3GKBA

Crystal structure of a putative enoyl-coa hydratase from streptomyces avermitilis
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
274
structure length
274
Chain Sequence
b'AYSTLRVSSEHGVARIILDNPPVNVIGATMMRELRTVLTTLADDSSVRVIVFSSADPEFFLAHVDMRIGEKMDALQELAASAPADVNVFQAVGELIRHQPQVTIVKLAGKARGGGAEFVAAADMAFAAAETAGLGQIEALMGIIPGGGGTQYLRGRVGRNRALEVVLTADLFDAETAASYGWINRALPADELDEYVDRVARNIAALPDGVIEAAKRSLPADDLKEGLLGENDAWAATFSLPAAQQLISGGLKDGAQTPAGERDLEGLMRSVARE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative enoyl-CoA hydratase
publication title Crystal structure of a putative enoyl-CoA hydratase from Streptomyces avermitilis
rcsb
source organism Streptomyces avermitilis
molecule tags Structural genomics, unknown function
total genus 104
structure length 274
sequence length 274
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3gkbA00
2Q2XA 1WDMA 1N6EA 4GM2A 3LAOA 3ZWCA 2HW5A 3H0JA 3KTHA 4KNPA 1EF9A 1HNOA 1FC7A 3QREA 3SLLA 5FUSA 4IZBA 3M6NA 3FDUA 3QKAA 2F6QA 1FC9A 3ST9A 2A7KA 2WTBA 3TDCA 3R9QA 5INFA 4B3JA 3HE2A 3IBBA 4U19A 3SWXA 3HP0A 1EF8A 4IZCA 2Q34A 4ZDBA 2VSUC 2F9IB 4QIIA 5DZKA 3GF3A 3BF0A 5FIFA 3MYBA 3TVWA 2VSSA 3RSIA 5DUCA 4ZDEA 1ON9A 4ZDFA 3BEZA 1OD2A 3GMAA 2DUBA 4FN7A 2CE3A 4FN8A 3H02A 4K2NA 2PG8A 3H0SA 1SZOA 2BZRA 3TT7A 3FF6A 3MT6A 3PZKA 3DORA 2CBYA 3V5EA 3KTJA 4ELSA 3T3WA 3HRXA 4Q1IA 3L3SA 4JCTA 3OMEA 2X58A 3QK8A 3K8XA 3Q1TA 1YG8A 4OG1A 3R9TA 4QFEA 2J5GA 2F9YA 2VX2A 3KTGA 2IEXA 4FZWC 2GTRA 5G1SA 4EMLA 1K39A 3GKBA 3QYRA 4MXIA 5E0NX 5DU4A 5KJPA 3VIVA 3HLN1 5CTCA 4EMMA 1W2XA 4FB8A 3QWDA 3OC7A 2FBMA 2F9YB 3ZWBA 3OT6A 5MGBA 3N6RB 4JYLA 3KQFA 3ISAA 3R9SA 4JCSA 1FCFA 2ZL4A 4EMPA 3G64A 3JU1A 5DTPA 1XNVA 4RYFA 2VSSF 1RJNA 4WZ8B 2VSUA 4IZDA 2C8TA 1UIYA 3P85A 4JOTA 2F9IA 3H0QA 1K32A 4ZDCA 2J5SA 4ZDDA 3MOYA 4ZU2A 4K29A 1N6DA 5E0SH 2VSSE 4JWVA 2FZSA 