3GJXC

Crystal structure of the nuclear export complex crm1-snurportin1-rangtp
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
171
structure length
171
Chain Sequence
b'VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGLEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Snurportin-1
publication title Crystal Structure of the Nuclear Export Receptor CRM1 in Complex with Snurportin1 and RanGTP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 47
structure length 171
sequence length 171
chains with identical sequence F
ec nomenclature
pdb deposition date 2009-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3gjxC00
2CK3A 2GA8A 4RSGA 3RRYA 3P20A 4BEBA 3K9NA 4F4CA 3CF0A 5B2ZA 4BFZA 5CM8B 2XTZA 2F1RA 4LSGA 2CK3D 5AUPB 1XTJA 3GJ5A 2WMNB 4OHZA 2ZIAA 3ZGXA 2JLYA 1Z2CA 3THXA 2C9YA 4XSGA 2ANCA 4A1FA 2Q21A 5LD2B 4Q7JB 1HE8B 1W0KA 4AYWA 4XWKA 2ORVA 1XTIA 1NN5A 3EA0A 2BKEA 3U7EB 4DCUA 1W0KD 1QHYA 1OT3A 3FMPB 3FVQA 2ZRDA 1LNZA 4XH9B 5DSZA 4Q19A 2E9SA 1PV4A 3UIEA 3EG5A 2VHUA 1X1SA 1U90A 2RGBA 4A0HA 2BV3A 4FINA 1MRSA 2OG2A 4DT1A 4DCTA 3AQ4A 4HDOB 2J0UA 1ZIOA 2ZI5A 3OIUA 4Q47A 2O8DB 3HR7A 2VEDA 2ZJ2A 4HZUB 3SFZA 2VF7A 4MGKR 4Q18A 2ZJBA 2O8CB 4JSTA 4HAXA 4DB4A 1HV8A 4L9SA 4HEJA 1Z5ZA 3K0FA 1OYWA 5TB5A 3I3SR 5KO2A 2D7CA 2AN9A 3PFIA 4LC0A 1HQYE 3N5CA 3OE7A 1W4BA 3TK1A 2QUZA 3U3RA 2EQBA 3G5UA 3KDSE 1GUAA 3OE7D 3PQCA 1CU1A 3CRQA 3LNCA 1G7TA 1Q21A 1XBTA 3LH5A 4L9WA 5ANRB 1KO4A 2BEJA 1HEIA 3QENA 2ZTSA 4YONB 3OIYA 4R7ZA 2VP4A 4AKIA 1SKYB 5CYOA 1LB1B 3U3KA 1KI2A 4KLZA 4NL4H 1VCNA 3LX5A 3OIWA 3SYLA 4TWZA 1G6OA 2C2HA 4C7OA 2D4HA 4LYAA 1FNMA 3WP1B 1VTKA 4M1YA 1XEXB 2YOHA 4IJMA 1G8HA 3GLHB 3AVUA 3BE4A 2P5SA 4PR0A 3WYGA 1G18A 3P27A 3R8CA 2F3TA 2W00A 4LJ4A 3H84A 4IXNA 1GL9B 3NHAA 4XVRA 2B7BA 3KL4A 4CEJA 3REFA 2CCGA 1ONBA 1XD8A 1Q44A 1Z2AA 4LV5B 2C9OA 1EFTA 3AVWA 4IDNA 4TYQA 4OK5A 3QI2A 1U81A 2IBMA 2JJ2A 2N42A 5E3HA 1IJEA 1QHSA 1HA3A 2AL7A 5LPNA 3QF4B 2CE2X 2VSOA 2Z4SA 5J4LA 2CVFA 1EX7A 3BBPA 4Q1EA 3QE0A 3WHLA 4BASA 2JLVA 1KKMA 3PUZA 1IHUA 2FOLA 1KI4A 2GEDA 4B73A 4IVRA 1P5ZB 3IIMA 1TAGA 3R20A 3RS0A 1Z63A 1IY0A 4A8JC 5JS8A 1P3JA 2ERXA 3SBDA 3FMIA 2IEZA 2IWHA 1KHTA 4EPYA 4M9QA 5FL7A 1E2FA 2NG1A 3R7WB 1K8RA 2DHRA 5JRJA 2ZJOA 3MGCA 2GDJA 2WAYA 3UMSA 3W8RA 1E3MA 1G8PA 3DMNA 4US0R 5FL7D 2YC4C 1KSFX 5BN5A 2NO6A 4NYMQ 4KAXA 4Q9HA 4ITRC 1KK3A 1YRBA 4DWJA 2J9RA 5B57C 2NMVA 4JIMA 1M2OB 1CR0A 2RKOA 1G17A 4C4PA 1P7CA 4B76A 3QG5A 1KZGB 1NMYA 2AHOA 2DPXA 2ONKA 4JL8A 1S3SA 4M1WA 4Q4AB 4Q4HB 2ZI3A 4Z54A 2ZU0C 4JVLA 3I92A 4HAVA 5CJ2A 1KO7A 3AM1A 1M6NA 3R8FA 4B32A 1AZTA 2ODNA 3CKLA 2HT1A 3MFYA 1IY2A 2X8AA 4AY2A 2PL3A 1ZU5A 1B0UA 3ZS9A 4H1UA 1JBKA 2OUKA 1GRRA 5DH9A 3CRW1 5HKKA 3QXJA 2O8FA 1ZNWA 3P1JA 5FL3A 2QSYA 2WWGA 2ZITA 5HKKD 5KTYA 4BFWA 2GCPA 1EG7A 1S1MA 3B6EA 3DDCA 1ESNA 4US2R 2CHQA 3B5JA 3PVSA 5KSPA 1S0UA 2GHIA 4KO8A 5TDHA 3C4JA 5EE5B 2P6UA 1DAEA 3AEZA 5LD2C 4W5WA 4LBYA 5CDFE 1HH4A 2Z4RA 1CULC 3LBHA 3W5JA 2CJWA 1G8YA 4Y0VA 3KJEA 4M9ZA 1JQLB 3EPLA 2OCAA 1N6IA 4WZ6A 5IK2A 1W46A 1D8TA 2BBSA 2GXAA 5AJVB 5E7IA 1OSNA 5IK2D 4A0RA 4OI0A 2J3EA 4WXPA 5EP2A 4IVPA 1UAAA 1NVVQ 4TT3A 1DPFA 3V4FA 1JAHA 3LRPA 3AVOA 4U7DA 1AZSC 1FTNA 1ZP6A 2NIPA 3EZ7A 1RIFA 3H86A 3EWSA 5CB8A 1CXZA 3DHWC 3ZVLA 3H2YA 1Z0DA 2OAP1 3OAAD 1FP7A 3WYFA 3ZVMA 1IXZA 2WAXA 1FW6A 1PLLA 1SVMA 4LHWA 1MH1A 3VX4A 1XXHE 2OXCA 2PX3A 4BWYA 2AKAB 2V54A 2OCPA 2OLJA 3QXXA 4DUGA 1VHTA 3F0TA 3I8XA 2J46A 1KDRA 4TZ6A 3ZVNA 2AFIE 4DUGD 1NG1A 2I3BA 3CW2A 4B6EA 1GRNA 2F1HA 4JVSB 1OE0A 3QUSA 4A2QA 4BLRA 2GBLC 1ZC4A 3CX7A 3QPUA 5DN6A 4PC2A 4JBXA 4RFSB 4JT2A 5E4FA 1IOZA 1W47A 3BD9A 4DEXA 3EZFA 4R2IA 1G5PA 1HT1E 1T5LA 2ZRAA 3NEJA 3VX3A 1KYIA 1A2KC 3NDBB 4GOJA 3KJGA 3AV0B 3SJZA 2GCOA 2ZAMA 3ADKA 5FTMA 5JJKA 2V1UA 4ZPXA 1TNDA 2IA5A 4A82A 1FL9A 1TADA 5GVRA 5KOYA 5TMPA 1IONA 2WJVA 3CH4B 3QVVA 1E4YA 2WOOA 4TYYA 3T1VA 5JI3E 1NVVR 3CBQA 3KQUA 3B85A 4F4IA 3GJ0A 4PQRA 4ZIRA 3THXB 2UKDA 2R44A 1OFTA 5FUXA 4GL2A 2Z5FA 2FE4A 4KFRA 1EWQA 1N2CE 5G40A 3W9YA 1CR4A 3F3YA 3MWYW 4UJ3A 3DOEA 2P6RA 2OZEA 1TX4B 5CM9C 4XJXA 4JS0A 1E9EA 4GP6A 121PA 5FI0B 3GLFA 1J8MF 1HTWA 4ERNA 3RABA 4A15A 4DT1B 2R8RA 1OXTA 2NO9A 4Q03A 5HR5A 2W0MA 2G3YA 3LLMA 5FUWA 4Q9IA 5FTNA 2J0UB 1OXSC 2G0TA 3W6OA 1YJ5A 4NPHA 4WZAE 1JAIA 2GILA 3GMTA 4QC2A 1PLJA 2QGZA 3JVUA 3DMDA 3UMFA 4TLCA 1IBRA 2ASEA 1ZNZA 4H9GA 1E2NA 3K0FB 1GOTA 6Q21A 2QEQA 4OQFA 2AFHE 3VKHA 3KFVA 3O8DA 4NBSA 1GP2A 5EXTA 1DADA 1R8SA 3TJZA 2Q3MA 2WM9B 2YWGA 4FCVA 5P21A 2VH5R 1DS6A 3VHXA 3D6TB 5BXQC 3O8CA 3NC1C 1KDPA 1JJ7A 621PA 2ZM5A 4LV8B 4BLTA 4MKFA 2DFNA 5IDVA 2EVWX 2VLIA 1NF3A 721PA 2I1QA 4PO8A 3EZ9A 1SVSA 4G1UC 4K46A 2ZI7A 4CW7A 1U9IC 2QMEA 2AD5A 5FH9A 1VG1A 1ZRHA 5AUOB 3AF1A 3K1JA 4KSCA 1GTVA 4ZO4A 1XD9A 4OJKA 5FBRB 4C7OB 2QP9X 4BQSA 3RRNA 1Z0IA 1XU4A 1Q1EA 3IQWA 4WZBE 4DSTA 1AKEA 1G3UA 2HJVA 4YDSA 3BFKA 1OIXA 3MWJA 4AIIA 2SHKA 3A58B 2EFEB 1Q20A 1XJ0A 2GAAA 1S9DA 3I1FA 4GP7A 4UXHA 4V0MA 3Q72A 4EJSC 4CEJB 5JBQA 1E94E 1FPMA 3ZZ0A 2J45A 3K09C 4HLQB 4NH0A 4IRUB 2D74A 2IS1A 4Q9KA 4PAOA 4RVCA 3BOSA 2ZJAA 1XPOA 4YMSA 