3GJXC

Crystal structure of the nuclear export complex crm1-snurportin1-rangtp
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
171
structure length
171
Chain Sequence
VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGLEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Nuclear Export Receptor CRM1 in Complex with Snurportin1 and RanGTP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Snurportin-1
total genus 47
structure length 171
sequence length 171
chains with identical sequence F
ec nomenclature
pdb deposition date 2009-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3gjxC00
4JVSB 3QVUA 1D8TA 4QGFA 2ZEJA 1Z07A 1S96A 2ZU6A 4UXJA 5EZ6B 3LAWA 4Q01A 4TL7A 3UMSA 1HQCA 1OPXA 2PZFA 2H57A 2IC5A 4QNMA 4D81A 4NYJR 3BRWD 2QENA 1DAGA 1VIAA 1ZNWA 1XMSA 1GDDA 2VA8A 2IXFA 5KSOA 4JLPA 2VIIA 5E7IA 1E0AA 2QM7A 3DO6A 1DVRA 4KO8A 1TTTA 4C0JA 3WMEA 4KFUA 2NPFA 2W6JA 2AK2A 1Z6YA 3ZH9B 4ACBA 1G3UA 1NRJB 1KNXA 1N6KA 2AK3A 4Q02A 5JECA 5FUYA 4LYAA 4ZKEA 1K6MA 2O0KA 2B6HA 3I3SR 4TTPA 721PA 3ADDA 3GLFE 1ZP6A 2X77A 3EIHA 4ZKDA 2QG6A 4QGGA 2GRJA 4KV9A 4M1MA 2VP4A 5HR5A 3KL4A 1Y3AA 4MRPA 1OE0A 1KI6B 3WMFA 1XTKA 5FOTA 2OBNA 2MMCA 3AUXA 2DYKA 4JLDA 1IXRC 2QP4A 4OHXA 3SE0A 3O8RA 3QVVA 2CLCX 1O3YA 3NBYC 4JJZA 2QUZA 5LD2C 1JR3A 3V4RA 4I99A 3T1QA 3N70A 1S9HA 4DEXA 5FTLA 4A0HA 2QL6A 3PV0A 3B13B 4ARZA 5L3SA 4PQYA 1R2QA 4IFEA 1XTJA 4AKGA 5FL7A 2O0HA 2GF9A 4Q03A 1KZ7B 1XPRA 5KDOA 1X1SA 3QE0A 1NMXA 1K8RA 2E9SA 1JPJA 2JDID 1VCOA 2HJVA 5H1YA 2CNWD 3KKQA 1OH5A 5CK4A 1SXJE 2F9LA 3K0EA 3I92A 4DLTA 4HAYA 3D7MA 2OFXA 3V00A 2WTUA 5HZHA 1SKYE 1NVUQ 3GJ7A 4Z8XA 5KSZA 4LJ7A 1YKSA 4Z8YA 2I1VB 2OXRA 3GJ0A 1HE8B 3C15C 1OHHA 2O0JA 4TL8A 3SYLA 4ARZB 4B44A 5L3SB 4TTRA 2XNDA 2F7SA 2NO1A 1XEXA 5EQTA 1KJWA 2XOKD 2JGNA 4LJAA 1BS1A 2AD5A 3F8TA 1AA9A 1RW4A 1N0WA 2ZJYA 2EWWA 4ZI2A 5FTKA 3ZZTA 2CXXA 1F6BA 1TAGA 3AGQA 4NP6A 3I5XA 1VIYA 1G8GA 5A0FA 2P6UA 4HAWA 4UXIA 2X19A 3IIKA 3KJGA 3EWSA 3DOFA 3NH9A 1EFCA 1UKYA 2HXSA 4W5JA 1R8QA 4NKRA 1D2EA 1I2MA 3FFAA 4URUR 3RS0A 5DHAA 4BWYA 5JEDA 2XNSA 2GDJA 5EXSA 5IK2A 3E70C 3L0OA 1DAMA 8OHMA 4UKDA 2WWGA 1IY1A 5DI9A 5AR1A 3CBQA 4OQMA 1TF2A 4P4SA 5GVSA 5FUXA 1N25A 1NI3A 2ZE5A 1G7TA 4DJTA 4HDOB 4LYJA 4NCKA 1KDOA 2WV9A 3AF4A 1TX4B 4MDEA 1JR6A 4US1R 2P5SA 2NTYC 2G1JA 2EFDB 1BO6A 4RVCA 1UDXA 2R2AA 2ZYWX 4OI1A 2ORIA 1L7VC 1IXZA 3TNFA 2ZSFA 3I72A 3MWKA 1P9RA 3K0AA 3FMPB 4IDHA 5JJLA 3LQQA 4B71A 3RWMB 1A1VA 4BLOA 1U94A 3I8XA 3X1WA 4EFMA 5EJEA 4BLPA 5L8VA 1MRSA 2IXEA 1YQTA 4AC9A 4M4SA 3K09C 4LGMA 2IYQA 1B0UA 4BFTA 3THXB 2QT0A 3R7WB 3SJAA 2IW3A 1R8SA 3EW9A 4PHHA 1U9IC 3P26A 4OQLA 2ORVA 3H1TA 2GCOA 1KYIA 4FI3C 4JLAA 3DKVA 3LWNA 3THOA 3VKWA 1IN4A 5E7MA 3VU9B 1W5SA 3IUYA 4PQRA 1Z6XA 4ZDIA 2NZJA 3NEJA 4M9XA 1OXTA 2O8CA 4FCWA 3IHLA 2CK3A 3AKCA 2ZRIA 1HH4A 1E3MA 3TSWA 2F6RA 4D4JA 2P6RA 4CGZA 1JECA 2WVJA 3B1YA 2XJ9A 4V0LA 4DSNA 1YZUA 2WSMA 1RZ3A 1JR3D 2HXYA 2GKSA 3PEUA 3QPVA 5J5CA 4AIIA 2C96A 3UG6A 2RGXA 3IQXA 3CR8A 1TMKA 1TEVA 2WJIA 1D9ZA 4ERNA 3KJHA 2WMNB 4IOKA 1KKMA 4HB4A 1RJ9B 1W48A 3LW7A 1NLYA 3K9GA 4A1FA 4II7A 1FUUA 1N6IA 4OYHA 4ESHA 1T8TA 4JJKA 3GMTA 4B47A 3LFUA 5EE3A 3RS4A 3CO5A 2OFWA 4JYBA 2QTHA 3DZDA 1P9NA 1TUEA 3CF6R 2QRNA 2QTFA 3EX7C 1QHNA 1SVLA 1Z22A 2ZRGA 3L43A 2RMKA 4P3YA 2O8EA 4RFSB 4DSOA 1E9SA 1ZMXA 2OXCA 2VSFA 2CLDX 1OHHD 2J3EA 2QE7A 3CUEF 3O8BA 4URWR 4DT1B 4HDQB 1ZU5A 4Q1FA 3BOSA 3GJXC 1Z0DA 4QRHA 5FUWA 5TVKA 2V3CC 2OCYC 3W90A 4OQXA 4B3DA 1QHHB 2F1IA 4EPVA 5J4LA 3I73A 2H8KA 2JASA 5B2ZA 1LS1A 2OILA 4JT4A 1OSNA 3CKLA 4FMBB 5JI3E 1MV5A 1P6XA 4E03A 2GCOB 3TKLA 4BZPA 2WWYA 3IILA 1IN7A 4GZLA 4I1OA 4QL3A 4YMTA 2ERXA 4IXNA 4UXHA 2WJVA 3KXLA 1AKEA 1EFRD 3X1YA 3GLIE 2PEZA 3AQ4A 3PEWA 2V8OA 1H8EA 4ILEA 4XIGS 4RD2A 3BORA 3CRQA 1YR9A 1TADA 1TQ2A 3MGCA 4CF7A 1XCPA 2Z43A 4CIDA 2BMDA 2ZE8A 1UPTA 1XP8A 4XD7D 2A2ZA 4C0BA 1E2GA 1UF9A 1S2MA 2FSHA 1DBSA 2IYSA 4A4DA 4YQFA 2YWEA 4YMVA 4LJ4A 3R7WA 1E79A 2Y8EA 2XSZD 4M1YA 1XZQA 3T1VA 2TMKA 1KDRA 2XZLA 2P0EA 3W6PA 3HDTA 2DFLA 2X2EA 1D5CA 1XDBA 1G41A 1E9CA 1ZIOA 1PLKA 2PLRA 3UK6A 4DHEA 3AM1A 3KKMA 2JIZA 421PA 5G41A 2QSZA 3Q5DA 4MGKR 4O2LA 3U4QB 4C7OB 4UNSA 2IK8A 4UJ3A 1R0XA 4QJ3A 2GESA 1T8UA 1VCNA 4YMWA 1FMJA 1G7RA 4JIMA 4HAXA 1L2TA 1ZD9A 1ZCAA 2JJ8A 1Z0FA 4FINA 2ZM5A 2RB4A 1CTQA 3K53A 1GRRA 4DDVA 2ZI7A 1CIPA 2GJSA 2I4IA 5KPJA 4DDWA 2ERYA 1KY2A 2WWHA 3ADKA 3E5HA 1E9FA 4JLVA 5DH9A 3U3OA 1TL7C 3KJEA 4Q1CA 2D62A 5TXGA 5EP3A 1TF7A 2FG5A 1T91A 1EK0A 1C4OA 1DG3A 4PAMA 2R8RA 3G0HA 1Z0AA 2XEXA 2VF8A 3PIRA 4OQFA 3LNCA 3L0SA 1MABA 1G5RA 1II8B 4Q18A 1FNNA 1LS6A 2IYZA 3U5ZB 3B1VA 2PJRA 4TMVA 1P2SA 3DL0A 4DCTA 1XF9A 1VG1A 3PEVA 3PUXA 2GXUA 1Z6GA 2OBMA 2PEYA 3LVQE 3WHKA 4TYNA 3WXMA 1DAFA 2BDTA 3SJBA 2O8DB 2Z5FA 3WY9A 3AP3A 4EDHA 1T5IA 1ZNZA 5AK0A 3DM5A 2AFIE 2OEPA 4Q9IA 4Q7LA 5EE1A 1KDTA 1XB2A 2AWOA 2DY1A 2HT6A 2WJYA 4KI0A 1G4AE 1BIFA 3X1ZA 3H4MA 4CEJA 3QY0A 3W8NA 1LW7A 4KJZA 2GK6A 4BQSA 1ZC3A 2EW1A 4HUTA 4JLJA 1M74A 1OKKA 3RRNA 1XJ0A 3GCGA 3WMGA 4OJQA 4O3MA 1AZTA 3KZ1E 1DELA 3KXIA 1W4RA 4K81B 4BEBA 4RKFA 2B92A 2QE7D 1A2KC 4EJSB 