3GJXC

Crystal structure of the nuclear export complex crm1-snurportin1-rangtp
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
171
structure length
171
Chain Sequence
VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGLEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Snurportin-1
publication title Crystal Structure of the Nuclear Export Receptor CRM1 in Complex with Snurportin1 and RanGTP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 47
structure length 171
sequence length 171
chains with identical sequence F
ec nomenclature
pdb deposition date 2009-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3gjxC00
4M1SA 2OFXA 4LYJA 3O8RA 2A78A 1UBGA 2CMKA 1E9AA 3HU1A 2ANCA 3KX2A 2V1XA 1XEFA 5EP1A 3RANA 4B71A 3ZD6A 2EYUA 5AUNB 2GCPA 4HI0E 2P6UA 1ELOA 1R5NA 1EGAA 1TQ6A 2QY9A 4NPHA 2R6FA 3QPVA 3EZ7A 4IDPA 3RC8A 5LBIA 3GCGA 3REGA 4OI1A 4HDOB 4QGAA 2GJAA 1RPZA 1OH7A 3VNVA 2R6AA 3F5FA 1T9HA 2WMNB 4LC0A 4NCJA 1KI7A 1VKJA 2AL7A 3BOSA 3MWKA 1CF4A 1LS1A 2WWGA 3LBHA 1JR3E 5JHGB 4P3YA 1S2MA 4OL0A 4D25A 2GZHA 5J4KA 3WNCA 1W4BA 3U4QA 5KTYA 3MSXA 1E0AA 5KO2A 5JJKA 1DVRA 2O52A 3B85A 1E9EA 3AVUA 3ZVRA 2IT1A 2WWIA 2VBCA 4C2UA 5C4GB 4EPVA 4AYTA 3BH6A 5SZJA 5E7IA 2ZE8A 3A1VA 2C95A 1JI0A 2ZI3A 4PHFA 4LRWA 4GMDA 2ZETA 4W9MC 2B8WA 5AUQA 3SC3A 4B3XA 3U4QB 3OHMA 4TYQA 4YC7A 2GF9A 2FSGA 3NEYA 1XNJA 3CH4B 2GXQA 1OFHA 3LLUA 2OUKA 3NIBA 3ICEA 4OHYA 1JB1A 1R2QA 4AURA 4Q4AA 1DAGA 3K0CC 3C16C 1U0JA 3BC1A 2BMEA 4IVPA 1W4RA 1FUKA 2FA9A 2ZRHA 2DPXA 3MRSA 1VYVA 121PA 2N46A 3EW9A 1II9A 1AQUA 5CK5A 4E09A 1ZU4A 4OQXA 3OFND 1IN5A 1Q44A 2C9CA 3GEEA 4G0NA 4NCNA 4Q4AB 1XCPA 5DISB 2VH5R 4KVAA 2GEVA 1Q20A 1OE0A 4OI4A 3IDQA 1G19A 3I1FA 2F3RA 3EWAA 1AS3A 1IAQA 2RGEA 3LFUA 4Q01A 2IYTA 1OHHA 1CEEA 1OW3B 3VKWA 1YU9A 4MYTA 1ESNA 2QUZA 2WWXA 2IS4A 4P4UA 3T5GA 4DHEA 2QA5A 1UPTA 4UJ3A 5JBQA 4GMXA 3U6BA 3NWJA 2V7QD 3F3YA 3R7WB 1F6BA 5G53C 4Q66C 2GHIA 4C2TA 4QM7A 3KQNA 2YJTD 1TNDA 2X19A 1M7BA 1TEVA 1P73A 4IEIA 2FH5B 4IXNA 4FMDF 4GOXA 4A8JC 3SQWA 2HDNB 4DCUA 4NCIA 3LX5A 1T8UA 2G0NA 1TQ2A 2NGRA 2LKCA 4GNKA 4TL6A 3PITA 2WIAA 1X8KA 4PQFA 4DLZA 5GADl 2IS2A 4BFVA 4QM6A 3K0FA 3W6NA 1GNPA 1NKSA 3LXXA 3B1XA 3KFVA 4PAQA 4L5BA 4V0ME 5F9FA 1HEIA 2GBLA 2GAAA 3DDCA 3B1WA 3ND8A 4I1OA 2GJSA 3B8HA 2ZSDA 3T1OA 1AZSC 1DAKA 3RS4A 3THXA 2W83A 2IBMA 1KIMA 2ZS7A 3K0FB 1X6VA 2GXSA 4ITRC 2AK2A 1T0JB 2PMKA 4TYPA 1P61B 4BWYA 1CJMA 1QZXA 1VG1A 2QM7A 2YVUA 4HAWA 1W1WA 2IYQA 3MMPA 3ZVNA 5DYGA 4B44A 1E1RA 1T5LA 2OLJA 4RZUA 3THXB 2F9MA 3IUYA 3WRYC 4TYNA 2ZAOA 5TXGA 2XB2A 1EFRD 5DHAA 4MRVA 4BRUA 2CLCX 1NIPA 3X1YA 3NG1A 4NTZA 5H68A 3IGFA 5FR1A 4TT3D 4D26A 3VR5A 1SKYB 1KMHA 4C7OA 1Z6TA 5JMTA 2R6CA 1ZMXA 3BB1A 1YR6A 2BBSA 5M04A 1CU1A 2PZEA 3KJHA 3BB3A 3NC1C 4FMCF 3DKPA 4PAOA 4ASUA 4R71A 2OLKA 2A5GA 2V6JA 3SFVA 4MRPA 1UDWA 5SZIA 2BMDA 1KMHB 3SOPA 4UQOA 2ZRIA 4AKIA 1VYUA 1B0UA 5L3VA 2JLSA 2GVDC 2IHYA 4PPQA 4C7OB 4TLCA 4BFTA 2JLXA 2VP9A 5EP4A 2X8AA 4QGGA 3TQCA 5FTMA 3GLGE 1E6CA 1EWRA 4RFVA 1SVOA 2DWOA 1EG7A 3HDTA 1TEXA 2WMOB 1E1QD 3G82C 3HWSA 5CIWA 4XVRA 1Z2CA 5CIQA 4Q7JB 4TMZA 2AKAB 3L8ZA 1KSHA 1YZQA 2Q3HA 4QHSA 3LDAA 2NZ8A 5FPTA 2VA8A 2JJ2A 2FDCA 3A1SA 1US8A 2RGAA 2KB0A 3HP1A 1ZRHA 1G4UR 4GBMA 4TLEA 4URVR 4G3XA 2J59A 1Z0JA 2IEZA 1G9XA 2ZYVX 3OE7A 1BH2A 2WJIA 1KSFX 3KUDA 3AP1A 1FTSA 2EFHB 1EWQA 2N1BA 1YZTA 3AKCA 4M22A 3TNFA 1UKEA 2WJYA 2QE7D 3KJGA 3VKHA 4NL4H 3RRMA 1US8B 2MSDB 3UXMA 2IYYA 3MFYA 1Z83A 3I62A 4TZ0A 5D3MA 1P2TA 3L8YA 4FD2A 4IOKA 2CL7X 1JECA 4JYCA 3ZGXA 1QDEA 2AR7A 5AWFC 1DG3A 2HLDA 4U7DA 2X77A 4F92B 3UMFA 3K70C 1NNEA 4LZZA 2ZSBA 3IO3A 3OAAA 4G5SA 3IQXA 3LRPA 4PHGA 1SGWA 5D3MB 1DAIA 1GL6A 1HTWA 2O8EB 1XFAA 1YZGA 3I32A 1P62B 3A1TA 3B9PA 3C41J 4KSBA 1XPUA 3W6PA 1O87A 3T06B 1W2GA 2IEYA 1Z29A 2W6JA 3F0TA 4JMPA 3L2OB 2XB4A 3RS0A 2JDID 4DWJA 4E03A 2CLSA 4C0LA 4NZYA 4F93B 5TVKA 2PMDA 1Q1ZA 2ZJBA 4QKQA 4MRNA 1MABA 4A6PA 1WBBA 1IN8A 2WOJA 3MWJA 1D5CA 3NKVA 5FTKA 4BLOA 3C5CA 3SJZA 4ACAA 4JLDA 1GILA 1P3JA 5F2EA 4MDFA 4ZCIA 3BAFA 2WBLC 1M2OB 2IS6A 3GJXC 3IHWA 2FSHA 1MABB 3P4XA 4C0AC 5IHPA 1UEJA 3CF2A 4TL9A 2ZYUX 3SHFA 1M6NA 3TSWA 3TAUA 4MGKR 3CW2A 5JJIA 1VMAA 2JLRA 4QGHA 4WXRA 2ZREA 2IUTA 2P67A 4URYR 4Z8YA 3AKYA 2Q9CA 4Q4LA 1KSGA 2QP9X 3TW8B 3SS8A 4Q47A 5B58C 2BV3A 3DO6A 1DAFA 1JEDA 2Z5FA 4GP7A 3U3OA 221PA 3QQ5A 1ZJ6A 3UWKA 2ZR0A 2JIZA 3K9HA 4URXR 2LWIA 2X2FA 3QENA 2REOA 3NXSA 4G5RA 4O3MA 1QVAA 1XU4A 1W5SA 5KOYA 4WBSA 3HU3A 4JLMA 4B6EA 2JLZA 2YOFA 2V1UA 3K9NA 4FW9A 4KJZA 5EXXA 4JLBA 5IRCD 2ZJAA 4MDEA 4HAYA 3U44A 1SHZA 4UKDA 3X1DA 1Q3HA 1BOFA 2JJ8A 1F60A 4QJ3A 2DY1A 4Q48A 3NTUA 1NVVR 1FMJA 4KBFA 1DG1G 2JASA 4LX0A 2O8FA 2CCJA 1COWD 1VHLA 2JLUA 3A8TA 3LWNA 4TLDA 5EQTA 1G3IA 2A2ZA 2FGKA 3B6EA 3B78A 1SVKA 5G3YA 2AHOA 2OCPA 2ZUBA 5CYOA 3ZQJA 2QAGC 1GRQA 3GLFA 5FPYA 1XMJA 4HAXA 3MUFA 2QI9C 5JCPA 2UZ3A 2EFEB 2ZRNA 5KPJA 2NMVA 1DAMA 3TR0A 3UKDA 4DB4A 4I1SA 4UNSA 2O8FB 3CRVA 2PLFA 1XZPA 2Q9AA 4MKIA 4AKHA 1IBRA 1NF3A 4Z51A 3U6KA 4PPFA 2H17A 3VAAA 3AUYA 4BFUA 3AVYA 5KSOA 3E1SA 3BB4A 4L8GA 3GLFB 2WKRA 2PT7A 4BEBA 1WE2A 5EE1A 