3GKBA

Crystal structure of a putative enoyl-coa hydratase from streptomyces avermitilis
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
274
structure length
274
Chain Sequence
AYSTLRVSSEHGVARIILDNPPVNVIGATMMRELRTVLTTLADDSSVRVIVFSSADPEFFLAHVDMRIGEKMDALQELAASAPADVNVFQAVGELIRHQPQVTIVKLAGKARGGGAEFVAAADMAFAAAETAGLGQIEALMGIIPGGGGTQYLRGRVGRNRALEVVLTADLFDAETAASYGWINRALPADELDEYVDRVARNIAALPDGVIEAAKRSLPADDLKEGLLGENDAWAATFSLPAAQQLISGGLKDGAQTPAGERDLEGLMRSVARE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative enoyl-CoA hydratase from Streptomyces avermitilis
rcsb
source organism Streptomyces avermitilis
molecule tags Structural genomics, unknown function
molecule keywords Putative enoyl-CoA hydratase
total genus 104
structure length 274
sequence length 274
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3gkbA00
3BPPA 1UYRA 4IZDA 4FB8A 2HW5A 2ZQRA 1NZYB 2Q2XA 3ZW8A 4HNKA 5C9GA 2BZRA 2PPYA 3P85A 1K39A 1JXZA 2PBPA 4Z0MA 2ZL2A 3ZWBA 4OMRA 4YLHA 4JJTA 2VSSF 5G1SA 3VIVA 3IAVA 4WZ8B 3BEZA 5DUCA 3MOYA 3L3SA 5DU4A 3GF7A 4JCRA 1PIXA 1WDLA 2VSUA 1K32A 5DZKA 5FUSA 3LKEA 4L8KA 4ZDFA 4QFEA 4DI1A 4FNDA 1X0UA 4KNPA 4KD6A 3U9RB 4G2RA 2ZL3A 3LAOA 1FC7A 1N6FA 2UZFA 3GMAA 2J5IB 4NEKA 4JOTA 3TDCA 1XO6A 4HC8A 3Q0JA 3G64A 3JU1A 3NJDA 2ZL4A 3R6HA 4FZWC 3KTGA 3H0UA 5G1QA 3V5EA 1XX4A 1XNWA 3U9SB 3SLLA 3IB9A 1HZDA 1W2XA 3RSIA 1WDMA 3Q0GA 1N6DA 2F6IA 1FCFA 5JBXA 3HP0A 3KTKA 4U0GH 2F9IA 4U18A 5E0SA 1UYSA 3QXIA 2X24A 2CBYA 2FW2A 2QQ3A 1UYTA 3TLFA 4B3JA 4I4ZA 2Q35A 3HE2A 5DL1A 4K29A 2GTRA 3PGQA 3OC7A 3N6RB 4JWVA 1PJHA 2F6QA 2ZL0A 3T8BA 5E0NX 5DTPA 1VRGA 5KDRA 1EF8A 1HNOA 3MT6A 1UYVA 4JFCA 3R0OA 2F9IB 3H81A 1N6EA 2FZSA 3QK8A 3KQFA 3WG5A 3TT6A 5INFA 3Q1TA 1YG6A 4K3WA 3QYRA 2CE3A 5KJPA 4GHNA 4IZBA 3QREA 4WCZA 3RSTA 1DCIA 3I47A 2A7KA 2C8TA 4FN8A 2VX2A 1Q51A 5JBWA 3STAA 5IKLB 4L6WA 1FC6A 2F9YB 3OT6A 5DUFA 2VSUE 3QXZA 4GM2A 3TRRA 4ZDCA 3NJBA 3TVWA 4EMPA 1DUBA 4NNQA 1RJNA 3FF6A 2ZQQA 4U0HA 2J5II 4IZCA 5DU8A 3R9SA 1WZ8A 3IBBA 3R9QA 3M6MA 2VREA 4LK5A 3MYBA 4ELWA 3V5IA 1SG4A 4KPKA 3PE8A 3QWDA 2D3TA 4ELXA 4KWBA 2FBMA 3R9TA 3P2LA 2VSUC 2A81A 3QMJA 3P5MA 4ZDEA 4MOUA 2VSSA 3ZW9A 5G1RA 2VSSE 3ISAA 