3GKBA

Crystal structure of a putative enoyl-coa hydratase from streptomyces avermitilis
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
274
structure length
274
Chain Sequence
AYSTLRVSSEHGVARIILDNPPVNVIGATMMRELRTVLTTLADDSSVRVIVFSSADPEFFLAHVDMRIGEKMDALQELAASAPADVNVFQAVGELIRHQPQVTIVKLAGKARGGGAEFVAAADMAFAAAETAGLGQIEALMGIIPGGGGTQYLRGRVGRNRALEVVLTADLFDAETAASYGWINRALPADELDEYVDRVARNIAALPDGVIEAAKRSLPADDLKEGLLGENDAWAATFSLPAAQQLISGGLKDGAQTPAGERDLEGLMRSVARE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative enoyl-CoA hydratase from Streptomyces avermitilis
rcsb
source organism Streptomyces avermitilis
molecule tags Structural genomics, unknown function
molecule keywords Putative enoyl-CoA hydratase
total genus 104
structure length 274
sequence length 274
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3gkbA00
2F9YA 3DORA 5INGA 3IBBA 5CTCA 3T88A 3HP0A 2VSUE 2VSUF 5KJPA 2ZQQA 4JJTA 4JYLA 2X24A 5DUCA 4MXIA 1FCFA 3ZWBA 5DUFA 4QFEA 4Q0GA 4IZBA 3SLLA 1UYVA 4U0GA 4I52A 1RJNA 3TV5A 1PIXA 1YG8A 4HNKA 5DTPA 3GLMA 3OMEA 1EY3A 5C9GA 1FC6A 3T89A 3ST9A 4Q1IA 3KTKA 1W2XA 1UYSA 5INFA 3V5IA 4NNQA 2J5GA 4WZ8B 3WG5A 3ZW9A 2FW2A 3LKEA 3RSIA 4K29A 3N6RB 3RSTA 3R6HA 3KTGA 1ON9A 4I42A 3IAVA 3R9TA 4FJWD 3OT6A 5FUSA 1TG6A 3QXZA 1TYFA 4L8KA 1XX4A 3JU1A 2PBPA 3ZWCA 3QYRA 4FN7A 3QKAA 2D3TA 2VSUA 3MYBA 5CTBA 1Q51A 1HNOA 3TVUA 3GF3A 4L6WA 4IZCA 3QXIA 3STAA 3R0OA 3L3SA 2UZFA 3QMJA 1XO6A 4ZDDA 1WZ8A 3SWXA 3K8XA 2F6QA 1DUBA 2ZL0A 1OD4A 3U9SB 4OLQA 1WDKA 4DI1A 2GTRA 2J5GD 4JCQA 2A81A 2IEXA 1SG4A 1K39A 3Q0GA 5DZKA 1FC9A 3BPPA 4JCTA 3T8AA 2QQ3A 3OC7A 3DJAA 2ZL3A 4FNBA 1FC7A 4ELXA 3PGQA 5KDRB 2PPYA 4ZDCA 3HE2A 3HINA 4JSBA 4KPKA 2J5II 3H81A 1VRGA 3KQFA 3IB9A 4EMMA 2EJ5A 4GM2A 4LK5A 2HW5A 4ZU2A 3HLN1 4K3WA 5G1QA 2NP9A 3P2LA 3TLFA 4I4ZA 1N6DA 2FBMA 2A7KA 3PZKA 2F9IB 4JVTA 1XNWA 4FZWA 4WCZA 3R9QA 5DZKH 3G64A 3KTJA 3MT6A 2VX2A 3M6MA 5DTWA 1J7XA 2BZRA 1N6EA 4ZDBA 3NJDA 1HZDA 4EMPA 3ZWAA 5JBXA 3K50A 4U1AA 4ASIA 4RYFA 2Q35A 4OG1A 5DKPA 5INIA 4EMLA 1ON3A 3QWDA 3TRRA 1X0UA 4ELWA 4K2NA 4IZDA 2Q34A 3BEZA 3VIVA 1N6FA 3U9RB 3TT7A 1XNVA 3PEAA 4YLHA 3R9SA 4HC8A 5C90A 4B3JA 5IKLB 2Q2XA 4B3HA 2A7SA 1O8UA 