4CIDA 2AWNA 3PUXA 2ATVA 2OE2A 1VYTA 4R2IA 1Z6AA 2D3WA 3BXZA 1ZD8A 4A1FA 3LW8A 3C15C 4A36A 4JLPA 2Z6VA 4J0QA 4O0MA 1NRJB 1SKYE 1C1YA 1Z3IX 2ZE5A 5IDVA 2XNDD 1G8YA 3PVSA 1KY3A 3T5DA 3DL0A 1E2GA 3U7FB 3PUVA 2ORVA 2BJWA 2J45A 5KYKA 1ZNWA 1GTVA 4HZIA 4PQYA 3NBYC 2ZPTX 4JLNA 1QHHA 4TLAA 4DVGA 4F7WA 3E70C 3GP8A 4R9UC 5FTNA 1XWIA 2FSIA 4C0SA 4ON9A 2KBFA 1JR3D 1RW4A 2CCGA 2Z83A 2QG6A 1NSFA 2W2VA 3V4RA 3RVBA 1SVWA 2X1VA 4B48A 2J0QA 1WQ1R 3WYGA 1T4GA 5EP3A 5E7MA 1QHHB 4DB2A 1AJEA 4IW3B 4DCTA 1ODFA 1P7CA 2N42A 2QMHA 2IA5A 3K70D 3EC2A 4M9XA 3FKSA 1TADA 4EKDA 3CH5A 4OHXA 4KODA 3RABA 4KBGA 3SR0A 2CE7A 4JVMA 3CNLA 4KFTA 1BMFA 3TQFA 1W2HA 4NCKA 4QHTA 2VIIA 4Q7MB 2BMJA 2D2FA 3FHTA 2WWFA 2CJWA 2WWWA 3B7GA 4IJMA 1E9RA 4ZCLA 2FF7A 5L8VA 4GZLA 1AA9A 3WMFA 1NVWQ 5GJVC 4EPWA 3EIEA 2OG2A 4RD6A 4RCYA 3LW7A 4Q1EA 1DAEA 3FOZA 4NCHA 2C98A 5BYKA 1UBCA 2P65A 3C14C 3D7MA 3L0OA 4JVSB 4BE7B 2QMOA 3NBZC 3NVAA 1N6PA 4MKGA 1VG0B 2O5VA 1W0KA 2OFWA 4MUAA 3WMEA 3IIKA 1LTQA 4XVUA 2ZE7A 4KO8A 4B3FX 4LPSA 2CJWB 1E0JA 1X8LA 1GSIA 3FFAA 4M4SA 4PXAA 4BFYA 4DT1A 1AGPA 2J5XA 1AN0A 3B60A 4LHWA 3TBKA 3WYAA 4G5QA 2QP4A 1UF9A 1U0HC 2B7BA 2XX3A 2J0VA 5KU1A 3TUZC 3TMKA 3CPEA 4LJ6A 1ZD1A 1IN7A 4NHOA 2VO1A 3DZ8A 2C77A 5KNBA 4FXPA 2HF9A 3OZXA 1BIFA 1FNNA 1U0LA 1AS2A 1SKQA 2VQSA 2V54A 5FI0B 2AXNA 4OQFA 1Z0IA 2CE2X 2FE4A 4JL6A 2ONJA 3Q72A 1B23P 2PCJA 2ZI4A 4DT1B 5J4VA 2IF0A 1Z0AA 1P9RA 1T91A 2YINC 4OK6A 1KK0A 4DIEA 1OH5A 1KMQA 1SXJA 1NBMD 5DN6D 3AVQA 1JQLB 5HKKA 1XZQA 2H5EA 2WOOA 2WSSA 2ZROA 2W00A 3EPHA 1VIYA 1XCMA 4I1VA 2G3YA 3FPAA 2NPIA 3PQCA 3RC3A 5AJZA 3UMRA 2WM9B 5FPKA 1M34E 4N3NA 1X3SA 1XP8A 1SXJB 1FX0A 1ZNZA 2HJVA 1WF3A 1H8EA 2JJ1D 4ARZA 4URUR 3TIFA 1ZVQA 1NY6A 3V9PA 2Z0MA 3QKRA 4LYHA 4CF7A 1ZIOA 2NO7A 3LX8A 2UVQA 3DKVA 1OFUX 2ZI7A 1AQYA 4HLCA 5KNCA 1G16A 1Z47A 1NMYA 3PEVA 3AH8A 5H70A 4ABYA 2FZ4A 2GZDA 5KDOA 3BH7A 1FX0B 4ARZB 4ZDIA 4B2IA 1J70A 3U61B 1AKYA 3D31A 2GDJA 3LV8A 1ZM2A 4QNMA 1JPNA 1E0SA 1N6RA 5GVRA 3QKRB 3SQXA 4A0FA 2ZRJA 3EIQA 2CLDX 3SFZA 2XXAB 2BWJA 2OV2A 4OI2A 1GOTA 1I4TD 1KSJA 2MSEB 3OEED 2RGGA 4Q03A 1G5PA 1YZUA 3WBJA 5CDFA 1CTQA 2YZ2A 4Z1MD 1SZPA 2H57A 3S1AA 2A30A 2NO9A 3QXHA 1CR1A 1JR6A 4N0DA 1LF5A 4BFSA 2CNWD 1OSNA 4Q1BA 4WZAE 3SBEA 4A9AA 4EIWA 2AD5A 2ZITA 2NO1A 3PUYA 3QKSA 5FOWA 4NE2A 4LV8B 3HU2A 1GUAA 3CUEF 4PTLA 4PC2A 4M1TA 4DLUA 3AVWA 1OH8A 1W36C 3FB4A 4MITA 4Q5IA 2BKUA 3BJIC 4TSFA 3S1AB 3THWA 2ZRKA 1N5LA 1W47A 4BLQA 4KYIB 3ZS8A 1F48A 2D7DA 1HH4A 2XOKD 1Q3TA 3RRYA 1AZTA 3ASZA 1HYQA 4S2EA 3DM9B 4F38A 1WB9A 4DUGA 3QKSB 4LJYA 1BO6A 4C30A 1QHIA 4DLSA 2FN4A 1XEWX 2RH5A 1P2UA 1GITA 2FGJA 5E95A 5KSPA 3KTAB 3THWB 3QF7A 2ERXA 4LOAA 3ECCA 3SU8A 1XMSA 3W9YA 3H86A 4PZZA 4IDQA 3LY5A 5L3RA 5FOSA 4CW7A 4Q1AA 4TLBA 3RRNA 1P72A 3NH9A 1NN5A 5ELXA 1WXQA 1JJ7A 2WKQA 4A0GA 2P6NA 4EFMA 5HE9A 5FPHA 1GKYA 4S35A 4TMXA 3GLFE 4RCZA 1VTKA 1QRAA 1M1YE 1R5BA 3SBDA 2Q3MA 5JFGA 1JEEA 1OXVA 2OM2A 3QXSA 2WPDA 4QXAA 2HYIC 1XD9A 1HUQA 1J8YF 3GD7A 2CHGA 5TARA 1MT0A 3IIMA 3ZZUA 2GF0A 5JHHB 1G4AE 3MAAC 1KK2A 1Y3AA 4LV5B 1VCMA 4B73A 2ZJ5A 4KCGA 4C0KA 4ZI3A 2VSOA 3RWMB 1G18A 3W90A 1FW6A 2FSFA 2OBLA 1GFIA 2J46A 1U94A 4HSEA 1VIAA 2GETA 2PX0A 1GRRA 4GRAA 1HA3A 1KTVA 1P2VA 4L4UA 5B30A 3M0EA 1A1VA 2YHSA 5E7JA 3BFXA 2V3CC 4YMSA 2XEXA 3CM0A 2XITA 5L3SA 4PC7A 2XAUA 5HE8A 2BM0A 1F5NA 4JL5A 3LLMA 3MD0A 3ZQ6A 821PA 4EQ6A 4FCVA 1WMSA 2CK3D 4AWXA 3BWDD 5KNDA 4AY2A 2OAQ1 1OXTA 5LB4A 2ZEJA 2P6RA 1G64A 3C8UA 1RJ9A 4IOMA 3I8XA 3ICQB 4DLRA 3ADDA 3HJNA 4RKFA 3A4NA 4LBWA 1T6NA 4FWIB 1CJVC 5L3SB 3NEJA 2YWGA 2BMFA 1OIVA 4EQ6B 4N1AA 4PSVA 1JAIA 3H0KA 4MKFA 4II7A 1GKUB 4TWZA 1IM2A 5H8WA 4HLQB 3TE6A 1RJ9B 1CJKC 4I99A 5FI1B 1QHXA 4FIDA 1UFQA 2XZPA 3IBYA 2KI5A 2AFHE 3QPWA 4RD1A 1ZC3A 1G3UA 4LCBA 1NY5A 2WJGA 4OHVA 4RVCA 1OLOA 3GJ0A 1KGDA 2G6BA 2XZOA 2JCSA 2REXB 1R7RA 1BYIA 4OYHA 3BH0A 3W6OA 2ZJ8A 1XJQA 2UZIR 3PV0A 4IFEA 4DEYA 3WP0A 3UANA 1XX6A 1W7AA 4JBYA 3HPQA 1N6OA 4JJKA 1PLKA 1H8HD 1JNYA 4YMTA 3EAQA 3W8NA 1NN0A 4LHZA 3FFBA 4YDHB 1DADA 5JRZA 4JBWA 4XTCS 3PIRA 2QZ4A 4KI0A 4RY2A 2CDNA 1R5OA 3DOFA 4M53A 2XZLA 4TZ6A 4D0LB 1KI6A 1G20E 1E2HA 3R7WA 1NN1A 3IPXA 3ONWA 4URZR 5HCNA 2QGNA 2XTZA 2YYZA 1R0ZA 1N6IA 2RGCA 2FOLA 3VMFA 3EIHA 2QQ0A 3CWZA 4LI0A 1Z08A 1ZM7A 2QTHA 1Z22A 2ZJYA 3R20A 1KI6B 2C99A 1SXJE 3GMTA 1ZBDA 5AJVB 1D8TA 1HE1C 3CF0A 1G5TA 4Q4JA 5IK2D 3OFNA 1EESA 5FTJA 2BJVA 1ZINA 5G3ZA 3UG7A 2ASEA 1W36D 1N0WA 4Q9LA 3I8SA 1CBUA 3W3ZB 2DFKB 3OEHA 3IKJA 5EE0A 3ZIAD 2GCOA 1LS6A 4Q4JB 4JVNA 4DLWA 1P5ZB 5FFMA 3CRW1 5JI2E 2PBRA 1YJ5A 3JVVA 1CS4C 4YMWA 4B6FA 5HR5A 5KDLA 3W5IA 2Q6TA 1TUIA 4HLDA 2V7QA 2O8CA 1NG9A 3K1JA 1VCIA 1EXMA 4EJSB 2V8OA 3OIWA 1TPZA 2GCOB 2OZEA 4WVFA 4CDGA 1GNRA 1WRBA 4O2RA 3UMSA 4MYUA 4POAA 4BZPA 1E96A 1UBEA 5B2ZA 4BFWA 1S96A 3VNUA 2H8KA 4XJXA 5AJXA 2GWHA 3VR6A 3CX6A 1NP6A 2O8CB 2BHRA 1XBTA 5KHOC 1KKLA 2CCKA 2QPTA 1Z8FA 1TF2A 1Z6GA 3DM5A 3I3SR 3PR1A 5CDFE 5JS8A 4XD7A 1ZNXA 1A5TA 4ILEA 2NPFA 4AK9A 1Q12A 4XVQA 4LJ8A 4XWKA 4MRSA 1M7GA 2XNSA 3C4JA 2NZJA 1E2JA 2HYDA 2RGXA 1T5IA 2EWWA 3I72A 1T3SA 4RD3A 3PEYA 2HEIA 4O25A 3N70A 4AG6A 