1S4QA 3LXRA 1VIAA 4R71A 1EXMA 3IIJA 4BFVA 4DLWA 2GETA 1XTRA 1N0VC 2V55B 1TPZA 1ZUNB 4B3BA 4JJZA 3SQWA 1FMLA 1GM5A 2HXYA 3ASZA 2ZR0A 2PJZA 1WCV1 2GK6A 3HU1A 2GBLA 4BEJA 5KSZA 4KYIB 4B3FX 2ECKA 2FZ4A 4G01B 4JMPA 2P67A 2RGEA 2RHDA 1W0JA 2HYIC 4FMBB 4KCGA 4IXMA 3EIEA 2ZRLA 2ZRHA 3TSOA 4FMCB 4CEHA 2IYTA 1QDEA 1W0JD 1KI7A 4ACBA 3GFTA 4BUJA 1KI1A 1BO6A 2BKUA 3BERA 4DIDA 4PC1A 4JLDA 2ERYA 1LF0A 2ONJA 1OB2A 4XWAA 4LI0A 2O0HA 2V4ZA 3V4RA 2IC5A 3GFOA 2Z43A 3JZMA 2IYWA 4TTQA 3T1OA 4OJQA 3U6KA 4CZ2A 2Q3HA 1WDTA 4RKEA 1IN5A 4IFBA 3PXGA 5CK4A 3W3AA 4KSBA 2HCJB 1YZNA 1KDOA 1SHZA 4OL0A 5DHAA 1UBCA 4TMXA 1LY1A 4ASUD 2H92A 1YRAA 1UKZA 4IOMA 2KBFA 4US1R 2B8TA 3K9LA 2WWIA 2OFXA 1HURA 1KK2A 3TR0A 5KYKA 2CL0X 2LKCA 2ZI4A 4G5OA 1E9DA 4DJTA 4DRZA 4NONA 1V5WA 3WRYC 1H65A 1U2RA 4O0MA 1ZJ6A 4CDGA 1MT0A 2VA8A 2D3WA 2BJVA 2CMKA 3I5XA 2ZYUX 4MRRA 1R0WA 1RYHA 2RGAA 5BWMA 1G3IA 3GJ8A 4GMDA 4QG7A 1COWA 1M74A 1E2IA 4CYMA 2O8FB 2P3SA 1SULA 2QMOA 2ZRCA 3QXSA 3VNVA 1COWD 2F6RA 2GZDA 4GOKA 4II7A 4B75A 4JL6A 4MA4A 3AF3A 4NCNA 3EPHA 3OIVA 3H4MA 1YZQA 3EA5A 3MD0A 2CLSA 5CYPA 3BFXA 1G1MA 4I1VA 4BZXA 2RCNA 3B82A 2XTNA 3T34A 1QHXA 3QKRA 2H5EA 3TKLA 3AP1A 1X6VA 4C9BA 4OQLA 2Q9CA 1II8A 2CCKA 2WWHA 1BS1A 1OW3B 2CJWB 3SJCA 2J7KA 2X19A 1LW7A 2FG5A 2A9KA 2VBCA 2XNSA 5FPYA 1XZQA 3K70D 1DE0A 1OH8A 3V00A 1NRJB 2QT1A 3K0CA 1OIWA 3VR3A 1G7RA 4EJSA 4URVR 2HV8A 3WNBA 1ZINA 2B92A 3ZZTA 3KJHA 4RKFA 1X3SA 1E1QA 1M7BA 1KO8A 1QF9A 4DEYA 3CO5A 1ZNYA 5K8TA 4L15A 2YKGA 3SR0A 4UNSA 4ARZA 5FUVA 3U7FB 1RRPA 2IS2A 2YINC 2A3RA 4HAWA 3ZDQA 1OH6A 2PLRA 1HUQA 1CR2A 4BZQA 2PT7A 1JPJA 3KB1A 4A2WA 1RW4A 2ANBA 5FR2A 1P9NA 1QG4A 2F7SA 3CX8A 3IEUA 3SEAA 1B23P 1NI3A 2WHXA 4C0JA 3C8UA 3LBNA 2AXNA 3SDZA 4NYIQ 3I61A 1WB9A 1OH7A 3HWSA 1WA5A 4EPXA 1P2TA 3LW7A 5A4JA 1KSGA 1M7GA 1KI8A 4KYUA 2AD1A 4QBGB 4UXIA 4DB2A 1DG3A 1NY6A 2FPLA 1HE1C 4P4SA 4B3GA 4ZKDA 5EE0A 4ZI3A 1U98A 1SZPA 4DKXA 3WXMA 1G16A 4UNPA 3ZLJA 3GLGA 4AK9A 1E6CA 2OAQ1 3TVDA 3NBFA 3L8ZA 1XPRA 1N5KA 5UKDA 3M4YA 2GXSA 3WMGA 3C14C 4JLKA 4PZLA 5FTKA 2FV8A 3NDPA 2GTPA 4AG5A 1ZU4A 2BJWA 2GCOB 1MO6A 2CDNA 2F55A 4LBWA 4F4JA 3M1IA 3RSLA 1AK2A 1BOFA 3ADBA 5FOVA 4NCIA 3ZQJA 3Q5EA 1R0ZA 2HXSA 2IW3A 3AKEA 1XCMA 1KJYA 5SZJA 4ZCIA 4ZIRB 3U4QA 4BLPA 2DCUA 3K53A 1FQJA 4ZKEA 3CNOA 4B34A 2JDIA 4MITA 1OXUA 5CDFA 1ZUHA 1W5TA 1Z6AA 2JDID 3FFBA 3QKSA 4GI7A 3HPRA 5G41A 1XJCA 2D7DA 3MUFA 5BN3A 2BM0A 4Q1BA 2ATVA 3GLFB 3PEUA 2J0QA 4E03A 1UPTA 5EP1A 4NYIR 5JEEA 4Q1DA 1XRJA 1GZSA 4EFNA 4D4LA 3AF0A 5DYIA 2RGCA 4IEIA 4PPNA 4A6PA 5J4YA 5LDDC 2TMKA 1Q3TA 2H7VA 1J2JA 1F2TA 1IJFA 2P2LA 5DLQC 2D62A 3RVBA 2PJRA 5JFGA 1S3GA 4GDFA 4JLJA 5EUQB 3X1WA 3BH6A 1GILA 4B74A 4Z51A 3K0AA 4B48A 3NH6A 5CLLA 1PUJA 5C46F 2HDNB 3KQNA 1LFDB 2J5XA 2FEMA 4JZKA 4OQMA 1J70A 1OPXA 2VSXA 1Q0UA 1VCMA 2DR3A 3J81k 4OQXA 3LQQA 2Y8EA 2DFTA 1VYUA 5AR1A 4FMDF 2OO7A 1XXHA 8OHMA 1E0AA 1BMFA 2IUTA 4BFSA 4U02A 1T3SA 1SKYE 2ZE7A 4P0TA 4I4LA 1BMFD 2PZFA 1UKVY 4LJ5A 3T5DA 2ZROA 4QBHA 1MKYA 4AYXA 1BYUA 3EC1A 4B3DA 3GLHE 1UBFA 3A1SA 3NWJA 3FHTA 3D8BA 5TARA 5KPDA 1UKYA 4X8OA 3I73A 1MOZA 3OF5A 3BAFA 2VHQA 2KBEA 1CEEA 1FQKA 2IYXA 4RY2A 1FUUA 4PFSA 3U61B 3MJRA 1AS3A 4JYCA 1OB5A 1NLZA 5HE8A 1Q3HA 2DFLA 2JLSA 1AM4D 5SZHB 4TL7A 1YE8A 2HF9A 2AR7A 2HLDA 4RD4A 4WAUA 2K5UA 2WKQA 1G291 2XZPA 1E2DA 2QGNA 5AJYA 4F91B 2HLDD 4JKIA 3FYHA 4G5RA 3BRWD 2XB2A 3N2EA 3RRMA 1EWRA 2FNAA 1KJWA 3GJ7A 3OZXA 1EX6A 1YZTA 3ZIAA 4HZIA 2YVUA 4DDUA 2QTVB 4LPSA 4QNRA 2RHMA 3ZIAD 1J7KA 4IHQA 3VHLB 1TQ4A 1ZCBA 2QMHA 1RRFA 2R6FA 3THYA 4G5SA 3IPYA 1U0HC 1KDTA 2QRZA 2F43A 4LK2A 1JEEA 4MUBA 4WIAA 4D2IA 5H8WA 4N3NA 1RYFA 1XMSA 4NZYA 2VP5A 3LAWA 1T0HB 1N0WA 1A1VA 2A30A 2ZJ8A 5KHOC 2DB3A 4YXWA 2UZ3A 3V9PA 1KKLA 2FH5B 2IXEA 1H8HA 4GSYA 1YR9A 2ZUDA 1NMXA 3LY5A 4HB4A 3Q85A 1VCOA 2REXB 4YXWD 4B44A 4A0FA 1JXOA 2E1RA 1H8HD 4MYHA 5EZ6B 1XEFA 4EIWA 1WF3A 5AJWA 4X8MA 3A1UA 2W83A 4QGAA 4B6FA 2KWIA 3RS3A 4ZDJA 4LJ8A 1UDXA 5TXGA 4LHZA 4XOIA 5EZ5A 2ZRBA 1L7VC 1E9AA 2CXXA 2A2ZA 3B1ZA 3UKDA 5FBQB 1KNQA 2X2FA 1TMKA 5JLJA 2YOFA 2QNRA 1NSFA 1G3MA 2WWFA 1ODFA 1UEIA 2GJ8A 2WJIA 3L0IB 1I2DA 1KAOA 1KI6A 1SKQA 1TEXA 2H17A 3VKGA 3PEWA 5BYJA 4PSAA 1A82A 1I4DD 4TL8A 2GAOA 2BBOA 4G0NA 1ZAKA 2VP0A 3EC2A 5CB6A 3MWLA 1N6PA 1VPLA 5FOTA 2LCFA 2GVZC 4Q01A 3UWKA 1F6BA 5EP3A 2ZQ5A 2J7PA 3THOA 1ESMA 1JR6A 3PUVA 2IYSA 2V7QA 4OHXA 2R6AA 5KDLA 4GBMA 1IY1A 2YWEA 4OHYA 2J7PD 2ZE5A 4YC7A 3SE0A 1Q57A 4JSYA 3RS7A 2V7QD 1TQDA 4HAZA 4GT1A 4POAA 3QKRB 3SHWA 2W6IA 3AGQA 3IBGA 1DARA 2OCYC 4IDOA 2A5YB 3ZD6A 3PITA 3GLIA 4TL6A 1RVDA 3P4XA 4UNQA 1II8B 2VHTA 2W6ID 1X8KA 1KZ7B 3C7KA 1UF9A 3SHFA 3BH0A 1E2KA 2A78A 3K70B 1JJVA 1SXJA 2JAQA 4NCKA 2J59A 3RSOA 1G4AE 2IYQA 5K8IA 5KNBA 4TTPA 4YMUA 2WWWA 2IYZA 2CHVA 2REBA 1KIMA 1SXJD 4NMMA 1R6BX 3B1WA 3KX2A 1EFRA 1XPUA 1I4LD 1RJ9A 4EJSB 2VF8A 1P61B 4DDVA 2FFAA 2A5DA 3SQXA 1KAGA 2ZE8A 1R5NA 1RE0A 1EFRD 2FGJA 4IVQA 1N6LA 1ANKA 4F38A 3GD7A 1N6KA 3IILA 3CM0A 1KK1A 5FPSA 5G3ZA 2BCJQ 5KNCA 4JLVA 1SVOA 1T3LA 4OKSA 2J87A 2GXQA 2IT1A 3IPXA 5L3SA 2XAUA 1XD2A 4ARZB 4WW0A 2JLUA 5L3RA 3SI7A 2QORA 2NO7A 2C95A 