4I42A 5INGA 2IEXA 1OD4A 3K8XA 2WTBA 3TV5A 4RYFH 1MJ3A 4OG1A 4JCSA 3K50A 4ZU2A 5FIFA 3QKAA 2VSUF 5E0SH 4B3IA 4QIJA 3TVUA 3ZWAA 1OD2A 5C90A 3KTHA 4RYFA 4JCQA 3H0QA 3OMEA 4FN7A 1TG6A 2J5SA 3BF0A 2J5GA 3T3WA 5DKPA 4U19A 3DORA 4QIIA 1XNVA 3RRVA 3H0JA 2F9YA 4ZDBA 3HINA 5CTCA 4U1AA 5DU6A 4JYJA 3H0SA 4B3HA 1TYFA 2A7SA 1O8UA 2X58A 4Q1IA 4OLQA 4ELSA 2DUBA 1NZYA 4JSBA 3T8AA 5DZKH 1Y7OA 1RJMA 4JCTA 2J5GD 4JVTA 4Q0GA 4FZWA 5INIA 4ZDDA 4RCNA 2NP9A 1Q52A 1ON9A 4U0GA 3H02A 2W3PA 3DJAA 5KDRB 1UIYA 3GF3A 3KTIA 5CTBA 3SWXA 1YG8A 3FDUA 5DTWA 3PEAA 3GLMA 2DEOA 3HRXA 3TZ3A 1FC9A 2EJ5A 1WDKA 2J5IA 1EY3A 4JYLA 2Q34A 1ON3A 4EMMA 3HLN1 4FJWD 3TT7A 3U9TB 4MI2A 4ASIA 1SZOA 3M6NA 3GKBA 3T89A 3KTJA 4MXIA 1EF9A 4WYOB 3PZKA 4FNBA 1J7XA 3ST9A 4F47A 3T88A 4EMLA 2PG8A 4I52A 3MFMA 4K2NA 5MGBA 3ZWCA 3Q7HA 1XNYA 1HNUA
chains in the Genus database with same CATH superfamily
2YJGA 3BPPA 1UYRA 4IZDA 4FB8A 2HW5A 2ZQRA 1NZYB 2Q2XA 3ZW8A 4HNKA 5C9GA 2BZRA 2PPYA 3P85A 1K39A 1JXZA 2PBPA 4Z0MA 2ZL2A 3ZWBA 4OMRA 4YLHA 4JJTA 2VSSF 5G1SA 3VIVA 3IAVA 4WZ8B 3BEZA 5DUCA 3MOYA 3L3SA 5DU4A 3GF7A 4JCRA 1PIXA 1WDLA 4NARA 2VSUA 1K32A 5DZKA 5FUSA 3LKEA 4L8KA 4ZDFA 4QFEA 4DI1A 4FNDA 1X0UA 4KNPA 4KD6A 3U9RB 4G2RA 2ZL3A 3LAOA 1FC7A 1N6FA 2UZFA 3GMAA 2J5IB 4NEKA 4JOTA 3TDCA 1XO6A 4HC8A 3Q0JA 3G64A 3JU1A 3NJDA 2ZL4A 3R6HA 4FZWC 3KTGA 3H0UA 5G1QA 3V5EA 1XX4A 1XNWA 3U9SB 3SLLA 3IB9A 1HZDA 1W2XA 3RSIA 1WDMA 3Q0GA 1N6DA 2F6IA 1FCFA 5JBXA 3HP0A 3KTKA 4U0GH 2F9IA 4U18A 5E0SA 1UYSA 3QXIA 2X24A 2CBYA 2FW2A 2QQ3A 1UYTA 3TLFA 4B3JA 4I4ZA 2Q35A 3HE2A 5DL1A 4K29A 2GTRA 3PGQA 3OC7A 3N6RB 4JWVA 1PJHA 2F6QA 2ZL0A 3T8BA 5E0NX 5DTPA 1VRGA 5KDRA 1EF8A 1HNOA 3MT6A 1UYVA 3BPTA 4JFCA 3R0OA 2F9IB 3H81A 1N6EA 2FZSA 3QK8A 3KQFA 3WG5A 3TT6A 5INFA 3Q1TA 1YG6A 4K3WA 3QYRA 2CE3A 5KJPA 4GHNA 4IZBA 5HUQA 3QREA 4WCZA 3RSTA 1DCIA 3I47A 2A7KA 2C8TA 4FN8A 2VX2A 1Q51A 5JBWA 3STAA 5IKLB 4L6WA 1FC6A 2F9YB 3OT6A 5DUFA 2VSUE 3QXZA 4GM2A 3TRRA 4ZDCA 3NJBA 3TVWA 4EMPA 1DUBA 4NNQA 1RJNA 3FF6A 2ZQQA 4U0HA 2J5II 4IZCA 5DU8A 3R9SA 1WZ8A 3IBBA 3R9QA 3M6MA 2VREA 4LK5A 3MYBA 4ELWA 3V5IA 1SG4A 4KPKA 3PE8A 3QWDA 2D3TA 4ELXA 4KWBA 2FBMA 3R9TA 3P2LA 2VSUC 2A81A 3QMJA 3P5MA 