5CB8A 5AJWA 1IY1A 1P9WA 2QMEA 3CZPA 3KKNA 4L16A 3IHLA 1A82A 3H4MA 3Q3JB 2FPLA 2ORWA 3D6TB 4JS0A 4P0TA 3C7KA 4U00A 3NHAA 3K53A 3CONA 2A5FA 3KFXA 1W4AA 4JVLA 1IXRC 2IYZA 3UPUA 3R8CA 2YWHA 4Q18A 4U02A 1X1RA 4W5WA 2IXEA 5TY0A 3SNHA 4TT3A 1CP2A 3CRQA 5EJEA 2J7PD 2Q3FA 1OKKD 3AB3A 4XSHA 1KI1A 1D6JA 2HT1A 4Q4HA 3EARA 4TQAA 3DZDA 4G5GA 2D06A 3T15A 1LF0A 4DCNA 3QY0A 4PSKA 2C03A 3AUXA 4PX9A 4DSOA 1R10A 3VX3A 4GL2A 4EUNA 2EWVA 5K8UA 2Z43A 4RD2A 2V9PA 3OE7D 4D4KA 5BYJA 2BVNA 1ZAKA 2DB3A 3LH5A 4M1WA 3A6PC 4Q4HB 3U60B 3CRRA 2L0XA 4LHYA 1IJFA 4CZ2A 4P33A 1N5KA 4W5HA 1E79D 1OF1A 1C9KA 2ZRPA 5BWMA 5JECA 2HT6A 4L9WA 5J4LA 2B7CA 2H1LA 2O8EA 2RHMA 2NIPA 1F2UB 3GFTA 4Q7LA 4C0JA 1S3SA 4FMDB 2OBNA 4HATA 2X2EA 3VR3A 2XGJA 1G6HA 4ZCMA 4E5UA 2RGNC 2RGDA 5K8IA 1S8FA 4H1VA 4AI6A 2DBYA 1RC8A 2QTFA 3SE0A 2F1RA 1TUEA 1N5IA 2FU5C 1XTJA 3TSOA 4A6XA 4LYFA 3DMNA 1EX6A 2GXUA 5GJCA 2IL1A 4NYMR 3RRZA 1KOFA 1W0JD 2LCFA 5H1YA 4E07A 4TL8A 3M6AA 5A0FA 1HT1E 2OSBA 5AR1A 5CYPA 3KXIA 4XWOA 1DO2A 2IW3A 2FPMA 3VR4A 3W5JA 8OHMA 3K0CA 1M8PA 1HY3A 3CIOA 1E9DA 2IC5A 1KHTA 1K8RA 3WY9A 1AIPA 3PUWA 2YKGA 1KO1A 4GOJA 1E2MA 5GJBA 3FVQA 4F4CA 1GZSA 4JZKA 2YOHA 2JA1A 4UXIA 421PA 4NP6A 3TSZA 2GZAA 1HE8B 4US0R 4EPYA 4QHYA 5FBRB 5BXQC 6Q21A 1R0YA 3NBFA 1X86B 4YXWD 3RLFA 4B76A 4QBHA 4IDNA 3KKMA 1D9XA 1XPOA 1N25A 1OPXA 4Q19A 3RAPR 1DO0A 1KJWA 4K46A 3GJ3A 5C4MA 1IN4A 1ESMA 2RB4A 2ZRFA 1NLZA 2JDIA 4IVRA 4A4DA 3BE4A 4OQNA 1TTTA 1UKVY 3LNCA 2IYVA 3FMPB 4MKHA 3AF1A 4IDOA 1NVVQ 4YMUA 1JJVA 1TF7A 3Q5DA 3ZD7A 4PO8A 2PT5A 1YR9A 3RSLA 4HAVA 2VF7A 4DSUA 1G291 4PFSA 4A8JA 2TMKA 1J8MF 4QG7A 4HB3A 2A7QA 1YVDA 3QIAA 4X8LA 4QC2A 2I1VB 3CLVA 3TGPA 2CVHA 4JJZA 1E2FA 2E9SA 2JLQA 2ZJZA 3IQWA 4PANA 4JLKA 1I4LD 5E4FA 1SVMA 4MUBA 4A8JB 4DCSA 1XEXA 1F3OA 5KUTA 2HXSA 1XTKA 3NDBB 4E22A 3QI2A 5DHFA 1S4QA 3LO5A 4JLVA 4QBIA 4LUCA 1CJTC 1MO6A 4HDQB 2OO7A 2YV5A 4D80A 4NYJR 2ZS9A 3A37A 3QXCA 1AM4D 2Q21A 4Q1CA 2OILA 4LBZA 2RHDA 4A82A 4AG5A 3ADCA 1Z2AA 4ZKEA 4FWTA 3K09A 1XEXB 3ZZTA 2P5TB 2ZJ2A 1PLLA 4A2WA 3AGQA 4XH9B 2ZS8A 5BN4A 2J3EA 4DZZA 4D4LA 3P32A 1J7KA 3ZLJA 3KKQA 2HJGA 4CT5A 1UDXA 1OB5A 3GJ7A 1FP7A 2H92A 2QENA 5FOVA 1G3QA 2FEOA 2WJJA 3FHOA 4K81B 3X2SA 5DGXA 4CVNA 3QEJA 1HV8A 1LY1A 2C2HA 1OJLA 1G7CA 1P60A 1RIFA 2GEDA 4OHWA 5IF9A 2R6GA 5JEEA 1COWA 4AIIA 3EPJA 1UM8A 2WHXA 4FCTA 5ANRB 5AUOB 1RVDA 1XD2B 1QG2A 2GNOA 1EFTA 4M2LA 2ZXUA 4JT2A 2EYQA 5TDHA 3W8RA 4EPTA 1IXSB 2JLVA 1UADA 2F43A 3K9GA 3BFKA 3AP2A 5FL7D 2PEYA 5LD2C 3U2QA 3EWSA 2G9NA 2B21A 1PVOA 1P75A 2R65A 1JPJA 4NH0A 1ZP6A 2NG1A 2VP2A 3X1XA 2VHQA 2NTYC 3AVVA 4RKEA 5KSZA 4NYIR 2F43B 3DOEA 4LBYA 1WDTA 3U44B 2EW1A 2ZU6A 3OIYA 3QG1A 4GP6A 5JI3E 1GG2A 1VCNA 2HCJB 4DDUA 2F3TA 3RHFA 1C4OA 4TYWA 1KZGB 4GI7A 5J40A 3KKPA 2QM8A 3HR7A 4QOSA 3ASYA 2XNDA 1NJFA 3TR5A 2QPAA 3K0AA 1U9IC 1Q21A 2ZTSA 1RRGA 1BMFD 1R8SA 2BCGY 4A2PA 2Z4SA 3IILA 2CL0X 3GJ8A 4RZ2A 1J99A 3E2IA 3QVUA 4UNPA 5FH9A 2CXXA 3ZZ0A 1ZU5A 1IN6A 1PZNA 2XTNA 1NN3A 4H1UA 2BBTA 4OJKA 2G88A 3KUCA 3SDZA 5CB6A 4QGFA 1TF5A 3QKUA 3K0AB 2FJUA 1G21E 4NU0A 3AVXA 3PEWA 2KBEA 1LFDB 3PENA 2VLIA 4MGZR 1KO8A 2ODBA 4DLXA 2YWFA 3DPUA 1A7JA 3SYKA 2IYSA 2ZYTX 2QGZA 4R7ZA 3Q85A 2JLWA 2RKOA 1QG4A 1VECA 1ZM4A 3EZFA 3RYTC 1CKEA 2O0JA 2RAPA 2W6ID 1OFTA 1XTRA 1XXHA 4A2QA 3K70B 3VKGA 4RFSA 5DH9A 3R9WA 1KAOA 1YHNA 3RS3A 1D2MA 1QHGA 2VEDA 2VP5A 3FKQA 2C5LA 4YDSA 2Z4RA 4C0BA 4C3ZA 3N2IA 3L0PA 4M0LA 1PLJA 1KO5A 2A3RA 3M1IA 1MRNA 1U8YA 1EX7A 4BZXA 1XXHB 3LXRA 1MO4A 1RKBA 1BS1A 5JS7A 1E9BA 1NL3A 4LJ4A 4LJAA 2AN9A 1E4YA 4RFSB 3J81k 5JRJA 3MCAA 4Z8XA 4DSNA 5J4HA 3CPHA 1FQJA 1KDRA 4I81A 1UKZA 4IHQA 3U3KA 521PA 1QVRA 2AD1A 1E2DA 2RMKA 4FN5A 1LV7A 3TW4A 1JAHA 2BEKA 1N3BA 2GKSA 2OCBA 2VSXA 3VHXA 2D62A 1RRCA 2XJ4A 2QMUA 1EFUA 3MJRA 3ZDQA 2I1QA 2ORIA 2XXAA 2QAJA 1NBMA 3EXAA 2VP0A 5DYIA 1WBDA 2F7SA 5DN6A 4XTRA 4B47A 1KKMA 1R0WA 2ANBA 4M9ZA 2QROA 2W58A 2OAP1 1LB1B 3GLHA 4MQBA 3KQKA 1L2TA 2OFOA 2YC4C 2GK7A 3ZVLA 2ERYA 3U7HB 1HURA 2XSZD 4HB2A 1A2BA 2G83A 2IWHA 621PA 1S3GA 3GEHA 3I5XA 1G41A 3IO5A 5FOTA 4JSTA 1FNMA 2JJ1A 4URWR 3FTQA 4PZYA 2OCAA 3LAWA 3GLHB 4B75A 1TU3A 2ODEA 3CBQA 4YMVA 1N0UA 1CJUC 5GVSA 4BLPA 1CR0A 2GK6A 1IY2A 2J7KA 5B64A 4UXJA 1MR3F 1E9FA 1E2KA 1XTSA 2IK8A 4OQLA 3DMDA 4V0KA 4N0EA 1KI3A 5TB5A 4TMKA 3EZ2A 3MGCA 1KI4A 4IOLA 5DE3A 4BLTA 4TSFD 3UG6A 5CITA 4FI3C 1P6XA 2QL6A 3TAHA 4DLVA 3AM1A 3KTAA 2QAGA 4RSGA 4K8OA 5BN3A 1XF9A 3AKEA 4EPRA 4YLGA 3WBKA 4D0GA 4EDHA 1E2EA 3KXKA 2C96A 5CLQA 1P4SA 2AKYA 1YKSA 2Y8EA 1LNZA 2GBLC 4Z1MA 1FMLA 3FMFA 1GRNA 2HXYA 4PPNA 4XIGS 2FFBA 4G5OA 3AKDA 4HAUA 3MWYW 5FUXA 5FBLB 1FZQA 3SI7A 5KSYA 2QAGB 1II8A 4JLAA 4V0NA 3F8TA 2FFAA 1R8QA 5J4YA 4GZMA 4D4JA 2BEJA 1M7HA 3OESA 1T3LA 4DKXA 4OK5A 3KB2A 1NG1A 3VR1A 2VPPA 2IYLD 4I1UA 5BN5A 3TRFA 3PCRB 1XB2A 2O0KA 4LGMA 1KDOA 2Q9BA 2XOKA 1II8B 3SJCA 3SHWA 1ZM9A 1G1MA 5FL3A 3NH6A 5FBWB 3TKLA 3R9XA 2B6HA 1IOZA 3B5JA 3DHWC 3GLGA 1BYUA 3CNNA 4B74A 3LQRA 1JXOA 2R8RA 2VRWA 4OHZA 1I2DA 3A1WA 2VTKA 3BD9A 2GJKA 2ECKA 4PPGA 4ZIRA 3V00A 4NONA 2H16A 2C9OA 2F1JA 2ZU0C 4V02A 1TMKA 5FBQB 3GLGB 1R4AA 2GEUA 1YE8A 