2ANCA 1US8A 2VQSA 1W2GA 3GLHE 2ZVPX 4LBVA 2ATVA 3CRRA 2GJKA 5JCZA 3DVLA 2BM0A 2BHRA 1LB1B 1QHSA 1YR8A 4M22A 4DEYA 2EFGA 3FGNA 3GJ6A 4D6PA 4C0QC 1J2JA 1U81A 5CB6A 3CPEA 3D6TB 3IDQA 4RZ3A 2NO6A 4LOAA 2VHTA 1U99A 4P4UA 4G5SA 3T61A 5AUQA 2E1RA 2ZROA 1H8ED 4Q19A 1XZPA 3C5HA 3A8TA 2RHMA 4M0LA 3AV0B 4B2IA 1LTQA 1F2TB 3LH5A 4M9SA 1E9EA 2WJJA 3GD7A 1W36B 4NE2A 4B35A 1SQ5A 3KUCA 5FBLB 1GL7A 3PJRA 4TYYA 1E2NA 4CT4B 5A5GA 4IEEA 1YZNA 4NYJQ 3PQCA 1Q21A 4WZAE 4JYCA 3QOFA 1N6LA 3AKDA 5BYKA 3DZ8A 2VP0A 1ZJ6A 1GRNA 3CONA 4IJMA 4OL0A 2ZAOA 1Z2AA 4RD4A 3B78A 3U2QA 5J40A 2DBYA 3THXA 4DLVA 1E9BA 2EFEB 1G5TA 2JIZD 1PUJA 3GLIA 1FTNA 4V0KA 5FBQB 4QFMA 2FDCA 4QM7A 2D7DA 1S1MA 2XTNA 1MO4A 4BEJA 1P9WA 4WW0A 2F43B 4ZDJA 1UBEA 4DC9A 3M4YA 2OAQ1 3IPXA 1CR2A 3DKPA 2FU5C 2OHFA 4IDOA 2J9RA 3EPJA 2O8CB 1NG9A 1G6OA 4BFXA 2ZRAA 1SULA 4N3NA 4BECA 2OT3B 1M7GA 2GZHA 3JZAA 1G3MA 4IHQA 1SVKA 1BOFA 4O2RA 3TIFA 4BLQA 4QBGB 4UNRA 3OIYA 4MGIR 4LBYA 4K46A 2WJGA 2BCGY 5CIWA 4NTZA 4OHYA 2HLDA 2OCPA 2ZETA 4TZ0A 2Q9CA 4Q7MB 2GZDA 4PO1A 1ZYUA 4QG7A 4DB2A 5EXXA 2J41A 3BC1A 3NBXX 5TV2A 2FFHA 4B3GA 5FI0B 3SNHA 4RFSA 1Q12A 2ZRHA 3BAFA 2ZI9A 3SZRA 3W8RA 3U44A 2BEJA 2YC4C 2XZOA 3CX7A 3SN6A 3SQXA 4YLGA 2D06A 3WRXC 4NL4H 3CX8A 4BGDA 1L4YA 4JSYA 1VMAA 1NIPA 1OXVA 3EARA 4FN5A 4HB0A 1WCV1 3U6BA 3AVVA 2BEKA 4LJ8A 4R98A 2UZ3A 3J81k 1UEIA 4V03A 4TMZA 1QHIA 1R6BX 1OKKD 4PTLA 5B57C 4WXRA 2FSFA 4HUQB 4PQFA 3A37A 1NKTA 3FKSA 5K8LA 2F43A 3WNCA 2CBZA 5L3RA 4A8JB 2G83A 4BFVA 3ONWA 1F2TA 2H1LA 1PVOA 2KB0A 1P73A 1R0YA 4PZZA 2D3WA 3HU2A 4IOLA 1DO0A 4JVNA 5B58C 4XWAA 2IWHA 1W36D 1J99A 2IEYA 3KDSE 2C98A 4MRVA 4WZ6A 2PZEA 2NGRA 4BLRA 2IYTA 4V0OA 2QBYA 2YHSA 3OEED 1W7AA 4TLDA 5AJVB 5H68A 1MKYA 5C46F 3QXCA 2O8BB 1E94E 4C2UA 2CEAA 1YR6A 4DIEA 2BKUA 2J7KA 5TMPA 2BMJA 1U9IA 3DOEA 4JZKA 2V54A 1S8FA 1Z47A 2GAOA 3CF2A 4OHWA 4M1OA 4B34A 3FDIA 1TNDA 3LW8A 1RIFA 5KSYA 1T4GA 3T34A 3AVYA 4DLUA 2WIBA 4R7ZA 3A36A 1KDPA 2VF7A 1GKYA 1G7CA 2JLQA 2MSCB 4AI6A 4CEIB 1Q22A 1P3JA 5DN6A 4PO9A 4GP7A 2ECKA 1QHGA 3PFIA 1RYFA 1KO7A 1G3IA 2OESA 4JT2A 2JLWA 1H65A 2RGAA 3IIMA 4U00A 2X1VA 4KLZA 4JMPA 4OJKA 4F92B 1P61B 1KKLA 4H1VA 4B2LA 2ZUBA 1X8KA 3K9HA 4LJ9A 1RYHA 1OXUA 1HY3A 1GP2A 2J7PD 2ODNA 4TYQA 5DO9A 1OB5A 5KYKA 1FOEB 1S9DA 4AY2A 4WA7A 5AWFC 4LSGA 4ZPXA 4PAOA 3THYB 2GEDA 1Z2CA 4I81A 1E2LA 4A0GA 4PSKA 2GVZC 4B32A 1IN5A 1ZNXA 4H9GA 2G9NA 1KAOA 3K09A 4YONB 3KQNA 4ZCLA 1FMLA 2R6CA 5FH9A 1SXJD 1SHZA 3PUVA 2R6DA 4B74A 4C0SA 2P67A 1XWIA 2UZIR 4R2HA 2GJ8A 1M7BA 2OM2A 1R0ZA 1G3QA 4OHZA 1TF5A 1GM5A 4XVRA 1GILA 4B6FA 5TDHA 5SZIA 1IY0A 5DNYB 4PAQA 1DE0A 5BN5A 2PT5A 1U2RA 1V5WA 1WDTA 1FL9A 3SEAA 2ZRPA 1FZQA 2A5FA 1CR4A 1JXMA 2J0UA 4QHYA 5P21A 4B75A 2OO7A 3OE7A 3REFA 3C5CA 5AJWA 1LNZA 5FBWB 3SC3A 1R10A 2PJZA 5JS7A 3PEYA 3ZD6A 4A6PA 1DO2A 3A4NA 3F3YA 5HTKA 2IT1A 3BH0A 3TVTA 2WWFA 2G0NA 3KQKA 4M1TA 1KI4A 3QKSB 1Z0JA 2MMGA 2ZRNA 3U7GA 1QZXA 1GFIA 3B1WA 3EG5A 3TBKA 5B30A 1E0KA 4PPNA 4H1UA 5J4YA 1CR1A 4CT5A 4TSFA 2BCJQ 5EP2A 2XB4A 1AK2A 3MWJA 3MJRA 4L9SA 2BVNA 3BXZA 4QGAA 1VDZA 2P65A 5FTNA 3FKSD 3HR7A 1DS6A 1KJYA 2ODBA 1E2MA 2VP9A 3T1TA 1BH2A 4CVNA 2FWRA 1MRNA 3AP2A 1XRJA 1WRBA 1XEXB 3A1UA 3ICEA 1Q20A 2WIAA 2Q21A 3RYTC 4AG6A 2QMHA 1KSHA 5FPTA 3M6AA 3AF0A 1U8AA 4LJ5A 3PVSA 5D3MA 2BMFA 2LCFA 5FPYA 5DSZA 4Z1MA 2IYXA 3QXJA 3I8SA 1UDWA 4L8GA 3GEHA 1E2HA 3OEEA 4MYTA 1TEXA 2IXGA 3EZ2A 2F1RA 4LBZA 1CR0A 4V0ME 3ZQJA 3Q85A 4GOJA 3AH8A 5CB8A 3Q7PA 1KK0A 1KI9A 4QC2A 3S1AA 1CJVC 4X8LA 1OF1A 2XX3A 4RCYA 3VR2A 2RGCA 3FHCB 2J87A 2J5XA 1G18A 3W3ZB 3DPUA 3VHLB 1PZNA 3GFPA 2IL1A 3UATA 3EPLA 4IKEA 2PH1A 1K5DA 1VYUA 2KI5A 2GEVA 3HP1A 3P4YA 3GEEA 2W0MA 1XBTA 3VR6A 2HCJB 4R2IA 1Z83A 2WPDA 1RC8A 5KHOC 1ANKA 2AD1A 4IVQA 3ZS9A 1P2TA 2WAYA 2KBFA 2VBCA 4GZMA 3MFYA 4DT1A 3KB1A 1Q1ZA 2QAGB 2G0TA 4B3BA 2WJHA 4MQBA 3B85A 1UFQA 3NBFA 5CITA 4DSTA 2XAUA 2ZXUA 3EASA 2I1QA 2IUUA 5FFMA 4IDPA 4LWZA 2J0VA 3AGPA 2XXAB 3A1TA 1OYWA 5L3VA 3LVRE 3FMOB 3NIBA 5C4MA 1E4VA 3RS5A 1G8YA 221PA 4M53A 2A5JA 5FTMA 1IQPA 1X1RA 2P2LA 3UKDA 1XTIA 1IAQA 4A0RA 1E1QD 4C0AC 3RRZA 4JL5A 2W2VA 4US2R 2FEOA 5A4JA 3HYRA 1DEKA 3FMIA 1UAAA 3D31A 4ZCMA 1T9HA 4EPRA 1FP7A 1D2NA 1GITA 2W6JD 2YWFA 2XZPA 2N1BA 1M2OB 3GEIA 5CIQA 2QA5A 3IO3A 1U0HC 1NVVQ 4OI4A 4EUNA 2HT1A 1YE8A 3VR3A 2ZSEA 2QQ0A 3L8ZA 1JPNA 4Q1DA 4C0LA 4FCVA 1ZIPA 3TAHA 1M6NA 3PR1A 3TK1A 2JLYA 4M21A 1GNQA 2OZEA 3BK7A 4PO8A 2KWIA 3CLVA 1EXMA 1HQYE 1A7JA 3QF7A 4IVPA 1SKQA 2ZJZA 5L3QB 1C9KA 2WM9B 2FFQA 4XH9B 2CHVA 1E4YA 1T0HB 3KTAB 5KUTA 2YWGA 2HV8A 4TSFD 4MKIA 4JVMA 2VLIA 4B3XA 1GOTA 1IONA 1U90A 1ZUIA 2A3RA 3Q9LA 1E9AA 1XEWY 1XX6A 4KBGA 4MKFA 4OI2A 4POAA 2OUKA 2V6IA 4DRZA 1DG1G 2FX3A 2FFBA 4A0FA 1DOAA 4HZIA 1COWA 2JLSA 3OAAD 1OFHA 621PA 1ZC4A 3NHBA 4JS0A 3GLGA 3A58B 2ZRDA 1E99A 3BFXA 1D2MA 3CX6A 3HPRA 4O0MA 2IS6A 1N5IA 3EA0A 2CHQA 2IHBA 2CHGA 1G17A 3TUIC 4DUGD 5DE3A 1G8PA 3RS7A 1LF0A 1QHHA 4OBEA 1NVXQ 2DWQA 1CJKC 1U8ZA 5BW8A 2NPIA 4G0NA 4C0HA 1IXSB 3OZXA 3A4MA 4DLZA 3CRVA 3LY5A 1DAIA 4Z1MD 5G40A 3VKHA 2AN9A 2YJTD 1ESNA 2GBLC 1ZUHA 1ZM4A 2W2TA 2FGKA 3PUYA 3QBVA 3C7KA 3G82C 