1JXZA 2DEOA 3LAOA 3MOYA 4JYJA 2F6IA 1EF9A 3U9TB 5E0SH 3H0QA 1DCIA 1NZYB 1Y7OA 5DU4A 3P85A 3HRXA 1K32A 2VREA 3H0UA 3I47A 5FIFA 4NEKA 3TDCA 2ZL2A 2DUBA 3Q1TA 1UIYA 1Q52A 4FB8A 2CE3A 4U18A 4MOUA 2ZQRA 4U19A 3TZ3A 1HNUA 5E0SA 1RJMA 3H02A 3Q7HA 4G2RA 2C8TA 3ISAA 2W3PA 5DU8A 3KTHA 5JBWA 3T8BA 2VSSF 2X58A 3H0JA 4MI2A 4OMRA 4FZWC 1UYRA 1XNYA 3FF6A 3MFMA 3Q0JA 1SZOA 3M6NA 2F9YB 3GMAA 2VSUC 4KWBA 2CBYA 4JFCA 1UYTA 5MGBA 4ZDEA 1WDLA 2PG8A 2VSSA 3V5EA 3QREA 4QIIA 3QK8A 1NZYA 3NJBA 4U0GH 4FNDA 4GHNA 4JCSA 4U0HA 1WDMA 1YG6A 3GKBA 4B3IA 1OD2A 4JCRA 4FN8A 3TT6A 4JWVA 4KD6A 3ZW8A 4RCNA 3TVWA 3FDUA 5KDRA 3KTIA 2J5IB 2J5IA 4Z0MA 3RRVA 4KNPA 2J5SA 2ZL4A 1MJ3A 4ZDFA 2VSSE 5DU6A 5G1RA 5E0NX 3GF7A 4RYFH 4QIJA 5G1SA 1EF8A 2WTBA 4F47A 3BF0A 3H0SA 4ELSA 1PJHA 2F9IA 3T3WA 3P5MA 2FZSA 4WYOB 3PE8A 5DL1A 4JOTA
chains in the Genus database with same CATH superfamily
2F9YA 3DORA 5INGA 3IBBA 5CTCA 3T88A 3HP0A 2VSUE 2VSUF 4JJTA 2ZQQA 5KJPA 4JYLA 2X24A 5DUCA 4MXIA 1FCFA 3ZWBA 5DUFA 4QFEA 4Q0GA 4IZBA 3SLLA 1UYVA 4U0GA 4I52A 1RJNA 3TV5A 1PIXA 1YG8A 4HNKA 5DTPA 3GLMA 3OMEA 1EY3A 5C9GA 1FC6A 3T89A 3ST9A 4Q1IA 3KTKA 1W2XA 1UYSA 5INFA 3V5IA 4NNQA 2J5GA 4WZ8B 3WG5A 3ZW9A 2FW2A 3LKEA 3RSIA 4K29A 3N6RB 3RSTA 3R6HA 3KTGA 1ON9A 4I42A 3IAVA 3R9TA 4FJWD 3OT6A 5FUSA 1TG6A 3QXZA 1TYFA 4L8KA 1XX4A 3JU1A 2PBPA 3ZWCA 3QYRA 4FN7A 3QKAA 2D3TA 2VSUA 3MYBA 5CTBA 1Q51A 1HNOA 3TVUA 3GF3A 4L6WA 4IZCA 3QXIA 3STAA 3R0OA 3L3SA 2UZFA 3QMJA 1XO6A 4ZDDA 1WZ8A 3SWXA 3K8XA 2F6QA 5HUQA 1DUBA 2ZL0A 1OD4A 3U9SB 4OLQA 1WDKA 4DI1A 2GTRA 2J5GD 4JCQA 2A81A 2IEXA 1SG4A 1K39A 3Q0GA 5DZKA 1FC9A 3BPPA 4JCTA 3T8AA 2QQ3A 3OC7A 3DJAA 2ZL3A 4FNBA 1FC7A 4ELXA 3PGQA 5KDRB 2PPYA 4ZDCA 3HE2A 3HINA 4JSBA 4KPKA 2J5II 3H81A 1VRGA 3KQFA 3IB9A 4EMMA 2EJ5A 4GM2A 4LK5A 2HW5A 4ZU2A 3HLN1 4K3WA 5G1QA 2NP9A 3P2LA 3TLFA 4I4ZA 1N6DA 2FBMA 2A7KA 3PZKA 2F9IB 4JVTA 1XNWA 4FZWA 4WCZA 3R9QA 5DZKH 3G64A 3KTJA 3MT6A 2VX2A 3M6MA 5DTWA 1J7XA 2YJGA 2BZRA 1N6EA 4ZDBA 3NJDA 1HZDA 4EMPA 3ZWAA 5JBXA 3K50A 4U1AA 4ASIA 4RYFA 2Q35A 4OG1A 5DKPA 5INIA 4EMLA 1ON3A 3QWDA 3TRRA 1X0UA 4ELWA 4HDTA 4K2NA 4IZDA 2Q34A 3BEZA 3VIVA 1N6FA 3U9RB 3TT7A 1XNVA 3PEAA 4YLHA 3R9SA 4HC8A 5C90A 