5E3HA 5FPSA 4CEHA 4LJ5A 2AXPA 3NDPA 5LPNA 2ODWA 2PLRA 5BQ5A 1DE0A 1SVLA 5KPDA 2H7VA 4B33A 1OT3A 4QNRA 3CRMA 4ZIRB 2ZANA 1QHNA 3GLIA 2DCUA 3QUSA 2I4IA 2LKDA 5AJYA 2J9RA 5BW8A 2FNAA 3TJZA 3PJRA 4CEHB 1N5JA 2VYFA 2KE5A 2FFHA 3IEVA 1KAGA 4R98A 1PUIA 1E2LA 5IT5A 2DR3A 4FCWA 2DYKA 3THOA 2BKEA 3Q9LA 3DEFA 1AS0A 2ATXA 2ODNA 1D9ZA 3I61A 3GLIB 2FMXA 3BIFA 1IQPA 3G5UA 1I2MA 1G8PA 4AD8A 4HB0A 1MKYA 1K5DA 3T1QA 2IS1A 3OF5A 3LBNA 4OBEA 4QJ5A 4XSGA 1MOZA 4BLSA 4DC9A 1MRSA 3TUJC 4W7SA 4EPXA 2CK3A 3WXMA 3CX8A 1NVXQ 5F3WB 2ZRDA 1FTNA 1G8HA 4DCVA 1XRJA 2PZGA 4O2LA 2A5YB 3VHLB 1OYYA 4LY6A 4ESHA 2ZRBA 2G0TA 2HV8A 4JLOA 3Q8XB 3PG5A 2V4ZA 1IXZA 4JSYA 3GPLA 1NKTA 4KLNA 1CXZA 2D4HA 3X1ZA 2ZVPX 2IHBA 4D2IA 1KK3A 1WP9A 2DFNA 3PEUA 1UAAA 3Q7QA 1IJEA 1VG9B 1XJ0A 2QT1A 1XJCA 1ANKA 3JVUA 4MGYR 5HZKA 1NMZA 4PO1A 3MJHA 3KQHA 2DWQA 3B2EA 1GL9B 2YOGA 3ADKA 1GAJA 1XXHE 1YR7A 2ZRCA 3AQ4A 3H2YA 3JZMA 4OJQA 2PL3A 4A92A 3U3MA 2CVFA 2O0HA 5DSZA 1U2RA 4BQSA 1Q1EA 1TL7C 1OHHD 2C8VA 1XTIA 2C9YA 1XD8A 5JSZA 1SVIA 4GDFA 1DEKA 5JWOA 1NLYA 1VCOA 2GCNA 3O8BA 3CX7A 3HR8A 1DTSA 2VL7A 4MYCA 1H8HA 1E9CA 1GWNA 1ZUNB 2QNRA 3CZQA 3IEUA 4BFXA 1XMIA 2OXRA 1GL7A 1YZNA 1L4YA 4UXHA 4B2PA 2JLYA 4QBGB 1W48A 4LBVA 5B57C 5C1BA 5JSZB 1SULA 2KSQA 2EFDB 3LBIA 4F91B 1ONBA 3K0EA 4AYXA 2P0EA 3OEHD 1G7TA 1MO3A 4B2LA 4EJSA 2IUUA 3P4YA 2IXGA 4JKIA 1TAGA 3EG5A 4TTPA 4IOJA 4B34A 2RCNA 5EXPA 1O3YA 2R62A 5L3QA 4TTRA 5DI9A 1UEIA 1CRQA 2QQEA 1N2CE 4US2R 4AC9A 3I5YA 1NBME 4PC6A 5IK2A 2FPKA 5CJ2A 2PZFA 2ZUCA 3IPYA 3WHKA 3SJAA 2P2LA 4YQFA 3GLHE 3T34A 2WJVA 2B92A 5L3QB 4DDVA 1RFLA 4X8HA 4DDTA 3BFVA 2GESA 2CBZA 1DOAA 5JZVA 2D2EA 2EVWX 4BEJA 2KWIA 2J41A 3M4YA 5G40A 3WMGA 3ZIAA 1E1RD 4LHVA 2C78A 4DXAA 4PZLA 1KI2A 2O8BA 4V0OA 3QBTA 2OEPA 3T12A 3SYLA 3TLXA 5K8LA 4XD7D 1W36B 2QRZA 1CULC 1TU4A 5FOUA 5C18A 1ETUA 1Z06A 1RRFA 4PC1A 3UIEA 3ZH9B 1N6LA 1A2KC 5SZHB 4L15A 1HQCA 1XCGB 4HYYA 3O47A 4QFMA 4Q9JA 2O8BB 2IUSA 3RS5A 3K09C 2BC9A 2ZI6A 2OCYC 1FPMA 4X8OA 2EFGA 1G7RA 2Q0HA 4ASUD 2D74A 4TMTA 4B3DA 2WIBA 3C5HA 2AK3A 4HB4A 3TUIC 4CT4B 5CM8B 1G6OA 1KI8A 1EFCA 3KDSE 3NC0C 1E3MA 1EFRA 2REBA 2DWPA 4KV9A 2ZRMA 1AGRA 3SN6A 2NO6A 1T8TA 1Z6YA 2GJ9A 2JGNA 3WHLA 5GJWC 3SZRA 1AKEA 4R2HA 1KO7A 4HLUA 2ZI5A 3EPKA 2CEAA 4M1KA 1DPFA 5A4JA 2QN6A 3N2EA 4KXFB 3AV0B 1OXSC 1D2EA 5TV2A 2JJ2D 4KSCA 2BCJQ 1FP6A 3JZAA 3D8BA 2H18A 3QOFA 1XTQA 1DBSA 2MMGA 1G17A 1FL9A 4LWZA 4M21A 3QNUA 2PCLA 4NYMQ 3H84A 2WTUA 1F2UA 4BFZA 2NQ2C 4QRHA 4HAZA 1H65A 3BRWD 3ZVMA 1N0VC 1TQDA 2FEMA 1RE0A 4RJLA 2J7PA 2CHQA 3QXJA 1OKKA 3HYTA 1R6BX 4Q1DA 2W2XA 3KQUA 4GT1A 4FMBB 4P32A 1BKDR 2YC2C 4UNRA 1E1QA 1F2TA 4WA7A 2PJRA 4TQUS 4KLZA 3FYHA 4PQRA 5FBVB 3WNDA 4IFBA 5FUYA 2HLDD 1YRBA 2P3SA 4PHTA 2ZI9A 2ZR7A 4Q02A 3WP1B 1W5TA 2WVJA 3KL4A 4G1UC 3OAAD 2WWYA 1XMVA 2UKDA 3THYA 4LHXA 1F2TB 1ZW6A 3PUZA 3BORA 1E79A 5EUMA 1YZLA 2QE7A 2HUPA 1ZC4A 4V03A 2GAOA 4KFRA 3GLIE 3EASA 5EXSA 1FFHA 2QP3A 3BK7A 1QHSA 3UWOA 3ZJYA 2W6JD 1N6NA 1G5RA 2VHUA 4TQ9A 4IXMA 1GNQA 1MO5A 1RYFA 3THYB 1GDDA 5F98A 4NKRA 1DS6A 2R44A 4Q00A 4Q9HA 3N5CA 1ZIPA 5HTKA 1M74A 3L43A 4W5JA 1Z0DA 4ZKDA 3B1VA 2F55A 4B3CA 3B13B 1N6HA 1SQ5A 2GXAA 4DIDA 5EE3A 1OXUA 2MMCA 3CKLA 3HYRA 2AFIE 4Q21A 1SHKA 1X1SA 3L0IB 3WNBA 4HUQA 1W0JA 2ZSAA 2WICA 3SJBA 4P4SA 3EC1A 3RSOA 1UKYA 1E69A 3QPUA 1E98A 4B43A 1VDZA 1ZD9A 3Q5EA 3EX7C 1E0KA 2ZIAA 5EP2A 1GP2A 1E4VA 2NO0A 3AF4A 3KXLA 4FINA 1P9NA 4Z54A 1NMXA 5CM9C 1U90A 4KYUA 2J0SA 4HUQB 1E2IA 4BECA 3FMOB 2KJQA 4FMCB 4P4SB 2GVZC 3I73A 2ZM5A 3TH5A 5LDDC 3CNOA 1Z0FA 5HZHA 4NYJQ 1SXJC 4M1YA 3IIJA 3ETLA 3OIUA 1CLUA 1W46A 1YQTA 3TVTA 3VFDA 1MV5A 4ZDWA 1VG8A 2F6RA 4YXWA 4EFLA 5CK4A 3EZ6A 3CR8A 3IBGA 2JIZD 1Z0KA 2QT0A 2BBWA 3LQQA 4ZDJA 4OI0A 2XJ9A 3U3RA 1J2JA 5J47A 4AKGA 3FMIA 3L0SA 4JYBA 4KHZA 4CGZA 3I92A 3DVLA 1E32A 1DELA 2F9LA 1KJYA 1L4UA 4XWAA 1S1MA 1VHTA 2QTVB 5HPYB 5JLJA 1QBKC 4WW0A 2ZJOA 5F9HA 4BLRA 2A5DA 4IRUB 5EZ6B 1U98A 4Y0AA 5A5GA 3AEZA 2ONKA 2GTPA 3WYFA 1S9DA 1R0XA 1OIWA 5DLQC 3FGNA 4ZO4A 2PX3A 4B3GA 2JATA 1N6KA 3KJIA 4UNNA 1KZ7B 1ZUIA 4D6PA 1WCV1 2VHJA 3LVQE 2P5SA 4JT4A 4RZXA 1L8QA 4TTQA 4V0LA 2YWEA 4IVQA 1Q1QA 4PAMA 2ZRAA 1ZUHA 4ERNA 1ZCBA 4PR0A 3U7EB 1UJ2A 1RRPA 1I4DD 4F4IA 2V55B 2IWRA 1XD2A 1GKIA 2DFTA 2PEZA 4TL7A 2IX3A 5TMPA 4IDHA 5EZ5A 4LJ7A 4NYIQ 3Q7PA 4G01B 4Q1FA 4ACBA 2VSFA 2G77B 4EAQA 4CEIA 4BUJA 4CEJA 2W2TA 1KDTA 4JLJA 4HDCA 4M8NE 1OXXK 1Q1BA 1U99A 4ZV4A 3TK1A 3T1VA 1E2NA 1NJGA 1K6MA 3D3QA 2FG5A 1RZ3A 3FE2A 2I3BA 2K5UA 3G0HA 1Q22A 4KVGA 4I4LA 1PJRA 2R2AA 2V6IA 1XDBA 2F1IA 1GIAA 5UKDA 721PA 4CEJB 2WWHA 4B32A 4LSGA 4X8MA 4CEIB 4MA4A 2AWOA 2DHRA 5K8TA 1KYIA 1W4CA 4WIAA 1PV4A 3A58B 2WJHA 1E99A 5HCIA 2FX3A 3BERA 3QJYA 4LJ9A 4M9QA 2BOVA 2ZYWX 4P4TA 2QRNA 2QBYA 3VX4A 2FV8A 3B9QA 3ZYCA 2MSCB 4DEXA 3A4MA 3GJ4A 4IKEA 4KFSA 3RWOA 3VQTA 3GJ5A 5JJLA 2WKPA 4WXPA 5J5CA 5P21A 4AYWA 5DNYB 4LV6A 4RZ3A 1G3MA 2FZLA 1W44A 1E2QA 3FKSD 3VTKA 5FL7A 3QBVA 3KZ1E 3K9LA 4DBLC 1JALA 2QBYB 3W34A 1DAHA 1E94E 4M1OA 1ZNYA 2FWRA 2HCBA 4DDWA 3ADBA 1AK2A 4NBSA 1HQYE 1KDPA 4IEEA 4BRWA 2IYWA 1JR3A 2J1LA 3QVVA 2ZQ5A 3CR7A 1QF9A 3SYNA 