4ZDEA 4MOUA 2VSSA 3ZW9A 5G1RA 2VSSE 3ISAA 4I42A 5INGA 2IEXA 1OD4A 3K8XA 2WTBA 3TV5A 4RYFH 1MJ3A 4OG1A 4JCSA 3K50A 4ZU2A 5FIFA 3QKAA 2VSUF 5E0SH 4B3IA 4QIJA 3TVUA 3ZWAA 1OD2A 5C90A 3KTHA 4RYFA 4JCQA 3H0QA 3OMEA 4FN7A 1TG6A 2J5SA 3BF0A 2J5GA 3T3WA 5DKPA 4U19A 3DORA 4QIIA 1XNVA 3RRVA 3H0JA 2F9YA 4ZDBA 3HINA 5CTCA 4U1AA 5DU6A 4JYJA 3H0SA 4B3HA 1TYFA 4J2UA 2A7SA 1O8UA 2X58A 4Q1IA 4OLQA 4ELSA 2DUBA 1NZYA 4JSBA 3T8AA 5DZKH 1Y7OA 1RJMA 4JCTA 2J5GD 4JVTA 4Q0GA 4FZWA 5INIA 4ZDDA 4HDTA 4RCNA 2NP9A 1Q52A 1ON9A 4U0GA 3H02A 2W3PA 3DJAA 5KDRB 1UIYA 3GF3A 3KTIA 5CTBA 3SWXA 1YG8A 3FDUA 5DTWA 3PEAA 3GLMA 2DEOA 3HRXA 3TZ3A 1FC9A 2EJ5A 1WDKA 2J5IA 1EY3A 4JYLA 2Q34A 1ON3A 4EMMA 3HLN1 4FJWD 3TT7A 3U9TB 4MI2A 4ASIA 1SZOA 3M6NA 3GKBA 3T89A 3KTJA 4MXIA 1EF9A 4WYOB 3PZKA 4FNBA 1J7XA 3ST9A 4F47A 3T88A 4EMLA 2PG8A 4I52A 3MFMA 4K2NA 5MGBA 3ZWCA 3Q7HA 1XNYA 1HNUA
chains in the Genus database with same CATH topology
2YJGA 3BPPA 1UYRA 4IZDA 4FB8A 2HW5A 2ZQRA 1NZYB 2Q2XA 3ZW8A 4HNKA 5C9GA 2BZRA 2PPYA 3P85A 1K39A 1JXZA 2PBPA 4Z0MA 2ZL2A 3ZWBA 4OMRA 4YLHA 4JJTA 2VSSF 5G1SA 3VIVA 3IAVA 4WZ8B 3BEZA 5DUCA 3MOYA 3L3SA 5DU4A 3GF7A 4JCRA 1PIXA 1WDLA 4NARA 2VSUA 1K32A 5DZKA 5FUSA 3LKEA 4L8KA 4ZDFA 4QFEA 4DI1A 4FNDA 1X0UA 4KNPA 4KD6A 3U9RB 4G2RA 2ZL3A 3LAOA 1FC7A 1N6FA 2UZFA 3GMAA 2J5IB 4NEKA 4JOTA 3TDCA 1XO6A 4HC8A 3Q0JA 3G64A 3JU1A 3NJDA 2ZL4A 3R6HA 4FZWC 3KTGA 3H0UA 5G1QA 3V5EA 1XX4A 1XNWA 3U9SB 3SLLA 3IB9A 1HZDA 1W2XA 3RSIA 1WDMA 3Q0GA 1N6DA 2F6IA 1FCFA 5JBXA 3HP0A 3KTKA 4U0GH 2F9IA 4U18A 5E0SA 1UYSA 3QXIA 2X24A 2CBYA 2FW2A 2QQ3A 1UYTA 3TLFA 4B3JA 4I4ZA 2Q35A 3HE2A 5DL1A 4K29A 2GTRA 3PGQA 3OC7A 3N6RB 4JWVA 1PJHA 2F6QA 2ZL0A 3T8BA 5E0NX 5DTPA 1VRGA 5KDRA 1EF8A 1HNOA 3MT6A 1UYVA 3BPTA 4JFCA 3R0OA 2F9IB 3H81A 1N6EA 2FZSA 3QK8A 3KQFA 3WG5A 3TT6A 5INFA 3Q1TA 1YG6A 4K3WA 3QYRA 2CE3A 5KJPA 4GHNA 4IZBA 5HUQA 3QREA 4WCZA 3RSTA 1DCIA 3I47A 2A7KA 2C8TA 4FN8A 2VX2A 1Q51A 5JBWA 3STAA 5IKLB 4L6WA 1FC6A 2F9YB 3OT6A 5DUFA 2VSUE 3QXZA 4GM2A 3TRRA 4ZDCA 3NJBA 3TVWA 4EMPA 1DUBA 4NNQA 1RJNA 3FF6A 2ZQQA 4U0HA 2J5II 4IZCA 5DU8A 3R9SA 1WZ8A 3IBBA 3R9QA 3M6MA 2VREA 4LK5A 3MYBA 4ELWA 3V5IA 1SG4A 4KPKA 3PE8A 3QWDA 2D3TA 