4HC8A 4U0GH 4OMRA 4JSBA 4L8KA 4NNQA 2NP9A 5CTBA 1WZ8A 4ASIA 4I42A 3M6MA 3Q7HA 3TZ3A 4DI1A 1SG4A 1TYFA 4G2RA 3V5IA 2X24A 3ZW8A 3GLMA 4NEKA 4JFCA 1JXZA 5INIA 3KTKA 1YG6A 3BPPA 2ZL3A 3NJDA 2ZL2A 3MFMA 5G1QA 4I4ZA 3U9RB 4Q0GA 5DKPA 3DJAA 3ZW9A 3H0UA 1NZYB 4JJTA 4QIJA 2ZQQA 5C90A 4FZWA 3TVUA 2A81A 1WDLA 2J5IA 3LKEA 1UYVA 1DUBA 1Q51A 1RJMA 1XNWA 5DZKH 3WG5A 1TG6A 3HINA 2J5IB 3TRRA 2PBPA 2W3PA 3Q0GA 1O8UA 3P2LA 3TT6A 2QQ3A 3T88A 3Q0JA 3U9SB 4JCRA 3TLFA 3GF7A 2ZL0A 5DTWA 2J5II 2J5GD 3R6HA 3T8AA 2VSUE 2UZFA 4YLHA 4L6WA 3RRVA 5JBXA 4OLQA 2A7SA 2D3TA 3T89A 3IAVA 1HZDA 3ZWAA 3STAA 2Q35A 2FW2A 4JCQA 5DU8A 4MI2A 2F6IA 4I52A 4JVTA 4KD6A 3PEAA 3PE8A 1PIXA 1J7XA 1XO6A 5DUFA 3K50A 4RCNA 4HNKA 5DU6A 4Z0MA 1WDKA 3QMJA 3U9TB 2DEOA 3R0OA 1XNYA 1ON3A 4B3IA 3PGQA 1UYTA 1VRGA 1MJ3A 3P5MA 1NZYA 4LK5A 5C9GA 4ELXA 4RYFH 4JYJA 3I47A 3QXZA 5DL1A 2ZQRA 1N6FA 4U1AA 4ELWA 4KWBA 5KDRA 4B3HA 1UYRA 3IB9A 2EJ5A 4U18A 1XX4A 2VREA 3RSTA 5G1RA 1DCIA 3TV5A 1X0UA 2PPYA 5KDRB 1EY3A 1UYSA 5JBWA 2VSUF 4FNBA 4U0HA 4WYOB 4F47A 4FJWD 1HNUA 4GHNA 4MOUA 4K3WA 5E0SA 1PJHA 5IKLB 3QXIA 3KTIA 3T8BA 4U0GA 1FC6A 1OD4A 4FNDA 3H81A 1Y7OA 5INGA 3NJBA 4WCZA 1Q52A 4KPKA
chains in the Genus database with same CATH superfamily
2Q2XA 1WDMA 1N6EA 4GM2A 3LAOA 3ZWCA 2HW5A 3H0JA 3KTHA 4KNPA 1EF9A 1HNOA 1FC7A 3QREA 3SLLA 5FUSA 4IZBA 3M6NA 3FDUA 3QKAA 2F6QA 1FC9A 3ST9A 2A7KA 2WTBA 3TDCA 3R9QA 5INFA 4B3JA 3HE2A 3IBBA 4U19A 3SWXA 3HP0A 1EF8A 4IZCA 2Q34A 4ZDBA 2VSUC 2F9IB 4QIIA 5DZKA 3GF3A 3BF0A 5FIFA 3MYBA 3TVWA 2VSSA 3RSIA 5DUCA 4ZDEA 1ON9A 4ZDFA 3BEZA 1OD2A 3GMAA 2DUBA 4FN7A 2CE3A 4FN8A 3H02A 4K2NA 2PG8A 3H0SA 1SZOA 2BZRA 3TT7A 3FF6A 3MT6A 3PZKA 3BPTA 3DORA 2CBYA 3V5EA 3KTJA 4ELSA 3T3WA 3HRXA 4Q1IA 3L3SA 4JCTA 3OMEA 2X58A 3QK8A 3K8XA 3Q1TA 1YG8A 4OG1A 3R9TA 4QFEA 2J5GA 2F9YA 2VX2A 3KTGA 2IEXA 4FZWC 2GTRA 5G1SA 4EMLA 1K39A 