4B3JA 5IKLB 2Q2XA 4B3HA 2A7SA 1O8UA 1JXZA 2DEOA 3LAOA 3MOYA 4JYJA 2F6IA 1EF9A 3U9TB 5E0SH 3H0QA 1DCIA 1NZYB 1Y7OA 5DU4A 3P85A 3HRXA 1K32A 2VREA 3H0UA 3I47A 5FIFA 4NEKA 3TDCA 2ZL2A 2DUBA 3Q1TA 1UIYA 1Q52A 4FB8A 2CE3A 4U18A 4MOUA 2ZQRA 4U19A 3TZ3A 1HNUA 5E0SA 1RJMA 3H02A 3Q7HA 4G2RA 2C8TA 3ISAA 2W3PA 5DU8A 3KTHA 5JBWA 3T8BA 2VSSF 2X58A 3H0JA 4MI2A 4OMRA 4FZWC 1UYRA 1XNYA 3FF6A 3MFMA 3Q0JA 1SZOA 3M6NA 2F9YB 3GMAA 2VSUC 4KWBA 2CBYA 4JFCA 1UYTA 5MGBA 4ZDEA 1WDLA 2PG8A 2VSSA 3V5EA 3QREA 4QIIA 3BPTA 3QK8A 1NZYA 3NJBA 4U0GH 4FNDA 4GHNA 4JCSA 4U0HA 1WDMA 1YG6A 3GKBA 4B3IA 1OD2A 4JCRA 4FN8A 3TT6A 4JWVA 4KD6A 3ZW8A 4RCNA 3TVWA 3FDUA 5KDRA 3KTIA 2J5IB 2J5IA 4Z0MA 3RRVA 4KNPA 2J5SA 2ZL4A 4J2UA 1MJ3A 4NARA 4ZDFA 2VSSE 5DU6A 5G1RA 5E0NX 3GF7A 4RYFH 4QIJA 5G1SA 1EF8A 2WTBA 4F47A 3BF0A 3H0SA 4ELSA 1PJHA 2F9IA 3T3WA 3P5MA 2FZSA 4WYOB 3PE8A 5DL1A 4JOTA
chains in the Genus database with same CATH topology
2F9YA 3DORA 5INGA 3IBBA 5CTCA 3T88A 3HP0A 2VSUE 2VSUF 4JJTA 2ZQQA 5KJPA 4JYLA 2X24A 5DUCA 4MXIA 1FCFA 3ZWBA 5DUFA 4QFEA 4Q0GA 4IZBA 3SLLA 1UYVA 4U0GA 4I52A 1RJNA 3TV5A 1PIXA 1YG8A 4HNKA 5DTPA 3GLMA 3OMEA 1EY3A 5C9GA 1FC6A 3T89A 3ST9A 4Q1IA 3KTKA 1W2XA 1UYSA 5INFA 3V5IA 4NNQA 2J5GA 4WZ8B 3WG5A 3ZW9A 2FW2A 3LKEA 3RSIA 4K29A 3N6RB 3RSTA 3R6HA 3KTGA 1ON9A 4I42A 3IAVA 3R9TA 4FJWD 3OT6A 5FUSA 1TG6A 3QXZA 1TYFA 4L8KA 1XX4A 3JU1A 2PBPA 3ZWCA 3QYRA 4FN7A 3QKAA 2D3TA 2VSUA 3MYBA 5CTBA 1Q51A 1HNOA 3TVUA 3GF3A 4L6WA 4IZCA 3QXIA 3STAA 3R0OA 3L3SA 2UZFA 3QMJA 1XO6A 4ZDDA 1WZ8A 3SWXA 3K8XA 2F6QA 5HUQA 1DUBA 2ZL0A 1OD4A 3U9SB 4OLQA 1WDKA 4DI1A 2GTRA 2J5GD 4JCQA 2A81A 2IEXA 1SG4A 1K39A 3Q0GA 5DZKA 1FC9A 3BPPA 4JCTA 3T8AA 2QQ3A 3OC7A 3DJAA 2ZL3A 4FNBA 1FC7A 4ELXA 3PGQA 5KDRB 2PPYA 4ZDCA 3HE2A 3HINA 4JSBA 4KPKA 2J5II 3H81A 1VRGA 3KQFA 3IB9A 4EMMA 2EJ5A 4GM2A 4LK5A 2HW5A 4ZU2A 3HLN1 4K3WA 5G1QA 2NP9A 3P2LA 3TLFA 4I4ZA 1N6DA 2FBMA 2A7KA 3PZKA 2F9IB 4JVTA 1XNWA 4FZWA 4WCZA 3R9QA 5DZKH 3G64A 3KTJA 3MT6A 2VX2A 3M6MA 5DTWA 1J7XA 2YJGA 2BZRA 1N6EA 4ZDBA 3NJDA 1HZDA 4EMPA 3ZWAA 5JBXA 3K50A 4U1AA 4ASIA 4RYFA 2Q35A 4OG1A 5DKPA 5INIA 4EMLA 1ON3A 3QWDA 3TRRA 1X0UA 4ELWA 4HDTA 4K2NA 4IZDA 2Q34A 3BEZA 3VIVA 