3K0CC 2ZQ5A 5JCPA 1ZNYA 3BERA 1QHYA 5DGXA 1RRGA 1ZRHA 4FMCF 1HA3A 3BFKA 1N6PA 4PC3A 2QPOA 5FPSA 3DMNA 4HLQB 2R6GA 2XOKA 5EUQB 2WWXA 3QF4A 2VEDA 1NN0A 1XJQA 4KSBA 3O47A 1PV4A 3SFVA 1E2FA 3K0CA 3LO5A 3RSOA 4MUBA 3M0EA 4U5XA 2Q6TA 4TMWA 4QJ4A 2H18A 1E2JA 3KX2A 1ZCBA 4TZ6A 2WKRA 3MSXA 4GRAA 1NIJA 1FW6A 3NC0C 2NO7A 4M1WA 1FPMA 1NVVR 4IVRA 2F1HA 2WPDD 2YINC 2ZYVX 1ZINA 1HURA 1OV4A 4GNKA 4D82A 4MA4A 1G291 3EIEA 1U8YA 4CEIA 1Q1EA 2HUPA 1D6JA 1OFTA 3UWOA 2WOJA 5JSZB 4C7OA 4FMDF 4IXMA 1PUIA 1YZKA 3CNNA 2GNOA 2QU8A 4EPXA 5EUMA 1G21E 2VO1A 2GXSA 4KAXA 3CIOA 5H70A 1AQUA 1T6NA 2ZJ2A 3BB1A 3FFBA 2GEUA 4TTQA 2FMXA 4QJ5A 3SI7A 2F3RA 3KKNA 3GLFA 2DR3A 3QKRA 4FWIB 4MH0R 4FXPA 3QENA 3WNBA 3K0FA 5EXTA 3U3KA 3TGPA 1MT0A 2V6JA 3TSZA 5JZVA 4JL8A 4AWXA 4LJYA 1XNJA 2FGJA 4DLSA 3T35A 2CJWB 3A4LA 2FH5B 5FPHA 4HAVA 4DDUA 2Q9BA 4KCGA 4XWOA 1DAKA 3FVQA 1E9DA 5C2JB 5JLJA 5IRCD 2JLVA 3L0PA 4JLOA 5JEEA 4XTRA 3TMKA 3EIQA 4KHZA 1Z3IX 3AVTA 5GJCA 4LI0A 3LBIA 1E1QA 4AYXA 3C8UA 2ODWA 2ZUDA 1NY5A 4US0R 2QTVB 3RDPA 2J59A 3HWSA 4GL2A 5JBQA 1BYIA 4LC0A 4URXR 3GLFB 2VSOA 3CWQA 1DPFA 1GWNA 4Q1BA 3N2IA 3AVOA 4B76A 4R71A 4NYMR 3QBTA 3W3AA 4RZXA 3F0TA 4LZZA 4DWJA 3K70C 5FPKA 3GPLA 3LA6A 2O8FB 4F4CA 5FOSA 1MH1A 2RGBA 2WKQA 2RGNA 1OJLA 4JKIA 5J47A 4LHZA 1KY3A 2AFHE 1X3SA 1JNYA 2REBA 1TUIA 1IN8A 4KFTA 3TJZA 5IHPA 1Q0UA 1W4BA 3GLHA 2GZAA 2ZRFA 3C41J 5JI2E 2CK3D 3KB2A 2P3SA 2D2EA 3GLHB 1F3OA 3RNLA 2NMVA 4L15A 2GHIA 4FMCB 3QNUA 1ZAKA 3AF1A 1GKUB 5KTYA 1COWD 2LWIA 1FX0B 2QGNA 3OAAA 4E5UA 3BD9A 2HF8A 3W6OA 1AQYA 1ZBDA 3QJYA 4OQNA 1NBME 3FHOA 3TQCA 2O8FA 1KMHA 4D4LA 2J46A 3VHXA 4DUGA 5FOXA 2V1XA 1WA5A 1EX6A 1GKIA 4Q48A 2OV2A 3AUYA 3HPQA 1GUAA 3B7GA 2AWNA 1Z28A 1XTQA 4Q5IA 1X6VA 4NMMA 1AGPA 3OHMA 1EWRA 2DCUA 3P4XA 1IOZA 4RY2A 1E0SA 2OE2A 3MLEA 5DYIA 2WZQA 1BYUA 3DDCA 1KOFA 3MCAA 2Z0MA 3P27A 4ON9A 3NWJA 4GSYA 2D74A 2B7BA 2H16A 3GLIB 1H8HD 4URYR 4NHOA 3RLFA 2BBWA 2XTZA 2F55A 4YMSA 1E2EA 3U7EB 3K0AB 1A82A 4A6XA 1NVWQ 4XOIA 3LX5A 1JJVA 2ZTSA 5CM8B 1G8FA 1TQ6A 2REXB 4X8OA 1W47A 4PZLA 2GTPA 4V0MA 4C30A 3ZVMA 1HV8A 1KAGA 2EQBA 5C18A 3BBPA 1J7KA 2CCJA 3T15A 5KOYA 4LYFA 2WOOA 1P72A 3PUZA 5F2EA 4GMDA 5GADl 2RGEA 1IHUA 3F5FA 2QSYA 1GNPA 4KFSA 1OFUX 5CJPA 1P7CA 5CM9C 3U3MA 4B33A 2EYQA 2ZIAA 4A8JA 1N2CE 1ZM7A 4NZYA 4S35A 2V7QA 821PA 1N6RA 2C95A 2YOHA 4XD7A 1GIAA 4NBSA 3BWDD 2AHOA 1G4UR 3T12A 2W58A 4LK2A 1XXHA 2EFHB 2OAP1 4KFRA 1E79D 1EWQA 2J0SA 2XSZA 2CL7X 5C4GB 1QVRA 2ZI5A 5E4FA 1UKEA 3SBDA 1CRQA 3CWZA 4BASA 4DKXA 1G9XA 1KSJA 3IIJA 1S0UA 1KJZA 2R44A 5DI3B 4JL6A 4LV8B 5KNBA 3RVBA 3THWA 3ASYA 4PC7A 4W5WA 5FTJA 2YYZA 1TQDA 1OB2A 3CZPA 1II8A 4TYPA 4IEIA 5BWMA 4W7SA 2YVUA 3PG5A 4RD1A 3GJ8A 3TE6A 2VL7A 3IBGA 4N0EA 4JKYA 3DEFA 4PHFA 4B3FX 4RJLA 3CRW1 3OF5A 4L5BA 1JB1A 2IF0A 2Z6VA 1R5BA 1XMIA 5GJVC 2ZSBA 5J4HA 4A2PA 5EP4A 1I4LD 4S2EA 5JJKA 1XD8A 2QM8A 5FI1B 5G53C 3RHFA 1HYQA 4HAZA 2XGJA 4QHTA 1ZM3A 4D4KA 3VR1A 4E09A 1RKBA 4B3CA 3UMRA 1XTRA 2Z83A 3GJ5A 2F9MA 4I4LA 3PXGA 5E7JA 1VG0B 3KXKA 4WOPA 5G3YA 4M9ZA 4DSUA 1MOZA 2W6IA 4GI7A 1Z6AA 3RC8A 4DDTA 2YOGA 1Z63A 1YZTA 3WRYC 1LVGA 1X8JA 2D2FA 4B6EA 1NBMA 1NMZA 1VKJA 3Q5EA 1KI6A 2ZS9A 1CU1A 4IOJA 5TB5A 3VR4A 3IBYA 2HCBA 3ECCA 1NF3A 4P4TA 2PLFA 3UXMA 2WSSD 3DM9B 4E22A 4NDZA 4NYMQ 4HB3A 1CULC 4PFSA 1VTKA 1W1WA 3BGWA 4FCTA 1E0JA 4MRSA 1LY1A 5K8IA 1QBKC 4WZBE 4HLUC 4Q4AA 3BFVA 3SBEA 2IX3A 4PHGA 4OKSA 5EE9A 1X86B 3T5DA 1I4DD 2QZ4A 1R5NA 1U0LA 4Q00A 1XEWX 3ZVLA 4BFYA 1J70A 2QRZA 2ZR0A 2NIPA 3TR0A 2BJWA 3RRMA 4LPSA 4CRWB 4D0LB 1AZSC 4RSGA 4Q1EA 2FOLA 4QNRA 4CZ2A 1HT1E 4TYWA 2W0SA 4G5RA 4B73A 2IUSA 1AN0A 2RH5A 3G5UA 2AKYA 4HAUA 1N0UA 3PITA 5HKKD 4A82A 2NO9A 2QP9X 4ZIRB 1TU4A 4DCNA 2Z4SA 4CYMA 2CE7A 1DARA 4KYIB 1YRAA 3NXSA 2JLXA 3QKRB 2BIFA 1EG7A 2FE4A 1VHLA 3Q72A 2CVHA 1WE2A 2QEQA 5AUOB 2HF9A 2ZREA 2ZU0C 2V4ZA 5HPYB 5KNCA 1I4TD 1CKEA 2CL0X 2GJAA 3K0FB 4XTCS 1KO1A 5HE8A 2RGNC 4FD2A 2PMDA 2V7QD 3TVDA 4GDFA 2Q3MA 1J8YF 1OIVA 4L4UA 3Q8XB 3ND9A 1ESMA 3C4JA 3RWOA 2BBSA 5JS8A 1GVNB 4HLDA 1YZGA 4XSGA 3MAAC 1KI7A 2ZJAA 1WBBA 5JSZA 3SFZA 3PUWA 2RCNA 1W0JD 3KFVA 4L9WA 1XPOA 4Y0AA 4QOSA 4P0TA 1YR7A 2HEIA 3B82A 2IF2A 3CRMA 1U0JA 4TL9A 3WBKA 1RFLA 1E2PA 1NN1A 3LQRA 2IHYA 2QMUA 1SVIA 2Q3HA 3RS3A 1EGAA 1QVAA 1E1RA 4HZUB 3CNOA 3SYNA 5KPDA 3SYKA 2ZJ8A 2WKPA 4MGZR 3FTQA 1CS4C 2JAQA 1KSFX 1ETUA 1JJ7A 1NMYA 4MYHA 2ZANA 1AS3A 2RAPA 4TQUS 5JHHB 1TQ4A 4JSTA 1W36C 4KU4A 2DHRA 3RANA 5FOVA 2PCJA 1BKDR 4LV6A 4F38A 2K5UA 1XD2A 4C0KA 1OT3A 4I1UA 1CXZA 1P2VA 1GZSA 4IFBA 4TMXA 1N3BA 1CEEA 4BFUA 3EZFA 3REGA 4UQOA 3LBHA 1J90A 3ZZUA 3T06B 4BFWA 2ONJA 2QY9A 1GTVA 4N0DA 2PX3A 2ZSAA 3X1DA 5HCIA 1KI1A 2HLDD 3SHWA 5LBIA 1YZQA 1BMFA 2OSBA 4RKEA 4EPYA 1G1MA 1Q1QA 2WWWA 1E2QA 4AKHA 4PSAA 2C03A 3ZGXA 2W6ID 2CLSA 1KI2A 5J4KA 3AF2A 3KKOA 2NO0A 4BFZA 5AUNB 4G5GA 4BRWA 3ZVRA 3C14C 4LBWA 5KDLA 4C9BA 5EE5B 4JVLA 4Z54A 4AD8A 4TMKA 3I62A 5UKDA 3ZJYA 3UPUA 4EJSA 5J4VA 2WSSA 4XVUA 4PC2A 4LHVA 4ASUA 4HLCA 3W6NA 1T3SA 3N5CA 4B43A 3TUZC 5EP1A 4ZO4A 3GFTA 5ANRB 1UM8A 2JATA 4AK9A 3VX4A 4UNNA 1G16A 1JI0A 2QAGA 2QI9C 3AVQA 2PMKA 4HDCA 