3GKBA

Crystal structure of a putative enoyl-coa hydratase from streptomyces avermitilis
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
274
structure length
274
Chain Sequence
AYSTLRVSSEHGVARIILDNPPVNVIGATMMRELRTVLTTLADDSSVRVIVFSSADPEFFLAHVDMRIGEKMDALQELAASAPADVNVFQAVGELIRHQPQVTIVKLAGKARGGGAEFVAAADMAFAAAETAGLGQIEALMGIIPGGGGTQYLRGRVGRNRALEVVLTADLFDAETAASYGWINRALPADELDEYVDRVARNIAALPDGVIEAAKRSLPADDLKEGLLGENDAWAATFSLPAAQQLISGGLKDGAQTPAGERDLEGLMRSVARE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative enoyl-CoA hydratase
publication title Crystal structure of a putative enoyl-CoA hydratase from Streptomyces avermitilis
rcsb
source organism Streptomyces avermitilis
molecule tags Structural genomics, unknown function
total genus 104
structure length 274
sequence length 274
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3gkbA00
1YG6A 1XO6A 2ZQQA 4KWBA 1RJNA 1FC6A 1MJ3A 2VX2A 4NNQA 5G1RA 5FIFA 2VSUA 4FJWD 4ZU2A 2PBPA 1WDKA 4FN8A 1SG4A 3MOYA 2UZFA 1K32A 3T3WA 3PGQA 2HW5A 4I4ZA 1XNWA 2ZQRA 4K3WA 4F47A 3P2LA 3KQFA 3Q1TA 1XX4A 3Q0GA 1N6FA 1Q52A 2DEOA 3WG5A 3HE2A 4U19A 3M6NA 2VREA 2CE3A 3LKEA 1HNUA 2ZL2A 2GTRA 1Y7OA 2D3TA 3V5IA 3DORA 3FF6A 3QMJA 2F9IB 1UYVA 1X0UA 4JCTA 3TRRA 5DUCA 1O8UA 3HLN1 4NEKA 1FC9A 2ZL3A 4JFCA 3HINA 3NJDA 2ZL0A 3IAVA 4GM2A 3NJBA 3QWDA 2A81A 4IZCA 2F6QA 5DZKA 3SWXA 3QREA 1N6EA 3K8XA 4U1AA 3T8BA 2VSSF 1ON3A 4OMRA 4Z0MA 2W3PA 3OC7A 4QIJA 4FNBA 4JCRA 5G1SA 4EMMA 4JOTA 1FC7A 4B3JA 4JVTA 3GKBA 3N6RB 3KTGA 4FNDA 1NZYB 1EF9A 4B3HA 3RSIA 2WTBA 5G1QA 3QXIA 3KTJA 1YG8A 3TT7A 4JSBA 3ZW9A 3VIVA 2VSSA 3R9SA 4L6WA 2VSUC 3GLMA 1PJHA 5DTPA 3RSTA 1UIYA 4QFEA 2F9YB 3I47A 3KTHA 4QIIA 1RJMA 3U9TB 5CTCA 2X58A 3KTIA 3L3SA 4JCSA 5DZKH 4ASIA 3ZW8A 2J5IB 1OD4A 4ZDCA 3SLLA 3QK8A 5DU6A 4WCZA 2A7KA 3R6HA 4ZDEA 2J5GD 3R9TA 3P85A 5DTWA 4MOUA 3TVUA 3R0OA 4GHNA 1DCIA 4JYJA 5IKLB 5E0SA 3QYRA 4RYFH 3HP0A 5KDRB 1WZ8A 1WDLA 3TLFA 4I42A 1XNVA 1K39A 3ZWAA 2J5II 1HZDA 5DU8A 3MFMA 2PPYA 2X24A 5JBXA 4KD6A 1UYSA 4JYLA 3TZ3A 2FBMA 3H0UA 4OG1A 3BF0A 2ZL4A 1UYTA 5INIA 3FDUA 3JU1A 5C9GA 3H81A 3KTKA 4LK5A 4ZDFA 5C90A 5DKPA 1SZOA 1W2XA 4IZDA 3STAA 5INGA 3RRVA 3H02A 4U18A 5INFA 5FUSA 