 1PZXA 2H07A 3K0CC 5DHPA 2IPAB 1D6SA 3O4IA 4B7ZA 1RIIA 5H4GA 1W6RA 2B7LA 1L5HB 2P9YA 1P0FA 2IZ1A 4NP6A 1WSDA 3LC2O 2HW8A 2BC9A 4FOSA 1IULA 4Y2RA 1S4QA 5ALQA 3OMWA 1OWMA 3ZY5A 3PDHA 1JIVA 5U4XA 3PLAE 2Q7XA 4PXAA 3RB8A 1XIVA 3WMEA 4UUMA 2C2OA 1TPZA 3OZAA 4PLYA 2I6GA 4YUVA 5JRDS 4QELA 4HDMB 4NBLA 1G59A 3RYFB 3HADA 3SQNA 4RVUA 3V5NA 2JGJA 1SUEA 4PC7A 4TXLA 3NVDA 4JBLA 1Q92A 1NVVR 1Z63A 4HUQB 2ZBQA 1C7FA 3AYXB 3I0ZA 2LWIA 1RJ9B 3URKA 4JCCA 4UREA 1L8QA 1WETA 5IHPA 1JWAB 2NGRA 4IIEA 1R50A 3KUXA 1IRXA 4YV2A 4YUZA 4Z5XA 5JD4A 6ADHA 1I7QB 1P9OA 2JA1A 2Y66A 3INGA 1P74A 3HY6A 4RYLA 2B3TA 2PRKA 2QYOA 4KXXA 1JG4A 3FB4A 3UPTA 3Q2OA 3M70A 4LJ7A 5DYYA 1TF5A 4IGIA 3IDQA 3M4ZA 1JFVA 4P3OA 5C4GB 1HC7A 4JKYA 1PNOA 2GTPA 1NXPA 1ZHFA 3MMNA 3KSAC 2VR1A 2CJWA 4DABA 1JDBC 2TMKA 2ZJ0A 2Z9BA 5JJLA 2KWIA 4JB3A 4R0VA 3SNKA 1YBFA 2B2CA 1KZGB 1XJQA 1SVNA 2QXTA 4TQ9A 4G0YA 4RV5A 2OKCA 2RKOA 1L7DA 5DB4A 4FJ0A 4RBNA 3FUCA 1YQ9A 4N5MA 4P0TA 5A5GA 2E21A 2YICA 1NXOA 3PFGA 2XUDA 4GI7A 2XSZD 4QECA 2B21A 2CDBA 1XMJA 1NJ2A 1PDOA 4LJSA 2C8JA 4DBLC 3T8YA 4D41A 4DGQA 1SBNE 4EYOA 5K3EA 1JPVA 2VQ3A 1Z7GA 3ETDA 2H9IA 2IU0A 2OHVA 3R23A 2L69A 2XMQA 1X13A 4Z1MA 3TFWA 2JVJA 4YAFA 5AJTA 3GJXC 1CJTC 2R85A 4ZOLA 4C5CA 4XQGA 1X74A 2HMYB 4LBVA 1D2GA 4GXNA 2D3WA 1CJUC 3GCGA 1SULA 3QOXA