2ANBA 3LLMA 4TLCA 2ZS8A 4W5HA 4DZZA 1W5TA 3THWB 4F93B 1KI8A 5IF9A 1W44A 2BJVA 4X8HA 1YJ5A 4GOKA 1SKYB 1VCIA 2H5EA 3H2YA 3BS4A 2XXAA 3JVVA 4LV5B 4C4PA 1SXJB 3PCRB 5D3QA 5FL7D 3ETLA 4ESVA 3CPHA 1CP2A 1F60A 3EZ9A 4KVAA 5JWRA 4EFLA 2PBRA 2C04A 2IS2A 1ONBA 2PT7A 4L16A 4X8MA 1WF3A 3JZMA 4WVFA 2QROA 3TUJC 2R6FA 4TN1A 4ABYA 3X2SA 2BOVA 3QF4B 3TW4A 1NN3A 4TT3A 3UANA 3TQFA 3I61A 2PCLA 3OIVA 3EPKA 4KSCA 1L4UA 2VYFA 3QKUA 4A36A 2QAGC 4FWTA 3K8YA 1W4CA 3CF0A 3P1JA 4QGHA 3I5YA 1ODFA 4BZQA 3K70B 2A9KA 1OYYA 1S1CA 1G64A 2V9PA 3NTUA 4NCJA 2XNDD 1AJEA 3FKQA 2FJUA 4O25A 4IOMA 4Q1AA 1QG2A 3VU9A 2FFAA 1A5TA 2ATXA 1XXHE 5SZHB 4EIWA 1NP6A 4JLBA 4DXAA 3L82B 1FQKA 1W46A 2W00A 3QEOA 2E87A 4EFNA 4RD0A 1E1RD 3ZLJA 4MUAA 1QDEA 1Y63A 2BKEA 3BB4A 4LPKA 3VX3A 1NLZA 4Y0VA 5IK2D 2C5LA 3LD9A 4NYIQ 1Z6TA 2C99A 5GVRA 1RVDA 1W0KD 1JR3E 3B1XA 4A2WA 3MRSA 4CEHA 4Q7JB 1JEEA 3D8BA 2A5YB 1QF9A 2VP6A 2G1KA 4ZDKA 1E2IA 4FW9A 2P6NA 2VTKA 3SQWA 1E2KA 3KTAA 4B2PA 5LDDC 1OXXK 2ZPTX 1B23P 4ACAA 2GETA 3Q3JB 1OH7A 2QBYB 1MO6A 3OE7D 4TL6A 3NDPA 1WMSA 1BMFD 3RAPR 3UG7A 2JLUA 2DWOA 3B2EA 4BFSA 1OH8A 3IPYA 5IT5A 2QPTA 4G5QA 5DIFA 2EFCB 2DFNA 1KNQA 2IYWA 4RD3A 4F4IA 5CDFA 2CCGA 3QG1A 1E6CA 2ZSDA 4QBHA 3KUDA 3N2EA 3KQUA 2YWHA 3NEYA 4IDNA 1HT2E 2AXNA 3QKSA 3ZYCA 2IYRA 4ASUD 4W9MC 3B8HA 2GXQA 4MYCA 2QPAA 4M2LA 1R4AA 3GFOA 4N1AA 4IW3B 3FMFA 1NG1A 5JHGB 2RGDA 3AVUA 1W4AA 3I4LA 4PC6A 4JLNA 2EVWX 1GRQA 3CPJB 3GJ4A 4I1SA 4PX9A 5JWHA 2YOFA 1XU4A 3KQHA 3MG9A 3OFNA 5HCNA 4WIAA 2CMKA 2KJQA 4DCVA 1WQ1R 2GXAA 3RC3A 3T5GA 4LYHA 2JJ1D 1XMJA 2VHQA 2OLJA 3FPAA 4Q9HA 1MABB 5AJYA 1LF5A 3QSYA 1GL9B 1SVWA 1X8LA 2RGGA 1ZU4A 3P20A 4PR0A 3U60B 2VSXA 2GAAA 3AKEA 1G7SA 2FF7A 1V43A 3OESA 1N0VC 2CCKA 1M1YE 5SZKB 1D9XA 5KU1A 4GMXA 1XFAA 3QG5A 4EPWA 3HJNA 2YNMA 1FP6A 2NQ2C 1AM4D 1E2DA 2AX4A 1F5NA 3GJ3A 1S3SA 3H84A 4MDFA 1NLFA 1M7HA 4F91B 3SS8A 4IDQA 4LC1A 3IQWA 4RZUA 1YZLA 4TT3D 1E98A 1P62B 2NZ8A 3IGFA 3B9PA 4M9QA 2XITA 4Q4JA 2XB2A 3S1AB 1T3LA 2KBEA 1P60A 5K8TA 3OIWA 5BXQC 2FPMA 2GCPA 3M1IA 4LUCA 4YDHB 2ZRMA 4HSEA 1Q57A 2H7VA 3ZIAA 1OFIA 2O5VA 2PX0A 2YV5A 2JJ2A 1A2BA 4TLAA 1LFDB 1UEJA 5BQ5A 3CR7A 1YU9A 4NCNA 2C9OA 1XEFA 4NPHA 1IJEA 2C9CA 2ODEA 4PZYA 4U02A 4MRRA 2CL6X 1UBCA 1Z29A 2FSIA 2JLRA 4GT1A 5CJ2A 4Q21A 1WB9A 4ZIRA 2JEOA 1EFRA 1Z8FA 4ZCIA 3ZZ0A 2O8DA 1P5ZB 2IYUA 1J8MF 2B8WA 1G19A 3EAQA 1KTVA 1Q3HA 5EZ5A 4EQ6A 2QN6A 1RE0A 2CVFA 3DHWC 4TLEA 3NHAA 4KXFB 1NJGA 3EWAA 2D4HA 3HYTA 1Z0IA 1W0KA 2ZRJA 1SXJC 4Q9LA 1N5JA 3RRYA 5JRJA 3NG1A 3DMDA 4IRUB 2ZYUX 4NYIR 4MYUA 3WYFA 4A92A 2V1UA 1CJUC 5BYJA 3QEJA 4HATA 3A1VA 4HLUA 5FOWA 4FIDA 2CE2X 3HR8A 4DCUA 1UBFA 2FNAA 5L3QA 5E3HA 5JRZA 1CJMA 3EA5A 2QMEA 1UKZA 3B5JA 3FB4A 1KK2A 5ELXA 1WP9A 4AYTA 3NBZC 2ORWA 4DCSA 2YC2C 4NCHA 3TSOA 5B64A 1JQLB 2EYUA 1S3GA 2UVQA 4M8NE 4QBFA 3U7FB 4R9UC 1GNRA 1CF4A 1VECA 2G88A 1JXOA 2HYDA 3H86A 1ZD1A 4B48A 3L2OB 5FR1A 5E95A 4PHTA 3EC2A 2RHDA 3BIFA 2IEZA 4YXWA 3SJZA 1KGDA 2H92A 1G8HA 1NSTA 4GFDA 4CW7A 1XJCA 2OBLA 3A1WA 2IUTA 4LHXA 4Q9JA 1FNMA 2ZAMA 3CB4A 4WXPA 3C16C 4BUJA 3LLUA 3ADBA 3JVUA 2WBLC 1CRPA 3QQ5A 3P32A 1OXSC 2QORA 3ZS8A 4G01B 3U44B 3QXSA 3AVWA 2O8EB 2R65A 2ZJOA 2BMEA 3CNLA 4MITA 4TMTA 4YMUA 3OFND 3NDBB 3WNDA 3AF3A 3CW2A 4J0QA 3GLGB 1EX7A 2JJ1A 3BH7A 4JLKA 1VG9B 3RS2A 4AKIA 1Z5ZA 1ZD8A 4KITB 1SVMA 2GF0A 1Z08A 3CH5A 4UNPA 2ZS7A 2C2HA 5K8UA 3B9QA 3ND8A 4QBIA 1KI3A 2W83A 121PA 3K9LA 2ZRBA 1KO8A 4HI0E 2X2FA 3EZ6A 1A4RA 3MJHA 1G20E 2ZI6A 2AKAB 3BJIC 5KO2A 4KBFA 4KYUA 5HE9A 5AJXA 1XXHB 1QRAA 1JALA 3QPUA 2Q0HA 4F7WA 2GILA 2PZGA 1SVSA 2VHJA 4MGYR 3AEZA 4AG5A 1XCGB 2IS4A 3HU3A 3UIEA 1N6HA 2OCBA 2ZE6A 2VP2A 3O8DA 4DIDA 4ZV4A 1KIMA 1MR3F 2NG1A 1OH6A 4Q4JB 2N46A 3ZIAD 1HE1C 2MSDB 2H17A 3U3RA 2JJ2D 4DB4A 1AKYA 3MUFA 4GOXA 4LJ6A 3THYA 4A8JC 2ONKA 1R5OA 1DADA 1MO5A 2EWVA 3QKTA 3WYAA 4C3ZA 3KKPA 4D4MA 5F98A 3VNUA 4QM6A 1P4SA 1FTSA 2Q9AA 1JQJC 1OIWA 3ICQB 2DPXA 2ZI4A 1W49A 1NJFA 4URVR 2ZRLA 1II0A 2ZITA 5F9HA 3R9WA 3WP0A 2J1LA 3EPHA 4LCBA 4DLYA 2NOAA 2ZR7A 2IA5A 5CYPA 4FMDB 4D2IA 4KVGA 4QXAA 5DLQC 4PSVA 3TH5A 2WMOB 3FWYA 4RFVA 2MSEB 4URZR 4P32A 4HEJA 4K8OA 2QNRA 3B1ZA 4JBWA 3QPWA 2HJGA 6Q21A 3VKGA 3R9IA 4DVGA 4WBSA 4Q4AB 3KFXA 3UMFA 1E32A 5GJBA 2FEMA 5FBVB 1Z06A 2C8VA 4GP6A 4RD6A 2R9VA 4XJXA 3T1OA 3X1XA 3AVPA 1VCMA 2VH5R 3FE2A 2L0XA 3I32A 2LKDA 3EXAA 3FYHA 1FX0A 1MO3A 4CDGA 1QHXA 4P31A 1YHNA 1N6NA 3AKYA 5CLQA 2A78A 5KSPA 2G6BA 2PL3A 1E9RA 1N5LA 2JCSA 2VHCA 3B60A 4YXWD 1VPLA 1YVDA 4TQAA 4G5OA 1PLLA 2FZLA 4QKQA 1PLJA 4Q4HB 4D26A 1XPUA 3SOPA 1M34E 4PPQA 4EJSC 2VRWA 3RABA 2REOA 2GWHA 5CDFE 2F3TA 3TAUA 3SDZA 5F9FA 4RZ2A 1G6HA 1UJ2A 1E96A 3TLXA 1CBUA 3IEVA 5KDDA 1YRBA 3TR5A 1GG2A 1OW3B 2ZYTX 4NONA 4P33A 4BE7B 3K0SA 4D25A 2DFKB 1NNEA 5HZKA 2QGZA 2G77B 2KE5A 3O8CA 3U7HB 3U4QA 3ZVNA 1C1YA 2D7CA 1SGWA 4C2TA 4WAUA 3W9YA 3U61B 1UKVY 1DAEA 1S4QA 4GPTA 4JBXA 3D3QA 1TPZA 1CLUA 3VAAA 2DB3A 3LX8A 2A5DA 1JAIA 4YC7A 3MD0A 3R20A 3TRFA 3SHFA 5JMTA 4M1KA 4PANA 1KK1A 4DBLC 4Q4HA 4TQ9A 1NKSA 1GAJA 1KO4A 1AS2A 1CJTC 1H8HA 5DI3A 1P2UA 1NL3A 3EZ7A 4JLMA 4OK5A 2ZUCA 2OFOA 5CLLA 3LXXA 3AB3A 5CYOA 