4FB8A 4K2NA 4EMLA 3TDCA 4U0HA 4JCQA 2VSSE 4KPKA 3GF3A 3ST9A 3PZKA 5KJPA 2Q2XA 2Q34A 4I52A 2F9IA 3MYBA 4HC8A 2VSUE 3P5MA 4OLQA 5E0SH 3U9SB 1WDMA 2C8TA 4U0GA 3TVWA 5CTBA 3G64A 4ELSA 4ELXA 1VRGA 4JJTA 4RCNA 2IEXA 3OT6A 3BEZA 2PG8A 3OMEA 4ZDDA 1J7XA 4FN7A 3HRXA 1OD2A 3V5EA 4JWVA 4WZ8B 3T8AA 3R9QA 1N6DA 3K50A 3ZWCA 3H0QA 5JBWA 2BZRA 3PE8A 5DU4A 5MGBA 1TYFA 1EF8A 1NZYA 4FZWC 4DI1A 1XNYA 4K29A 4KNPA 2NP9A 1JXZA 3T89A 4FZWA 2FW2A 4G2RA 4HNKA 2CBYA 3TT6A 4ELWA 4Q0GA 3Q7HA 3M6MA 1Q51A 5E0NX 4U0GH 2F9YA 4MI2A 3PEAA 3ZWBA 1HNOA 3H0SA 2DUBA 4IZBA 3IBBA 4MXIA 1TG6A 3QKAA 1ON9A 2QQ3A 1FCFA 1UYRA 5DL1A 4Q1IA 2J5IA 2EJ5A 3ISAA 2J5GA 4YLHA 1EY3A 1PIXA 3LAOA 3TV5A 4WYOB 2Q35A 3IB9A 2J5SA 4B3IA 4EMPA 3QXZA 2VSUF 5DUFA 3U9RB 2FZSA 2F6IA 5KDRA 2A7SA 3Q0JA 3MT6A 3GF7A 3DJAA 4ZDBA 3GMAA 4L8KA 3T88A 1DUBA 3H0JA 4RYFA 3BPPA
chains in the Genus database with same CATH superfamily
1YG6A 1XO6A 2ZQQA 4KWBA 1RJNA 1FC6A 1MJ3A 2VX2A 4NNQA 5G1RA 5FIFA 2VSUA 4FJWD 4ZU2A 2PBPA 1WDKA 4FN8A 1SG4A 3MOYA 2UZFA 1K32A 3T3WA 3PGQA 2HW5A 4I4ZA 1XNWA 2ZQRA 4K3WA 4F47A 3P2LA 3KQFA 3Q1TA 1XX4A 3Q0GA 1N6FA 1Q52A 2DEOA 3WG5A 3HE2A 4U19A 3M6NA 2VREA 2CE3A 3LKEA 1HNUA 2ZL2A 2GTRA 1Y7OA 2D3TA 3V5IA 3DORA 3FF6A 3QMJA 2F9IB 1UYVA 1X0UA 4JCTA 3TRRA 5DUCA 1O8UA 3HLN1 4NEKA 1FC9A 2ZL3A 4JFCA 3HINA 3NJDA 2ZL0A 3IAVA 4GM2A 4J2UA 3NJBA 3QWDA 2A81A 4IZCA 2F6QA 5DZKA 3SWXA 3QREA 1N6EA 3K8XA 4U1AA 3T8BA 2VSSF 1ON3A 4OMRA 4Z0MA 2W3PA 3OC7A 4QIJA 4FNBA 4JCRA 5G1SA 4EMMA 4JOTA 1FC7A 4B3JA 4JVTA 3GKBA 3N6RB 3KTGA 4FNDA 1NZYB 1EF9A 4B3HA 3RSIA 2WTBA 5G1QA 3QXIA 3KTJA 1YG8A 3TT7A 4JSBA 3ZW9A 3VIVA 2VSSA 3R9SA 4L6WA 2VSUC 3GLMA 1PJHA 5DTPA 3RSTA 1UIYA 4QFEA 2F9YB 3I47A 3KTHA 4QIIA 1RJMA 3U9TB 5CTCA 2X58A 3KTIA 3L3SA 4JCSA 5DZKH 4ASIA 3ZW8A 2J5IB 1OD4A 4ZDCA 3SLLA 3QK8A 5DU6A 4WCZA 2A7KA 3R6HA 4ZDEA 2J5GD 3R9TA 3P85A 5DTWA 4MOUA 3TVUA 3R0OA 4GHNA 1DCIA 4JYJA 5IKLB 5E0SA 3QYRA 4RYFH 3HP0A 5KDRB 1WZ8A 1WDLA 3TLFA 4I42A 1XNVA 1K39A 3ZWAA 2J5II 1HZDA 5DU8A 3MFMA 2PPYA 2X24A 5JBXA 4KD6A 1UYSA 4JYLA 5HUQA 3TZ3A 2FBMA 3H0UA 4OG1A 3BF0A 2ZL4A 1UYTA 5INIA 3FDUA 3JU1A 5C9GA 3H81A 3KTKA 4LK5A 4ZDFA 5C90A 5DKPA 1SZOA 1W2XA 4IZDA 3STAA 5INGA 