1N6FA 3U9RB 3TT7A 1XNVA 3PEAA 4YLHA 3R9SA 4HC8A 5C90A 4B3JA 5IKLB 2Q2XA 4B3HA 2A7SA 1O8UA 1JXZA 2DEOA 3LAOA 3MOYA 4JYJA 2F6IA 1EF9A 3U9TB 5E0SH 3H0QA 1DCIA 1NZYB 1Y7OA 5DU4A 3P85A 3HRXA 1K32A 2VREA 3H0UA 3I47A 5FIFA 4NEKA 3TDCA 2ZL2A 2DUBA 3Q1TA 1UIYA 1Q52A 4FB8A 2CE3A 4U18A 4MOUA 2ZQRA 4U19A 3TZ3A 1HNUA 5E0SA 1RJMA 3H02A 3Q7HA 4G2RA 2C8TA 3ISAA 2W3PA 5DU8A 3KTHA 5JBWA 3T8BA 2VSSF 2X58A 3H0JA 4MI2A 4OMRA 4FZWC 1UYRA 1XNYA 3FF6A 3MFMA 3Q0JA 1SZOA 3M6NA 2F9YB 3GMAA 2VSUC 4KWBA 2CBYA 4JFCA 1UYTA 5MGBA 4ZDEA 1WDLA 2PG8A 2VSSA 3V5EA 3QREA 4QIIA 3BPTA 3QK8A 1NZYA 3NJBA 4U0GH 4FNDA 4GHNA 4JCSA 4U0HA 1WDMA 1YG6A 3GKBA 4B3IA 1OD2A 4JCRA 4FN8A 3TT6A 4JWVA 4KD6A 3ZW8A 4RCNA 3TVWA 3FDUA 5KDRA 3KTIA 2J5IB 2J5IA 4Z0MA 3RRVA 4KNPA 2J5SA 2ZL4A 4J2UA 1MJ3A 4NARA 4ZDFA 2VSSE 5DU6A 5G1RA 5E0NX 3GF7A 4RYFH 4QIJA 5G1SA 1EF8A 2WTBA 4F47A 3BF0A 3H0SA 4ELSA 1PJHA 2F9IA 3T3WA 3P5MA 2FZSA 4WYOB 3PE8A 5DL1A 4JOTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F9Y A;  3DOR A;  5ING A;  3IBB A;  5CTC A;  3T88 A;  3HP0 A;  2VSU E;  2VSU F;  5KJP A;  2ZQQ A;  4JJT A;  4JYL A;  2X24 A;  5DUC A;  4MXI A;  1FCF A;  3ZWB A;  5DUF A;  4QFE A;  4Q0G A;  4IZB A;  3SLL A;  1UYV A;  4U0G A;  4I52 A;  1RJN A;  3TV5 A;  1PIX A;  1YG8 A;  4HNK A;  5DTP A;  3GLM A;  3OME A;  1EY3 A;  5C9G A;  1FC6 A;  3T89 A;  3ST9 A;  4Q1I A;  3KTK A;  1W2X A;  1UYS A;  5INF A;  3V5I A;  4NNQ A;  2J5G A;  4WZ8 B;  3WG5 A;  3ZW9 A;  2FW2 A;  3LKE A;  3RSI A;  4K29 A;  3N6R B;  3RST A;  3R6H A;  3KTG A;  1ON9 A;  4I42 A;  3IAV A;  3R9T A;  4FJW D;  3OT6 A;  5FUS A;  1TG6 A;  3QXZ A;  1TYF A;  4L8K A;  1XX4 A;  3JU1 A;  2PBP A;  3ZWC A;  3QYR A;  4FN7 A;  3QKA A;  2D3T A;  2VSU A;  3MYB A;  5CTB A;  1Q51 A;  1HNO A;  3TVU A;  3GF3 A;  4L6W A;  4IZC A;  3QXI A;  3STA A;  3R0O A;  3L3S A;  2UZF A;  3QMJ A;  1XO6 A;  4ZDD A;  1WZ8 A;  3SWX A;  3K8X A;  2F6Q A;  1DUB A;  2ZL0 A;  1OD4 A;  3U9S B;  4OLQ A;  1WDK A;  4DI1 A;  2GTR A;  2J5G D;  4JCQ A;  2A81 A;  2IEX A;  1SG4 A;  1K39 A;  3Q0G A;  5DZK A;  1FC9 A;  3BPP A;  4JCT A;  3T8A A;  2QQ3 A;  3OC7 A;  3DJA A;  2ZL3 A;  4FNB A;  1FC7 A;  4ELX A;  3PGQ A;  5KDR B;  2PPY