4ELXA 4KWBA 2FBMA 3R9TA 3P2LA 2VSUC 2A81A 3QMJA 3P5MA 4ZDEA 4MOUA 2VSSA 3ZW9A 5G1RA 2VSSE 3ISAA 4I42A 5INGA 2IEXA 1OD4A 3K8XA 2WTBA 3TV5A 4RYFH 1MJ3A 4OG1A 4JCSA 3K50A 4ZU2A 5FIFA 3QKAA 2VSUF 5E0SH 4B3IA 4QIJA 3TVUA 3ZWAA 1OD2A 5C90A 3KTHA 4RYFA 4JCQA 3H0QA 3OMEA 4FN7A 1TG6A 2J5SA 3BF0A 2J5GA 3T3WA 5DKPA 4U19A 3DORA 4QIIA 1XNVA 3RRVA 3H0JA 2F9YA 4ZDBA 3HINA 5CTCA 4U1AA 5DU6A 4JYJA 3H0SA 4B3HA 1TYFA 4J2UA 2A7SA 1O8UA 2X58A 4Q1IA 4OLQA 4ELSA 2DUBA 1NZYA 4JSBA 3T8AA 5DZKH 1Y7OA 1RJMA 4JCTA 2J5GD 4JVTA 4Q0GA 4FZWA 5INIA 4ZDDA 4HDTA 4RCNA 2NP9A 1Q52A 1ON9A 4U0GA 3H02A 2W3PA 3DJAA 5KDRB 1UIYA 3GF3A 3KTIA 5CTBA 3SWXA 1YG8A 3FDUA 5DTWA 3PEAA 3GLMA 2DEOA 3HRXA 3TZ3A 1FC9A 2EJ5A 1WDKA 2J5IA 1EY3A 4JYLA 2Q34A 1ON3A 4EMMA 3HLN1 4FJWD 3TT7A 3U9TB 4MI2A 4ASIA 1SZOA 3M6NA 3GKBA 3T89A 3KTJA 4MXIA 1EF9A 4WYOB 3PZKA 4FNBA 1J7XA 3ST9A 4F47A 3T88A 4EMLA 2PG8A 4I52A 3MFMA 4K2NA 5MGBA 3ZWCA 3Q7HA 1XNYA 1HNUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BPP A;  1UYR A;  4IZD A;  4FB8 A;  2HW5 A;  2ZQR A;  1NZY B;  2Q2X A;  3ZW8 A;  4HNK A;  5C9G A;  2BZR A;  2PPY A;  3P85 A;  1K39 A;  1JXZ A;  2PBP A;  4Z0M A;  2ZL2 A;  3ZWB A;  4OMR A;  4YLH A;  4JJT A;  2VSS F;  5G1S A;  3VIV A;  3IAV A;  4WZ8 B;  3BEZ A;  5DUC A;  3MOY A;  3L3S A;  5DU4 A;  3GF7 A;  4JCR A;  1PIX A;  1WDL A;  2VSU A;  1K32 A;  5DZK A;  5FUS A;  3LKE A;  4L8K A;  4ZDF A;  4QFE A;  4DI1 A;  4FND A;  1X0U A;  4KNP A;  4KD6 A;  3U9R B;  4G2R A;  2ZL3 A;  3LAO A;  1FC7 A;  1N6F A;  2UZF A;  3GMA A;  2J5I B;  4NEK A;  4JOT A;  3TDC A;  1XO6 A;  4HC8 A;  3Q0J A;  3G64 A;  3JU1 A;  3NJD A;  2ZL4 A;  3R6H A;  4FZW C;  3KTG A;  3H0U A;  5G1Q A;  3V5E A;  1XX4 A;  1XNW A;  3U9S B;  3SLL A;  3IB9 A;  1HZD A;  1W2X A;  3RSI A;  1WDM A;  3Q0G A;  1N6D A;  2F6I A;  1FCF A;  5JBX A;  3HP0 A;  3KTK A;  4U0G H;  2F9I A;  4U18 A;  5E0S A;  1UYS A;  3QXI A;  2X24 A;  2CBY A;  2FW2 A;  2QQ3 A;  1UYT A;  3TLF A;  4B3J A;  4I4Z A;  2Q35 A;  3HE2 A;  5DL1 A;  4K29 A;  2GTR A;  3PGQ A;  3OC7 A;  3N6R B;  4JWV A;  1PJH A;  2F6Q A;  2ZL0 A;  3T8B A;  5E0N X;  5DTP A;  1VRG A;  5KDR A;  1EF8 A;  1HNO A;  3MT6 A;  1UYV A;  4JFC A;  3R0O