3RRVA 3H02A 4U18A 5INFA 5FUSA 4FB8A 4K2NA 4EMLA 3TDCA 4U0HA 4JCQA 2VSSE 4KPKA 3GF3A 3ST9A 3PZKA 5KJPA 2Q2XA 2Q34A 4I52A 2F9IA 3MYBA 4HC8A 2VSUE 3P5MA 4OLQA 5E0SH 3U9SB 1WDMA 2C8TA 4U0GA 3TVWA 5CTBA 3G64A 4ELSA 4ELXA 1VRGA 4JJTA 2YJGA 4RCNA 2IEXA 3OT6A 3BEZA 2PG8A 3OMEA 4ZDDA 1J7XA 4FN7A 3HRXA 1OD2A 4HDTA 3V5EA 4JWVA 4WZ8B 3T8AA 3R9QA 1N6DA 3K50A 3ZWCA 3H0QA 5JBWA 2BZRA 3PE8A 5DU4A 5MGBA 1TYFA 1EF8A 1NZYA 4FZWC 4DI1A 1XNYA 4K29A 4KNPA 2NP9A 1JXZA 3T89A 4FZWA 2FW2A 4G2RA 4HNKA 2CBYA 3TT6A 4ELWA 4Q0GA 3Q7HA 3M6MA 1Q51A 5E0NX 4U0GH 2F9YA 4MI2A 3PEAA 3ZWBA 1HNOA 3H0SA 2DUBA 4IZBA 3IBBA 4MXIA 1TG6A 3QKAA 1ON9A 2QQ3A 1FCFA 1UYRA 5DL1A 4Q1IA 2J5IA 2EJ5A 3ISAA 2J5GA 4YLHA 1EY3A 1PIXA 3LAOA 3TV5A 4WYOB 2Q35A 3IB9A 2J5SA 4B3IA 4EMPA 3QXZA 2VSUF 5DUFA 3U9RB 2FZSA 2F6IA 3BPTA 5KDRA 2A7SA 3Q0JA 3MT6A 3GF7A 3DJAA 4ZDBA 3GMAA 4L8KA 4NARA 3T88A 1DUBA 3H0JA 4RYFA 3BPPA
chains in the Genus database with same CATH topology
1YG6A 1XO6A 2ZQQA 4KWBA 1RJNA 1FC6A 1MJ3A 2VX2A 4NNQA 5G1RA 5FIFA 2VSUA 4FJWD 4ZU2A 2PBPA 1WDKA 4FN8A 1SG4A 3MOYA 2UZFA 1K32A 3T3WA 3PGQA 2HW5A 4I4ZA 1XNWA 2ZQRA 4K3WA 4F47A 3P2LA 3KQFA 3Q1TA 1XX4A 3Q0GA 1N6FA 1Q52A 2DEOA 3WG5A 3HE2A 4U19A 3M6NA 2VREA 2CE3A 3LKEA 1HNUA 2ZL2A 2GTRA 1Y7OA 2D3TA 3V5IA 3DORA 3FF6A 3QMJA 2F9IB 1UYVA 1X0UA 4JCTA 3TRRA 5DUCA 1O8UA 3HLN1 4NEKA 1FC9A 2ZL3A 4JFCA 3HINA 3NJDA 2ZL0A 3IAVA 4GM2A 4J2UA 3NJBA 3QWDA 2A81A 4IZCA 2F6QA 5DZKA 3SWXA 3QREA 1N6EA 3K8XA 4U1AA 3T8BA 2VSSF 1ON3A 4OMRA 4Z0MA 2W3PA 3OC7A 4QIJA 4FNBA 4JCRA 5G1SA 4EMMA 4JOTA 1FC7A 4B3JA 4JVTA 3GKBA 3N6RB 3KTGA 4FNDA 1NZYB 1EF9A 4B3HA 3RSIA 2WTBA 5G1QA 3QXIA 3KTJA 1YG8A 3TT7A 4JSBA 3ZW9A 3VIVA 2VSSA 3R9SA 4L6WA 2VSUC 3GLMA 1PJHA 5DTPA 3RSTA 1UIYA 4QFEA 2F9YB 3I47A 3KTHA 4QIIA 1RJMA 3U9TB 5CTCA 2X58A 3KTIA 3L3SA 4JCSA 5DZKH 4ASIA 3ZW8A 2J5IB 1OD4A 4ZDCA 3SLLA 3QK8A 5DU6A 4WCZA 2A7KA 3R6HA 4ZDEA 2J5GD 3R9TA 3P85A 5DTWA 4MOUA 3TVUA 3R0OA 4GHNA 1DCIA 4JYJA 5IKLB 5E0SA 3QYRA 4RYFH 3HP0A 5KDRB 1WZ8A 1WDLA 3TLFA 4I42A 1XNVA 1K39A 3ZWAA 2J5II 1HZDA 5DU8A 3MFMA 2PPYA 2X24A 5JBXA 4KD6A 1UYSA 4JYLA 5HUQA 3TZ3A 2FBMA 3H0UA 4OG1A 3BF0A 2ZL4A 1UYTA 5INIA 3FDUA 3JU1A 5C9GA 3H81A 3KTKA 4LK5A 