A;  4ZDC A;  3HE2 A;  3HIN A;  4JSB A;  4KPK A;  2J5I I;  3H81 A;  1VRG A;  3KQF A;  3IB9 A;  4EMM A;  2EJ5 A;  4GM2 A;  4LK5 A;  2HW5 A;  4ZU2 A;  3HLN 1;  4K3W A;  5G1Q A;  2NP9 A;  3P2L A;  3TLF A;  4I4Z A;  1N6D A;  2FBM A;  2A7K A;  3PZK A;  2F9I B;  4JVT A;  1XNW A;  4FZW A;  4WCZ A;  3R9Q A;  5DZK H;  3G64 A;  3KTJ A;  3MT6 A;  2VX2 A;  3M6M A;  5DTW A;  1J7X A;  2BZR A;  1N6E A;  4ZDB A;  3NJD A;  1HZD A;  4EMP A;  3ZWA A;  5JBX A;  3K50 A;  4U1A A;  4ASI A;  4RYF A;  2Q35 A;  4OG1 A;  5DKP A;  5INI A;  4EML A;  1ON3 A;  3QWD A;  3TRR A;  1X0U A;  4ELW A;  4K2N A;  4IZD A;  2Q34 A;  3BEZ A;  3VIV A;  1N6F A;  3U9R B;  3TT7 A;  1XNV A;  3PEA A;  4YLH A;  3R9S A;  4HC8 A;  5C90 A;  4B3J A;  5IKL B;  2Q2X A;  4B3H A;  2A7S A;  1O8U A;  1JXZ A;  2DEO A;  3LAO A;  3MOY A;  4JYJ A;  2F6I A;  1EF9 A;  3U9T B;  5E0S H;  3H0Q A;  1DCI A;  1NZY B;  1Y7O A;  5DU4 A;  3P85 A;  3HRX A;  1K32 A;  2VRE A;  3H0U A;  3I47 A;  5FIF A;  4NEK A;  3TDC A;  2ZL2 A;  2DUB A;  3Q1T A;  1UIY A;  1Q52 A;  4FB8 A;  2CE3 A;  4U18 A;  4MOU A;  2ZQR A;  4U19 A;  3TZ3 A;  1HNU A;  5E0S A;  1RJM A;  3H02 A;  3Q7H A;  4G2R A;  2C8T A;  3ISA A;  2W3P A;  5DU8 A;  3KTH A;  5JBW A;  3T8B A;  2VSS F;  2X58 A;  3H0J A;  4MI2 A;  4OMR A;  4FZW C;  1UYR A;  1XNY A;  3FF6 A;  3MFM A;  3Q0J A;  1SZO A;  3M6N A;  2F9Y B;  3GMA A;  2VSU C;  4KWB A;  2CBY A;  4JFC A;  1UYT A;  5MGB A;  4ZDE A;  1WDL A;  2PG8 A;  2VSS A;  3V5E A;  3QRE A;  4QII A;  3QK8 A;  1NZY A;  3NJB A;  4U0G H;  4FND A;  4GHN A;  4JCS A;  4U0H A;  1WDM A;  1YG6 A;  3GKB A;  4B3I A;  1OD2 A;  4JCR A;  4FN8 A;  3TT6 A;  4JWV A;  4KD6 A;  3ZW8 A;  4RCN A;  3TVW A;  3FDU A;  5KDR A;  3KTI A;  2J5I B;  2J5I A;  4Z0M A;  3RRV A;  4KNP A;  2J5S A;  2ZL4 A;  1MJ3 A;  4ZDF A;  2VSS E;  5DU6 A;  5G1R A;  5E0N X;  3GF7 A;  4RYF H;  4QIJ A;  5G1S A;  1EF8 A;  2WTB A;  4F47 A;  3BF0 A;  3H0S A;  4ELS A;  1PJH A;  2F9I A;  3T3W A;  3P5M A;  2FZS A;  4WYO B;  3PE8 A;  5DL1 A;  4JOT A; 
#chains in the Genus database with same CATH topology