1RPZA 3G82C 4CIDA 1H8EA 3R9IA 5HCIA 3TLXA 3AGPA 3IHLA 2QRNA 1XMJA 3CB4A 1H8ED 1VG8A 2UVQA 3RWOA 1MR3F 4GNKA 2PMDA 2EWWA 4M1TA 3TQCA 2LWIA 4A92A 4E22A 3PV0A 5A5GA 1GDDA 3KKOA 1DAFA 1CJUC 1N0UA 3MAAC 4XVUA 5BW8A 3B13B 2YHSA 2GJ9A 4R2HA 4P4SB 5GADl 2CHGA 2CEAA 1CP2A 2BOVA 1OF1A 2ZUBA 1ZNXA 1L2TA 4XIGS 1EESA 1R0XA 2Z0MA 3TUZC 2G9NA 4L8GA 4QGFA 3TVTA 3GLGB 2RH5A 4DSUA 5GJVC 3OAAA 4M21A 1QHGA 2XOKA 2VL7A 4JLOA 1M1YE 2BVNA 3W5IA 2F1JA 3WP0A 4D6PA 1KSHA 2R6CA 3TBKA 4B3CA 4NCJA 2FN4A 2XOKD 1NN1A 4PHGA 4Q48A 4CGZA 4BE7B 3TW8B 3VAAA 3NVAA 1IN4A 1Z6YA 3FTQA 4JBYA 3T5GA 1C9KA 5IRCD 1Z0KA 1WP9A 3FOZA 3U4QB 5DGXA 1WRBA 2O5VA 5F98A 2G1KA 3B9PA 4PQFA 4PAQA 4JLPA 5KSYA 2NGRA 1MO5A 4XVQA 2IYVA 3UANA 1XJQA 2WJJA 2C78A 2YWFA 4XWOA 5KSOA 2XZLA 4LBVA 4LYJA 4TLEA 3IHWA 4ZI2A 4WA7A 3NBZC 4YLGA 5C4GB 3IGFA 4TQUS 2VTKA 3QKSB 1LF5A 1LS1A 2EFDB 4IKEA 3I5YA 4HLDA 1U94A 2ZU6A 2VP2A 1EK0A 1VG0B 2ZSEA 3CR7A 3BS4A 3CH5A 3CNLA 4C30A 3X2SA 4PX9A 4C0QC 5TV2A 1N6NA 3SYKA 3LVQE 5LBIA 4TLDA 2EYUA 2MMGA 1E9RA 4P4TA 2WV9A 3MWKA 3DO6A 4WBSA 1F2TB 1L4UA 3RAPR 2ATXA 1XFAA 3QXCA 4DLYA 5JSZA 1QHNA 1G5TA 3K0AB 3PIRA 5GJWC 1QHIA 3CPHA 5AUQA 4R98A 2ZRIA 3E70C 3SYNA 4LYHA 3VR4A 3SS8A 4M9SA 1UDWA 2PCJA 5LB4A 3GQBA 3RANA 1NLYA 1Z6XA 1XXHB 1Z22A 2XNDA 1G8FA 4RCZA 3OEHA 1RC8A 4Z8XA 1W4AA 1TU3A 3E2IA 2O0KA 2XNDD 4TLBA 2P6NA 4XSHA 1A7JA 4PHHA 4DZZA 3OEHD 4DCSA 2FFHA 3WRXC 3C5HA 4FW9A 2NPIA 3RDPA 4OI1A 3AP3A 4FXPA 5DYGA 2ZSBA 2GJKA 4GFDA 2ORWA 1RRCA 4V0NA 3VU9A 1FX0A 1TUIA 2O0JA 1D5CA 3DVLA 4V0LA 4PQYA 2B6HA 4I1UA 4I1OA 4QFMA 2OT3B 3VR2A 1OV4A 5IT5A 1D2NA 3VR1A 1E32A 2IYYA 1NIPA 1NP6A 3FKQA 3LXXA 3EZ6A 3KKNA 3SOPA 1SHKA 2CNWA 5TY0A 3LWNA 3VQTA 3CRRA 1P75A 2RGDA 2CNWD 4QBFA 3T61A 2FJUA 4OK6A 2D2FA 3ZQ6A 2CE7A 5KUTA 3OFNA 3T06B 3E1SA 3MLEA 1E4VA 1FZQA 4OYHA 3OFND 4P31A 1GNPA 3I72A 3K70C 4LCBA 3THYB 2ZS8A 4PPQA 1ZW6A 2F43B 1CJVC 2X1VA 3SJAA 5HZHA 3VFDA 5EE3A 3QOFA 3A37A 4LY6A 2BWJA 3K0CC 4MGIR 1E69A 1G20E 1YZLA 3MSXA 3WNDA 1K5DA 4FWIB 1BIFA 2FA9A 1SVIA 3CUEF 4G5QA 1AA9A 4KFSA 1W48A 2ZJYA 3RWMB 3TGPA 4DSOA 2OEPA 3U7HB 2O8BA 3B60A 5H1YA 4NHOA 2QN6A 4DLZA 2QA5A 3QSYA 1DAMA 3L43A 4Z1MA 3GFPA 1II0A 1D9ZA 1NMZA 3CWZA 2QAGA 3Q9LA 4E5UA 1NNEA 4G5GA 4Z1MD 2IL1A 3FDIA 4HSEA 2AX4A 2JLWA 4S35A 2FZLA 1ZUIA 2J0SA 5CLQA 1E9SA 3Q7QA 2QPAA 4TLAA 2ZVPX 4TMVA 3QXHA 5DNYB 1KMHA 1QRAA 1US8A 3S1AA 4DCNA 2G83A 1Z6TA 2HCBA 2ZS7A 4TMKA 5DISB 1OFUX 2WWYA 3D7MA 1DBSA 1JR3E 3LO5A 1CRPA 4O2RA 2G0NA 1SVWA 2UZIR 2JLXA 2NO0A 2CVHA 1GAJA 4FN5A 1F48A 2KJQA 3AUXA 4AKGA 2ZPTX 1KI6B 4B47A 2OE2A 4DDTA 1ZVQA 3HYTA 3CNNA 2QQEA 3FHOA 4PPGA 3HP1A 3FMOB 3I32A 3RC3A 3DM5A 1NN3A 2OXRA 4EPTA 4V02A 1NLFA 3GEHA 2D2EA 3SFVA 4O2LA 4QL3A 1UEJA 4LJYA 2VO1A 5HE9A 4ASUA 1OXXK 4AYTA 4OI2A 3QKTA 3AUYA 3IBYA 4V0KA 4FI3C 4HLUA 1QHHA 2GESA 2GF9A 4MRSA 4LV6A 3U3MA 2CLDX 2QM8A 4MGYR 2R6GA 2GCNA 4W5JA 4D4MA 3PCRB 2FDCA 3AKCA 3GLIB 2QTHA 1NG9A 2W2TA 3W8NA 5FPKA 1RRGA 3EASA 1AKYA 3LLUA 3Q3JB 3QBTA 4HUTA 1SXJB 3BH7A 4M53A 2DWPA 1Z06A 4QJ4A 3L0PA 5ELXA 1UKEA 3A4NA 2J41A 5JCPA 1RJ9B 2JIZA 4P3YA 1UFQA 4DHEA 5JHHB 4I1SA 2JIZD 1E2GA 4UJ5A 4F92B 2ZRPA 3RS2A 3TUJC 4Q4LA 2R6DA 2ZUCA 1GNRA 2CLCX 5B58C 2EFGA 1E2HA 2PH1A 1XD2B 2GNOA 5L3SB 4JLAA 5HCNA 2CCJA 3N2IA 3OEED 2F1IA 1TEVA 1XWIA 4LOAA 2JA1A 1NVWQ 4BLOA 4LHXA 4ZCMA 2JLRA 3IO5A 1E2JA 1JEDA 3KKPA 3CIOA 4Q00A 2V3CC 1UADA 1JNYA 5FPTA 1N6RA 3HPQA 4I99A 2IXFA 2XTMA 1DOAA 1O3YA 4KU4A 4LGMA 1DTSA 3BB3A 2ZR9A 2BMFA 4Z8YA 1VYTA 5L3QA 3DEFA 2QI9C 4N1AA 4TL9A 3W90A 1ZIPA 2ZSFA 4RZ2A 1MV5A 3C5CA 4BPBA 1MRNA 2BMDA 3CR8A 1DVRA 3T12A 5J4KA 2WOJA 1E96A 3FGNA 2PZGA 1XEWY 4KFUA 3SC3A 2R65A 1E2PA 1MABA 2ZRGA 4IDPA 3X1YA 4A6XA 1AS0A 2HYDA 3CLVA 1IN8A 4N0EA 4MYCA 2R9VA 4U00A 2W6JA 5FPHA 4CT4B 1CR1A 1A5TA 3ASYA 5GJCA 2VPPA 4DLTA 2W6JD 4URZR 1T3HA 5KDDA 1JPNA 3MCAA 2JJ8A 1KSJA 1AQYA 3O8BA 3QEJA 4DLVA 3AKDA 3ZZUA 2OLKA 4A4DA 2PEYA 3EIHA 2L0XA 2CL6X 4KODA 5D3MA 1NJGA 3HR8A 3NHBA 1GITA 2RGNA 3BGWA 3FB4A 3UXMA 1EFCA 3PEYA 5BYKA 4JJKA 2ZJZA 3L0SA 3I4LA 5C18A 4PZYA 4YQFA 4MYUA 1EGAA 1PJRA 5AJZA 1T4GA 3THWA 5FBWB 5CIQA 1E2QA 2QL6A 5E7MA 4DLUA 4M8NE 3GEIA 5JWRA 2HUPA 4EPWA 3EARA 3KB2A 2P5TB 5FOUA 4M1MA 3GPLA 1XDBA 1CIPA 4BFXA 2HJGA 5J40A 4Q1FA 4Q7MB 1ZD1A 1KK0A 4QGGA 2WTUA 1YR8A 4ZCLA 3A1WA 1P9WA 2QM7A 2I4IA 2QAJA 3CF6R 4V03A 5DI3A 3P4YA 4C0BA 1W49A 1RKBA 4Q9LA 3ETLA 4FCWA 1DAGA 1MO4A 4D82A 1ELOA 2KI5A 2PEZA 4A36A 2AWNA 4I81A 4IOJA 1SVKA 4BLQA 3GJ4A 5CIWA 2NTYC 2GF0A 1CTQA 2FWRA 1ETUA 1ZMXA 3QNUA 2H16A 1YR6A 1MO3A 1E2LA 2XSZA 2Q9AA 4EUNA 5JSZB 4YMVA 1AJEA 1EFHA 3KUCA 3D3QA 2IK8A 5F3WB 4IDHA 2XSZD 2RB4A 2QQ0A 3IIKA 4B2LA 4TYWA 1NL3A 2NZJA 3JZAA 3MMPA 1TL7C 5DIFA 4IEEA 3BC1A 1Z28A 4PHTA 3AVVA 4QHYA 4QBIA 3ONWA 3GCGA 1P2UA 3KXIA 4D0LB 3ZYCA 5DI9A 1LTQA 1R5OA 3OHMA 1UBEA 1TQ6A 3K9HA 4HAYA 4RD0A 1ZM3A 2VHJA 4UNNA 3HJNA 4B2IA 3F5FA 3VNUA 1W36D 2QENA 2XJ4A 1UJ2A 2WPDA 2DFKB 4QHSA 2EFCB 1T0JB 3VU9B 1FX0B 1S9HA 4KFTA 2C9CA 2WPDD 1WBBA 2XGJA 4V0ME 4OQNA 4XD7A 2G6BA 2WJGA 3RRZA 3PG5A 3EPKA 3EZ2A 1LS6A 4Q4JA 1AGRA 4IOLA 5DO9A 4XD7D 4EAQA 4F93B 2VIIA 3LQRA 4EPVA 