3V9PA 2SHKA 5LPNA 2A5GA 3KJIA 1UADA 3WBJA 1Q3TA 1EESA 4OI0A 2B8TA 3NVAA 2N42A 1GL6A 1JBKA 1VYTA 2J45A 3RSLA 3OEHD 1DTSA 3I1FA 3K9NA 1EFTA 2C77A 5FUVA 2FPLA 4G1UC 1LV7A 5H8WA 3ZD7A 3VFDA 3VMFA 2VPPA 1L8QA 1Q44A 2ZJ5A 2AR7A 3OIUA 5M04A 2FN4A 1Q1BA 1UBGA 3PENA 2RKOA 1Z0KA 3Q7QA 3ZQ6A 1T3HA 5JWOA 1FFHA 1VHTA 2I3BA 2IBMA 4HUQA 3W34A 4UJ5A 2HDNB 5DISB 5AJZA 2YZ2A 1T0JB 3GLGE 2GA8A 1ZVQA 4KODA 5IDVA 4V02A 2JLZA 1RRCA 4EAQA 4D80A 1I2DA 3FOZA 1F48A 3HU1A 4ZDWA 2ASEA 4Q7KA 2QP3A 2V55B 3LBNA 5DN6D 1WBDA 2WWIA 1K5GA 1KSGA 1G5PA 2B21A 3QI2A 1XMVA 2O52A 1II9A 3NKVA 3ZDQA 2DWPA 5FR2A 3GQBA 1HTWA 4DLWA 1NSFA 4CEJB 2A7QA 4M1SA 3A1SA 5TARA 3LRPA 4I1VA 4TWZA 1R7RA 4MKHA 4OK6A 1ZUNB 4XVQA 2IYYA 2GVDC 4LY6A 5EE0A 3VR5A 2GJ9A 2UKDA 2J7PA 3BE4A 4Z51A 4NU0A 2WHXA 4V0NA 2J0QA 3GP8A 1P75A 3SR0A 3V4FA 5C1BA 3QIAA 4HB2A 5LD2B 2WICA 2VP5A 1RPZA 3IEUA 4EKDA 3K70D 1PJRA 4A9AA 1US8B 4XSHA 521PA 1FQJA 4YDSA 5GJWC 3W5IA 1OLOA 2X8AA 3IHWA 1SXJA 2ZRCA 2AL7A 3R8CA 4MRNA 4DLXA 1XD9A 5SZJA 4AKEA 4PPGA 4PXAA 2A30A 2ZRKA 4D0NA 4BPBA 1KMHB 4JBYA 4BLTA 4EPTA 3U3JA 3R8FA 1IJFA 5EXPA 4U7DA 2C78A 2XJ4A 1G3RA 1SHKA 2ZJBA 2IWRA 4QHSA 5JFGA 1AGRA 5JJIA 1NBMD 4LX0A 1SVOA 2BM1A 3AVXA 4UNQA 2XTMA 4A15A 2QT1A 3QXHA 4Q9KA 1XD2B 2GK7A 1ZM2A 1AIPA 4XWKA 1JAHA 5BN4A 3WYGA 4PC1A 1VYVA 1U98A 2B7CA 4BLSA 2BC9A 4OK3A 1NN5A 4MKGA 3IO5A 2FV8A 3W5JA 3U6KA 1O87A 2WAXA 4ZI3A 4LDJA 1KZGB 3LV8A 3WHLA 3E1SA 2OG2A 2IS1A 5G3ZA 2P5TB 2HYIC 3MWLA 4NCIA 2FZ4A 1DAHA 4PPFA 2EU8A 4Q47A 4BRUA 5HKKA 3R9XA 5AUPB 2IYLD 2Q3FA 1KMQA 1F2UB 3L8YA 3LXRA 1ZW6A 1ZM9A 1VG8A 1SZPA 3OEHA 1GSIA 1IBRA 1N6OA 4Q4LA 5D3MB 4A2QA 5F3WB 3IKJA 3H0KA 2CDNA 4LRWA 1TU3A 4Q66C 1EFHA 1QG4A 3VQTA 1KK3A 2LKCA 2OCAA 4DLRA 3CM0A 1T5LA 2JDIA 3MMPA 2JA1A 2BBTA 2CNWA 4LHYA 1IY2A 5CK5A 3MWYW 4KLNA 2GBLA 1RRPA 4BZXA 4NH0A 4TLBA 2J0UB 3TW8B 1IN6A 2ZE7A 5FBRB 5BN3A 5DYGA 2QAJA 1M8PA 2OLKA 4OHVA 2ZR9A 2ZVQX 2C9YA 1FUKA 2FA9A 3KQLA 3QUSA 4HZUA 5LB4A 1RJ9A 5FOUA 2F1JA 4G3XA 2CJWA 3L0IB 1XCMA 3CZQA 4LHWA 3NC1C 4CEHB 4E07A 1W0JA 3BH6A 5LB2A 3VNVA 1WXQA 1HUQA 2FSGA 3CH4B 4AYWA 3ASZA 3VTKA 5FL3A 4F4JA 4D0GA 1AS0A 4GBMA 1W2HA 1R0WA 2BWJA 3K1JA 2Z4RA 2G3YA 2IYVA 4AURA 2AXPA 2GCNA 2ZI3A 3BB3A 3AP1A 1XTSA 2R62A 4EQ6B 1N5KA 2QQEA 5DHFA 5TY0A 1JEDA 4P4SB 2R6AA 3LDAA 2O8BA 1E69A 4ITRC 4RCZA 3B6EA 2BBOA 2KSQA 2VHUA 3NH6A 3SU8A 3FHTA 5KNDA 3WP1B 1ELOA 2DFTA 2FPKA 2W2XA 4HYYA 3SJCA 1NY6A 1EFUA 1HEIA 1OIXA 2BV3A 3EC1A 3UWKA 1KO5A 3A6PC 3QXXA 2YKGA 1RRFA 3ADCA 2QMOA 3E2IA 1IM2A 1F2UA 1KHTA
chains in the Genus database with same CATH superfamily
2CFCA 5I7FA 5JAPA 4GZ5A 1WABA 2JHPA 2BGJA 4H17A 1LD3A 1D8TA 3H17A 2ZEJA 1QS0A 4QGFA 5G1NA 1JIJA 3OF2A 1Z07A 4D56A 3IUNA 5EZ6B 1KOGA 1NR7A 1K2VN 2DM6A 3MRXA 4G24A 3IDZA 4UBMA 4D81A 1HYEA 1F5SA 4GVXA 4RMGA 5DYWA 4AMUA 1FFAA 4CV2A 1H93A 1DAGA 1MEEA 1Y1PA 4KNYA 3AR9A 3RFFA 3H11B 5IWCA 1NAIA 1GDDA 2VA8A 3OU2A 4E6EA 5DK4A 5KSOA 5TS2A 3WL7A 1SUIA 3Q98A 3E2PA 3ZZNA 1HRDA 3GWZA 3MMZA 1A9OA 1DVRA 4G36A 4C0JA 1X7XB 3DE4X 5LJLA 2WHPA 3NBQA 2P2YA 2ZDGA 2AK2A 2K4MA 1G3UA 3NR2A 1YFKA 2AK3A 2UYOA 1GTMA 1NI4B 4LYAA 3UK2A 4TTPA 721PA 3NV7A 5BYBA 4B6JA 3GLFE 2X77A 4UCQA 5CJJA 3TF5A 4UQLA 2INGX 3AI3A 4HPWA 4Z0TA 3RJZA 2J31A 4M1MA 2VP4A 5HR5A 2FZKA 3DEHA 1ZWLA 3JD2A 3A6LA 4MRPA 1VRCA 1GGHA 2BFOA 4RLHA 3WMFA 1XTKA 4LS3A 5FOTA 1YV9A 3KEOA 5C1DA 3IP5A 3AUXA 4GC9A 3ROXA 2EX1A 4G4SO 1G8KA 1I2CA 4X1IA 4AIRA 3SE0A 4C78A 3QVVA 2CLCX 3COJA 1O3YA 2EZ9A 3BWVA 4JJZA 5FWDA 3UOWA 2QUZA 1WM1A 1NRWA 3DMTA 5ES3A 1S9HA 4KQGA 1QGUB 1W5AA 3ZE7A 2CVPA 2QL6A 1HSOA 4X60A 5ECDA 3F1KA 2VA9A 2CNKA 2WSLA 4ARZA 4PQYA 2I29A 3QTLA 1MZPA 4C5BA 3L6BA 1WD5A 4H6XA 4JT9A 3FFWA 1MHPA 4G1VA 5FL7A 1ZUWA 2GF9A 2VJYA 3TOXA 3C97A 3R5FA 4OHBA 2TMGA 2VTEA 3JQBC 1X1SA 3KB6A 2PFSA 4TV9F 2LBPA 3N0VA 1JPJA 1PG2A 2JDID 1DI0A 1GN9A 4QU9A 3S55A 3KKQA 1V8PA 1OX6A 2XCOA 4U0KA 1XRMA 3O4VA 3CEHA 3K0EA 4AY3A 2GBIA 4J0CA 4DLTA 3L1UA 4B3HA 2HA2A 3O4HA 4D9FA 4EB3A 1ODKA 1TLLA 4HFJA 1EUCB 4QPNA 2E1PA 1J9EA 4CF5A 2Q9UA 1YKSA 3WVNA 2B35A 2OXRA 3A4YA 2FWMX 3AHHA 4HR7A 5CEEA 5IANA 5L3SB 1OHHA 2D13A 2IGBA 4TL8A 4UBLA 3UV7A 1JKXA 3A2MA 4J6FA 4K40A 4WFJA 5ECWA 1KMNA 1Y3BE 4NE9A 1QLHA 1XEXA 3ESZA 4BNIA 2AMFA 2VQ6A 1MJ5A 4E5KA 3G6WA 2CD9A 3HV0A 4YHHB 3EGDA 1RW4A 1L7XA 3KQWA 1GTJ1 2L19A 2EWWA 2G72A 4RHTA 2DU8A 1CRWG 1V1MA 4DCJA 1F6BA 3FUVA 4TKZA 2C1EA 5D7BA 2NLOA 2QU7A 2YV2A 4Y3UA 3S7ZA 4DIOA 3SF8A 1VIYA 1JKJA 2WIKA 1PGQA 4XR9A 2Z2YA 5A0FA 3ZYZA 1TC2A 2UDPA 4MQLA 3IIKA 3ZW7A 2ADFA 4G84A 1CUIA 1CZLA 2HXSA 4H7DA 4XQ9A 3U6KA 1GRCA 2W2LA 3FFAA 4BWYA 3GG9A 3RS0A 5JEDA 2GDJA 2AFIA 2VNSA 2ZWOA 3MELA 3OLXA 3V8MA 1V1RA 4G0MA 2UZ1A 2IQ5A 2PR2A 4I9FA 1CPYA 1CB7A 3IT1A 4KDRA 5GVSA 1NI3A 5HILA 3IQHX 3SLGA 3BQMB 1USUA 4LYJA 2J32A 4NCKA 2FKAA 3FLMA 5ADUS 4FU0A 3AF4A 3EFOA 4OOEA 1RACA 4LGCA 1QVVA 2ZAIA 1TX4B 2FSSA 2P5SA 1GGNA 4QWMA 3WYBA 1OX5A 4OB7A 3ILVA 1YD7A 1GTRA 3D7LA 4FZ5A 1N3YA 1NASA 2NV0A 4D6YA 4JJ4A 1G66A 4RVCA 4ZVPA 1CIJA 3MXTA 2ZYWX 2W37A 1HMPA 1NLUA 4OI1A 3RSCA 2R8PA 2ORIA 1OC2A 1IXZA 2FHSA 2CVOA 4CN8A 1KZYC 2ZSFA 5I5GA 