A;  2F9I B;  3H81 A;  1N6E A;  2FZS A;  3QK8 A;  3KQF A;  3WG5 A;  3TT6 A;  5INF A;  3Q1T A;  1YG6 A;  4K3W A;  3QYR A;  2CE3 A;  5KJP A;  4GHN A;  4IZB A;  3QRE A;  4WCZ A;  3RST A;  1DCI A;  3I47 A;  2A7K A;  2C8T A;  4FN8 A;  2VX2 A;  1Q51 A;  5JBW A;  3STA A;  5IKL B;  4L6W A;  1FC6 A;  2F9Y B;  3OT6 A;  5DUF A;  2VSU E;  3QXZ A;  4GM2 A;  3TRR A;  4ZDC A;  3NJB A;  3TVW A;  4EMP A;  1DUB A;  4NNQ A;  1RJN A;  3FF6 A;  2ZQQ A;  4U0H A;  2J5I I;  4IZC A;  5DU8 A;  3R9S A;  1WZ8 A;  3IBB A;  3R9Q A;  3M6M A;  2VRE A;  4LK5 A;  3MYB A;  4ELW A;  3V5I A;  1SG4 A;  4KPK A;  3PE8 A;  3QWD A;  2D3T A;  4ELX A;  4KWB A;  2FBM A;  3R9T A;  3P2L A;  2VSU C;  2A81 A;  3QMJ A;  3P5M A;  4ZDE A;  4MOU A;  2VSS A;  3ZW9 A;  5G1R A;  2VSS E;  3ISA A;  4I42 A;  5ING A;  2IEX A;  1OD4 A;  3K8X A;  2WTB A;  3TV5 A;  4RYF H;  1MJ3 A;  4OG1 A;  4JCS A;  3K50 A;  4ZU2 A;  5FIF A;  3QKA A;  2VSU F;  5E0S H;  4B3I A;  4QIJ A;  3TVU A;  3ZWA A;  1OD2 A;  5C90 A;  3KTH A;  4RYF A;  4JCQ A;  3H0Q A;  3OME A;  4FN7 A;  1TG6 A;  2J5S A;  3BF0 A;  2J5G A;  3T3W A;  5DKP A;  4U19 A;  3DOR A;  4QII A;  1XNV A;  3RRV A;  3H0J A;  2F9Y A;  4ZDB A;  3HIN A;  5CTC A;  4U1A A;  5DU6 A;  4JYJ A;  3H0S A;  4B3H A;  1TYF A;  2A7S A;  1O8U A;  2X58 A;  4Q1I A;  4OLQ A;  4ELS A;  2DUB A;  1NZY A;  4JSB A;  3T8A A;  5DZK H;  1Y7O A;  1RJM A;  4JCT A;  2J5G D;  4JVT A;  4Q0G A;  4FZW A;  5INI A;  4ZDD A;  4RCN A;  2NP9 A;  1Q52 A;  1ON9 A;  4U0G A;  3H02 A;  2W3P A;  3DJA A;  5KDR B;  1UIY A;  3GF3 A;  3KTI A;  5CTB A;  3SWX A;  1YG8 A;  3FDU A;  5DTW A;  3PEA A;  3GLM A;  2DEO A;  3HRX A;  3TZ3 A;  1FC9 A;  2EJ5 A;  1WDK A;  2J5I A;  1EY3 A;  4JYL A;  2Q34 A;  1ON3 A;  4EMM A;  3HLN 1;  4FJW D;  3TT7 A;  3U9T B;  4MI2 A;  4ASI A;  1SZO A;  3M6N A;  3GKB A;  3T89 A;  3KTJ A;  4MXI A;  1EF9 A;  4WYO B;  3PZK A;  4FNB A;  1J7X A;  3ST9 A;  4F47 A;  3T88 A;  4EML A;  2PG8 A;  4I52 A;  3MFM A;  4K2N A;  5MGB A;  3ZWC A;  3Q7H A;  1XNY A;  1HNU A; 
#chains in the Genus database with same CATH topology