2ZXUA 4C2UA 1NKTA 4NCHA 3QPWA 4KLNA 5JRZA 3LA6A 4H1VA 2FFQA 4ZDWA 1E0KA 1G41A 2IYLD 2FEOA 3TNFA 3IUYA 5C4MA 4DC9A 2GJAA 4Q5IA 3BXZA 4EFLA 3P26A 3B2EA 3B1XA 3FMFA 3KFXA 3CRVA 4MKHA 4B71A 4NU0A 5HZKA 2ZAOA 1YQTA 4QHTA 3LW8A 1IM2A 2RGGA 5FUYA 3SJBA 4B35A 2Q9BA 4LJ9A 5EXPA 1SXJC 3UMRA 2MSCB 2C8VA 3NBYC 4PHFA 5AK0A 1YU9A 2HEIA 5FOWA 2A5JA 1L4YA 5IF9A 4TTRA 1VYVA 2EWVA 1P62B 2FU5C 3L82B 3AVPA 1GIAA 5J4HA 2J1LA 4LX0A 3RLFA 4DXAA 4URXR 5AWFC 3UWOA 3KKQA 5FBLB 4FD2A 4JYBA 5F9FA 1NVXQ 4QJ5A 2WVJA 4N0DA 2VQSA 5FBVB 2O8BB 1G64A 2ZRKA 3CZQA 1X8LA 1FP6A 1VMAA 1XMVA 1FUKA 4M0LA 1CRQA 1GG2A 1GKIA 1TF5A 1CF4A 4HI0E 3E5HA 2QAGB 4TQAA 2NO1A 4TMZA 2ZRMA 3M6AA 4LBZA 4X8LA 4MYTA 3TH5A 4AG6A 3UG7A 2AK3A 2C98A 2H8KA 3IEVA 3QJYA 3WY9A 1R0YA 4UQOA 1KMHB 1US8B 1WQ1R 1E1RA 3S1AB 5FTJA 2IUUA 2G1JA 4JL5A 4WVFA 2ORIA 5AJXA 1E1RD 4CEHB 1GL7A 3M0EA 4W5HA 1DEKA 3F8TA 1NBME 1XX6A 521PA 3RYTC 1W7AA 1F60A 2IF0A 4FCTA 4LUCA 4Q7LA 4LRWA 5JJIA 4QM6A 4S2EA 1OFHA 1PVOA 2E87A 1KO1A 1GWNA 4Q1CA 1TTTA 1Y3AA 2HF8A 4FMDB 1IXSB 4GPTA 3H0KA 1P9RA 2Z6VA 4QM7A 4L4UA 5B64A 4IFEA 1VKJA 1Z8FA 1T8UA 2RMKA 1F5NA 2B8WA 3GJ3A 2XEXA 1S8FA 2N46A 3VR6A 221PA 1QVAA 2WWXA 3O8RA 1NIJA 5A0FA 2DYKA 3QQ5A 3GP8A 3C16C 2REOA 1E9FA 3EW9A 1ZD9A 4HATA 4RJLA 4PC6A 1IN7A 3AVXA 2ZEJA 1QHHB 4UKDA 4E09A 2NZ8A 1Q1ZA 4NP6A 4C0LA 3EXAA 3QIAA 2AKYA 4GMXA 4M9XA 1YZGA 1FMJA 4MKGA 1YKSA 2H57A 1TQ2A 1F3OA 3CONA 3IQXA 4MRNA 4E07A 3K0SA 1JECA 1X1RA 2JJ2D 4R9UC 4OHWA 3ZVRA 3NC0C 4MRPA 3U60B 2OM2A 1XCPA 1OYYA 3KKMA 3QF7A 3W3ZB 1NN0A 2BMJA 5M04A 3CRMA 3RS4A 4Q02A 2XZOA 4GZLA 1ZBDA 3LD9A 3U44A 2QT0A 1NY5A 4YMWA 2QBYA 4EPRA 4AURA 4C0AC 1GSIA 3MRSA 2R62A 3DKPA 4A2PA 3AVQA 5JWHA 1OH5A 2XXAA 4ACAA 1II9A 3L8YA 4RZ3A 2W2VA 4QNMA 2XB4A 2MSDB 5LB2A 3WNCA 5BN4A 1D2EA 1U8ZA 5KU1A 2N1BA 2X2EA 4RCYA 1G3QA 3BK7A 4ZDKA 3AVTA 2ZRJA 4A9AA 3VR5A 4BGDA 3KTAA 4BFTA 1G4UR 3ECCA 4W9MC 2OV2A 2RGXA 1RFLA 1GNQA 4P32A 4CEIA 4NKRA 4FWTA 4LJ6A 1ZCAA 1CLUA 4IDQA 4BRWA 3TR5A 3BB4A 4QGHA 3AKYA 1ZC3A 2LKDA 3CPJB 3KUDA 4RZUA 3ZD7A 2A5GA 2BDTA 1D6JA 1D2MA 2W2XA 3QPVA 4K8OA 3TAUA 5AUNB 4P4UA 2JLZA 4UNRA 3ADDA 3TIFA 5JECA 3W6NA 1J8YF 2V1XA 4PANA 3WYAA 1W1WA 3AB3A 1XCGB 1XNJA 2BIFA 3UATA 1Z07A 3CPEA 2PMKA 4HDCA 1JR3A 5L3QB 5L8VA 4KXFB 1XEWX 2VRWA 1O87A 3MG9A 1GKYA 1JR3D 4ESVA 3WHKA 1CKEA 1G19A 3PR1A 1AIPA 3I62A 5GJBA 3Q5DA 3PUXA 4M4SA 4LJ7A 4PSVA 3ICEA 1E0SA 3GLGE 3KZ1E 4TSFA 1MABB 2Q6TA 2WJYA 1CJKC 1DO0A 1CJTC 1E99A 1HQCA 2ZSAA 1AS2A 4KI0A 4L16A 2XX3A 1BKDR 2WSMA 3P32A 4TSFD 3ZS8A 2IXGA 3D31A 3U7GA 1P6XA 1YZKA 4BFYA 4C2TA 1ZM7A 3MJHA 2H18A 5D3MB 2B21A 2QPOA 2QU8A 4D81A 1N25A 3A36A 1DAHA 3PJRA 2G77B 4URUR 4DLSA 1E9BA 4BZPA 4MUAA 2B7CA 4TZ0A 2ODWA 3THWB 1D9XA 4TQ9A 3X1XA 3DL0A 1G8GA 5GVSA 4TMTA 3FPAA 2IS4A 3N70A 3QEOA 1CS4C 4M1KA 2O8EA 3LX8A 2OBLA 2ZS9A 4NYMR 2ZRFA 5F2EA 1T91A 1J90A 821PA 1E2MA 3A1VA 1VIYA 3CF2A 1P2SA 1P2VA 1U8YA 4D25A 1GKUB 3VMFA 5DI3B 1P60A 1F2UA 1KI3A 1AN0A 2CBZA 2BMEA 4OBEA 3ND9A 4JVMA 2Z83A 4PSKA 1G5RA 2Q3FA 1Z83A 2GWHA 1G21E 4K81B 4AD8A 4C0HA 2AXPA 2ODBA 3ND8A 3HDTA 1N5JA 2GEUA 3K9GA 4TT3D 1T6NA 1W2HA 2YWHA 1QBKC 2IF2A 2YJTD 5J4VA 2A5FA 1QVRA 2QAGC 4HB3A 5CITA 2QROA 5J5CA 4GRAA 5DHFA 3SNHA 4RFVA 2DWQA 1Z6GA 3NXSA 2IWRA 5CK5A 2VP6A 1FNNA 1ZM4A 3EX7C 4JVNA 2ZETA 4U5XA 2D06A 3HYRA 4HUQA 1ZD8A 3I8SA 4HLCA 2FSHA 4CF7A 3A4LA 4A8JA 5JZVA 2GJSA 4KITB 1DAIA 1TF7A 4L5BA 1GVNB 2IHYA 4RD6A 2IUSA 4ON9A 2OHFA 3RS5A 1W36B 2OSBA 3GJ6A 1BH2A 3DOFA 3KJIA 3PUYA 2ZSDA 4HB0A 1KJZA 4PTLA 2PBRA 4KHZA 3SBEA 5EP4A 4LWZA 3DPUA 1PUIA 2BEKA 1JB1A 5EJEA 5KDOA 4DLXA 4Q9JA 3QBVA 4NTZA 5DN6D 2GEVA 2JJ1A 3AH8A 2MSEB 4KV9A 1EFUA 4LDJA 3KQKA 4DLRA 1Z0AA 2JJ1D 4Q4JB 4Q1AA 2JLQA 3REGA 1T9HA 4NE2A 5EUMA 4LC1A 5G3YA 2C04A 3QG1A 1X86B 4HLUC 5L3VA 1R2QA 2VHCA 2OFWA 1TU4A 1XP8A 3EWAA 1Z29A 4WXRA 3U3JA 3LFUA 3VKWA 2WKRA 1SVLA 2YYZA 4TYPA 4EQ6A 2BM1A 2JEOA 2OBNA 5BQ5A 5TVKA 3TE6A 2WIBA 1DAKA 1KNXA 4D26A 3HU2A 1N3BA 2W0SA 3B78A 4JKYA 1JI0A 1L8QA 5K8UA 5HPYB 3NTUA 3KQHA 2WJHA 1VHLA 4QKQA 2I1VB 2YZ2A 4C0KA 4ZV4A 5FFMA 2FFBA 1C1YA 1HY3A 2FMXA 5E95A 3KQLA 4D4KA 2JCSA 3JVVA 2EW1A 3KXLA 1JQJC 1R5BA 1P4SA 4RZXA 4PAMA 1OIVA 1P72A 4ZDIA 4F7WA 1E0JA 1E98A 1G9XA 2V6JA 1AQUA 2OFOA 3TSZA 3EPJA 5G53C 4D80A 3FFAA 1NJFA 3TRFA 1W2GA 2QG6A 4QRHA 4GOXA 1X8JA 4V0OA 1CBUA 4JLMA 3W34A 3KXKA 4Q66C 4B43A 5E7JA 1ZYUA 5KNDA 4M2LA 4FMCF 5JWOA 5B30A 2YC2C 5SZIA 5SZKB 4C3ZA 4HB2A 1YVDA 2ZR7A 2PX0A 4URYR 2XITA 2OESA 3ADCA 3GEEA 3B7GA 4DSNA 5JJLA 2FPKA 2YNMA 1U99A 4XTCS 1U0LA 2WICA 2KSQA 1N5IA 4B33A 4HDQB 3O47A 2F3RA 1VECA 4AC9A 3UPUA 1N6HA 3G0HA 3BWDD 1T8TA 3FKSA 1NVUQ 1FOEB 2AK2A 2DWOA 2FGKA 4NYJQ 3U3OA 3FKSD 2HT6A 2JGNA 3ZJYA 2O8DA 1OJLA 2FF7A 1Z0JA 4HZUA 4BECA 1R10A 1A2BA 3R9WA 2V9PA 3TW4A 2GK7A 3QKUA 4GZMA 5C1BA 2O8CA 2XJ9A 1S96A 4B3XA 4CRWB 2PZEA 1AGPA 3L2OB 4M22A 2RAPA 1I4TD 1Y63A 1ZM2A 1XZPA 1XTQA 4MQBA 1NSTA 1KY2A 1Z0FA 2GKSA 2GZHA 2O52A 4JLNA 1FFHA 1M7HA 3NEYA 4LYFA 4PO1A 3BB1A 3WMEA 2JASA 4KJZA 1M8PA 1TUEA 2IX3A 1DG1G 4EFMA 2ZVQX 1YR7A 5EE1A 2GRJA 1Z3IX 4XTRA 2RGNC 1Q22A 3A8TA 4TYNA 3FE2A 1UBGA 3C41J 3QVUA 