1P9RA 4TRJA 4IIFA 5C5EA 2QMYA 3I8XA 5L8VA 2HPAA 1CY7A 3UFXB 5TQ0A 3VYWA 3VUEA 1XQ1A 2B98A 1WZNA 1DOZA 1XNGA 1YQTA 2VHYA 1B2LA 4KPUB 4M4SA 3K09C 5F4BA 4LA4A 2J6BA 3OM8A 5GONB 1BCRA 2AJLI 3BDAA 3E3OA 3V33A 2IW3A 2AXEA 2AEJA 3C43A 3W3AD 5MHTA 1V16B 3PIIA 3T4XA 2YZ7A 3ZDZB 2ZIZA 4BVKA 2X6TA 1IZ7A 5CH5A 4AZSA 3L0BA 4CMHA 1NR1A 1WUKS 3LWNA 3THOA 3IXLA 1PZEA 3GMSA 5E7MA 4MUMA 2UUBB 4ZGBA 2A0KA 4RA6A 1YHYA 3NEJA 4GX2A 4EJ0A 3ZGZA 5EIHA 1HE2A 3VPDA 2CK3A 1SBTA 1HH4A 1U8TA 3B6ZA 3TSWA 1E3MA 2I2WA 2P6RA 2ZCUA 3B1YA 4DSNA 2XJ9A 1H2RS 2PRYA 2WSMA 1JVBA 1JZTA 2BSXA 2HXYA 3PEUA 2XWJI 1ZQ9A 3QPVA 1RLOA 2C96A 3BMOA 2RGXA 3UG6A 3IQXA 1N32B 3CR8A 1TMKA 4CDRA 2WWTA 5PGMA 1SIOA 4ERNA 4BKPA 2BP7B 1YIDA 2YWRA 1AQJA 2WMNB 1MIOA 3RUEA 1UXGA 3M4ZA 3LW7A 1UINA 4YMHA 4DV6B 3O0TA 5HA5A 2WHPB 1G0OA 4CIXA 4II7A 1FUUA 3GMTA 1HXHA 1UBTS 4XW2A 4B47A 4JCOA 4UE3S 7AT1A 2QTWB 5JAHA 3BL8A 1J8DA 4OU5A 4JYBA 2QTHA 1CEYA 4JHLA 3TNJA 1PT6A 3H2IA 4LSWA 2D1QA 1X1EA 3TW0A 1PR6A 3CUTA 3WGVA 4MVJH 4XGRA 2O8EA 1CNEA 3LX4A 5BPFA 3VZSA 3KM0A 2WVAA 2N9UA 1G5QA 2X9NA 2ZTUA 1ZMXA 4Y6LA 3QUAA 5KYXB 4IVNA 4F60A 2Z2JA 3AERB 4BAGA 2VSFA 4ZZ0A 1TEZA 4RJ2A 1J1UA 2J3EA 3R3YA 1F14A 2XH8A 1ZU5A 2DOKA 3ACDA 5TVKA 2XOXA 3DC2A 1COZA 2OO5A 1TD1A 4EPVA 5J4LA 5IAKA 1JT2A 4RADA 4U9UA 4CNQA 3ORRA 2D8MA 3GJYA 2FK7A 3NBUA 3PDJA 1Y5LA 1L5VA 3PRYA 4QEDA 3CKLA 4FMBB 5I9NA 5JI3E 3PHHA 2F2TA 5T6MA 1SIBE 4S1NA 5LZ8A 1TIPA 3LCUA 4KQIA 1IN7A 4GZLA 2WWYA 1DIOB 1PDOA 4UXHA 3FFTA 2WJVA 3KXLA 4P3NA 4QXOA 4ZAVA 1IY8A 3GT0A 5ALEA 3PEWA 1TKRA 1H8EA 1DRJA 4XIGS 4RD2A 3CRQA 3MS7A 4OB6A 5AD1A 3JYLA 3QV2A 1TQ2A 2R8BA 2P7HA 3FR7A 4MO2A 4Q6BA 1M76A 1OOEA 1YMQA 1YS9A 2QD1A 4NY1A 3VUFA 2ZE8A 4XD7D 5ARCA 6NULA 3R74A 3ZQKA 3C6QA 3PA8A 1UF9A 4DREA 1DBSA 2AT1A 2ZJ7A 4YMVA 1O9BA 4J0EA 4LJ4A 4E5NA 4YA6A 4MV6A 1FJGB 4JENA 1GCOA 5EFOA 1L5HA 1XZQA 3T1VA 2GTIA 3OLYA 4LN1A 3LGXA 3L01A 5IYZB 2P0EA 4CMEC 3HDTA 4PF1A 2DFLA 3RYHA 2X22A 1M1XB 1KYWA 1FUYB 3STXA 2J30A 2EJCA 3HKBB 3CNQS 4E1AA 3TX6A 3DLTA 1M8JA 3KKMA 4NS1A 1H6CA 4WLVA 5TPWA 4BNLA 3CX4A 3GT4A 5DCYA 4O2LA 3VI4B 4DR1B 4X6UA 3ANLA 4UNSA 4PGGA 3DW3X 1VCNA 4U39A 2QLBA 3I01A 1J0AA 4YMWA 1U1IA 1XZKA 2BI8A 3T5MA 3OC0A 1ZD9A 1ZCAA 3L93A 1Z0FA 4FINA 4IP0A 4FKMA 4EP1A 2WINI 2RB4A 1CTQA 4W9RA 2C4NA 2JCGA 4ZCSA 2I6TA 1CIPA 1I0IA 2Y93A 4JBNA 4EL0A 1JDBC 1R6TA 4JELA 4C06A 3ADKA 3E5HA 1E9FA 1CY6A 2BZ0A 5DNDA 1JDUA 2D62A 1NUQA 1NYLA 2FG5A 4X1YA 1T91A 5IC5A 1EK0A 3V8PA 2B0CA 4X97A 2Z4TA 1Z0AA 4RJJA 5C35A 2BN4A 4HH4A 4OQFA 1VKHA 2YVLA 4O4JA 2DPGA 1MABA 1EBFA 2Y2VA 3I8OA 5B3AA 5EJMA 3BZBA 3VC2A 3EEQA 2WP8J 1GPUA 2PE5A 4KZKA 4QFDA 2RJNA 3ITEA 4GM1A 4R8VA 3EVCA 5FAKA 3DL0A 3SM3A 1VG1A 2C2YA 1X9GA 4X6LA 3WHKA 2OBMA 2PEYA 3C6XA 3EG9A 1T1JA 2AZMA 3F2VA 1QJ4A 3HY6A 3N6VA 3OZGA 3QLUC 4D8VA 4IIBA 2O8DB 4R8MA 2ZWPA 2Z5FA 2EWMA 5AT1A 2PGJA 3AP3A 4EDHA 2VJOA 4PGMA 1T5IA 2C5AA 4BO7A 1I6WA 5AK0A 1S3IA 3DM5A 2AFIE 4AFNA 1I7NA 4Q9IA 1ZJJA 1FQOA 5AI0A 3AI2A 3VR4D 5J63A 1KDTA 1XB2A 1GSOA 2WJYA 3IHKA 3MCUA 2BTEA 3IJPA 5FBHA 1J22A 5FPPA 2AUTA 4M7RA 5LMCA 5F77A 3ZXUB 3W8NA 1KKUA 2EKQA 4ROTA 3PBKA 2GK6A 2QV7A 3IUMA 4BQSA 2Y27A 4BZWA 1VHQA 4KXMA 5JQGF 1DUVG 4XGQA 1M74A 1OKKA 2ZDHA 2ZJ3A 3GCGA 4NFHA 1PYGA 2VCEA 2PFGA 3IVMA 3J7TA 1EFKA 1DHTA 1V8DA 3AQIA 1W2WB 4HN9A 1AZTA 3KL2A 1W5EA 3KZ1E 3QVGA 5JD6A 4KACA 1YB2A 1BVHA 1W4RA 3CNHA 1Z7BA 3IAHA 4RTRA 1PRYA 2QE7D 1L4NA 5KTSA 5LZ4A 4EGSA 2F17A 3UXYA 2ANCA 1HDZA 4AJ2A 2XYQA 4UDOA 1EVLA 1G8MA 2R97A 3HKEA 1ZO8A 2ATVA 3L7CA 3RBVA 3C1OA 3JY6A 3VZDA 2CL5A 1YB4A 4KYTA 4EO7A 3R6LA 2BHRA 3GJ6A 2QD4A 3I9LA 1EAMA 2NM0A 4C0QC 1S7CA 2WPNA 1U81A 4RNDB 3I2JA 4YQEA 5C8DA 5AJUA 3ELUA 5CDTA 2JD2A 3CPEA 4QBTA 4G65A 2E6KA 3BXGA 3GRCA 3LUKA 2E6UX 1U99A 3T61A 4WL0A 2PD3A 4X00A 1NQUA 2F48A 4ESOA 2ZROA 3A9VA 4UM7A 4FEAA 1NRXA 1XZPA 4AJJA 5DTEA 3R1IA 3C5HA 2DPYA 4LWQA 4GI5A 2RHMA 5EFZA 5ARDA 4YRMA 4PLPA 3JYHA 2B94A 1SQ5A 1U4OA 4FYKA 4ZCQA 2EV9A 3ZDEA 5B1EA 7REQB 3AY3A 3FYUC 2J9XB 2FRXA 2ZQYA 4KPFC 3A6KA 2R4TA 4Y18A 3PQCA 4WZAE 1EVIA 2UZ1B 4UEOA 4KR9A 1N6LA 1XZ8A 2R00C 2AVNA 2XYRA 1XK6A 1DAPA 1ZJ6A 3DZ8A 1GQFA 2OYRA 3UEOA 2DUUA 2J9FA 2O4CA 2A1UA 2WTXA 3CLRD 1F8UA 2ZAOA 3CONA 5EPEA 1SKMA 4QU5A 1Z2AA 3RC7A 1SD5A 4DQKA 2AF4C 2E4AA 4WSOA 3FHLA 3HSKA 2ZBVA 1Q19A 4H0FA 4XCVA 1R6DA 3ORHA 2NU7B 3ZEAA 4CDMA 1UC5B 3CE6A 4ZVTA 1K0UA 2V7UA 2VPQA 4QM7A 2XTNA 1P9WA 4PGAA 1CNMA 3PT9A 4ZDJA 2ZJFA 3U7IA 4YAUA 3LCRA 1T2UA 3QE3A 2OL4A 2OCGA 1VLJA 1AHHA 4OYLA 4WY2A 3DKPA 2FUG6 1U8EA 2UYQA 5JU6A 4ZTZB 1UXIA 1WXGA 5GY7A 3WX0A 1G2OA 1T15A 2GPBA 3WGIA 2IJGX 1TK2A 1G6OA 1NBOA 1EB9A 4BFXA 2K2QB 4ZYXA 4WDRA 1SKAA 3R40A 4R4JA 4R1UA 4BECA 1M7GA 2GZHA 1S4MA 3A11A 1G3MA 3O26A 3OMLA 1SVKA 4O2RA 1N9KA 2JLBA 5JPDA 3QVOA 1BEZA 2GWRA 3DJFA 1M1NA 1G6KA 3MBOA 4BMCA 4LBYA 2O1EA 4K46A 2WJGA 3P9IA 4ZRNA 2FPIB 2G07A 2OCPA 2PQMA 2Z8YM 3ICPA 3FI0A 1VC2A 1VKZA 4Q7MB 4TRMA 4DCCA 2GZDA 5J2UA 3BHNA 2W48A 4S1TA 2AYXA 5K3BA 3CXUA 3A26A 1PBTA 3IT3A 3V4ZA 5TV2A 4ZJUA 2JGJA 5FI0B 4UTOA 4TMFA 1Q12A 4G63A 1NVTA 2G1UA 2IPXA 4L3WA 1WY7A 5LZ7A 3U44A 2XZOA 5IM4F 