 2YJG A;  3BPP A;  1UYR A;  4IZD A;  4FB8 A;  2HW5 A;  2ZQR A;  1NZY B;  2Q2X A;  3ZW8 A;  4HNK A;  5C9G A;  2BZR A;  2PPY A;  3P85 A;  1K39 A;  1JXZ A;  2PBP A;  4Z0M A;  2ZL2 A;  3ZWB A;  4OMR A;  4YLH A;  4JJT A;  2VSS F;  5G1S A;  3VIV A;  3IAV A;  4WZ8 B;  3BEZ A;  5DUC A;  3MOY A;  3L3S A;  5DU4 A;  3GF7 A;  4JCR A;  1PIX A;  1WDL A;  4NAR A;  2VSU A;  1K32 A;  5DZK A;  5FUS A;  3LKE A;  4L8K A;  4ZDF A;  4QFE A;  4DI1 A;  4FND A;  1X0U A;  4KNP A;  4KD6 A;  3U9R B;  4G2R A;  2ZL3 A;  3LAO A;  1FC7 A;  1N6F A;  2UZF A;  3GMA A;  2J5I B;  4NEK A;  4JOT A;  3TDC A;  1XO6 A;  4HC8 A;  3Q0J A;  3G64 A;  3JU1 A;  3NJD A;  2ZL4 A;  3R6H A;  4FZW C;  3KTG A;  3H0U A;  5G1Q A;  3V5E A;  1XX4 A;  1XNW A;  3U9S B;  3SLL A;  3IB9 A;  1HZD A;  1W2X A;  3RSI A;  1WDM A;  3Q0G A;  1N6D A;  2F6I A;  1FCF A;  5JBX A;  3HP0 A;  3KTK A;  4U0G H;  2F9I A;  4U18 A;  5E0S A;  1UYS A;  3QXI A;  2X24 A;  2CBY A;  2FW2 A;  2QQ3 A;  1UYT A;  3TLF A;  4B3J A;  4I4Z A;  2Q35 A;  3HE2 A;  5DL1 A;  4K29 A;  2GTR A;  3PGQ A;  3OC7 A;  3N6R B;  4JWV A;  1PJH A;  2F6Q A;  2ZL0 A;  3T8B A;  5E0N X;  5DTP A;  1VRG A;  5KDR A;  1EF8 A;  1HNO A;  3MT6 A;  1UYV A;  3BPT A;  4JFC A;  3R0O A;  2F9I B;  3H81 A;  1N6E A;  2FZS A;  3QK8 A;  3KQF A;  3WG5 A;  3TT6 A;  5INF A;  3Q1T A;  1YG6 A;  4K3W A;  3QYR A;  2CE3 A;  5KJP A;  4GHN A;  4IZB A;  5HUQ A;  3QRE A;  4WCZ A;  3RST A;  1DCI A;  3I47 A;  2A7K A;  2C8T A;  4FN8 A;  2VX2 A;  1Q51 A;  5JBW A;  3STA A;  5IKL B;  4L6W A;  1FC6 A;  2F9Y B;  3OT6 A;  5DUF A;  2VSU E;  3QXZ A;  4GM2 A;  3TRR A;  4ZDC A;  3NJB A;  3TVW A;  4EMP A;  1DUB A;  4NNQ A;  1RJN A;  3FF6 A;  2ZQQ A;  4U0H A;  2J5I I;  4IZC A;  5DU8 A;  3R9S A;  1WZ8 A;  3IBB A;  3R9Q A;  3M6M A;  2VRE A;  4LK5 A;  3MYB A;  4ELW A;  3V5I A;  1SG4 A;  4KPK A;  3PE8 A;  3QWD A;  2D3T A;  4ELX A;  4KWB A;  2FBM A;  3R9T A;  3P2L A;  2VSU C;  2A81 A;  3QMJ A;  3P5M A;  4ZDE A;  4MOU A;  2VSS A;  3ZW9 A;  5G1R A;  2VSS E;  3ISA A;  4I42 A;  5ING A;  2IEX A;  1OD4 A;  3K8X A;  2WTB A;  3TV5 A;  4RYF H;  1MJ3 A;  4OG1 A;  4JCS A;  3K50 A;  4ZU2 A;  5FIF A;  3QKA A;  2VSU F;  5E0S H;  4B3I A;  4QIJ A;  3TVU A;  3ZWA A;  1OD2 A;  5C90 A;  3KTH A;  4RYF A;  4JCQ A;  3H0Q A;  3OME A;  4FN7 A;  