4IW3B 3TSWA 5JCZA 1PZNA 2IHBA 4DDWA 3GLIE 4FIDA 4C0SA 3DM9B 4A0GA 1FTSA 2G88A 2IS6A 2BC9A 4MGZR 4TMWA 1SXJE 4ILEA 3AF2A 3T1TA 4AKHA 5J47A 2QBYB 1XEXA 3U44B 3GLHA 3NIBA 3EIQA 2BCGY 2ZE6A 1LVGA 1ZM9A 2XXAB 4IOKA 4PC3A 4JLBA 3CWQA 4PO9A 4AKEA 2F9MA 2Q0HA 2ZREA 4DVGA 1N6OA 3K8YA 4JT4A 4LZZA 4HAUA 4W7SA 5EXXA 3ZH9B 2WSSA 2C96A 1CJMA 3DZDA 1Z47A 5FTLA 3KTAB 1HT2E 4MH0R 3EAQA 3NH9A 4RD3A 5JS7A 5CJPA 4DCVA 4CEIB 5JHGB 2WSSD 1DELA 4WOPA 3QF4A 2IEYA 5FR1A 2ZYVX 4NYJR 3T1QA 3A1TA 5IHPA 3SN6A 1WMSA 5EQTA 4MKIA 4B2PA 2QP3A 2P0EA 3RNLA 4NDZA 1K5GA 3UK6A 4MRVA 5FI1B 3AF4A 2WBLC 2KB0A 1S1CA 3X1ZA 2QPTA 5H70A 2WMOB 4P33A 3BJIC 1U0JA 5F9HA 2PT5A 4OHVA 1UM8A 1R8QA 4AI6A 1PLKA 3B1VA 1NBMA 2BBTA 1W36C 2J0VA 3T35A 1OXVA 3R7WA 1NBMD 2MMCA 3A4MA 3Q8XB 1GL6A 4KVAA 1SQ5A 1OKKA 3TMKA 3OEEA 2FX3A 2WKPA 3X1DA 5JI2E 2H1LA 1JXMA 1OKKD 3CX6A 2ZRNA 2DBYA 1IN6A 1W44A 2VP9A 4ESHA 2F9LA 3GJXC 2V8OA 1YZUA 1BYIA 4CT5A 3PENA 3VTKA 4UXJA 2ZJ5A 2V6IA 4OI4A 5JEDA 4Q4AA 1IXRC 2NPFA 1Q1BA 4Q4HA 4URWR 1VDZA 1XF9A 4LJAA 421PA 5K8LA 1G6HA 2OCBA 1P73A 2BHRA 1U9IA 5JMTA 3R9XA 3A6PC 2PCLA 2QP4A 2A7QA 3BFVA 3NG1A 4Y0AA 2QSZA 3B8HA 4PXAA 1XB2A 2WIAA 2QY9A 4MDFA 5FOXA 2W58A 2O8EB 1QZXA 4X8HA 2QZ4A 3SU8A 4JBWA 2R2AA 5HTKA 3TUIC 3UG6A 2C99A 2ZI9A 4QXAA 4QJ3A 1JALA 3Q7PA 4DBLC 4PC7A 4LHYA 4YDHB 1QG2A 2ZYTX 3LBIA 4TN1A 3SZRA 3T15A 1F2UB 1XMIA 4DIEA 2ODEA 2EYQA 3K09A 4BFUA 3W6PA 1E1QD 2GXUA 1HYQA 3CZPA 3WBJA 4YMTA 1S2MA 1V43A 3HU3A 3PUWA 2FSFA 1IAQA 4D0NA 2WZQA 1E2EA 1OFIA 1N5LA 3L0OA 2OILA 3IDQA 1WBDA 1C4OA 2YV5A 2C77A 4QOSA 1DO2A 3AVYA 1TF2A 1R4AA 1VG9B 2EFHB 3C15C 4HUQB 2CL7X 4BLSA 1G7CA 4KBFA 5FOSA 2KE5A 2FSIA 3ICQB 1G3RA 4MDEA 1Q1QA 4LHVA 5EXSA 4A8JB 3WMFA 3U5ZB 3OESA 3GLFE 3BORA 4M1SA 4RD2A 1W5SA 1Q12A 1W4CA 5D3QA 3DKVA 1NKSA 4D0GA 2GZAA 1G7SA 1KY3A 1U8AA 1J99A 2OBMA 3BIFA 1E9CA 1XTSA 1OHHA 1KMQA 3U6BA 2GVDC 4Q7KA 2QMUA 2FPMA 1GFIA 1Z08A 2QTFA 2QE7A 2BBWA 2VSFA 1LV7A 2FSGA 2NQ2C 1OHHD 2C5LA 2C03A 2ZYWX 1VCIA 3RHFA 3QY0A 2IYRA 5C2JB 2DY1A 1M34E 2QE7D 3NBXX 5DE3A 4PZZA 4KBGA 3U2QA 4EDHA 4CVNA 5KPJA 3PEVA 4OK3A 1K6MA 3DZ8A 3FHCB 3RC8A 4O3MA 3K0EA 3TAHA 4PPFA 1W4RA 3WBKA 1KTVA 3IO3A 1IQPA 4M1OA 1RZ3A 3AP2A 3NKVA 4D4JA 4EQ6B 1OLOA 4HYYA 3LV8A 2JATA 3B9QA 5H68A 1WE2A 2AWOA 3FWYA 1KGDA 3LVRE 4G3XA 1YHNA 4AWXA 1WXQA 2P65A 2VYFA 4KVGA 4EKDA 1KO5A 3LDAA 4RFSA 3IKJA 2YOGA 4Q21A 5EE9A 3B1YA 4LPKA 4RD1A 1A4RA 1GRQA 3TQFA 1I2MA 2PLFA 1E79A 2EU8A 2ZANA 1KOFA 4ABYA 1SGWA 1XTKA 1R7RA 2IYUA 2X77A 2NOAA 2ZI6A 3H1TA 4J0QA 4BRUA 4O25A 1E79D 1KI9A 1T5IA
chains in the Genus database with same CATH superfamily
1DRKA 3VDNB 1UIRA 3L3BA 3IOMA 3R3UA 3RRYA 3K9NA 3UK0A 2D2XA 4BFZA 5CM8B 3IAAA 2F1RA 3H6KA 4LSGA 3UKOA 1D4OA 1HC7A 2CK3D 4FR2A 1XTJA 2VJQA 1QIIA 5CYFA 2G36A 1WCXA 2FUCA 2GLTA 4OHZA 3KLNA 3PEFA 5KZMB 4XDYA 2C2YA 3DEIA 4EB8A 5BV8A 4XLZA 2PWYA 1S2NA 2G9RA 5C34B 2HIHA 5LD2B 3SHTA 4HDKA 5HCUA 1PZEA 2RBGA 1IG3A 2ORVA 4E2WA 1FFEA 5KMGA 1QH1A 1NN5A 3EA0A 1LDEA 4G2NA 3WL4A 1YCDA 1QH9A 1EVYA 1OT3A 3FMPB 1OLUA 1I0ZA 4RE5A 1OZ0A 1BQ3A 2I3AA 2ZRDA 4XH9B 2E9SA 3VYTB 3UIEA 1PV4A 3TLZA 3HBNA 2VHUA 1YI0A 4MI6A 4LKRA 4Q6BA 4A0HA 1ESCA 3NPMA 3CZAA 4KPYA 4FINA 4ZAGA 4DT1A 1Y5LA 4DCTA 3VRHA 1BFUA 1DKRA 1H3EA 4HMQA 2XQVA 2G17A 2ENUA 4DV6B 2ZJ2A 3RGWS 1ZHHA 2FOIA 1XNHA 1N7HA 1ZQ9A 2R79A 3H11B 3H2GA 4MGKR 3BMOA 1NRWA 3V2UA 1QONA 4DA0A 2DHCA 1E1CA 4JSTA 3UGKA 3IKTA 5K8CA 3JAKA 5LWHA 1M2JA 3O9MA 4URHA 3I3SR 3PFIA 1HQYE 3MCVA 4UBNA 3TK1A 1Q7BA 4AMVA 2R751 2HLNA 3C1UA 3ZDEA 5B55A 2F59A 5DNUA 2GPYA 3KALA 3M82A 1VXRA 3HO8A 5KYGA 5SY4A 1PT6A 3OBBA 1G7TA 2Z58A 3EVEA 4TMYA 3W06A 3FDJA 1DX9A 4R1OA 4OHFA 4ENRA 3HBFA 4G4SO 3O75A 4CTJA 2GHTA 4LGYA 2QZ9A 1REQB 3OIYA 4E2ZA 2WYHA 4P7JA 5K6AA 4EMBA 2H4XA 2VWGA 3TJMA 1OREA 4UE6A 4NL4H 3WB2A 3EOAI 4LJLA 4DNXA 3TZEA 2C2HA 1XP5A 4CTOA 4RQUA 2D4HA 2NW6A 3L1IA 2R4TA 3C6ZA 1HFKA 3QMWA 4I4NA 3WP1B 3CVWA 1VTKA 1R0BA 1XEXB 2DUMA 3MTAA 1G8HA 4J7CA 1YB2A 3A1NA 4V2IA 3BE4A 2X0DA 1JFSA 1X77A 4PR0A 3R3VA 3WYGA 4DRXB 3P27A 4QQKA 1JDUA 2F3TA 3EGVA 4Y2RA 3E4DA 3H84A 1SOWA 2RH8A 1N5RA 4IXNA 5EKXA 4EMTA 4XVRA 1AKQA 4EB0A 1H69A 2DX7A 2OSVA 4HDMA 4RY8A 1Q44A 4QYXA 3AWDA 2EQAA 5LUBA 4IDNA 4BTLA 3R5HA 5I9SA 4TYQA 3GGDA 4OK5A 4MMZB 5ITZA 2IBMA 2JJ2A 2N42A 3ONFA 5BR4A 1N32B 1RJEA 2OGZA 1IJEA 2PV0A 3MTDA 2GSWA 3ZJ4A 3D6JA 4FILA 2AL7A 3OURA 2VNHA 1YI1A 1IEWA 1QLWA 2VSOA 2W6ZA 3FAKA 5DDIP 1IZZA 1PWZA 2CVFA 2PRSA 3BBPA 4N7BA 5KSWB 1ZUNA 4UPVA 3WSVA 3W2TA 4E08A 2JLVA 2INGX 1RM5A 4BX0A 3EJWA 1TT5B 3VKVA 3KEMA 2Q5LA 4IVRA 5EIEA 1P5ZB 1M1XB 2H4YA 2HFJA 3M9WA 3R20A 1KA9H 2C58A 1IY0A 3P52A 4AUMA 3ZDCA 1WWKA 4JA2A 5A9TA 4E0BA 4E5DA 1JLLA 1WDMA 4RADA 4KKXB 2IEZA 2IWHA 1HOTA 1PZHA 2Q3DA 1L1RA 5FA5A 4AROA 3KOWA 2REQB 5FL7A 1E2FA 2Q8PA 5AIAA 4KWIA 5AM2A 3V6LA 1DEXA 4WQMA 1Y7TA 2GDJA 1E3MA 4Q7EA 2H4WA 5JMOA 1GCOA 2F17A 3E58A 4US0R 3A6EA 5DTRA 2PTGA 1F0PA 1G5QA 1XZHA 2NO6A 2PSHA 4IS2A 5H7XA 1OVGA 4LRQA 4Q9HA 5AJHA 1MTOA 2QJFA 2Y9PB 4NEHB 4YUYA 3ZDRA 1QIHA 1SBNE 5IH3A 3HNOA 4ZK6A 2X0IA 2FEXA 1D1SA 2RH9B 1M2OB 4E5MA 4JEMA 5JIBA 1G17A 3FH0A 4B76A 