3CX7A 3S2GA 3SN6A 2Y68A 3B2NA 4AY6A 3CX8A 4WLEA 4RACA 4JSYA 3WIVA 1VMAA 4HB0A 3U6BA 3AVVA 4ZVOA 7YASA 3FDXA 4EW2A 3DUWA 1EE9A 5BNIA 4TMZA 2QJOA 3LQ2A 2AOUB 1KEEB 3FBTA 2X58A 1U80A 5B57C 5JY1A 2JAXA 4EA7A 3NU1A 3A37A 4BBPA 3PFFA 4RVHA 4EZEA 4H0NA 1QTQA 1P44A 4WUTA 3RVJA 2XW6A 1QHFA 4RNCA 1UDRA 1EE1A 2F43A 4R3UC 4F3NA 3ABIA 3JPWA 2WJAA 2OVBA 3BKXA 4S12A 3WAKA 5B58C 3FR8A 4WA8A 1PJSA 1PJ4A 2B78A 3K7EA 5DYNA 2IWHA 3E7FA 4DWOA 1J99A 4UCXA 4ZMSA 2IEYA 1KPIA 2Q0SA 2ZULA 4WZ6A 2NGRA 3A9WA 3CLTC 3NLLA 3P9SA 4V0OA 5KYYA 2IDKA 2AC2A 3WIUA 3V2UA 2O8BB 3ESBA 5EIEA 1C0IA 2CEAA 1PK9A 3ZKWA 4RMNA 4R1QA 3H9EO 3O2NA 1U9IA 1MFPA 3Q6NA 3SXUB 5HTOA 2PSEA 2WYVA 4M1OA 4QUGA 3WIBA 4DABA 4YROA 3AVYA 4I50A 2VHXA 5HIKA 2C9ZA 2HA7A 5AMXA 3UAWA 4R7ZA 3DBRB 3Q7TA 1ZW1A 3JQDA 1G7CA 1XQYA 2GPTA 4CEIB 1W9MA 4L72A 3TG2A 4FYHA 2PUHA 1FXWF 5DN6A 3PFIA 2GD0A 2P6OA 4E21A 3GJRA 1CC1S 4YJDA 2JLWA 2W2QA 1H65A 1IVSA 2YFKA 1N33B 1L4EA 1L7BA 4KLZA 2RI0A 1C81A 1DT3A 1USIA 4G56A 4RZQA 1H1TA 1P61B 4ZO7A 5DRTA 3OZTA 3ZWXA 2JIBA 3B1KA 3AX6A 3EULA 3C1UA 3KT3A 1X8KA 1UL1X 1YI0A 3BJMA 3D7SA 3N28A 2FYTA 4DR3B 3AL0C 3FZNA 3OJLA 1T2AA 2ADMA 8MHTA 2K87A 4JLWA 5DO9A 4D9GA 1OB5A 4TN5A 2PQ0A 1S9DA 1FTQA 2JEZA 1GCAA 4WA7A 4LSGA 5GZ6A 3S2SA 2B8NA 3WL4A 1SB8A 1DC5A 2Y2UA 4MWCA 1ZA2A 1PK8A 3KAQA 3O2SB 3TD2A 3TRDA 2BMWA 5JD5A 2XKAA 4A0GA 4AP6A 1UJNA 1IN5A 1ZNXA 4B32A 2BFFA 3ETGA 5FA6A 3W2TA 3KQNA 3K09A 3KHTA 2FAXA 1PJ8A 1ARZA 1SBZA 2R6CA 2VRCA 5BWOA 4YRJA 4J0HA 2P67A 2RJOA 5BQPA 1XZDA 1N92A 3SG0A 4PZ9A 4YRKA 3IE2A 1UEXC 3FCCA 1JAZA 3ZCQA 5EGSA 1GILA 3BWXA 3EPRA 3JU3A 3RTBA 1IY0A 5ERYA 5CVEA 5DNYB 3IE0A 3NHKA 2PT5A 5KYXA 4M6WB 5AVOA 2AC7A 1V5WA 3KSDO 3O3NB 4FD3A 4NPAA 3KR9A 3RRFA 5IM5A 4MB6A 3EQ2A 3PYXA 4IX9A 2I55A 4BKRA 1L8OA 1MQ9A 4B3IA 3FA2A 2PS9A 3A31A 1PO7A 2CF6A 3PE4A 3ESAA 5TRTA 3CVWA 1Y6ZA 2DHQA 1SD1A 4A6PA 1DO2A 3F3YA 4KVZA 3VH1A 5LZ9A 2WMDA 2QUAA 3BH0A 2WWFA 4RV5A 1FU8A 3CR3C 5IAJA 3KQKA 1TIBA 1KI4A 4JR2A 5AHXA 4WFQA 3TVYA 3WISA 3VJKA 5C8YB 1GFIA 2PUVA 1E0KA 1ZDMA 3LUHA 5CXSA 5IVHA 3DB1A 5B4UA 1GXSB 2JGDA 2FEWB 3U1VA 4DLNA 1CR1A 9ATCA 4IIHA 3IKTA 2BCJQ 1TVEA 1AF7A 3ET4A 1AK2A 3MWJA 1MG0A 3OWOA 3MJRA 4L9SA 3USES 1CS0A 2J33A 3PGLA 3J80A 1HG0A 2IP4A 4QGAA 3MF4A 1VDZA 3QEBZ 4PYKA 2HHCA 2P65A 3LOQA 1Z15A 4IO1A 1ADJA 5AW2A 3UQZA 1SQGA 2OBXA 1V7ZA 2ODBA 3D8RA 3QP9A 3ZKAA 2HDOA 3L7YA 4CVNA 4TXMA 1R88A 3JAKA 3LZDA 2X0IA 2G06A 3R7BA 1DXHA 4PXSA 4LMBA 1KVSA 2EZUA 1PTJA 1Q74A 2MSKA 1NWHA 4WECA 3U9LA 2L17A 4AG6A 1KSHA 2CUZA 4R83A 3E5NA 2J3JA 4MA0A 5HUJA 2JAPA 5C9ZA 3CLSC 5A9TA 2LCFA 3NHPA 2ZYRA 4HTFA 3OUUA 2IYXA 2XLBA 3I8SA 4L8GA 4QNNA 3RGGA 3ITKA 3KPWA 1DJPA 1ZEMA 2YHIA 3D2LA 3LPDA 4ER3A 3RIYA 4DV3B 1O0BA 2DERA 2IXGA 1EE2A 2ZJ4A 3EY4A 3NRBA 3O9ZA 3J7AC 3RF7A 2FXVA 3MWEA 4OKNA 4XVHA 1STOA 3I5AA 4J0KA 1GLGA 3ZQJA 4ODIA 3ZDXB 1ZUNA 3OPXA 4LVCA 3SQDA 3OD5A 3KBBA 5EWJA 4ZGGA 4J7UA 1JEYA 1Y8CA 2YDYA 1KI9A 4Y2HA 5CVUA 1B0PA 3S1AA 5U4QA 1C8VB 1CJVC 4OP2A 1OF1A 2XX3A 3NCHA 2HX1A 4CL2A 4EA6A 2QLFA 5KIAA 1ICEA 2NZXA 1FK8A 2YASA 4IHJB 5JT1A 3I4CA 2J5XA 3HL0A 3RIGA 4IZHA 4F72A 2A4MA 1KEUA 4ZQHA 1AV6A 5I7WA 3GFPA 2Q3DA 4YP0A 3V48A 4HDRB 4J7CA 2M1XA 4XQGA 3RVKA 4AZVA 1VYUA 2KI5A 3P4YA 3GEEA 4QODA 4WGFA 5D86A 3VR6A 3UBMA 3HVHA 2HCJB 2D4AA 3CUKA 3BICA 2CBXA 3DAFA 1RC8A 4MVJI 2CNLA 3HYLA 4TV9A 1NYQA 1A9XA 2DUWA 2VHZA 3MCZA 3AU9A 3TKYA 5ILOA 1UPFA 3WJAA 3R6TA 1SD2A 3ENQA 2GPJA 2KBFA 1DKOA 4G5FA 3T3HA 3T41A 2I1LA 3DFKA 1NT2A 3ZY3A 3MA0A 3MFYA 3QM1A 4YJ2A 3KB1A 3BN3A 3PGA1 4ND4A 2BI7A 4AXBA 1EEXB 2IDJA 2Z30A 3ONFA 3QYFA 2WJHA 4B3BA 4RS3A 3B85A 1UFQA 3NBFA 5CITA 4OAQA 4DSTA 3ZH2A 2VI5A 2EIHA 3W4JA 4MQUA 4Q9DA 2QVCA 4PG5A 1XZGA 4IDPA 3RM3A 4S05A 2J0VA 3O4RA 3OLCX 1F12A 4C22A 4QPZA 1OYWA 4LQLA 4MS3B 5HXAA 3FOEC 5HUQA 5AKZA 2PLNA 3UJBA 1G8YA 3I6MA 9GPBA 2GEFA 4RORA 3D1LA 5KREA 3DO8A 4MJ3A 4X20B 2IH4A 1V2HE 3VNQA 1IEQA 4DJAA 2G7MC 3L7DA 4UVIA 1X1RA 3D4NA 2P2LA 4BWVA 1KEPA 4W7HA 4EQZA 3CW9A 3C1AA 4US2R 3C3WA 2QLJA 2XUFA 1GQ2A 4RK1A 1G6Q1 2H1CA 4A16A 4DCGA 3FMIA 4GR9A 2LNDA 4XD2A 1E18A 3T1YB 4KX3A 4EPRA 3U56A 1FP7A 2VDRB 1GITA 4HUJA 4LMPA 5EIBC 2KW5A 1M2OB 2N1BA 2P2ZA 1E3WB 3NTOA 1U0HC 2BR4A 2AQIA 2HT1A 1WKCA 1GL3A 2FEPA 1VPDA 4JYPA 5LWHA 4P34A 3L8ZA 2FTKE 2VUSA 5LYJF 4O4IF 5J2UB 4HBZA 4MR8A 1M6NA 4B4VA 5JC8A 1KEEA 2QTTA 3BK7A 5L3RA 1KMIY 2KWIA 4PO8A 2E4VA 1RJWA 1A7JA 2GPYA 3ITNA 3MHPA 4IVPA 4B79A 5JZ9A 5L3QB 2HQBA 2FW7A 3DV0B 1LZKA 4PZDA 1DKQA 4C3UA 5KUTA 2HV8A 4P4GA 4MKIA 3OQNA 1E3SA 4PLWA 1KEKA 3ZY6A 1IONA 1TCBA 1WP4A 2AEEA 1E9AA 4PCVA 4POAA 4QT4A 1Z82A 1UZMA 2DWUA 2WLTA 2XOEA 3GZ4A 1C4XA 2FFBA 2LW7A 1LI7A 2X0JA 4A0FA 1DOAA 3Q9NA 4YJFB 621PA 1BXZA 4MUEA 4NZPA 5D84A 4JS0A 1YA8A 3IPRA 4AUEA 5IXJA 2V4MA 3BHMA 4D9JA 3HPRA 3ENKA 4MINA 5IASA 2CHGA 5AH0A 4TUYA 4HN2A 3FYDA 5DE3A 2IHUA 3LYUA 3WKEA 1JIKA 3HBFA 1NVXQ 3ONNA 4F4FA 2I2AA 1B6SA 4AJHA 3MGKA 5I4IA 2KYRA 5I4BA 1Z5VA 3QITA 1QYDA 4ZEWA 3A4MA 4KKVA 5KQSA 3NVMB 5KX5A 1DAIA 4Z1MD 2VYVA 1WPQA 1O8CA 3ICCA 3C70A 4MAFA 3G8YA 5IKEA 3HEMA 4X45A 3U49A 4BVGA 1N2BA 1WL8A 1ZM4A 2IZ6A 3IQGX 1TJ5A 