1TG6 A;  2J5S A;  3BF0 A;  2J5G A;  3T3W A;  5DKP A;  4U19 A;  3DOR A;  4QII A;  1XNV A;  3RRV A;  3H0J A;  2F9Y A;  4ZDB A;  3HIN A;  5CTC A;  4U1A A;  5DU6 A;  4JYJ A;  3H0S A;  4B3H A;  1TYF A;  4J2U A;  2A7S A;  1O8U A;  2X58 A;  4Q1I A;  4OLQ A;  4ELS A;  2DUB A;  1NZY A;  4JSB A;  3T8A A;  5DZK H;  1Y7O A;  1RJM A;  4JCT A;  2J5G D;  4JVT A;  4Q0G A;  4FZW A;  5INI A;  4ZDD A;  4HDT A;  4RCN A;  2NP9 A;  1Q52 A;  1ON9 A;  4U0G A;  3H02 A;  2W3P A;  3DJA A;  5KDR B;  1UIY A;  3GF3 A;  3KTI A;  5CTB A;  3SWX A;  1YG8 A;  3FDU A;  5DTW A;  3PEA A;  3GLM A;  2DEO A;  3HRX A;  3TZ3 A;  1FC9 A;  2EJ5 A;  1WDK A;  2J5I A;  1EY3 A;  4JYL A;  2Q34 A;  1ON3 A;  4EMM A;  3HLN 1;  4FJW D;  3TT7 A;  3U9T B;  4MI2 A;  4ASI A;  1SZO A;  3M6N A;  3GKB A;  3T89 A;  3KTJ A;  4MXI A;  1EF9 A;  4WYO B;  3PZK A;  4FNB A;  1J7X A;  3ST9 A;  4F47 A;  3T88 A;  4EML A;  2PG8 A;  4I52 A;  3MFM A;  4K2N A;  5MGB A;  3ZWC A;  3Q7H A;  1XNY A;  1HNU A; 
#chains in the Genus database with same CATH homology
 2YJG A;  3BPP A;  1UYR A;  4IZD A;  4FB8 A;  2HW5 A;  2ZQR A;  1NZY B;  2Q2X A;  3ZW8 A;  4HNK A;  5C9G A;  2BZR A;  2PPY A;  3P85 A;  1K39 A;  1JXZ A;  2PBP A;  4Z0M A;  2ZL2 A;  3ZWB A;  4OMR A;  4YLH A;  4JJT A;  2VSS F;  5G1S A;  3VIV A;  3IAV A;  4WZ8 B;  3BEZ A;  5DUC A;  3MOY A;  3L3S A;  5DU4 A;  3GF7 A;  4JCR A;  1PIX A;  1WDL A;  4NAR A;  2VSU A;  1K32 A;  5DZK A;  5FUS A;  3LKE A;  4L8K A;  4ZDF A;  4QFE A;  4DI1 A;  4FND A;  1X0U A;  4KNP A;  4KD6 A;  3U9R B;  4G2R A;  2ZL3 A;  3LAO A;  1FC7 A;  1N6F A;  2UZF A;  3GMA A;  2J5I B;  4NEK A;  4JOT A;  3TDC A;  1XO6 A;  4HC8 A;  3Q0J A;  3G64 A;  3JU1 A;  3NJD A;  2ZL4 A;  3R6H A;  4FZW C;  3KTG A;  3H0U A;  5G1Q A;  3V5E A;  1XX4 A;  1XNW A;  3U9S B;  3SLL A;  3IB9 A;  1HZD A;  1W2X A;  3RSI A;  1WDM A;  3Q0G A;  1N6D A;  2F6I A;  1FCF A;  5JBX A;  3HP0 A;  3KTK A;  4U0G H;  2F9I A;  4U18 A;  5E0S A;  1UYS A;  3QXI A;  2X24 A;  2CBY A;  2FW2 A;  2QQ3 A;  1UYT A;  3TLF A;  4B3J A;  4I4Z A;  2Q35 A;  3HE2 A;  5DL1 A;  4K29 A;  2GTR A;  3PGQ A;  3OC7 A;  3N6R B;  4JWV A;  1PJH A;  2F6Q A;  2ZL0 A;  3T8B A;  5E0N X;  5DTP A;  