4CMCA 3KT6A 3QG5A 4YJGB 4ZJYA 4Q4HB 5AXBA 5CJJA 2DCMA 2W2KB 1NBHA 3CV3A 3I92A 5BT9A 5H4GA 5CA0A 4K87A 2SNIE 5K0LA 1IJKA 5BQ3A 2ZGVA 4EI9A 4MOWA 1JIKA 1J2YA 2GKOA 1Y8CA 4EYOA 3ZLUA 5HK8A 1U6KA 5JS6A 2OG1A 5HRAA 2WAMA 1UKCA 2ODNA 3CKLA 4L3OA 2HT1A 2FSSA 1D09A 2BZ1A 3OLVA 4H1UA 2OUKA 1VJTA 1QAOA 5BUCA 2R1VA 5IT0A 4GM0A 2IEBA 4Q3LA 3RG2A 3GZNA 4KK4A 4ENPA 1YS4A 2OPBA 3O1IC 5E3JA 5HKKA 1IJBA 2AW3A 2QX6A 3P9RA 2O8FA 3DFZA 3P1JA 4Y3UA 4PX3A 2HIAA 4H1TA 1CUUA 1KEVA 2FPOA 2WWGA 1YVPA 3ZQ4A 1AXRA 5KTYA 1X1EA 1U65A 1AO3A 3D4NA 4PRZA 4B40A 4EVQA 4NCBA 2C0PA 4LOHA 3B6EA 1B0AA 3DDCA 1ESNA 3MELA 4FEEA 4P93A 5EERA 2V7GA 2QW1A 3I2JA 4R6WA 2GHIA 4KO8A 2BCEA 1X92A 4ZVOA 2G08A 2BGKA 4YYZA 1IXYA 3WAKA 3NVMB 3ZHCA 3T5AA 3P0EA 3ET5A 3ITNA 5H02A 4YQFA 4EJ2A 3V97A 3DTYA 2FG6C 4ZCRA 1BE0A 1HH4A 1JHVA 1WDWB 2B2CA 1EP2B 1CULC 2JD2A 2Z4RA 3G0IA 3KTOA 4MS3B 2OYRA 2JIPA 2CJWA 2YNMC 5C35A 3TCNA 4M9ZA 1V39A 2M2IA 4OQEA 4HH4A 2NVWA 3K92A 4PLTA 3EPLA 1MB9A 1FLNA 1XKQA 1RHKA 2DBQA 2OCAA 1C41A 1D8TA 2BBSA 3I6BA 2R6R1 3I6YA 3ICOA 3OCVA 5K09A 3EEOA 3RAFC 2OHXA 2YW9A 2QNIA 3IAUA 4HGZA 1FNSA 2GAIA 2J3EA 4WXPA 1EA7A 4ZU3A 5BW6B 2F00A 2CYCA 4TT3A 4PGAA 3V4FA 1BS2A 5FPQA 2R7MA 4BEWA 1HMYA 5H80A 1FTNA 3ZDDA 2NIPA 3EZ7A 3L79A 1QXSA 2H7YA 3W79A 2XQIA 1SQFA 2I33A 1GPKA 1TUGA 2GLUA 2D2IA 5IXJA 3IUEA 4K9LA 5EWLA 3CLHA 4JODA 4YRKA 5CB0A 3DHWC 1RBQA 3ZVLA 2OAP1 1FP7A 1V1MB 4CTMA 3V8RA 1JA0A 2QI9F 1C3VA 1S2GA 3GJZA 3ZC3A 4LHWA 5BMOA 1MH1A 2PSFA 4KO4S 3I83A 5HF5A 1RI2A 3VX4A 1WZNA 4QRIA 1XXHE 2PX3A 2HQBA 3EC7A 4DUGA 3QXXA 1VHTA 3W4KA 5KB3A 3I8XA 2J46A 3LGSA 2AFIE 1U3VA 4KBYA 1NG1A 4UW9A 3CW2A 3JY6A 4B6EA 2J0EA 1ID1A 3ROTA 3RRJA 5KQSA 4JVSB 1PYOA 5FLXA 3QUSA 4NMXB 4RVHA 5HGJA 2V03A 4K26A 1KXJA 1ZC4A 4WMLA 5B4VA 3DLIA 4IPTA 4OXXA 1DUSA 2XNJA 4AJHA 4IIEA 1CHNA 5E4FA 4DBLE 4QGSA 1W47A 2YZ7A 3BD9A 3LJKA 2HHCA 3NOXA 4JT8A 1AUXA 4HNQA 3HB1A 3LT5A 5DHAA 5T4EA 4WDRA 1OYVA 2ZRAA 1PL7A 1T5LA 4BMNA 4EKEA 4YIKA 4AZ0B 3NDBB 3SJZA 2P2ZA 3D3NA 1YDEA 3NRJA 4YT4A 1X0XA 4QOHA 1D8AA 4HP8A 2AOUB 4FE4A 4JI5B 1VSUA 2GHQA 4A82A 1FL9A 1TADA 2FPPA 5KOYA 2BGNA 1IONA 5CFNA 1BA2A 2I9KA 1E4YA 1C8BA 1AD2A 1NVVR 3CBQA 4F4IA 3AG6A 3GJ0A 1PKEA 2R00C 4DV7B 2XCLA 3NT4A 5CH5A 2HYIC 4CF3A 3PB3A 3TZQA 2CDCA 3WR5A 2FE4A 1QHEA 1ULAA 3FMVA 4DMHA 1PUXA 3DAHA 5G40A 1EWQA 3F1LA 3HRKA 5JTTA 3AOGA 3F3YA 2OB2A 4UJ3A 3RTGA 4BNTA 1MGOA 2PKEA 3ZV6A 4BQFA 5HXAA 5EZYB 2P6RA 4F2PA 2Y1KA 3MQ2A 1PCXA 1E9EA 3LP6A 4IFTA 5IKPA 1NAIA 1PI3A 3BIJA 1GNTA 3KJXA 3L1VA 3LPAA 2TMYA 121PA 4J2OA 1J8MF 2PMBA 1FYXA 2VDLB 4X20A 3U4GA 3RABA 1SIWA 1EK6A 1RLTA 4TSKA 2R8RA 3GXOA 3HCFA 3NHZA 4XUCA 2W0MA 4FKMA 1DJPA 2JKZA 3BDAA 3KPVA 3LLMA 1C3LA 1YJ5A 2CB0A 3MWFA 3GFVA 1KGSA 5AW5A 1E4OA 3HA7A 4QC2A 5JDCA 1YOVB 5AW9A 3LQ4A 3JVUA 4EEKA 1P8AA 1J97A 3KC2A 1IBRA 2P3OA 1ZNZA 2AOWA 4KJXA 1E2NA 1N92A 1UBMS 1WG8A 4XCQA 1GOTA 3NXKA 4D9EA 5A4MS 3O91A 2QEQA 5B7PA 4OQFA 2IU6A 3VKHA 5CFOA 4NBSA 2PTHA 3LVFO 3MOSA 1Z7GA 2QLNA 4KE8A 1NP7A 4UDXX 2OBYA 3QNWA 4FCVA 2BFEB 2X3FA 4LISA 5BRNA 3U0VA 3WLMA 9ATCA 4F2GA 5I48A 4U2EA 3HFJA 5DCWA 5KVCA 2O2EA 5JYCA 2ZM5A 3C8ZA 5DKFA 3G68A 3ERCA 2DFNA 2P0YA 4LSMA 1JA9A 1ZA1A 4I3HA 721PA 1EYZA 2I1QA 5J1SB 1SVSA 1B6TA 4G1UC 4MA5A 3LQ1A 1HT3A 4UU1A 5ALPA 3OUTA 1IK4A 2BSXA 2HDOA 5JH7B 1E1DA 1GTVA 4OJKA 4ZO4A 3OFVA 3VMMA 3QEMA 3DH0A 3RRNA 1Z0IA 5FWDA 2D54A 1U3DA 3PXEA 4RXTA 4B6GA 4YDSA 1H2YA 3UJCA 1LTKA 4LS3A 4K9SA 4MICA 1KBZA 2IPLA 4ES6A 1GTSA 3PIDA 5L45A 4GP7A 1CQPA 1VLQA 3I1FA 3B20A 1VJCA 2B35A 3GEMA 2II6A 3R9KA 3V8BA 3NP7A 5JBQA 2PMWB 4Y6LA 1NVFA 2JANA 4YAIA 4EA9A 1JEYB 2JBAA 3QBJA 5CTAA 1J8QA 4GF5A 1ICEA 1POXA 1TLLA 4MZDA 4P3PA 3OZTA 1WP4A 2ZJAA 3GGSA 1XPOA 2GBGA 4YMSA 1BXGB 3JQCA 5EJAA 1Y37A 1Z33A 1IPEA 3LXRA 3L9WA 4DQKA 1VIAA 3B3FA 1TCCA 1DQPA 3IIJA 4DLWA 5DT9A 5CVEA 3UBMA 2VTEA 5IC4A 4DFDA 2A1UA 2JGAA 4ZVKA 3SQWA 4B3BA 4AKTA 3DUFA 4TX1A 1TVEA 3DXZA 2PJZA 3HU1A 3DLPX 1X2BA 1ZMTA 4D41A 2CYAA 4C7BA 4XWWA 2UXDB 2XRYA 4PYJA 5LZ7A 1NATA 2RGEA 4KCGA 1BNCA 2Q6IA 2XVAA 3G8CA 4LDQA 2ZRHA 3Q3CA 3TSOA 1LW6E 4FMCB 5JXGA 1QDEA 3L8CA 4RH3A 4NF2A 4URFA 5FYQA 4C1NA 4WEQA 5T64A 4D96A 3CVXA 1O6CA 3CMMA 4QYMA 3GFTA 2HMAA 4BUJA 3QWHA 3SZOA 2OC9A 3RS9A 4BCCA 1JFFA 1T2NA 2WM2A 1H22A 1A9RA 4JLDA 4UTRA 1ZVKA 2ONJA 1BCSB 4XWAA 3MERA 3RREA 2V4ZA 3L7MA 2EFJA 5EINA 1ILEA 2Z43A 3T1OA 4HRAA 2Y1XA 4MTCA 4OJQA 5BSUA 4CZ2A 1WDTA 5B37A 4AUEA 4RKEA 1O58A 4FGZA 4IFBA 1JFVA 3JQGA 5BQFA 1G4HA 2BI7A 3PIIA 2HCJB 2HRDA 2BFOA 1TK9A 5FDFA 1JLSA 3H5VA 1F20A 3KR0A 4KIGA 4PR3A 4QLAA 2D2VA 1HE3A 2BMWA 2I71A 1NUPA 3LP5A 3AINA 4TMXA 5CLHA 4YFYA 2ZIEA 3W3AD 1T8PA 4FGUA 3ELDA 3LFTA 3WIUA 4DM3A 5C7LO 1CIJA 1I32A 3PVZA 1VL5A 2OCLA 5J2TB 3WOHA 1YL5A 3BTSA 2NTJA 1EQ2A 3RIMA 3WL3A 3TR0A 5KYKA 1QIJA 1RQRA 4Y2VA 3WLRA 2UAGA 4NONA 4DLNA 1GZ3A 4PSUA 1DP4A 5A05A 2HRBA 1QS0A 1E3WB 1U2RA 3ES9A 2NNWB 4OHKA 3SHOA 4B1FA 4RGVA 1ZJ6A 2Z3ZA 4GUAA 3KVYA 1RBMA 1BQEA 1RPJA 1GD1O 3W7AA 2ZYUX 4MRRA 1UMDB 1R0WA 2AEEA 2VVTA 2V7WA 3OU7A 1L6RA 4YQZA 6NULA 3AVUA 5BWMA 2P9BA 4D3FA 3KEGA 2ID7A 2VQDA 4DAEA 2Z2IA 4DZRA 2HREA 3ZJUA 