4ZDFA 5C90A 5DKPA 1SZOA 1W2XA 4IZDA 3STAA 5INGA 3RRVA 3H02A 4U18A 5INFA 5FUSA 4FB8A 4K2NA 4EMLA 3TDCA 4U0HA 4JCQA 2VSSE 4KPKA 3GF3A 3ST9A 3PZKA 5KJPA 2Q2XA 2Q34A 4I52A 2F9IA 3MYBA 4HC8A 2VSUE 3P5MA 4OLQA 5E0SH 3U9SB 1WDMA 2C8TA 4U0GA 3TVWA 5CTBA 3G64A 4ELSA 4ELXA 1VRGA 4JJTA 2YJGA 4RCNA 2IEXA 3OT6A 3BEZA 2PG8A 3OMEA 4ZDDA 1J7XA 4FN7A 3HRXA 1OD2A 4HDTA 3V5EA 4JWVA 4WZ8B 3T8AA 3R9QA 1N6DA 3K50A 3ZWCA 3H0QA 5JBWA 2BZRA 3PE8A 5DU4A 5MGBA 1TYFA 1EF8A 1NZYA 4FZWC 4DI1A 1XNYA 4K29A 4KNPA 2NP9A 1JXZA 3T89A 4FZWA 2FW2A 4G2RA 4HNKA 2CBYA 3TT6A 4ELWA 4Q0GA 3Q7HA 3M6MA 1Q51A 5E0NX 4U0GH 2F9YA 4MI2A 3PEAA 3ZWBA 1HNOA 3H0SA 2DUBA 4IZBA 3IBBA 4MXIA 1TG6A 3QKAA 1ON9A 2QQ3A 1FCFA 1UYRA 5DL1A 4Q1IA 2J5IA 2EJ5A 3ISAA 2J5GA 4YLHA 1EY3A 1PIXA 3LAOA 3TV5A 4WYOB 2Q35A 3IB9A 2J5SA 4B3IA 4EMPA 3QXZA 2VSUF 5DUFA 3U9RB 2FZSA 2F6IA 3BPTA 5KDRA 2A7SA 3Q0JA 3MT6A 3GF7A 3DJAA 4ZDBA 3GMAA 4L8KA 4NARA 3T88A 1DUBA 3H0JA 4RYFA 3BPPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YG6 A;  1XO6 A;  2ZQQ A;  4KWB A;  1RJN A;  1FC6 A;  1MJ3 A;  2VX2 A;  4NNQ A;  5G1R A;  5FIF A;  2VSU A;  4FJW D;  4ZU2 A;  2PBP A;  1WDK A;  4FN8 A;  1SG4 A;  3MOY A;  2UZF A;  1K32 A;  3T3W A;  3PGQ A;  2HW5 A;  4I4Z A;  1XNW A;  2ZQR A;  4K3W A;  4F47 A;  3P2L A;  3KQF A;  3Q1T A;  1XX4 A;  3Q0G A;  1N6F A;  1Q52 A;  2DEO A;  3WG5 A;  3HE2 A;  4U19 A;  3M6N A;  2VRE A;  2CE3 A;  3LKE A;  1HNU A;  2ZL2 A;  2GTR A;  1Y7O A;  2D3T A;  3V5I A;  3DOR A;  3FF6 A;  3QMJ A;  2F9I B;  1UYV A;  1X0U A;  4JCT A;  3TRR A;  5DUC A;  1O8U A;  3HLN 1;  4NEK A;  1FC9 A;  2ZL3 A;  4JFC A;  3HIN A;  3NJD A;  2ZL0 A;  3IAV A;  4GM2 A;  3NJB A;  3QWD A;  2A81 A;  4IZC A;  2F6Q A;  5DZK A;  3SWX A;  3QRE A;  1N6E A;  3K8X A;  4U1A A;  3T8B A;  2VSS F;  1ON3 A;  4OMR A;  4Z0M A;  2W3P A;  3OC7 A;  4QIJ A;  4FNB A;  4JCR A;  5G1S A;  4EMM A;  4JOT A;  1FC7 A;  4B3J A;  4JVT A;  3GKB A;  3N6R B;  3KTG A;  4FND A;  1NZY B;  1EF9 A;  4B3H A;  3RSI A;  2WTB A;  5G1Q A;  3QXI A;  3KTJ A;  1YG8 A;  3TT7 A;  4JSB A;  3ZW9 A;  3VIV A;  2VSS A;  3R9S A;  4L6W A;  2VSU C;  3GLM A;  1PJH A;  5DTP A;  3RST A;  1UIY A;  4QFE A;  2F9Y B;  3I47 A;  