4QX6A 2FGKA 3G82C 2QQFA 1KU0A 2ZQ5A 4P83A 4PBSA 1ZNYA 3AFHA 4ALLA 4Z3DA 2BTOA 2PTGA 3CJTA 1FF9A 2AE2A 4Q12A 1I24A 3HHPA 2V7BA 4GICA 2BGMA 4FMCF 2ODPA 4GPZA 3VR2D 3KT0A 1Z5NA 4ZA2A 4PC3A 5FPSA 4HLQB 2M6SA 3O93A 5FULA 2HA5A 2YZKA 2I78A 3R24A 1QMGA 1XJQA 1MXHA 2E4ZA 5ALSA 3TRJA 5JVDF 1EJ6A 4KN6A 4FGLA 1EUDA 1E2FA 2OM6A 3TIGA 4I5EA 1J9GA 2YYSA 3HBAA 3M0EA 5AFSA 5LSAA 1A04A 3AWDA 1E2JA 3TGLA 5AW5A 1GVHA 4JC0A 4ZTBA 1FW6A 5L6MB 3HS3A 2NO7A 1JILA 4F2WA 4KX5A 2OHXA 4OJNA 1NVVR 5M3BA 2CB0A 2ZYVX 1OBOA 1SEPA 3HCCA 4GNKA 1HURA 2BFFB 3CU5A 3IB6A 1A97A 4KLAA 1G291 1EBBA 3S81A 2AHRA 1DU4A 1U8YA 2HUPA 2P5YA 2P9EA 2W2LD 2ECOA 2Q4RA 1ORDA 3UWOA 5IZCA 1J00A 3B70A 4C7OA 3UJ9A 3CNNA 1CY2A 3NM5A 2QU8A 4UHHA 2E4UA 5EUMA 1G21E 1T24A 1UBKS 1Y7LA 3N2KB 2X1MA 1WOMA 4KE9A 2QX7A 4RPCA 3L7NA 4CPDA 3CIOA 5J2UF 5TPZA 2HU2A 3IJ5A 3JQ8B 4OAOA 3VKVA 2HA6A 6AT1A 2BGGA 2JIDA 4BPRA 1L5YA 3LU1A 1L4KA 2UXBB 3VSBA 4FXPA 4R9SA 3K0FA 5EXTA 1SPXA 4R1LA 1Z7EA 4X3CA 1YGYA 4R8SA 5K3SA 1GZ6A 1WXFA 5TMEA 3T6KA 3CHYA 4LE2A 2XVAA 4KO3S 4DDUA 5FH9A 1MAWA 2AVDA 3LXMA 2Q4DA 3JVIA 4G4JA 4EGJA 3ZLTA 5JLJA 1SUEA 2UAGA 3F98A 1MU0A 4ZT6A 3BE8A 2R6ZA 3H19A 5TF0A 3TCKA 4DA0A 3DVRX 3IVRA 2J9ZB 4C6TB 4N49A 4NXMB 1Z3IX 3AVTA 3L7MA 3EVAA 3R2JA 5FBZA 2YZNA 4AYXA 3C8UA 2ODWA 1N9GA 4PNPA 3U1TA 3ZBPA 2YTZA 5CD9A 7ADHA 4RMIA 1NY5A 3L02A 1MGOA 2QTVB 3RDPA 2J59A 3HWSA 1XTTA 1BYIA 2B82A 3DXXA 3R6GA 3OZWA 3GYGA 4LRUA 4URXR 2FP4B 1NTOA 2ST1A 1DPFA 4Q1BA 5JNWA 2QD3A 3MPOA 4NDNE 4R71A 1YA6A 2YHUA 3W3AA 4LZZA 3BTOA 3K70C 1G1AA 1BU5A 5FP0A 1K4YA 5T4EA 6REQA 2WKQA 3U1BA 5LL6P 3OZSA 3VMMA 2HHHB 1OJLA 1PX2A 5ULLA 5J47A 3GFQA 1XMPA 3LQYA 1KY3A 4JEHA 3VZPA 2AFHE 4QTTB 1W94A 3L7OA 3HTXA 4TKVA 5JJCA 1JNYA 1G2IA 3GELA 4IUBS 4LY9A 3ZBTA 5E3IA 1Q0UA 1W4BA 2P0AA 2RCYA 3A3YA 2HTFA 4LGYA 5EPOA 4JXXA 2IKSA 2CK3D 2IOYA 5T4FA 3KB2A 2D2EA 2XKKA 2NMVA 3RNLA 1C3VA 4BC0A 3UCEA 2GHIA 5DF1A 5EVJA 5EINA 4DG9A 1DBVO 1GKUB 1COWD 2LWIA 2QGNA 2JCVA 2VDKB 3IKLA 4QO7A 5F78A 3RU9A 1P19A 1SUPA 3SKYA 1T5TA 2IIBA 2OLEA 2W2PA 4RAQA 1N1DA 2F3QA 4ZP1A 3C7AA 1AQYA 1E58A 4OQNA 2GBPA 3NTXA 3FHOA 4WCFB 3EDOA 3PTZA 3CZ4A 2J46A 2V7PA 4TKUA 3SHVA 2OXEA 3VHXA 3WLKX 1ZN2A 2VAWA 2ZWVA 3P2OA 3Q1KA 1OWLA 4DUGA 10MHA 1BTOA 1YQDA 4ZT7A 4C03A 3B7GA 4UPVA 1MIOB 2RIPA 2A35A 4P80A 1Z28A 5IS2A 4DXHA 1LWOA 1V9LA 3FCOA 4AUMA 5A04A 3TQSA 3ZE6A 4JUAA 1BXGB 3L07A 4GSYA 4IHJA 1ZGBA 1GZVA 2D74A 3NDIA 4YP6A 3ZE0B 3BSFA 2IUEA 3EAFA 1AUPA 4AZTA 2BBWA 4J7AA 2ZZNA 1GPYA 2WA2A 4IDEA 1W34A 3MTAA 3NT4A 1RBQA 2P9JA 3FPHA 3P9QA 3ZTTA 2M98A 4ZI7B 3LX5A 1JJVA 2ZTSA 2IZZA 5CM8B 1ZS9A 4RV4A 4EYEA 2ZIFA 3GXBA 4AMVA 4HYQA 3QE9Y 1RM5A 1YMUA 3V32A 5BUCA 4FQ5A 1VMIA 1Z37A 2EQBA 5DM4A 2R79A 2CZGA 3BBPA 5JMPA 1K0FA 2PMFA 3T15A 4MXDA 3FETA 2OVFA 2WOOA 4LYFA 1A8IA 1MW9X 1UDAA 3PUZA 2FZEA 2Y4NA 5GADl 4HNSA 4HNTA 5TVGA 2IDZA 5JQGB 3F5FA 4RVGA 3HZOA 1UM9B 4HNGA 1GNPA 1H6AA 4FLEA 5CM9C 4PICA 3KYDA 3MYRA 4B33A 2ZIAA 3MGBA 3WO1A 4KBYA 1ZM7A 3HL4A 1H9CA 3PNBA 4IJUA 4S35A 2V7QA 4GPIB 2B1RA 5DNAA 2PVCA 1ZD5A 2YOHA 2YYAA 4XD7A 2C82A 4KPYA 3X43A 2PD4A 2Y0DA 3T12A 3UFXA 4Y1GA 4E7PA 2H4JA 2Q1WA 3Q10A 2OAP1 1W1IA 4KFRA 1HI9A 3WYNA 1MAAA 1X87A 1UKEA 2X5OA 2OO3A 3SBDA 3TB6A 4DLLA 4Z2AA 3MTDA 4WOCA 3WGQA 3DL4A 4DKXA 1RHKA 1XFDA 1UMDB 2NUPA 1PZGA 2HNBA 3IIJA 5BUZA 4Q7QA 1Y5RA 5KQMA 1E5TA 3RIMA 2R44A 4DANA 3NFRA 2GCEA 1JHYA 4PC7A 3Q2OA 3V80A 1O94A 5HIMA 5IJ0A 1S8OA 2OECA 3CZPA 1ZK4A 1KVTA 1XRSB 5BWMA 3AHJA 4OXQA 3ZWKA 2YVUA 2VH2A 3TE6A 5BSHA 2VXOA 4B3FX 1JHRA 1H2YA 4KOEC 1ORRA 3ZQ4A 1I1NA 2XXBA 1JB1A 4OMDA 3B53X 1XMIA 1OI4A 3FUUA 1PWYE 3IRVA 1CFZA 1D1SA 1I4LD 2QK4A 4S2EA 5JJKA 1PI3A 1XD8A 3HCPA 1QHEA 4IPTA 2ZSJA 1VRVA 5G53C 3RHFA 5IVKA 1O95C 1J2EA 3GVPA 2G25A 4LOLA 1HDCA 1ZM3A 2B3DA 2F8MA 4N5IX 3ZC3A 1RKBA 3SEZA 1PZXA 4XYMA 3UMRA 3GJ5A 3RU2A 4FFOA 2GX6A 4YV7A 3K9BA 6LDHA 2GARA 2OP0A 2QTAA 4QFBA 2BYTA 5E7JA 1Z16A 3W1EA 2HJRA 2AZ4A 2BMVA 4G0PA 1V5EA 3TMAA 3KXKA 4GXQA 4WOPA 5KWSA 4GUAA 1VJRA 3IP3A 5TPWB 1I80A 2ODQA 1L8LA 4BO3A 3PFKA 3LWDA 1V7CA 1Z6AA 5BN1A 1I4EB 1Z63A 4JC5A 1LVGA 3BHJA 1RLUA 1PT9A 1K6EA 2PZ8A 3V8RA 1ENZA 2WUFA 3W06A 1SBQA 2J3HA 4RTSA 3HO6A 5KYVA 1NMZA 1VKJA 1Y1SA 4FDUA 1CU1A 4IOJA 3VR4A 1P7ZA 1ESDA 1R74A 3ECCA 1QAMA 1U02A 1C7EA 2PLFA 3DOIA 4PLZA 1D4ZA 4UU8A 2D1RA 1K7CA 2WSSD 2XVMA 3DM9B 3SJ7A 4E22A 4NDZA 2V98A 3QBEA 1SCAA 4D4GA 4NRDA 4DAEA 2QRVA 1VTKA 4OQDA 2XCUA 4PFSA 1VBNA 5HBGA 4CR7A 1XYVA 2FX2A 4FCTA 2P4HX 4U3JA 5DU2A 4IV8A 3M89A 5LJIA 2P7IA 2XGGA 1H2FA 5HGXA 1FLNA 1QBKC 1EXDA 4NBLA 2B8JA 4HLUC 4PHGA 4OKSA 5EE9A 1LGYA 1X86B 3P0EA 1I4DD 4YYEA 1R5NA 3L84A 1CZOA 1WXXA 1E7SA 3AU8A 3FRJA 1A4XA 2PMCA 2QRZA 4AJKA 2BGIA 3RRMA 4CRWB 4DDKA 4D0LB 4YRAA 3DMHA 5LXTA 2I76A 4J0GA 4C6TA 2W2OA 1EHYA 1HT1E 2HH9A 2W0SA 5EZSA 1GNSA 2IY7A 3CX3A 4EUKA 4TYWA 1M72A 4LY3A 5EJ7A 3HGQA 2RH5A 4HAUA 2GHRA 3L9WA 1U0TA 1H2HA 3PITA 2NO9A 2QP9X 4ZIRB 1TU4A 3ZOKA 1KJIA 4BVJA 3C5WP 3QMWA 4F9TA 2KLHA 2MSWA 1TTQB 4P3PA 2X4IA 3H7IA 4KYIB 4X92A 5A3QA 1U9ZA 4L76A 3L1HA 2BIFA 1EG7A 1VHLA 1GPAA 1CEQA 5H0IA 3S70A 1J25A 1ENOA 4F1WA 2CVHA<