1E2IA 1L8AA 3DOHA 2P3SA 1SULA 1WB5A 2ZRCA 3QXSA 3TL3A 4CCYA 1G55A 2F6RA 3KKEA 3KCQA 4B75A 1HE4A 1SWVA 2R8PA 4JL6A 1UL1X 3EPHA 3BCRA 1K8XB 2GD2A 3EVBA 1KYYA 1V7PC 4KRYA 2PVSA 3TXAA 5B5SA 5BVGA 2C97A 1EVQA 3W9SA 2JGEA 3L0YA 1A1SA 3TE7A 2GFIA 4A10A 2FAXA 3UAVA 4BZXA 1XDSA 1A9TA 2FMKA 2FPGA 1LBTA 1TMYA 4QAJA 2GCGA 4LRUA 2ACEA 2BFDB 3K0HA 4OB6A 1SWWA 3VA7A 3FNHA 1NWCA 4C9BA 1GAEO 4GLJA 4NY1A 1WXGA 4PFKA 1ETHA 3HCWA 3ZD9A 3ZHBA 3EMKA 3UJNA 4FDTA 1U4OA 1Y1QA 3LX4A 1II8A 4N12A 3PZBA 5BR1A 4R1TA 3RKRA 2QV7A 1A8HA 5FPYA 4K6HA 1UWLA 1DE0A 2CZQA 4KZPA 2BEWB 5EIBD 1OH8A 2VXOA 5G0UA 4C4YA 4IQFA 4BAUA 1G7RA 4EJSA 4X7RA 2HV8A 3WNBA 1ZINA 2BTQA 3BFPA 1U7WA 4Y30A 1YNSA 1X3SA 1E1QA 5JQWA 1BN7A 2V98A 5E7QA 2QXYA 2JH8A 3L7AA 4RA6B 1Y4UA 3EXEA 3PNOA 4TLLB 3ESDA 3MGGA 4UBOA 3QITA 2VNKA 1Y6JA 3HJRA 4QOEA 3KQQA 4E5KA 5K8TA 3QHAA 2WKSA 2A35A 2B3TA 2WB4A 4II3A 3SR0A 4ZV7A 3KHTA 1NXQA 3OHPA 3DT9A 3CQ9A 1C1DA 3KJNA 3MSCA 2EARA 1FSFA 1USVA 3OKPA 5C5CA 3SVZA 1QO9A 3O21A 1HUQA 1CR2A 1XL1A 1V71A 4RDCA 1JPJA 3KB1A 4AJIA 5KJ1A 5LYJA 5FR2A 4CV1A 1P9NA 3MA0A 3PC3A 5IFLA 3O73A 4C4XA 1ATZA 3ROGA 3EXHB 4TKVA 3PXUA 3T7KA 2IH5A 5LQDA 1FDTA 1OH7A 1CUCA 4P5EA 4YCJA 2PKWA 2RHHA 4FHZA 5ERGB 2FRDC 1Y89A 1M7GA 5KWVA 3QW4B 5JZ9A 5BXYA 3NHLA 2P69A 2GJ4A 3ED1A 4B17A 1LDGA 3GPBA 1K4KA 1TTPB 2X6QA 2XLBA 2D0DA 1E6LA 4G8CA 1HE1C 1UC4B 2WK1A 4JP5A 4O08A 4P4SA 4CM3A 5FTWA 4UOZA 1AC5A 4ZI3A 3U9LA 1SZPA 4PYOA 1FRNA 1WOYA 3PVCA 3IH5A 1P4HA 4QU8A 1D1QA 2BHSA 3KQOA 4OLHA 5CXSA 5EN4A 4WGGA 5B36A 4CKZA 3ZLJA 3OPYA 2OAQ1 4FONA 2XCUA 3QK7A 2UYGA 1PQPA 4MV7A 4WI1A 3TVDA 1P0IA 3NIGB 5FJIA 4NCXA 4BNZA 1BGVA 4L5CA 4JSRA 1P4JA 2ZYHA 4JLKA 3DBOB 4OIMA 4J2HA 1NA5A 4FYKA 1FXUA 4H08A 4KQJA 4P1ZA 1A7UA 4CV0A 2PYZA 5ICGA 1DQYA 4OHUA 4AG5A 5KCZA 1SUDA 1Y7PA 1FMTA 3M2TA 4MR8B 4GWLA 3ZWYA 4LBWA 3UWDA 4DPKA 2O2DA 3M1IA 2X0NA 4R81A 5KTKA 1AK2A 4M0PA 2FP3A 3JYHA 1E3DA 4FZVA 5FOVA 3U3XA 1D4AA 3OCCA 2Z2XA 3N8KA 2OHIA 2H1WA 1EINA 3OZAA 1MIHA 2O5EA 3Q5EA 4JN6B 3DF9A 2HXSA 2AHRA 1XCMA 2PH7A 1M2VB 2V7VA 4FZRA 5SZJA 4DPLA 1X74A 1GAQA 2OL4A 5I5GA 1E6MA 3NHFA 1GADO 1Q84A 4IDGA 4LN1A 3PGA1 2A9OA 4ZKEA 3PXBA 4MKXA 2V65A 3IURA 4B34A 4MITA 1ISJA 3EQZA 1UBNA 3LWZA 1SOUA 3QU4A 1PGQA 1NTOA 1T9GR 1SBCA 2FSVA 2ZRQA 4MRMA 2GUWA 2R5WA 1Z6AA 1FNCA 2JDID 2WUWE 3QKSA 4IR7A 5HS4A 2F2TA 4H6WA 3MUFA 3FUUA 3GG2A 3UT5B 3K1YA 1FUIA 1NMQA 4O4JA 5BN3A 2IQIA 4HQRA 3T3OA 1PNVA 2ZIGA 3B3GA 5EP2A 1KP3A 3T7AA 3IV9A 2PGDA 1QRTA 4FTWA 3K4PA 4ZP1A 5L6LB 3AEKA 2Z1NA 2NP7A 1T36A 1G21A 5FP0A 3LL7A 1KS9A 4S0XA 2HZ7A 2BUBA 4MW1A 4OLBA 4CMIA 3G0HA 1S8NA 1Q3TA 3D3WB 4G0VA 4FGLA 1J2JA 1ND5A 1F2TA 1IJFA 4L4SA 5DLQC 2VQFB 2C9ZA 5JFGA 5JQGB 4LYEA 2XWBF 2YZKA 4B74A 2HK7A 1G6Q1 3GQVA 4IMPA 2PMCA 1GZHB 2VWHA 1H85A 4LY3A 4B48A 4EG4A 2CF6A 1NYQA 5BSFA 1J70A 5CLJA 2VSXA 4TVOA 4UATA 2DR3A 3DEKA 5IYZA 3EF0A 4Z0PA 2DFTA 3MZ0A 4ARAA 1OZFA 2OO7A 1RHUA 1O1YA 3KO8A 4L76A 5TSDA 5IBPA 3ZXUB 2ATEA 2MINB 2MCFA 2EEZA 2VJBA 1SKYE 4LG1A 2ZE7A 2PZFA 1D7AA 4OQ4A 3T5DA 3KV3O 5D6NA 1JEJA 1OBOA 5JVDA 1MKYA 4ZU1X 4Y6SA 4JCOA 2E49A 4B3DA 3P7MA 5JPCA 4BNVA 1UBFA 1L7BA 4NK4A 1DV1A 2W70A 1MOZA 2PD6A 3ENVA 4JXKA 2Z56A 3EEQA 4KAJA 1FQKA 2IYXA 4K03A 3I9V1 1GHTA 3TYXA 5GVSA 4MDHA 4WXHA 1KTIA 1TEZA 1AM4D 4BO8A 5AICA 4WAUA 3EY9A 3OBIA 5J9FA 3R24A 1FMCA 4AXXA 1CV2A 2V9ZA 2QGNA 3QUQA 3SE7A 4LF8B 1XLTC 1DCTA 3RYHB 2XRZA 2HLDD 4YRZA 3PQ4A 4JJ4A 4TS3A 4XFJA 5AJTA 4G5RA 3T9FA 1V5FA 2Q4EA 1P6QA 1O97D 2V6MA 3N8IA 2W2LD 1U2GC 3ELWA 4X6LA 3GJ7A 2AG0A 4QYIB 1YZTA 4UEJA 3HJBA 4HZIA 4LECA 4CWAA 3O82A 1N5OX 2YVUA 5BMVA 3SX2A 2WPNA 4W5RA 1SBTA 2O0MA 2JFWA 4XLTA 5D7NA 3WMWA 4QXOA 3ZIAD 4DMRA 1XRMA 3DBRA 1PNRA 1W6RA 4JELA 1TOAA 3L77A 4OXQA 5K8JB 1AUOA 2QUKA 2R6FA 2JK0A 4OHBA 4ZC1A 2ZIWB 4N3NA 2P6PA 1RYFA 4IGIA 4NZYA 2HGZA 2VP5A 4X1IB 3U1VA 2G04A 3BMCA 1N0WA 2OBXA 2QD5A 1I6LA 1ZUWA 2BF4A 3CRNA 4MEBA 3T99A 3FSJX 4YGYA 4CETA 1Z25A 2IP2A 2DB3A 3P9XA 1H2ZA 1XN4A 2Y1CA 2QJOA 4QDTA 3OHSX 4HDSB 1UEXC 3N2ZB 1U0TA 1H8HA 2IXEA 2UUPA 3GAZA 1KVSA 4F4HA 4HNAB 5JYEA 2REXB 3TOVA 2QRLA 4YRPA 4B44A 1W34A 2E1RA 1MH9A 1MO2A 4WZAA 1LNQA 4MYHA 3DZGA 5EZ6B 1XEFA 3UNXA 1YKFA 3MGKA 1DJQA 3A6ZA 2ZUTA 4OA5A 1YB4A 2GYVA 3UUGA 3N2GB 4ZDJA 1UDXA 1LBIA 3EFEA 5TXGA 3A7DA 3CH7A 3GAFA 2M6SA 2W7TA 5CVVA 5ICFA 3E5RA 3S68A 3ENWA 3P19A 1WZUA 2CXXA 2AOTA 3UM9A 3P9CA 3KOUA 2J08A 2E89A 2VPWA 3GNTA 1YVRA 2FEKA 3QEAZ 2NVOA 4EZIA 1NI5A 2YL2A 4WLOA 1I5OA 4XB1A 1G3MA 2R6ZA 2WJIA 2XHZA 3ZPXA 2WFAA 3FYTA 5DX1A 3N39C 3JQAA 2H17A 3OPQA 3PEWA 2JA2A 2VJMB 2XQFA 3MBKA 1T6XA 3MQFA 3QTLA 4FLMA 3V4OA 4MUHA 2ZZNA 5KYWB 4CCSA 2Q0XA 2X86A 4KACA 4TL8A 4B8ZA 3L05A 3DGFC 3KB6A 4TUYF 4CLHA 5MN5A 2XCSB 1GA6A 2XYPA 3NTLA 1FRVA 1Z4JA 1E3EA 1F0YA 2PA0A 1ZAKA 1RXSA 2QYOA 4KGZA 5A3QA 1QB7A 5LMNB 2BR5A 4XKJA 5CB6A 3GVCA 4KTVE 3B89A 3KKZA 1RPTA 5IMSA 1Y6GA 1VPLA 2H9AA 2LCFA 4Q01A 3UWKA 4I14A 3A05A 3QVWA 2ZQ5A 4Y6OA 3RC9A 3RUDA 2J7PA 4K0RA 4TV9B 2D5LA 3MTEA 3OG9A 3KZVA 4QEKA 4RKWA 4OHXA 2R6AA 4GBMA 4HWTA 1JHAA 1YZVA 3CZ9A 1QCDA 2CC2A 2IEAA 4YC7A 5L7YA 1NT4A 5B6JA 2BFAA 2GM9A 4RABA 4U6NA 4BC0A 