3KTH A;  4QII A;  1RJM A;  3U9T B;  5CTC A;  2X58 A;  3KTI A;  3L3S A;  4JCS A;  5DZK H;  4ASI A;  3ZW8 A;  2J5I B;  1OD4 A;  4ZDC A;  3SLL A;  3QK8 A;  5DU6 A;  4WCZ A;  2A7K A;  3R6H A;  4ZDE A;  2J5G D;  3R9T A;  3P85 A;  5DTW A;  4MOU A;  3TVU A;  3R0O A;  4GHN A;  1DCI A;  4JYJ A;  5IKL B;  5E0S A;  3QYR A;  4RYF H;  3HP0 A;  5KDR B;  1WZ8 A;  1WDL A;  3TLF A;  4I42 A;  1XNV A;  1K39 A;  3ZWA A;  2J5I I;  1HZD A;  5DU8 A;  3MFM A;  2PPY A;  2X24 A;  5JBX A;  4KD6 A;  1UYS A;  4JYL A;  3TZ3 A;  2FBM A;  3H0U A;  4OG1 A;  3BF0 A;  2ZL4 A;  1UYT A;  5INI A;  3FDU A;  3JU1 A;  5C9G A;  3H81 A;  3KTK A;  4LK5 A;  4ZDF A;  5C90 A;  5DKP A;  1SZO A;  1W2X A;  4IZD A;  3STA A;  5ING A;  3RRV A;  3H02 A;  4U18 A;  5INF A;  5FUS A;  4FB8 A;  4K2N A;  4EML A;  3TDC A;  4U0H A;  4JCQ A;  2VSS E;  4KPK A;  3GF3 A;  3ST9 A;  3PZK A;  5KJP A;  2Q2X A;  2Q34 A;  4I52 A;  2F9I A;  3MYB A;  4HC8 A;  2VSU E;  3P5M A;  4OLQ A;  5E0S H;  3U9S B;  1WDM A;  2C8T A;  4U0G A;  3TVW A;  5CTB A;  3G64 A;  4ELS A;  4ELX A;  1VRG A;  4JJT A;  4RCN A;  2IEX A;  3OT6 A;  3BEZ A;  2PG8 A;  3OME A;  4ZDD A;  1J7X A;  4FN7 A;  3HRX A;  1OD2 A;  3V5E A;  4JWV A;  4WZ8 B;  3T8A A;  3R9Q A;  1N6D A;  3K50 A;  3ZWC A;  3H0Q A;  5JBW A;  2BZR A;  3PE8 A;  5DU4 A;  5MGB A;  1TYF A;  1EF8 A;  1NZY A;  4FZW C;  4DI1 A;  1XNY A;  4K29 A;  4KNP A;  2NP9 A;  1JXZ A;  3T89 A;  4FZW A;  2FW2 A;  4G2R A;  4HNK A;  2CBY A;  3TT6 A;  4ELW A;  4Q0G A;  3Q7H A;  3M6M A;  1Q51 A;  5E0N X;  4U0G H;  2F9Y A;  4MI2 A;  3PEA A;  3ZWB A;  1HNO A;  3H0S A;  2DUB A;  4IZB A;  3IBB A;  4MXI A;  1TG6 A;  3QKA A;  1ON9 A;  2QQ3 A;  1FCF A;  1UYR A;  5DL1 A;  4Q1I A;  2J5I A;  2EJ5 A;  3ISA A;  2J5G A;  4YLH A;  1EY3 A;  1PIX A;  3LAO A;  3TV5 A;  4WYO B;  2Q35 A;  3IB9 A;  2J5S A;  4B3I A;  4EMP A;  3QXZ A;  2VSU F;  5DUF A;  3U9R B;  2FZS A;  2F6I A;  5KDR A;  2A7S A;  3Q0J A;  3MT6 A;  3GF7 A;  3DJA A;  4ZDB A;  3GMA A;  4L8K A;  3T88 A;  1DUB A;  3H0J A;  4RYF A;  3BPP A; 
#chains in the Genus database with same CATH topology