4C0HA 4UJ5A 3U7GA 4WZ6A 3L82B 3QXXA 4LDJA 1U81A 3FHCB 3T35A 4C9BA 4D4MA 4F4JA 1CRPA 2YNMA 3B1ZA 2XTMA 4MRRA 2HF8A 2RGNA 4PO9A 3RDPA 1EK0A 3GJ6A 5FR2A 2GILA 1W0KD 2B8TA 1E9SA 2CL6X 5FOXA 1A4RA 2A9KA 3ND9A 4WZBE 4H9GA 1P2SA 5SZKB 2PH1A 4A0HA 4LPKA 3CO5A 3T61A 4BZQA 2IF2A 2VHCA 3CB4A 1JQJC 1NVUQ 3WRXC 4L9SA 1NSTA 2BIFA 4DLTA 4TYYA 3H1TA 5JWRA 4TMVA 3RS2A 5JEDA 3LD9A 3PFIA 1HT2E 1YZKA 4LC1A 3QG5A 1FUUA 1J90A 1NLFA 3AF0A 2AX4A 1U8ZA 3P26A 1MH1A 4NDZA 2DFLA 3CPJB 5JWHA 1SVSA 2BBOA 2EFCB 1Z5ZA 1IHUA 3A4LA 2WAYA 4LYAA 4WAUA 1E2PA 3REFA 2QORA 3SEAA 5JCZA 3B1YA 4A15A 3NBXX 1GVNB 4U5XA 1DARA 1SXJD 1Z6XA 4GPTA 4D81A 5HKKD 2R6DA 4PC3A 3FDIA 2WSSD 1OFIA 4D0NA 3GFOA 2VP6A 4RD0A 3V4FA 4DLYA 3I4LA 3R8FA 2CHVA 2W6IA 4QBFA 2OHFA 3X1WA 2JEOA 4AKEA 3QF4A 5EXTA 2J0UA 2C04A 2ZR9A 3KKOA 4M1MA 3OIVA 4B3BA 4Q9KA 3QKTA 1V5WA 1K5GA 1H8ED 5AK0A 2OT3B 4BASA 1U8AA 4OQMA 3BS4A 2F1HA 4PSAA 3LA6A 1S9HA 3CWQA 4EFNA 4ZI2A 1Q0UA 3QF4B 2J0UB 2J87A 2BM1A 2SHKA 4WOPA 3K0SA 4JL8A 4YONB 2EU8A 3HPRA 3K8YA 1G8FA 2GRJA 3KQLA 2GJ8A 2WSMA 3AVTA 1OIXA 4Q7KA 1VPLA 3FWYA 3ZS9A 2EQBA 3AGPA 4ESVA 2WAXA 2RGBA 5DIFA 4M9SA 3KJEA 3E5HA 1W49A 4DRZA 4JIMA 1CR4A 5D3QA 4V0MA 1YR8A 2FFQA 1FQKA 1LVGA 3QEOA 3MG9A 3RNLA 4ZDKA 4HUTA 3U3JA 3TVDA 2WZQA 4GFDA 2GA8A 2JAQA 4HEJA 4MGIR 5C2JB 1OH6A 1KI9A 3AP3A 3EA0A 2W0SA 1G8GA 1Y63A 4LK2A 1XEWY 1GM5A 1OYWA 1Z28A 3GEIA 1ZYUA 2VP4A 2XSZA 4P31A 4PHHA 4Y0VA 5DO9A 4CRWB 2NOAA 5CLLA 5KDDA 4QJ4A 1TX4B 1IY0A 1ZCAA 4EJSC 2QSZA 4GOKA 1FOEB 4OK3A 3AVOA 3AVPA 4Q9IA 3R9IA 2O8DA 1II0A 2IYRA 2QPOA 2A5JA 3A1UA 3B82A 3A36A 1L7VC 4DUGD 3OEEA 1KK1A 3GFPA 3VU9A 4B35A 1KJZA 4GSYA 4OKSA 5AUPB 4DJTA 2ZUDA 5FUWA 1WA5A 2G1JA 1CR2A 2D7CA 1G3RA 3LVRE 2CNWA 5CJPA 3CF6R 4JKYA 4C0QC 4C4PA 5FUVA 2QSYA 1V43A 2E1RA 3P27A 2O8DB 4D82A 2ZSEA 3RS7A 3P20A 4DSTA 4A0RA 1JXMA 2IXFA 4TN1A 3VU9B 2VHTA 3PXGA 4CYMA 2ZRLA 1EFHA 2VF8A 3EPLA 1KY2A 1G7SA 1X8JA 4XOIA 5G41A 1NI3A 2IYXA 3NHBA 3UATA 1RYHA 1XPRA 2QU8A 5EUQB 3MLEA 2G1KA 2ZSFA 1T0HB 2E87A 2WPDD 2ZE6A 1OV4A 4TMWA 3O8DA 1KO4A 1Z63A 2OBMA 1CIPA 4RD4A 3U5ZB 4BGDA 2OESA 4KU4A 1D2NA 1QHYA 2BDTA 2WV9A 3AF3A 4JBXA 5LB2A 3MWLA 4KITB 1IONA 2W0MA 2R9VA 3W3AA 1KNQA 4HZUA 1YRAA 1Q57A 1S1CA 3BGWA 5LD2B 3EA5A 4MH0R 1T3HA 5EE5B 5DI3A 1UBFA 5C46F 5FTLA 3P1JA 3AF2A 1JBKA 3BBPA 3EZ9A 4ZPXA 1KNXA 2ZVQX 3KB1A 3QSYA 2OXCA 5EE9A 1U9IA 4HZUB 2ZAMA 4KFUA 3QE0A 3UK6A 1NIJA 3O8CA 1OB2A 4KAXA 1PUJA 4UNQA 3VR2A 4US1R 1LW7A 4MYHA 2IYUA 2ZRGA 3GQBA 4BPBA 2PJZA 5DI3B 1Z07A 4QL3A 1ZM3A 4NMMA 1TQ4A 3T1TA 2QEQA 4HLUC 1S0UA
chains in the Genus database with same CATH superfamily
1NAIA 2PX5A 2A78A 1UBGA 3BE5A 1E9AA 5KVVA 1NNUA 2YX1A 3AQIA 3V7UA 3KX2A 4G0UA 1E3TA 5U4QA 3B2QA 5K2OA 5EP1A 4B71A 2X5JO 3MMNA 5JJBA 5SY6A 1KORA 1FUIA 1ELOA 5ICSA 1R5NA 4BVKA 3EVEA 4HRYA 2QN7A 1FFCA 4B8ZA 2XHEA 1SVUA 3DVQX 4IDPA 1QQ6A 2D1QA 2LPMA 4FR2A 4MZXA 3DYVA 3GCGA 5EHQA 5T4FA 5KBYA 3K1AA 3RC1A 1OH7A 3C85A 3ECSA 1T9HA 1UJMA 3SSMA 1R0BA 3I5MA 1A7AA 4NCJA 1K3TA 2AL7A 1OZAA 1FFAA 3VH1A 3YASA 1JFFB 2PXXA 3G2HA 2GAJA 2VDQB 3DEJA 2WWGA 5JJCA 1X14A 2AHRA 4OL0A 4RPCA 2GZHA 4U7PB 5J4KA 1BJKA 3BXPA 1W4BA 1NP3A 1QTIA 2VXYA 3U4QA 1J0BA 2C8KA 1E0AA 2GZRA 4FOOA 5BQFA 4JGIA 4AX8A 2CL5A 4B17A 4J2HA 3DBOB 4GLBA 3MS2A 3D8NA 3OU7A 4TUYA 3PWZA 4C2UA 4MJ3A 5C4GB 1P1BA 1HKHA 3BH6A 1J1IA 1Y6QA 3A1VA 3S40A 3TQQA 3EOAI 4JBLA 5GY7A 1CZKA 1GZDA 1G63A 1MJGM 3C3AA 4KGDA 1V11B 2IPXA 4ZAXA 4B3XA 2VNIA 4BMDA 4TYQA 4BNKA 2QGFA 5F7XA 2GPNA 1CY4A 5E0KB 4ZVQA 1M72A 1FFYA 4IIHA 4IIXA 2Q6OA 4YJKA 4EUFA 4PYJA 4WY2A 5JW6A 1BFUA 4FGZA 3B6IA 1U7ZA 5P8WA 2GH1A 3GBVA 2WHPA 1NZDA 1TYCA 3NIBA 4UE6A 1Z12A 3R7LA 3K0CC 3N2YA 1YIAA 1QH8B 3N59A 2CV1A 1GPKA 3BMOA 1B43A 4IVPA 5AVTA 4R69A 4AJIA 2ZRHA 3MRSA 1CDZA 1PI3A 1ZK0A 2JIQA 1ECFA 2C57A 2PQ0A 4IBOA 1PW7A 4NOMA 3HKBA 5JROA 2B37A 3L02A 1H3EA 1II9A 1XK7A 5BRAA 4J9VA 4OHRA 4BWFB 2JHGA 2X8JA 2C2BA 5ESWA 4OSEA 3PGJA 4NJOA 4G0NA 1IN5A 1Q44A 1ZRNA 2BEWA 2PJDA 5C3MA 3B89A 4KREA 4JXZA 3BIWA 4Q4AB 4AO6A 2PT9A 3OKCA 1VE9A 2XGSA 4N5DA 1GG8A 4BJ6A 1UXJA 1XQ9A 1V5GA 5F7ZA 1XZDA 3I1FA 3I09A 3V8QA 3SGLA 3LYUA 1FP2A 3U7IA 3PX2A 1AS3A 3KAQA 1OASA 3ESYA 3GEMA 1ECCA 3DT6A 1CEEA 5K3EA 4QBTA 4MYTA 2WRZA 3BAZA 4RORA 3VAZA 1MT3A 3NGMA 4P4UA 4F2WA 5ITWA 5LQKA 2WUVA 4IMPA 1PEYA 1YQWA 2G1AA 3QITA 1ZOIA 2YWXA 2JIDA 4GX0A 1GTSA 1F6BA 1E2BA 1LI4A 2Z3ZA 1KE2A 4MTLA 3IMEA 4LOLA 2X19A 1E64A 5AKHA 1G9SA 4J90A 4Z7QB 1UANA 3PNKA 5BWBA 2Q7DA 2YICA 2DY0A 4NBNA 1Y98A 5LZ7A 2E4VA 2HDNB 4PZDA 3EZYA 4J29A 2LKCA 5IZCA 4FQ5A 2WIAA 2VDPB 3O3MB 4PZCA 3OM0A 2ERCA 4X97A 2HADA 2CNNA 4QM6A 3SP1A 3W6NA 1GNPA 1U9CA 1J00A 2JLAA 3D1VA 4PAQA 1J5PA 4L5BA 3F1KA 2EBUA 1HEIA 1JEOA 2GBLA 2H85A 3IKVA 5FUQA 3A6LA 3B1WA 3QFHA 3IR5A 4HMOA 1KTIA 5FD8A 4G4JA 1O97C 2FUCA 4ZV7A 1DAKA 1NTOA 5F5NA 1R4NA 4AX4A 4RTLA 3T3MB 2ZS7A 3K0FB 2GXSA 1C4WA 1BHJA 1SOAA 2NU9A 4IWNA 3L8HA 5E9WA 3WGNA 4M83A 4D3FA 1T0JB 4E32A 5JYCA 1UAYA 4RL4A 1BE8A 4KNVA 1VBKA 2YVUA 4B7AA 2K6GA 1W1WA 2D5BA 3GIDA 2X0RA 4HGNA 3ZVNA 4J0DA 3VYUB 1B8OA 5CDGA 2GSWA 2I76A 5DTIA 4RA9B 1E1RA 2DFDA 1T5LA 3E7DA 2NU6A 