1LK5A 1A27A 1TQDA 2AC2A 1EFDN 3P9ZA 4POAA 5CHEA 1MC5A 3K6KA 1FS6A 3T5PA 1C7JA 3PITA 1IK6A 1RVDA 1RI1A 3I23A 4BX9A 2IHVA 2W6ID 4H15A 2A78A 3K70B 1DBVO 2FKNA 1Y1LA 4NCKA 2IYFA 1G4AE 2QZPA 3OT5A 3ID6C 5KNBA 1WUHS 2ZAIA 2EDCA 2IYZA 3CLRC 2D7JA 4E1BA 1T1JA 3I6ZA 3RTCA 3WZLA 1MXHA 2GTHA 2PA3A 2WWRA 1R6BX 2GAFA 3RV3A 1EFRA 1DFGA 1WMDA 2VF8A 1P61B 5GGXA 1KAGA 2ZIXA 3EDMA 4DJEC 2G8LA 5AMXA 2P9CA 1T1GA 2GGSA 3KAJA 1NQUA 2IIVA 4IVQA 4QULA 4XIFA 1FQOA 4HPJB 3IILA 3CM0A 4FMPA 5FPSA 2QL9A 2YVKA 3VNAA 3ZV5A 2BCJQ 4JLVA 1HKUA 1T3LA 4LDNA 1K3TA 2GXQA 3GRUA 3IPXA 4FYWA 2XAUA 5KC9A 3CLUD 1R27A 3DTTA 5L3RA 1SC6A 2OHVA 1YTUA 2NO7A 2VZ8A 2XMRA 3AR3A 4WXMA 4CIDA 3TLXA 3RSGA 1IXKA 2PLWA 4P5PA 3HZZA 3FAZA 1MNAA 2HK8A 3AFGA 4U5QA 5BQXA 1HI9A 3ETCA 2E21A 3LHSA 5D3KA 4EG3A 1H8ED 2YUTA 4FFNA 5CW2A 1IIBA 2PMDA 4C6TA 3DR5A 4MKZA 2FB9A 4C6SA 1SB8A 3PA8A 4E22A 2B34A 2JFYA 3DE3X 3PV0A 4EAAA 5A5GA 3UWPA 5ALSA 3DS8A 2HWXA 1UUFA 4ZVQA 5FQOA 4BDSA 4XVUA 5LXTB 1H9BA 2PD4A 3IELA 5F78A 3B13B 5E2BA 3T7RA 1V8DA 2O2IA 5JATA 4NNPA 4TROA 2CHGA 5GADl 1T10A 4KPEC 4KI7A 4TRMA 2ZUBA 1JLRA 4BXOA 1ZNXA 4PYNA 2QR3A 3C97A 1JDJA 1MG5A 1R0XA 4LW8A 5AW4A 3TUZC 3ODPA 4W5OA 3TVTA 4AJNA 5LZ2A 3A70A 3T3IA 3GLGB 2GDZA 2QN1A 2YHUA 3N58A 5C4IA 4X7BA 3B6ZA 2ILVA 3ABSB 2MYNA 4OGLA 1M9NA 4ARCA 1PG2A 2NTNA 1DIGA 2VL7A 3G2IA 4ID9A 2F1JA 4D44A 2OTCA 3SXUB 9LDBA 3HSKA 5JXJA 2VK4A 3I5MA 4PHGA 4W63A 3VAYA 1M2WA 4CLRB 4GPZA 3TW8B 4BE7B 4F5EA 5A3JA 1BWQA 4ZC8A 1UK8A 3AR4A 5F2OA 4FDMA 1Z6YA 3RIGA 4WLNA 5BYBA 1W5FA 5KNBH 4KFCA 1WLSA 4OMFG 3QWBA 2YUIA 3LUFA 4M0MA 4ZARA 3X1JA 3FOZA 1DNPA 3LF2A 3U4QB 3PE4A 1VOTA 4KR3A 5F98A 2G1KA 4PQFA 4P7BA 4PAQA 4JLPA 5KSYA 2FMIA 1MO5A 4XVQA 1XK6A 1XJQA 2YWFA 3ZH2A 1P5FA 4CUKA 2CEKA 4AJEA 2Q4BA 3IHWA 4C7KA 2MYUA 1UC9A 4YLGA 1DBWA 5FHQA 1ZCJA 1BDBA 4FB4A 2YMLA 3VDQA 1LF5A 4LMRA 2GZSA 1XZJA 3EUWA 2EFDB 4J6EA 3LDGA 4X7MA 3ROPA 3I5YA 3HJUA 3M8KA 1IH8A 4GOMD 2ZU6A 3PQDA 2VCYA 3D54D 3UAOA 3N7AA 1EK0A 2I66A 3O92A 3UFXA 3CH5A 1N3LA 1DTWB 1ODJA 1Z35A 3KYBA 3M6UA 3Q0EA 2NU9A 4FNAA 4KMSA 4PX9A 3SYKA 3LVQE 4RS3A 2Q1SA 2BFBA 2F8LA 4TLDA 2BGMA 1ZZEA 3L7BA 4P4TA 5LBIA 5IABA 1JHDA 4CF5A 1L4UA 2J9FA 1RC0A 4C20A 1WO8A 1N2JA 2ATXA 1W4ZA 1OI7A 5IN4A 1C14A 3DDUA 2QZZA 3UAYA 4JI3B 1BW9A 4EA7A 3K0AB 3PIRA 1AGNA 4LXHA 3DVAB 3PLNA 4R98A 5DW3A 3E70C 3PP8A 2FTKE 3AL2A 3AHDA 4RHCA 4LYHA 3OQNA 3OX3A 2QTNA 2FPRA 2OHJA 3KUKA 2C7BA 4RNDB 5EMNA 3QFTA 5CT4A 5EWJA 1Z6XA 1AHNA 2C4NA 3DZCA 3VR4D 1AMUA 2BRUC 3PFKA 2PYDA 3KLOA 1W30A 1RC8A 2DR0A 4JWKA 3C43A 3E2IA 1XPJA 4WRRA 2JGDB 4GVPA 3SZLA 2XNDD 4HRYA 3LOPA 4RXMA 4XSHA 2PL1A 3ZWCA 5JE8A 4DCSA 4G0ZA 4I5EA 3TG2A 4H0NA 1PEDA 4QUGA 4UEOA 2C5HA 2WTAA 2NPIA 3GUUA 3VNSA 2P7IA 4OI1A 4FXPA 5BUSA 4DLKA 4EX6A 1J24A 3MMNA 1BQ4A 5DYGA 4B6OA 1QV6A 5BWLA 1P3DA 4GX5A 1DJMA 4CUJA 4D9CA 1L3IA 1J1UA 1CX9B 2JCVA 4PQYA 4BP9A 2YS7A 2H7CA 2IHJA 3HGMA 3E9NA 4FSHA 5LQRA 2YHIB 4FDLA 1OV4A 3MXOA 1D2NA 2IZ5A 3VR1A 3ZKAA 2PE5A 3IKMB 1XAIA 2IYYA 4N0PA 1NIPA 3M3DA 3F8SA 4GVLA 1N5DA 3KKNA 1JNXX 1OU4A 3FPKA 3FR8A 5TY0A 2FI1A 4ZANA 4RMIA 3VQTA 4RTSA 1SOAA 5IAOA 2G4CA 1MOPA 5CNKA 1C9NA 3T61A 3NFYA 1CWUA 2D2FA 3ZQ6A 2A9VA 5JISA 4RHFA 3DZJA 4LYGA 3DBLA 1QP0A 3KYDA 3R0QA 3GUZA 3WAGA 2YRXA 4FGKA 4UVIA 3WK9A 1LSUA 4JKOA 1YMUA 4JBLA 3OFND 4OYHA 1GNPA 3I72A 3W1VA 2WYIA 2CV2A 5EIBC 1YFZA 4Z53A 1XZIA 2ZS8A 3O6VA 3VZBA 1N2CB 2C4TA 2F43B 2VAMA 4NIMA 4JQZA 1JFLA 2J6CA 1UJ4A 1H2WA 2BWJA 2TMDA 4JLUA 4G36A 4MGIR 2PZKA 1BCRA 3MSXA 2C7QA 3J7TA 2WHQA 4MS1A 5F35A 1BWPA 4MWBA 1Z74A 5CGQB 2W9XA 4YAGA 1A5ZA 3TGPA 3NJRA 3VO8A 3O4RA 3MB8A 2O8BA 2ERCA 3B60A 2EL9A 5ALTA 5H1YA 5JFOA 4DLZA 3QKIA 3ZW7A 3QSYA 1ISSA 3L43A 3DXFA 3FVRA 3GFPA 4GPD1 4XI9A 4EGSA 5LNK6 1VI5A 1JVBA 2COEA 1LPBB 3PXXA 1ADYA 4HKTA 1U7TA 2GD1O 1NNEA 4NBWA 2IL1A 2OLEA 3FDIA 5FIUA 4YCCA 2JLWA 1O95A 4ZOCA 4C7VA 5ALMA 4NFYA 3RVKA 3PT9A 3SAJA 4Z3DA 2K2QB 3EBPA 5C1OA 5DNYB 4P0PB 2AEJA 4LJSA 4LZAA 4S1PA 3LWBA 4NU8X 2JBHA 2JGJA 2W6MA 3DW1X 2HSGA 4TMKA 5DISB 1OFUX 2CMFA 2XKAA 3MYYA 4XIIA 3SKVA 1DBSA 4O4IB 2H54A 3TW6A 2NAPA 1H66A 1EA5A 2PAAA 3WZ2A 1NJ6A 2YS6A 2CVHA 4FN5A 1T0BA 5J43A 1PK8A 2ZPTX 4B47A 2Y9MB 1Y9DA 2B4KA 2OE2A 3VJRA 1ZVQA 1GZ5A 1ZNQO 4PS0A 3TQOA 2CB9A 2XGSA 3KPWA 3AR8A 3WKCA 2QQEA 1AKTA 1VKRA 1DC4A 3HP1A 3DWEX 3JD3A 5ALEA 4R1PA 3V4SA 2X1MA 3I32A 3DM5A 3K9CA 4N3GA 1QRRA 2W98A 1NN3A 4FHGA 4W5TA 3IP6A 3RARA 3OP4A 4V02A 3C3KA 5KQGA 2YWDA 3GEHA 4KDEA 3FPEA 1BOOA 5CFZA 2VO1A 3T1NA 1LCIA 1U11A 1VB5A 4IUYA 3RW9A 4BX8A 3L01A 2NVUA 3AUYA 4NHEA 4R1NA 4KE6A 3NAMA 1T0IA 1D6MA 4CM4B 4HNHA 3F3SA 1O6BA 1C0IA 4HLUA 1O5TA 4EVIA 2GF9A 2ZIVB 3ZX4A 5FLKA 1ODKA 3EQ8A 2CLDX 5EMLA 3CKMA 3D81A 4GI5A 3OMWA 2KQUA 3I9FA 5TGZA 4W5JA 4D4MA 3RBVA 4LE1A 4GGPA 2EC5A 2C84A 1JYFA 1RABA 2OCDA 3TZKA 2JZCA 2AEMA 3ILVA 3MCTA 3NU1A 1KC3A 2OZLB 4ADSG 5A4DA 2VATA 1EDDA 1Y8ZA 1T4MA 2XMPA 3DMFA 3HC7A 5F9MA 3Q3JB 3BH7A 3KWFA 1T9KA 2FUKA 1D04A 3SYTA 1HEUA 1TKAA 1YIDA 3EQ2A 1KE1A 3ZNQA 3A4NA 5ELXA 2J41A 2R87A 3KHUA 3GB9A 4E4TA 1J22A 1FFAA 4D3DA 4P3YA 5DP1A 4AJPA 1G59A 2WIDA 1XNRB 3HDYA 4I1SA 1HORA 1MIOA