 1YG6 A;  1XO6 A;  2ZQQ A;  4KWB A;  1RJN A;  1FC6 A;  1MJ3 A;  2VX2 A;  4NNQ A;  5G1R A;  5FIF A;  2VSU A;  4FJW D;  4ZU2 A;  2PBP A;  1WDK A;  4FN8 A;  1SG4 A;  3MOY A;  2UZF A;  1K32 A;  3T3W A;  3PGQ A;  2HW5 A;  4I4Z A;  1XNW A;  2ZQR A;  4K3W A;  4F47 A;  3P2L A;  3KQF A;  3Q1T A;  1XX4 A;  3Q0G A;  1N6F A;  1Q52 A;  2DEO A;  3WG5 A;  3HE2 A;  4U19 A;  3M6N A;  2VRE A;  2CE3 A;  3LKE A;  1HNU A;  2ZL2 A;  2GTR A;  1Y7O A;  2D3T A;  3V5I A;  3DOR A;  3FF6 A;  3QMJ A;  2F9I B;  1UYV A;  1X0U A;  4JCT A;  3TRR A;  5DUC A;  1O8U A;  3HLN 1;  4NEK A;  1FC9 A;  2ZL3 A;  4JFC A;  3HIN A;  3NJD A;  2ZL0 A;  3IAV A;  4GM2 A;  4J2U A;  3NJB A;  3QWD A;  2A81 A;  4IZC A;  2F6Q A;  5DZK A;  3SWX A;  3QRE A;  1N6E A;  3K8X A;  4U1A A;  3T8B A;  2VSS F;  1ON3 A;  4OMR A;  4Z0M A;  2W3P A;  3OC7 A;  4QIJ A;  4FNB A;  4JCR A;  5G1S A;  4EMM A;  4JOT A;  1FC7 A;  4B3J A;  4JVT A;  3GKB A;  3N6R B;  3KTG A;  4FND A;  1NZY B;  1EF9 A;  4B3H A;  3RSI A;  2WTB A;  5G1Q A;  3QXI A;  3KTJ A;  1YG8 A;  3TT7 A;  4JSB A;  3ZW9 A;  3VIV A;  2VSS A;  3R9S A;  4L6W A;  2VSU C;  3GLM A;  1PJH A;  5DTP A;  3RST A;  1UIY A;  4QFE A;  2F9Y B;  3I47 A;  3KTH A;  4QII A;  1RJM A;  3U9T B;  5CTC A;  2X58 A;  3KTI A;  3L3S A;  4JCS A;  5DZK H;  4ASI A;  3ZW8 A;  2J5I B;  1OD4 A;  4ZDC A;  3SLL A;  3QK8 A;  5DU6 A;  4WCZ A;  2A7K A;  3R6H A;  4ZDE A;  2J5G D;  3R9T A;  3P85 A;  5DTW A;  4MOU A;  3TVU A;  3R0O A;  4GHN A;  1DCI A;  4JYJ A;  5IKL B;  5E0S A;  3QYR A;  4RYF H;  3HP0 A;  5KDR B;  1WZ8 A;  1WDL A;  3TLF A;  4I42 A;  1XNV A;  1K39 A;  3ZWA A;  2J5I I;  1HZD A;  5DU8 A;  3MFM A;  2PPY A;  2X24 A;  5JBX A;  4KD6 A;  1UYS A;  4JYL A;  5HUQ A;  3TZ3 A;  2FBM A;  3H0U A;  4OG1 A;  3BF0 A;  2ZL4 A;  1UYT A;  5INI A;  3FDU A;  3JU1 A;  5C9G A;  3H81 A;  3KTK A;  4LK5 A;  4ZDF A;  5C90 A;  5DKP A;  1SZO A;  1W2X A;  4IZD A;  3STA A;  5ING A;  3RRV A;  3H02 A;  4U18 A;  5INF A;  5FUS A;  4FB8 A;  4K2N A;  4EML A;  3TDC A;  4U0H A;  4JCQ A;  2VSS E;  4KPK A;  3GF3 A;  3ST9 A;  3PZK A;  5KJP A;  2Q2X A;  2Q34 A;  4I52 A;  2F9I A;  3MYB A;  4HC8 A;  2VSU E;  3P5M A;  4OLQ A;  5E0S H;  3U9S B;  1WDM A;  2C8T A;  4U0G A;  3TVW A;  5CTB A;  3G64 A;  4ELS A;  4ELX A;  1VRG A;  4JJT A;  2YJG