2OLJA 4MWOA 4MUNA 4QPJC 3HFRA 3MINA 5H3CA 3UTDA 1CUSA 3WRYC 4KIJA 1OZHA 3WK8A 3STYA 4BRUA 1UPFA 3BZWA 5CTJA 1EXWA 2BM9A 5ALUA 4ZEMA 4OQ4A 2YJNA 1BEEA 1K4YA 1H85A 1JS1X 5ALWA 4LHSA 2YW2A 3VR5A 1XC7A 1SKYB 4Q15A 5CLGA 3HBLA 3ZVKA 1RYYA 1JIJA 5IKPA 1JQ5A 2CHEA 2POQX 2QRHA 4RZIA 3F98A 3C39A 5JMTA 4XJSA 1ZMXA 4MWBA 3D0OA 4RPGA 2ILVA 4ZVTA 5M04A 4M8SA 3EHEA 1CU1A 2E89A 5BRNA 3NC1C 1JDBC 3D7SA 1Q6ZA 3WWZA 4KACA 3OJEA 2V6JA 3SFVA 4YT4A 1KKUA 4LHEA 2YV4A 1FU7A 1DMRA 1JPUA 2B30A 3QYFA 2Q7OE 4B9AA 3HZRA 2MTBA 1Q0SA 3PJEA 3Q7RA 3WA6A 3ZY6A 2BR4A 3ESRA 3ONEA 5L3VA 2GM9A 3UM9A 2JLSA 5AW4A 4PPQA 4TLCA 4AVYA 2IDKA 1VPEA 5AYVA 4OFBA 4EYKA 3HTXA 1EWRA 1Z6PA 4Z4CA 5FAXA 4LW8A 3G82C 5HNKA 5EJAA 3MCTA 1Z2CA 5BXYA 2GKOA 2NNLD 2TMDA 3L8ZA 1KSHA 1YDWA 4XGNA 4IHJF 2NU7B 2AZMA 2NZ8A 3FSJX 5FPTA 5LBUA 3JALA 3LCCA 3IE0A 4P2GA 3A1SA 1US8A 3HP1A 4MUXA 4EUHA 1GFZA 5KIAA 4PN3A 1NXQA 4G3XA 2J59A 1W2WB 1AKQA 1Z0JA 2JD2A 3GRUA 4WMLA 3Q8MA 1G9XA 2VZEA 3GGOA 3KUDA 5HM6A 4RK1A 1E0DA 1ADBA 1FTSA 3IAXA 1SD2A 3BRWA 3MTQA 2R1UA 1YZTA 3AKCA 2Q1YA 3NBUA 1GHTA 2X8LA 1P7VA 5LWHA 2WJYA 3VKHA 4QTXA 4NL4H 2H0QA 4XAQA 2BZSA 4M0PA 4RK4A 4RYDA 3I62A 3N2ZB 5D3MA 2NVUA 5IXSA 3CVXA 1LVHA 1JT9A 2WTEA 3DTVB 3ZXUB 4BMNA 4Y98A 4AS1A 2ZIGA 3LQ1A 4PYRA 3L0ZA 4JYCA 2MINA 3C6QA 2OORC 4LF9B 4C07A 3TLKA 3OJFA 4DG5A 3GVXA 2HLDA 4J43A 1XJWA 3P2YA 2QW8A 4G9EA 3Q1LA 4BRZA 4CUZA 3K70C 3I4FA 4BJ1A 3OAAA 4YAKA 4IINA 1HPLA 5ITVA 1JDZA 2HRCA 3KJQA 5DBGA 1NUHA 2QN9A 1XFAA 1FX1A 1BNCA 2WNSA 4HNQA 2PSEA 4MP8A 4YCSA 2E49A 3I32A 5AVRA 3LI2A 3QLTA 1D0IA 3G8AA 3AL3A 4D5GA 3ND7A 5I4BA 1WCYA 3W6PA 4RL6A 2MWMA 2X58A 1W2GA 4HZGA 3HKEB 1Z29A 3E6AA 4CIYA 5IX8A 3N3AC 2XB4A 2Y71A 3RS0A 4GKAA 3TNYA 2D1YA 1G8KA 3GDWA 4KTVE 4ZAVA 1M2OA 5FRDA 1ZH8A 1YQEA 4F93B 3NGXA 2P69A 4ETNA 2EIHA 2VRCD 2ZJBA 5FEUA 1MABA 4F56A 2R751 1NW5A 1FNDA 4OJNA 4DCCA 4A6PA 1WBBA 1IN8A 2X0IA 3V3KA 4X6UA 2XRFA 1WDKA 3OQBA 5FTKA 4DM4A 3O93A 3Q0IA 3Q2KA 4FLEA 1UJ6A 1WXDA 2ZCVA 4ZCIA 5JSHA 3BAFA 2VYQA 5A02A 3S2UA 4QYWA 3D3WB 3F3MA 3IHWA 3KJXA 5T7BA 4IH1A 1T4BA 3KVYA 1Q1AA 4BMOB 2H07A 1XXLA 4L0QA 1KETA 4P58A 3VJMA 2HPHA 3UH1A 3KETA 1IMJA 4KRXA 3H1GA 1M6NA 1W87A 1L5QA 3AY3A 2YFHA 2IE0A 3FZNA 4HN4B 3DDOA 2JLRA 1JKJB 4XB2A 5JALA 2IUTA 2P67A 2PO5A 2QX7A 4G6ZA 4URYR 4D9KA 1H1LB 3R4VA 1U9JA 2E2WA 4RABA 1Z3CA 3GRPA 4YDRA 5KVAA 4OGWA 4LMRA 3SG0A 4BN0A 2Q28A 4CIBA 4BO5A 1EDOA 1THMA 3I2GA 4Q47A 2WNIA 4WZAA 3AW8A 2CZCA 1CG6A 3DO6A 1DAFA 5FCDA 4BP3A 4YALA 4KE8A 1VIVA 1IZ7A 4OH1A 1PE0A 4B8WA 1C9DB 1RJWA 4GP7A 2Z5FA 3U3OA 3MQ4A 2YJ3A 3O0DA 1YHZA 4CL3A 5JO0A 3ZDEA 1AKTA 4JJ4A 4NU5A 3UWKA 2FJPA 5LQSA 1VL2A 4WFQA 4YRTA 1YBHA 4O3MA 1Z8HA 5KOYA 4LE1A 5BSGA 5CDYA 4Y1EA 4JDUA 1W19A 3CV3A 2JFHA 3TD6A 1OR8A 1EK1A 3D2CA 4FW9A 5JAMA 3GU3A 5IRCD 1NFFA 1GAQA 5LZ5A 1GPH1 4MDEA 4HAYA 1EUQA 1FTGA 3GGJA 3OLCX 1SHZA 1L4MA 4H7DA 2P9HA 1N1MA 4JXJA 4NOLA 5JSUA 2QN3A 1MB4A 3WDLA 1THGA 2CB0A 1JX6A 3I4CA 4XLLA 2O8FA 2CCJA 2C00A 1DWOA 3I1YA 4DANA 1SN7A 4TSRA 3N6RA 4MDHA 1VHLA 1X1DA 3E3MA 3LWNA 3EG9B 3LKVA 2JL1A 4TLDA 5EQTA 4CIXA 3B78A 4AL4A 1SVKA 2PRZA 5CYOA 1C3OB 3U13A 2IZ1A 1OA1A 1EUYA 5FPYA 3FUTA 1BA3A 5JCPA 5TS3A 2EFEB 2C2OA 2JBAA 1HDIA 2OG1A 5ALDA 3TR0A 4DR1B 1VGRA 3AV3A 3Q8WA 4I1SA 2BGMA 1C9EA 4UNSA 3U48A 4C6TA 2PLFA 4EI7A 1K4MA 3VH3A 1NF3A 3U6KA 1BHQ1 1Y9ZA 4I6EA 3G8DA 3K5PA 3VAAA 3AVYA 3EGCA 1P0CA 3HM2A 1FUEA 1VC2A 4L8GA 1EFAA 2X6QA 1K7EB 4X3OA 1MN6A 2WPNA 3ABIA 4K9OA 4KLAA 3ZE2B 1WE2A 5EE1A 2JAPA 2AWNA 3LDHA 1QJCA 3DPIA 2VBIA 2OE2A 4X20A 4C06A 1Z6AA 2D3WA 4BL5A 1ABBA 1GFWA 1DBIA 1ZD8A 2GN4A 1VL5A 1DP4A 1JYFA 5WRFA 3RTBA 5JZBA 4YAOA 4JLPA 2PH5A 3TW6A 1WXEA 4ZPJA 1NRJB 1C1YA 2HJSA 4QDZA 2V6MA 2ZE5A 4F0JA 5IDVA 1PR5A 2Y9MB 3IS3A 3QV2A 3IP7A 2TRSB 5H3LA 5BWNA 1NOKA 3T5DA 3OZCA 2QDXA 2SECE 3PUVA 2ORVA 4KKXB 1M6YA 4EG1A 1MIOB 4PFQA 4DVGA 1K8YB 2ZPTX 4JLNA 1QHHA 3E70C 1KYTA 1FS6A 2IYNA 2HCFA 1XWIA 1FP4B 4L3VA 1W5EA 2CCGA 3EXFB 3OEYA 2QG6A 1NSFA 2RI0A 3IAUA 3ZGOA 3GNTA 2H4JA 3K1TA 3AJRA 2J0QA 4RF4A 3WZLA 1TVCA 4REMA 2WU1A 3ZOZA 5EP3A 4WBNA 4DB2A 5KJCA 4IW3B 1GT6A 2CJXA 2JANA 3W1EA 4DCTA 1U2GC 3Q0EA 2YVAA 2CXQA 2N42A 4N12A 3AIKA 4M9XA 1IU9A 4RHXA 1E4EA 1WR8A 2YJ5A 5ESDA 4KQIA 3ZJ4A 4D9HA 4OHXA 1KMCA 4KODA 4ND5A 1KJIA 4YRZA 4ZYWA 4OFWA 5KKCA 4ARCA 2CE7A 1H66A 4KFTA 4IIJF 1W34A 3JRNA 1BMFA 1LSSA 4KDRA 1QS0B 2NZ2A 3T7AA 3TQFA 4CM1A 3TDNA 4JLSA 2VIIA 1UM9A 1R6VA 3IVMA 1XT6A 1QK4A 2BMJA 4Q7MB 1KPIA 2CJWA 2WWFA 3B7GA 2F4VB 2VDUE 4ZCLA 5CU7A 3PC7A 2OKCA 2GVNA 4RD6A 2ZBPA 3C7DB 1M0WA 4Q1EA 3MF4A 4W63A 5AKLA 3DE4X 3N2LA 2Y68A 1UCFA 3CJTA 1DEAA 2D1RA 3C14C 1VMEA 4JVSB 5B37A 4ZMRA 4FX5A 4TKVA 3VKUA 2ZT5A 3NBZC 4JR1A 4ZA2A 2IDZA 3D8TA 1P6UA 4G63A 4GE0A 3F6BX 4MUAA 1BVHA 4HD8A 4NJEA 1DDGA 3BTVA 1W36D 4AWBA 5AICA 1GSIA 4M4SA 4MSUA 3T5CA 1IBCA 1AGPA 4NR0A 1VJ5A 1B6RA 4YCJA 3H65A 5C8YF 4QJIA 2XX3A 3I76A 3LVBA 1QRTA 3SHVA 3TUZC 4JI8B 4QPZA 1CDOA 3CPEA 3MJSA 4S04A 2QX4A 5FX2A 2V5VA 2CDRA 2C77A 1RU3A 2P9EA 2HF9A 1EVIA 3CH6A 4HEQA 1SKQA 2REQB 1I33A 2CDCA 3IVRA 4OQFA 2FE4A 4JL6A 1DV1A 5C32A 2IU3A 5ALOA 1AMNA 2IF0A 4Q37A 