 2F9Y A;  3DOR A;  5ING A;  3IBB A;  5CTC A;  3T88 A;  3HP0 A;  2VSU E;  2VSU F;  4JJT A;  2ZQQ A;  5KJP A;  4JYL A;  2X24 A;  5DUC A;  4MXI A;  1FCF A;  3ZWB A;  5DUF A;  4QFE A;  4Q0G A;  4IZB A;  3SLL A;  1UYV A;  4U0G A;  4I52 A;  1RJN A;  3TV5 A;  1PIX A;  1YG8 A;  4HNK A;  5DTP A;  3GLM A;  3OME A;  1EY3 A;  5C9G A;  1FC6 A;  3T89 A;  3ST9 A;  4Q1I A;  3KTK A;  1W2X A;  1UYS A;  5INF A;  3V5I A;  4NNQ A;  2J5G A;  4WZ8 B;  3WG5 A;  3ZW9 A;  2FW2 A;  3LKE A;  3RSI A;  4K29 A;  3N6R B;  3RST A;  3R6H A;  3KTG A;  1ON9 A;  4I42 A;  3IAV A;  3R9T A;  4FJW D;  3OT6 A;  5FUS A;  1TG6 A;  3QXZ A;  1TYF A;  4L8K A;  1XX4 A;  3JU1 A;  2PBP A;  3ZWC A;  3QYR A;  4FN7 A;  3QKA A;  2D3T A;  2VSU A;  3MYB A;  5CTB A;  1Q51 A;  1HNO A;  3TVU A;  3GF3 A;  4L6W A;  4IZC A;  3QXI A;  3STA A;  3R0O A;  3L3S A;  2UZF A;  3QMJ A;  1XO6 A;  4ZDD A;  1WZ8 A;  3SWX A;  3K8X A;  2F6Q A;  5HUQ A;  1DUB A;  2ZL0 A;  1OD4 A;  3U9S B;  4OLQ A;  1WDK A;  4DI1 A;  2GTR A;  2J5G D;  4JCQ A;  2A81 A;  2IEX A;  1SG4 A;  1K39 A;  3Q0G A;  5DZK A;  1FC9 A;  3BPP A;  4JCT A;  3T8A A;  2QQ3 A;  3OC7 A;  3DJA A;  2ZL3 A;  4FNB A;  1FC7 A;  4ELX A;  3PGQ A;  5KDR B;  2PPY A;  4ZDC A;  3HE2 A;  3HIN A;  4JSB A;  4KPK A;  2J5I I;  3H81 A;  1VRG A;  3KQF A;  3IB9 A;  4EMM A;  2EJ5 A;  4GM2 A;  4LK5 A;  2HW5 A;  4ZU2 A;  3HLN 1;  4K3W A;  5G1Q A;  2NP9 A;  3P2L A;  3TLF A;  4I4Z A;  1N6D A;  2FBM A;  2A7K A;  3PZK A;  2F9I B;  4JVT A;  1XNW A;  4FZW A;  4WCZ A;  3R9Q A;  5DZK H;  3G64 A;  3KTJ A;  3MT6 A;  2VX2 A;  3M6M A;  5DTW A;  1J7X A;  2YJG A;  2BZR A;  1N6E A;  4ZDB A;  3NJD A;  1HZD A;  4EMP A;  3ZWA A;  5JBX A;  3K50 A;  4U1A A;  4ASI A;  4RYF A;  2Q35 A;  4OG1 A;  5DKP A;  5INI A;  4EML A;  1ON3 A;  3QWD A;  3TRR A;  1X0U A;  4ELW A;  4HDT A;  4K2N A;  4IZD A;  2Q34 A;  3BEZ A;  3VIV A;  1N6F A;  3U9R B;  3TT7 A;  1XNV A;  3PEA A;  4YLH A;  3R9S A;  4HC8 A;  5C90 A;  4B3J A;  5IKL B;  2Q2X A;  4B3H A;  2A7S A;  1O8U A;  1JXZ A;  2DEO A;  3LAO A;  3MOY A;  4JYJ A;  2F6I A;  1EF9 A;  3U9T B;  5E0S H;  3H0Q A;  1DCI A;  1NZY B;  1Y7O A;  5DU4 A;  3P85 A;  3HRX A;  1K32 A;  2VRE A;  3H0U A;  3I47 A;  5FIF A;  4NEK A;  3TDC A;  2ZL2 A;  2DUB A;  3Q1T A;  1UIY A;  1Q52 A;  4FB8 A;  2CE3 A;  