A;  4RCN A;  2IEX A;  3OT6 A;  3BEZ A;  2PG8 A;  3OME A;  4ZDD A;  1J7X A;  4FN7 A;  3HRX A;  1OD2 A;  4HDT A;  3V5E A;  4JWV A;  4WZ8 B;  3T8A A;  3R9Q A;  1N6D A;  3K50 A;  3ZWC A;  3H0Q A;  5JBW A;  2BZR A;  3PE8 A;  5DU4 A;  5MGB A;  1TYF A;  1EF8 A;  1NZY A;  4FZW C;  4DI1 A;  1XNY A;  4K29 A;  4KNP A;  2NP9 A;  1JXZ A;  3T89 A;  4FZW A;  2FW2 A;  4G2R A;  4HNK A;  2CBY A;  3TT6 A;  4ELW A;  4Q0G A;  3Q7H A;  3M6M A;  1Q51 A;  5E0N X;  4U0G H;  2F9Y A;  4MI2 A;  3PEA A;  3ZWB A;  1HNO A;  3H0S A;  2DUB A;  4IZB A;  3IBB A;  4MXI A;  1TG6 A;  3QKA A;  1ON9 A;  2QQ3 A;  1FCF A;  1UYR A;  5DL1 A;  4Q1I A;  2J5I A;  2EJ5 A;  3ISA A;  2J5G A;  4YLH A;  1EY3 A;  1PIX A;  3LAO A;  3TV5 A;  4WYO B;  2Q35 A;  3IB9 A;  2J5S A;  4B3I A;  4EMP A;  3QXZ A;  2VSU F;  5DUF A;  3U9R B;  2FZS A;  2F6I A;  3BPT A;  5KDR A;  2A7S A;  3Q0J A;  3MT6 A;  3GF7 A;  3DJA A;  4ZDB A;  3GMA A;  4L8K A;  4NAR A;  3T88 A;  1DUB A;  3H0J A;  4RYF A;  3BPP A; 
#chains in the Genus database with same CATH homology
 1YG6 A;  1XO6 A;  2ZQQ A;  4KWB A;  1RJN A;  1FC6 A;  1MJ3 A;  2VX2 A;  4NNQ A;  5G1R A;  5FIF A;  2VSU A;  4FJW D;  4ZU2 A;  2PBP A;  1WDK A;  4FN8 A;  1SG4 A;  3MOY A;  2UZF A;  1K32 A;  3T3W A;  3PGQ A;  2HW5 A;  4I4Z A;  1XNW A;  2ZQR A;  4K3W A;  4F47 A;  3P2L A;  3KQF A;  3Q1T A;  1XX4 A;  3Q0G A;  1N6F A;  1Q52 A;  2DEO A;  3WG5 A;  3HE2 A;  4U19 A;  3M6N A;  2VRE A;  2CE3 A;  3LKE A;  1HNU A;  2ZL2 A;  2GTR A;  1Y7O A;  2D3T A;  3V5I A;  3DOR A;  3FF6 A;  3QMJ A;  2F9I B;  1UYV A;  1X0U A;  4JCT A;  3TRR A;  5DUC A;  1O8U A;  3HLN 1;  4NEK A;  1FC9 A;  2ZL3 A;  4JFC A;  3HIN A;  3NJD A;  2ZL0 A;  3IAV A;  4GM2 A;  4J2U A;  3NJB A;  3QWD A;  2A81 A;  4IZC A;  2F6Q A;  5DZK A;  3SWX A;  3QRE A;  1N6E A;  3K8X A;  4U1A A;  3T8B A;  2VSS F;  1ON3 A;  4OMR A;  4Z0M A;  2W3P A;  3OC7 A;  4QIJ A;  4FNB A;  4JCR A;  5G1S A;  4EMM A;  4JOT A;  1FC7 A;  4B3J A;  4JVT A;  3GKB A;  3N6R B;  3KTG A;  4FND A;  1NZY B;  1EF9 A;  4B3H A;  3RSI A;  2WTB A;  5G1Q A;  3QXI A;  3KTJ A;  1YG8 A;  3TT7 A;  4JSB A;  3ZW9 A;  3VIV A;  2VSS A;  3R9S A;  4L6W A;  2VSU C;  3GLM A;  1PJH A;  5DTP