9GPBA 1Z0AA 1I1NA 2X40A 2GPSA 1O77A 1V16A 2YINC 4OK6A 2P11A 5JSKA 1UWLA 1XE3A 4ZCSA 1KMQA 4DA9A 4E21A 4Z7OB 3OWHA 5AVWA 2BRUA 1JQLB 1XZQA 2WSSA 2ZROA 3OPYB 3JX9A 1ZA1A 3AILA 3AWDA 3L0DA 3EPHA 5BUSA 3IAFA 1ESDA 1IEWA 2G3YA 3CF4G 3AFNA 2WMDA 3RJTA 2AFVA 2FWNA 4JDPA 1M34E 1L3CA 3PNLA 4XX0B 3WKAA 4B8YA 2R1TB 1KERA 3DBVO 5ECWA 3R3YA 4QO7A 4YJ3B 3RHTA 1OVMA 1SXJB 2G06A 1PL8A 1ZNZA 2QX6A 1H8EA 1K0FA 2IIBA 1U7XA 3QU5A 5H02A 3TIFA 1G98A 4DA0A 3G6KA 3A9RA 4BLUA 4DRXA 1GA4A 2G7ZA 5DYYA 3JQGB 1A72A 3QKRA 2ZT8A 2JH9A 4BLWA 2HSZA 1YS7A 3KB8A 1A9PA 3JYPA 3S44A 2UVQA 3R5KA 1FE8A 3VNAA 4PXSA 1AQYA 4ZRMA 3IVAA 1KFJB 5H70A 3PEVA 4QLAA 2FZ4A 2GN8A 3EF0A 1FX0B 5DW0A 3PIIA 2OO5A 2IXTA 4U0KA 4Q3CA 1J70A 2H0AA 3CWCA 4MCHA 1UWCA 2WHEA 4S0ZA 1ZM2A 4YHBA 2E5LB 4NICA 4QNMA 2GCGA 1N6RA 2XXBA 5GVRA 1ATIA 2A33A 5IBPA 5T8KA 5K03A 2C7RA 1NI5A 1H4SA 3F5SA 5K1ZA 2NO5A 1I7NA 2EKQA 4RPIA 2BWJA 4ZFNA 2D4AA 3NO4A 3B53X 3I04A 3V46A 1Y80A 3SQDA 3WLOA 2ID7A 4DOMA 3GZJA 3WAJA 4NBVA 3OQMA 3LQYA 1XCLA 4H3VA 3OEED 2YXPX 5I8ZA 2NTNA 5AI6A 1G5PA 1SIWA 1JI3A 4L8YA 2IYPA 1CTQA 3E7WA 3I2FA 3O4IA 4GM0A 4OP3A 1B74A 3QKWA 3EPPA 3JYOA 4JFAA 3TR6A 2NO9A 1CR1A 2Z8XA 2ZPAA 4D9NA 1RWBA 1CUZA 2Y0DA 4P7KA 1OSNA 2HLPA 4WZAE 3SBEA 4CMGA 4U9HS 1IFXA 2AD5A 4IXDA 1I5RA 1JE1A 2H0RA 2Z98A 2JI7A 3LGAA 4MR8B 4X6XA 1GGNA 2W7TA 4LV8B 4Q7QA 3FFTA 3HU2A 4P7JA 4KC0A 1U2QA 1OH8A 1AO3A 3FB4A 1W36C 3JQPA 3PHLA 4YEDA 4MITA 1W94A 3S1AB 2VBGA 5HIAA 1F9AA 1AH2A 2WA1A 1NQXA 1F48A 3HYNA 4MUMA 2D7DA 3V2IA 3RRYA 1IEXA 1AZTA 4XQCA 2X4IA 4DQUA 1HYQA 4G25A 5TNXA 3I2JA 4DUGA 3QKSB 4JWKA 1RLOA 4OQDA 3TNLA 3RFTA 4C30A 4DYVA 2ST1A 2IIVA 2FN4A 1U0SY 1WMFA 2XYGA 3IVXA 3UH0A 3MERA 1PJ3A 2KMLA 4UD6A 4E94A 3I5UA 3QF7A 4JAVC 2RARA 4H0FA 5DYWA 2RC6A 4K1LA 1O6ZA 1XMSA 5DTEA 5DGHA 4F9FA 1D0VA 1EGMB 1VSQA 3LY5A 4Y6OA 1KMIY 1N5MA 3TX6A 4G41A 4PLHA 5MFPA 1NUSA 4WI1A 5JNRA 1P1JA 1D8AA 3HWRA 3URMA 3W06A 1PFWA 4B6QA 4ZQGA 2R84A 2WKQA 2OBBA 5B3JC 1QP8A 4WERA 4CM6A 3RR2A 4EFMA 4JGGA 4PBRA 4TMXA 4RCZA 1HO3A 3BXOA 3NM6B 4GR9A 5LXTA 3W2HA 3SBDA 5CA1F 1WQ3A 3MCWA 2IH5A 2EJBA 2V6FA 1KYYA 1OXVA 2OM2A 2Q27A 3LYHA 3VR2D 1XD9A 3FWZA 1VHQA 1BDMA 2XE4A 1JW9B 3EBPA 4LDRA 1MT0A 4DV0B 1M9NA 4ETIA 4X1IA 4HT3B 3W9UA 4Z4IA 1E7MA 1ICEA 4M0KA 3WG9A 3PPVA 1KK2A 5IT0A 3WFIA 1YCFA 3EC7A 3HCBA 4C0KA 1ZVJA 2ZIWB 2C4WA 4M9UA 4ZI3A 4YQZA 1UZUA 3ZDFA 1UK8A 1G18A 3CKYA 2KW5A 4XIJA 1GQYA 1LGYA 2G9QA 4MCAA 3AETB 4JOCA 2DPHA 4RJJA 3PKZA 4YWHA 3LKBA 5FFNA 1HQDA 3OZWA 4GRAA 3SZLA 5CVTA 4PLWA 1O96B 2A4KA 3GDOA 2W2PA 4OGFA 5DU2A 1SBQA 1K9VF 2YHSA 3SIXA 6REQB 1A1VA 1SM4A 5L7YA 4QARA 2XEXA 3CM0A 5KEIA 4KB5A 4XD2A 4YRBA 2PWBA 5L3SA 1JEYB 1PL7A 2BM0A 1T5TA 3OIGA 4JL5A 1IZZA 5JMOA 3UAYA 3L06A 4JMLA 2CK3D 3FPHA 4AWXA 3E9ZA 5KNDA 1Q0ZA 2OAQ1 1JLSA 1WEHA 1NJ8A 3OZAA 3W7VA 4NK4A 3RV3A 3QVGA 3AB8A 2HD4A 4D9MA 4KP7A 4RPLA 2YHBA 4BO3A 3T3GA 3I2YX 5LR6A 1I1QB 4RKFA 4P93A 3VJLA 4DCPA 4DYHA 5AK3A 1Q50A 2J08A 4UHEA 5A4MS 5BSKA 4A6EA 3WDMA 1U3WA 2AEJA 1GARA 4QWWA 1JSLA 1OIVA 2CD7A 3M81A 3H0KA 2BDEA 4ZD6A 2OXTA 1GKUB 3RT1A 2XBMA 1FVHA 1P7WA 3PGKA 5H8WA 1GXSB 3A3OA 1LV8A 3VOAA 4ZRDA 1R9JA 4C4YA 1CJKC 2J3JA 1WMEA 1ZH0A 3L8CA 2BN4A 3H42B 4NH4A 2XZPA 5FI1B 5BPHA 2VDKB 2CXTA 4I9NA 1ZC3A 4N7BA 1FYXA 4MW1A 5AXDA 1FMTA 1NY5A 2WJGA 2CVQA 4MS4B 1EGVB 4RVFA 1A8PA 1YKFA 4RVCA 2XZOA 1CYEA 1MJFA 2HOQA 3D2BA 5G2OA 2QTBA 4AROA 1XJQA 4RSRA 1L7MA 2IZZA 3GIWA 4F46A 4YRGA 4DEYA 2I22A 4V2UA 4ZVUA 3ULKA 3ZWOA 2ADOA 3A1DA 4PNPA 4ENUA 1XX6A 2Z5LA 3QUAA 5C37A 4JJKA 2JH8A 4RQTA 4B4OA 3UJ9A 3EAQA 4GM1A 1NN0A 3WMRA 5FWXA 1GGJA 2H9AA 1IVYA 1GA1A 5JRZA 2BFBA 3OQNA 7MDHA 1IQUA 2QZ4A 4KI0A 1TYDE 4X1KB 5REQB 4BUCA 5TT1A 1DJQA 1KI6A 3SSAA 1E2HA 1YR1A 4FZ5A 5GPBA 3MJFA 3M5WA 4TOIA 5IAGA 3IPXA 1SKBA 3D1LA 5HCNA 5DDIP 3U4DA 3FPBA 1EWYA 3FMGA 3L7NA 4K5QA 4M54A 1XVAA 2XTZA 1R0ZA 4LWQA 2FE1A 4W6QA 1WMAA 2RGCA 3EQ7A 2GAIA 4HWPA 4OCZA 4R2JA 3PFKA 4LY3A 4BO4A 3QQPA 1G60A 1V1MB 2EJVA 4UBIA 4UPEA 3FIUA 1RZUA 3N8KA 3B6ZA 1L5FA 1Z22A 2ZAYA 1L5ZA 1VBNA 3T38A 3R20A 1SXPA 4KR7A 1J09A 3GMTA 4IP0A 4M60A 1D8TA 1HE1C 1UPBA 2ESRA 2O3TA 1G5TA 3JY6A 4E5KA 3OFNA 5HUHA 3LT1A 4COKA 5JXIA 1EESA 1IOVA 5FTJA 1T35A 2B1GA 2BJVA 1ZINA 3B3FA 3L0CA 4JUCA 4MQFB 4AUNA 5G3ZA 1J9ZA 2PD6A 3L4JA 3UG7A 2I6SA 3I3OA 1T36A 4GYKA 3G1WA 4QFCA 4N82A 1OWNA 2O19A 2B3DA 2PYZA 2YJZA 2I4NA 1LLUA 4R8LA 4NBRA 5BRJA 3ETJA 2CLEB 1ML3A 4HQLA 1LS6A 2UUBB 1U8EA 3D6HA 2HA6A 3HVUA 1RAIA 3O83A 3CRW1 3KKZA 3FNGA 4RNDB 1KDYA 4EVSA 1JAYA 1KR5A 4JGBA 5JBNA 4YMWA 4BQPA 3W5IA 2FYTA 2Q6TA 1K89A 2Y2UA 3OMXA 1H2WA 4HLDA 2V7QA 3HUEA 4YUVA 2O8CA 4I4CA 1I6MA 1B2LA 1WZEA 4R1MA 1LEHA 1L8LA 1A0OA 1F0KA 1I4EB 1VOTA 3MCVA 1UMDB 4XEHA 5J2TF 3TNJA 3HFGA 4NS1A 5CT5A 4DILA 4AY3A 1RPNA 2GCOB 2OZEA 1GNRA 2WF9A 2PZBA 4O2RA 3VJKA 4FDUA 4TGLA 4MYUA 1MRZA 1B8VA 3KYIB 4BZPA 3OTQA 3TAXA 4BFWA 5B2ZA 3ZXIA 4DZTA 3OT1B 5SYNA 1N5RA 3KTFA 4XJXA 4WKGA 1O0CA 1RI2A 5JS1A 1IC6A 1NP6A 2ZM6B 4IDEA 4RPHA 1FMCA 3I1JA 2NUPB 3CLSC 3NS7A 4NV3A 5IP5A 3TLYA 4YXFA 1CHDA 1TF2A 1EM8A 3I3SR 5I47A 1VIMA 3DE3X 1ZJ5A 5JS8A 2B5WA 3C7TA 2I9KA 3G9TA 