4U18 A;  4MOU A;  2ZQR A;  4U19 A;  3TZ3 A;  1HNU A;  5E0S A;  1RJM A;  3H02 A;  3Q7H A;  4G2R A;  2C8T A;  3ISA A;  2W3P A;  5DU8 A;  3KTH A;  5JBW A;  3T8B A;  2VSS F;  2X58 A;  3H0J A;  4MI2 A;  4OMR A;  4FZW C;  1UYR A;  1XNY A;  3FF6 A;  3MFM A;  3Q0J A;  1SZO A;  3M6N A;  2F9Y B;  3GMA A;  2VSU C;  4KWB A;  2CBY A;  4JFC A;  1UYT A;  5MGB A;  4ZDE A;  1WDL A;  2PG8 A;  2VSS A;  3V5E A;  3QRE A;  4QII A;  3BPT A;  3QK8 A;  1NZY A;  3NJB A;  4U0G H;  4FND A;  4GHN A;  4JCS A;  4U0H A;  1WDM A;  1YG6 A;  3GKB A;  4B3I A;  1OD2 A;  4JCR A;  4FN8 A;  3TT6 A;  4JWV A;  4KD6 A;  3ZW8 A;  4RCN A;  3TVW A;  3FDU A;  5KDR A;  3KTI A;  2J5I B;  2J5I A;  4Z0M A;  3RRV A;  4KNP A;  2J5S A;  2ZL4 A;  4J2U A;  1MJ3 A;  4NAR A;  4ZDF A;  2VSS E;  5DU6 A;  5G1R A;  5E0N X;  3GF7 A;  4RYF H;  4QIJ A;  5G1S A;  1EF8 A;  2WTB A;  4F47 A;  3BF0 A;  3H0S A;  4ELS A;  1PJH A;  2F9I A;  3T3W A;  3P5M A;  2FZS A;  4WYO B;  3PE8 A;  5DL1 A;  4JOT A; 
#chains in the Genus database with same CATH homology
 2F9Y A;  3DOR A;  5ING A;  3IBB A;  5CTC A;  3T88 A;  3HP0 A;  2VSU E;  2VSU F;  4JJT A;  2ZQQ A;  5KJP A;  4JYL A;  2X24 A;  5DUC A;  4MXI A;  1FCF A;  3ZWB A;  5DUF A;  4QFE A;  4Q0G A;  4IZB A;  3SLL A;  1UYV A;  4U0G A;  4I52 A;  1RJN A;  3TV5 A;  1PIX A;  1YG8 A;  4HNK A;  5DTP A;  3GLM A;  3OME A;  1EY3 A;  5C9G A;  1FC6 A;  3T89 A;  3ST9 A;  4Q1I A;  3KTK A;  1W2X A;  1UYS A;  5INF A;  3V5I A;  4NNQ A;  2J5G A;  4WZ8 B;  3WG5 A;  3ZW9 A;  2FW2 A;  3LKE A;  3RSI A;  4K29 A;  3N6R B;  3RST A;  3R6H A;  3KTG A;  1ON9 A;  4I42 A;  3IAV A;  3R9T A;  4FJW D;  3OT6 A;  5FUS A;  1TG6 A;  3QXZ A;  1TYF A;  4L8K A;  1XX4 A;  3JU1 A;  2PBP A;  3ZWC A;  3QYR A;  4FN7 A;  3QKA A;  2D3T A;  2VSU A;  3MYB A;  5CTB A;  1Q51 A;  1HNO A;  3TVU A;  3GF3 A;  4L6W A;  4IZC A;  3QXI A;  3STA A;  3R0O A;  3L3S A;  2UZF A;  3QMJ A;  1XO6 A;  4ZDD A;  1WZ8 A;  3SWX A;  3K8X A;  2F6Q A;  5HUQ A;  1DUB A;  2ZL0 A;  1OD4 A;  3U9S B;  4OLQ A;  1WDK A;  4DI1 A;  2GTR A;  2J5G D;  4JCQ A;  2A81 A;  2IEX A;  1SG4 A;  1K39 A;  3Q0G A;  5DZK A;  1FC9 A;  3BPP A;  4JCT A;  3T8A A;  2QQ3 A;  3OC7 A;  3DJA A;  