A;  3RST A;  1UIY A;  4QFE A;  2F9Y B;  3I47 A;  3KTH A;  4QII A;  1RJM A;  3U9T B;  5CTC A;  2X58 A;  3KTI A;  3L3S A;  4JCS A;  5DZK H;  4ASI A;  3ZW8 A;  2J5I B;  1OD4 A;  4ZDC A;  3SLL A;  3QK8 A;  5DU6 A;  4WCZ A;  2A7K A;  3R6H A;  4ZDE A;  2J5G D;  3R9T A;  3P85 A;  5DTW A;  4MOU A;  3TVU A;  3R0O A;  4GHN A;  1DCI A;  4JYJ A;  5IKL B;  5E0S A;  3QYR A;  4RYF H;  3HP0 A;  5KDR B;  1WZ8 A;  1WDL A;  3TLF A;  4I42 A;  1XNV A;  1K39 A;  3ZWA A;  2J5I I;  1HZD A;  5DU8 A;  3MFM A;  2PPY A;  2X24 A;  5JBX A;  4KD6 A;  1UYS A;  4JYL A;  5HUQ A;  3TZ3 A;  2FBM A;  3H0U A;  4OG1 A;  3BF0 A;  2ZL4 A;  1UYT A;  5INI A;  3FDU A;  3JU1 A;  5C9G A;  3H81 A;  3KTK A;  4LK5 A;  4ZDF A;  5C90 A;  5DKP A;  1SZO A;  1W2X A;  4IZD A;  3STA A;  5ING A;  3RRV A;  3H02 A;  4U18 A;  5INF A;  5FUS A;  4FB8 A;  4K2N A;  4EML A;  3TDC A;  4U0H A;  4JCQ A;  2VSS E;  4KPK A;  3GF3 A;  3ST9 A;  3PZK A;  5KJP A;  2Q2X A;  2Q34 A;  4I52 A;  2F9I A;  3MYB A;  4HC8 A;  2VSU E;  3P5M A;  4OLQ A;  5E0S H;  3U9S B;  1WDM A;  2C8T A;  4U0G A;  3TVW A;  5CTB A;  3G64 A;  4ELS A;  4ELX A;  1VRG A;  4JJT A;  2YJG A;  4RCN A;  2IEX A;  3OT6 A;  3BEZ A;  2PG8 A;  3OME A;  4ZDD A;  1J7X A;  4FN7 A;  3HRX A;  1OD2 A;  4HDT A;  3V5E A;  4JWV A;  4WZ8 B;  3T8A A;  3R9Q A;  1N6D A;  3K50 A;  3ZWC A;  3H0Q A;  5JBW A;  2BZR A;  3PE8 A;  5DU4 A;  5MGB A;  1TYF A;  1EF8 A;  1NZY A;  4FZW C;  4DI1 A;  1XNY A;  4K29 A;  4KNP A;  2NP9 A;  1JXZ A;  3T89 A;  4FZW A;  2FW2 A;  4G2R A;  4HNK A;  2CBY A;  3TT6 A;  4ELW A;  4Q0G A;  3Q7H A;  3M6M A;  1Q51 A;  5E0N X;  4U0G H;  2F9Y A;  4MI2 A;  3PEA A;  3ZWB A;  1HNO A;  3H0S A;  2DUB A;  4IZB A;  3IBB A;  4MXI A;  1TG6 A;  3QKA A;  1ON9 A;  2QQ3 A;  1FCF A;  1UYR A;  5DL1 A;  4Q1I A;  2J5I A;  2EJ5 A;  3ISA A;  2J5G A;  4YLH A;  1EY3 A;  1PIX A;  3LAO A;  3TV5 A;  4WYO B;  2Q35 A;  3IB9 A;  2J5S A;  4B3I A;  4EMP A;  3QXZ A;  2VSU F;  5DUF A;  3U9R B;  2FZS A;  2F6I A;  3BPT A;  5KDR A;  2A7S A;  3Q0J A;  3MT6 A;  3GF7 A;  3DJA A;  4ZDB A;  3GMA A;  4L8K A;  4NAR A;  3T88 A;  1DUB A;  3H0J A;  4RYF A;  3BPP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...