1VRG A;  5KDR A;  1EF8 A;  1HNO A;  3MT6 A;  1UYV A;  3BPT A;  4JFC A;  3R0O A;  2F9I B;  3H81 A;  1N6E A;  2FZS A;  3QK8 A;  3KQF A;  3WG5 A;  3TT6 A;  5INF A;  3Q1T A;  1YG6 A;  4K3W A;  3QYR A;  2CE3 A;  5KJP A;  4GHN A;  4IZB A;  5HUQ A;  3QRE A;  4WCZ A;  3RST A;  1DCI A;  3I47 A;  2A7K A;  2C8T A;  4FN8 A;  2VX2 A;  1Q51 A;  5JBW A;  3STA A;  5IKL B;  4L6W A;  1FC6 A;  2F9Y B;  3OT6 A;  5DUF A;  2VSU E;  3QXZ A;  4GM2 A;  3TRR A;  4ZDC A;  3NJB A;  3TVW A;  4EMP A;  1DUB A;  4NNQ A;  1RJN A;  3FF6 A;  2ZQQ A;  4U0H A;  2J5I I;  4IZC A;  5DU8 A;  3R9S A;  1WZ8 A;  3IBB A;  3R9Q A;  3M6M A;  2VRE A;  4LK5 A;  3MYB A;  4ELW A;  3V5I A;  1SG4 A;  4KPK A;  3PE8 A;  3QWD A;  2D3T A;  4ELX A;  4KWB A;  2FBM A;  3R9T A;  3P2L A;  2VSU C;  2A81 A;  3QMJ A;  3P5M A;  4ZDE A;  4MOU A;  2VSS A;  3ZW9 A;  5G1R A;  2VSS E;  3ISA A;  4I42 A;  5ING A;  2IEX A;  1OD4 A;  3K8X A;  2WTB A;  3TV5 A;  4RYF H;  1MJ3 A;  4OG1 A;  4JCS A;  3K50 A;  4ZU2 A;  5FIF A;  3QKA A;  2VSU F;  5E0S H;  4B3I A;  4QIJ A;  3TVU A;  3ZWA A;  1OD2 A;  5C90 A;  3KTH A;  4RYF A;  4JCQ A;  3H0Q A;  3OME A;  4FN7 A;  1TG6 A;  2J5S A;  3BF0 A;  2J5G A;  3T3W A;  5DKP A;  4U19 A;  3DOR A;  4QII A;  1XNV A;  3RRV A;  3H0J A;  2F9Y A;  4ZDB A;  3HIN A;  5CTC A;  4U1A A;  5DU6 A;  4JYJ A;  3H0S A;  4B3H A;  1TYF A;  4J2U A;  2A7S A;  1O8U A;  2X58 A;  4Q1I A;  4OLQ A;  4ELS A;  2DUB A;  1NZY A;  4JSB A;  3T8A A;  5DZK H;  1Y7O A;  1RJM A;  4JCT A;  2J5G D;  4JVT A;  4Q0G A;  4FZW A;  5INI A;  4ZDD A;  4HDT A;  4RCN A;  2NP9 A;  1Q52 A;  1ON9 A;  4U0G A;  3H02 A;  2W3P A;  3DJA A;  5KDR B;  1UIY A;  3GF3 A;  3KTI A;  5CTB A;  3SWX A;  1YG8 A;  3FDU A;  5DTW A;  3PEA A;  3GLM A;  2DEO A;  3HRX A;  3TZ3 A;  1FC9 A;  2EJ5 A;  1WDK A;  2J5I A;  1EY3 A;  4JYL A;  2Q34 A;  1ON3 A;  4EMM A;  3HLN 1;  4FJW D;  3TT7 A;  3U9T B;  4MI2 A;  4ASI A;  1SZO A;  3M6N A;  3GKB A;  3T89 A;  3KTJ A;  4MXI A;  1EF9 A;  4WYO B;  3PZK A;  4FNB A;  1J7X A;  3ST9 A;  4F47 A;  3T88 A;  4EML A;  2PG8 A;  4I52 A;  3MFM A;  4K2N A;  5MGB A;  3ZWC A;  3Q7H A;  1XNY A;  1HNU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...