2ZL3 A;  4FNB A;  1FC7 A;  4ELX A;  3PGQ A;  5KDR B;  2PPY A;  4ZDC A;  3HE2 A;  3HIN A;  4JSB A;  4KPK A;  2J5I I;  3H81 A;  1VRG A;  3KQF A;  3IB9 A;  4EMM A;  2EJ5 A;  4GM2 A;  4LK5 A;  2HW5 A;  4ZU2 A;  3HLN 1;  4K3W A;  5G1Q A;  2NP9 A;  3P2L A;  3TLF A;  4I4Z A;  1N6D A;  2FBM A;  2A7K A;  3PZK A;  2F9I B;  4JVT A;  1XNW A;  4FZW A;  4WCZ A;  3R9Q A;  5DZK H;  3G64 A;  3KTJ A;  3MT6 A;  2VX2 A;  3M6M A;  5DTW A;  1J7X A;  2YJG A;  2BZR A;  1N6E A;  4ZDB A;  3NJD A;  1HZD A;  4EMP A;  3ZWA A;  5JBX A;  3K50 A;  4U1A A;  4ASI A;  4RYF A;  2Q35 A;  4OG1 A;  5DKP A;  5INI A;  4EML A;  1ON3 A;  3QWD A;  3TRR A;  1X0U A;  4ELW A;  4HDT A;  4K2N A;  4IZD A;  2Q34 A;  3BEZ A;  3VIV A;  1N6F A;  3U9R B;  3TT7 A;  1XNV A;  3PEA A;  4YLH A;  3R9S A;  4HC8 A;  5C90 A;  4B3J A;  5IKL B;  2Q2X A;  4B3H A;  2A7S A;  1O8U A;  1JXZ A;  2DEO A;  3LAO A;  3MOY A;  4JYJ A;  2F6I A;  1EF9 A;  3U9T B;  5E0S H;  3H0Q A;  1DCI A;  1NZY B;  1Y7O A;  5DU4 A;  3P85 A;  3HRX A;  1K32 A;  2VRE A;  3H0U A;  3I47 A;  5FIF A;  4NEK A;  3TDC A;  2ZL2 A;  2DUB A;  3Q1T A;  1UIY A;  1Q52 A;  4FB8 A;  2CE3 A;  4U18 A;  4MOU A;  2ZQR A;  4U19 A;  3TZ3 A;  1HNU A;  5E0S A;  1RJM A;  3H02 A;  3Q7H A;  4G2R A;  2C8T A;  3ISA A;  2W3P A;  5DU8 A;  3KTH A;  5JBW A;  3T8B A;  2VSS F;  2X58 A;  3H0J A;  4MI2 A;  4OMR A;  4FZW C;  1UYR A;  1XNY A;  3FF6 A;  3MFM A;  3Q0J A;  1SZO A;  3M6N A;  2F9Y B;  3GMA A;  2VSU C;  4KWB A;  2CBY A;  4JFC A;  1UYT A;  5MGB A;  4ZDE A;  1WDL A;  2PG8 A;  2VSS A;  3V5E A;  3QRE A;  4QII A;  3BPT A;  3QK8 A;  1NZY A;  3NJB A;  4U0G H;  4FND A;  4GHN A;  4JCS A;  4U0H A;  1WDM A;  1YG6 A;  3GKB A;  4B3I A;  1OD2 A;  4JCR A;  4FN8 A;  3TT6 A;  4JWV A;  4KD6 A;  3ZW8 A;  4RCN A;  3TVW A;  3FDU A;  5KDR A;  3KTI A;  2J5I B;  2J5I A;  4Z0M A;  3RRV A;  4KNP A;  2J5S A;  2ZL4 A;  4J2U A;  1MJ3 A;  4NAR A;  4ZDF A;  2VSS E;  5DU6 A;  5G1R A;  5E0N X;  3GF7 A;  4RYF H;  4QIJ A;  5G1S A;  1EF8 A;  2WTB A;  4F47 A;  3BF0 A;  3H0S A;  4ELS A;  1PJH A;  2F9I A;  3T3W A;  3P5M A;  2FZS A;  4WYO B;  3PE8 A;  5DL1 A;  4JOT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...