2NPFA 2MYPA 1QTNA 3HDYA 1CZRA 3RVKA 1Q12A 1NVBA 3MLBA 1I0ZA 4EZEA 1PEDA 5IULC 4MRSA 3C4JA 3GT3A 1UBUS 2HYDA 2RGXA 5K4AA 1XFDA 4RX1A 3DBLB 1I13A 5A7HA 1C30B 3I72A 3DAHA 4RD3A 5E9JA 3PEYA 1JU9A 1OXMA 2HEIA 2FLWA 4AG6A 3N76A 1O94A 5CVDA 2QMEA 1A82A 3DZCA 3H4MA 4JS0A 2ORWA 2PWZA 3CVWA 3C7KA 1FRNA 3QHQA 3CONA 2UDPA 1IXRC 2IYZA 4C7KA 2EOAA 2QRVA 5DWQA 3W2IA 1R5JA 3QLEA 4Q18A 5BNTA 1ZK2A 4UCQA 3H5VA 1NGSA 3ROGA 4JI2B 4W5WA 2C82A 5T5QA 5TY0A 1CUJA 4H6PA 4REQB 4TT3A 3QLUA 2DUWA 1QPGA 2VF2A 1GSHA 1EXNA 2Q3FA 1IZ0A 2ONCA 1OKKD 3AB3A 3G6WA 1J22A 3RVJA 2X0JA 4ZYZA 1XMQB 3UUGA 3A3PA 4DCGA 1I3LA 3KYCB 1IRXA 3KAJA 3RB8A 1LF0A 4DCNA 2PMWB 4FKMA 5KCMA 4NZ9A 3TXYA 4DSOA 3I9KA 1QQ5A 3VX3A 2XCTB 4U7GA 1VL6A 2G4VA 2JFVA 2WJPA 5LUAA 3EFEA 2WU8A 1PVOA 1Y89A 3O2QB 3AYZB 2VJMA 2PX4A 3PRHA 4Q4HB 4RADA 3U60B 2NVOA 3JAKA 4K9NA 4R6XA 3C1AA 1E79D 1OMOA 1SIOA 2ZYIA 4TTIA 3HCPA 1QO0A 1LD3A 5MN4A 2W2LD 1KZ1A 3BGVA 4L9WA 4E5PA 4DTCA 2Y67A 4K28A 3E9EA 3A1NA 3DE6X 1T4DA 5JTTA 5IJ9A 4K6CA 1KVUA 3E3AA 1FDWA 3L8DA 2M98A 1G8AA 5LOVA 4CPDA 1MPTA 1U7DA 2VH2A 3Q7IA 3T9CA 5K8IA 2ODPA 1O95A 1VJ0A 1BEZA 5FXMA 3WL4A 1N5IA 2FU5C 2DQZA 1IWBB 3ROQA 2I99A 4O4JF 3U4CA 4KN8A 3TRHA 3UA3A 3U3DA 4A6XA 5LP1A 3TZQA 3I5AA 1JDNA 4LYFA 1PVVA 3JQAD 2N75A 1SRRA 4K6OA 4K86A 2GXUA 5JDIC 2IL1A 1J21A 1VL8A 3RK4A 1ZGBA 2LCFA 1CLEA 4LCEA 4U6SA 4IHAA 3KSAC 3I6IA 1JAXA 1PU2A 5AR1A 3MXTA 4JP2A 1ULTA 3ZJVA 3ONNA 2FPMA 4FFLA 3VR4A 3VYWA 2D5LA 1JHUA 2BI7A 1M8PA 4AKTA 1HY3A 3H9UA 8OHMA 4RTOA 1FS5A 1Y3IA 4KQ6A 3AB7A 2VK2A 4UULA 1AIPA 3ZUPA 5BT9A 1DBWA 1V7ZA 2WINI 1E2MA 2OD9A 4LZJA 4PYKA 4JZKA 3P0RA 2Z1NA 4GSLA 3WLKX 4OM7A 4LAFA 3TSZA 4HDSB 1HE8B 3PC4A 1TJYA 2HIAA 2WK1A 4U2EA 5FBRB 3HKCB 2Q5LA 5HIJA 1R0YA 1KHHA 4Z0PA 3IH5A 4ZVPA 1I1OA 4LZAA 4WECA 5AI8A 3CY6A 1WB4A 1CEXA 1R8YA 2ZIXA 3MA0A 1XPOA 3VO8A 5E7QA 1HSZA 1C7RA 4CM4A 4BAGA 4CR6A 3LF1A 4DCMA 2AIRA 4JX9A 4LQLA 1DO0A 2HMUA 4PBTA 3GJ3A 5AIAA 3K72B 1VPDA 4C2AA 2VN8A 1K97A 1VIDA 2ETVA 2VK4A 3DD1A 1WUTA 4IVRA 5L6MB 2XCUA 4NBUA 3USZA 5KC9A 4ZAYA 1AUQA 1HDYA 2D5IA 3JQ8B 4N40A 4P36A 5IMBA 3X0DA 5F21A 1MTOA 1WU8A 3STVA 3O1JC 2B5OA 4QQ8A 1YKGA 4B3TB 4I1IA 1JJVA 3KYJB 3T3OA 1JDSA 2EHJA 2OZVA 2C5EA 1YR9A 2ZB4A 1P5JA 1YT5A 4FSHA 3WV5A 3BA1A 3COSA 4I50F 2VF7A 1PHRA 2Q4DA 4CKEB 4F06A 5I3ZA 1HE4A 3NCHA 5F7OA 1MO2A 2FPWA 1T0IA 5T64A 3DEYX 1ZPDA 2IFTA 4MW6A 4QG7A 4HB3A 1TYBE 2O54A 2B7LA 3A25A 5B4VA 4YR7A 3ZBTA 1FW8A 3TGPA 1AX9A 2CVHA 4ZI7A 3OD1A 4ARVA 4AZ3A 5GIOE 1DCFA 1E2FA 3BN3A 1PS9A 3Q6MA 4JT9A 4ZEOA 1D09A 4DFDA 2C58A 5CURA 1HL3A 1FSZA 3VGJA 3R0VA 3L6EA 4O63O 4A8JB 4KGVA 1XEXA 1F3OA 4XUEA 2A1IA 4RKWA 4TVBA 5CT9A 1U5BA 2Q99A 4J3FA 5EJIA 5JS2A 1JH8A 1EFVB 2FPSA 3F6YA 3VPAA 4C29A 1S4QA 3L8FA 5KX5B 4R9VA 4PZAA 3ZCQA 1RQNA 3NDIA 3GT4A 2AOUA 4NHEA 4EITA 4NYJR 3GP3A 4KYVA 3AYXB 1SCNE 1IMOA 5IBRA 4G0WA 2OILA 3IPLA 2RHDA 4GL4A 4AG5A 3LPAA 4ZKEA 3VVLA 1KEUA 2VF4X 3K09A 3AEUA 4HMPA 3ZZTA 4IJQA 3RFXA 2ZJ2A 4UATA 2A9VA 1PLLA 1C0KA 3GMIA 1ZNQO 4WTOA 3WB1A 7REQB 4U63A 1HEYA 5BN4A 2J3EA 3EDRA 3KVRA 3LUKA 2C5GA 3ETGA 1J23A 2Y0PA 4PWZA 3TCXB 4NXMB 3LKZA 3IEPA 2PZ8A 2HJGA 4EO7A 1SXIA 4TV9B 5TIIA 5LU8A 3N3BC 2H92A 4L8VA 4V3BA 2YRFA 3EEIA 1RAFA 4XB1A 3AMVA 4YRAA 4CLOA 3U1BA 2AJLI 1HV8A 3BDAA 1G7CA 1RIFA 2C4MA 3DCIA 3VYVA 1R3DA 1QJ4A 2R6GA 4YJHA 3CLTD 4LNAA 4AIIA 4Q6WA 3DOIA 2WHXA 1BDBA 1UC9A 4FCTA 1EFTA 1DEHA 3RH0A 3O5AA 4ZT3A 4YTEA 2ZXUA 2A9JA 3H99A 2HV9A 3D02A 4FK8A 3W8RA 4EPTA 1UADA 3K9GA 2K2WA 4FEAA 3N0RA 2PGJA 3AP2A 5J23A 5FL7D 2NXCA 1BW9A 5LD2C 1DB3A 3LECA 1SUWA 1ZJ4A 4WXMA 3HQ4O 4QU5A 1FDRA 1KEZA 2NUAA 2VH1A 2BFFA 4OJYA 1MC5A 4D4IA 3B1JA 4DJFC 4A16A 1K6EA 2WIJA 3X1XA 3PNOA 3Q4GA 4FGJA 1M6EX 4AZ0B 1V2HE 4O0LA 3COJA 2MT9A 4V1CB 1F8FA 3QA3E 1UH5A 4LBYA 3TBHA 3D4NA 2EW1A 4GP6A 3OIYA 2QF7A 4FFNA 4RVDA 4DDUA 2AYYA 2YNMD 1C9NA 3H7IA 2PBFA 2MDTA 3KKPA 2VWQA 4WKPA 2QM8A 4BMPB 1L5SA 1NT2A 3F4KA 3PLRA 3KD3A 2XNDA 3RS9A 2QIPA 4LE2A 4A5SA 2CVZA 1PX0A 2QXTA 1BMFD 2FZEA 3DEKA 3JD0A 1QV7A 1VQ1A 2G80A 4DYDA 4YDQA 2V0GA 2YIJA 3A0RB 4Q9AA 2HC9A 2Z4SA 4J3JA 3IILA 4LRTB 4O4LF 3EQ2A 2JGIA 1ZX1A 5AM4A 1EHIA 1NJ2A 5B2EA 5FH9A 1NX6A 1WX1A 4J0KA 4X54A 3UJ8A 3PDJA 2BTOA 3W3AD 3ZZ0A 4EYOA 3FSGD 2WTNA 4MYDA 3STHA 1O9HA 4QGFA 3A6FA 3UAVA 1TF5A 4OFXA 2W6QA 1KARA 4YV2A 3IVGA 5A3JA 1O6CA 4HWSA 1GNSA 3K05A 2HHJA 2WSYB 3BHIA 3WJAA 4D44A 5I45A 2WU3A 3DPUA 5AKXA 2VR1A 1CUEA 3ORSA 1VECA 1SVNA 4MB6A 3RYTC 4FXOA 1K2WA 3JARA 4GKVA 5F4BA 1J8DA 2ZWIA 2O0JA 3BM5A 2D0IA 3QJ5A 4OYRA 1CIJA 1PR2A 1XTRA 4PCVA 2QYTA 1WLYA 4A2QA 3AR4A 3VKGA 1GQFA 3OTIA 1LVUA 4RFSA 2RJOA 5DH9A 4B80A 4Z49A 3F6EX 5DNUA 3TW0A 1TZCA 3T9FA 3A2NA 4GLFA 1D2MA 2ZSKA 2J31A 1T5SA 1X7WA 2WF6A 3FKQA 3H5NA 3D8HA 4KAFA 4YP1A 3GEPA 4BKUA 3L0PA 5IM4A 1PLJA 1KO5A 2Q6KA 4JQSA 3G2NA 1RKBA 4UBMA 3EMVA 5DGIA 1AQIA 2PMBA 5JRJA 2NZUG 1QKJA 1HYEA 4NPCA 3TM4A 4DSNA 4ZO6A 2G8LA 3RLIA 1FJGB 1QIDA 4IHQA 3X1KA 3Q9UA 4JI1B 3H5LA 1U1GA 4EHIA 1I7LA 1D2GA 4YP5A 2Y1CA 1DTWA 1VJCA 3WA7A 3PCTA 2PUGA 4YAGA 5JLAA 1E2DA 2RJ3A 4OHBA 1UDCA 4WNIA 1H2ZA 1E3DA 3QMVA 2GKSA 4LYDA 4YAIA 5JATA 3S6JA 4TTSA