3GKBA 3QYRA 4MXIA 5E0NX 5DU4A 5KJPA 3VIVA 3HLN1 5CTCA 4EMMA 1W2XA 4FB8A 3QWDA 3OC7A 2FBMA 2F9YB 3ZWBA 3OT6A 5MGBA 3N6RB 4JYLA 3KQFA 3ISAA 3R9SA 4JCSA 1FCFA 2ZL4A 4EMPA 3G64A 3JU1A 5DTPA 1XNVA 4RYFA 2VSSF 1RJNA 4WZ8B 2VSUA 4IZDA 2C8TA 1UIYA 3P85A 4JOTA 2F9IA 3H0QA 1K32A 4ZDCA 2J5SA 4ZDDA 3MOYA 4ZU2A 4K29A 1N6DA 5E0SH 2VSSE 4JWVA 2FZSA 4HC8A 4U0GH 4OMRA 4JSBA 4L8KA 4NNQA 2NP9A 5CTBA 1WZ8A 4ASIA 4I42A 3M6MA 3Q7HA 3TZ3A 4DI1A 1SG4A 1TYFA 4G2RA 3V5IA 2X24A 3ZW8A 3GLMA 4NEKA 4JFCA 1JXZA 5INIA 3KTKA 1YG6A 3BPPA 2ZL3A 4NARA 3NJDA 2ZL2A 3MFMA 5G1QA 4I4ZA 3U9RB 4Q0GA 5DKPA 3DJAA 3ZW9A 3H0UA 1NZYB 4JJTA 4QIJA 2ZQQA 5C90A 4FZWA 3TVUA 2A81A 1WDLA 2J5IA 3LKEA 1UYVA 1DUBA 1Q51A 1RJMA 1XNWA 5DZKH 3WG5A 1TG6A 3HINA 5HUQA 2J5IB 3TRRA 2PBPA 2W3PA 3Q0GA 2YJGA 1O8UA 3P2LA 3TT6A 2QQ3A 3T88A 3Q0JA 3U9SB 4JCRA 3TLFA 3GF7A 2ZL0A 5DTWA 2J5II 2J5GD 3R6HA 3T8AA 2VSUE 2UZFA 4YLHA 4L6WA 3RRVA 5JBXA 4OLQA 2A7SA 2D3TA 3T89A 3IAVA 1HZDA 3ZWAA 3STAA 2Q35A 2FW2A 4JCQA 5DU8A 4MI2A 2F6IA 4I52A 4JVTA 4KD6A 3PEAA 3PE8A 4J2UA 1PIXA 1J7XA 1XO6A 5DUFA 3K50A 4RCNA 4HNKA 5DU6A 4Z0MA 1WDKA 3QMJA 3U9TB 2DEOA 3R0OA 1XNYA 1ON3A 4B3IA 3PGQA 1UYTA 1VRGA 1MJ3A 3P5MA 1NZYA 4LK5A 5C9GA 4ELXA 4RYFH 4JYJA 3I47A 3QXZA 5DL1A 2ZQRA 1N6FA 4U1AA 4ELWA 4KWBA 4HDTA 5KDRA 4B3HA 1UYRA 3IB9A 2EJ5A 4U18A 1XX4A 2VREA 3RSTA 5G1RA 1DCIA 3TV5A 1X0UA 2PPYA 5KDRB 1EY3A 1UYSA 5JBWA 2VSUF 4FNBA 4U0HA 4WYOB 4F47A 4FJWD 1HNUA 4GHNA 4MOUA 4K3WA 5E0SA 1PJHA 5IKLB 3QXIA 3KTIA 3T8BA 4U0GA 1FC6A 1OD4A 4FNDA 3H81A 1Y7OA 5INGA 3NJBA 4WCZA 1Q52A 4KPKA
chains in the Genus database with same CATH topology
2Q2XA 1WDMA 1N6EA 4GM2A 3LAOA 3ZWCA 2HW5A 3H0JA 3KTHA 4KNPA 1EF9A 1HNOA 1FC7A 3QREA 3SLLA 5FUSA 4IZBA 3M6NA 3FDUA 3QKAA 2F6QA 1FC9A 3ST9A 2A7KA 2WTBA 3TDCA 3R9QA 5INFA 4B3JA 3HE2A 3IBBA 4U19A 3SWXA 3HP0A 1EF8A 4IZCA 2Q34A 4ZDBA 2VSUC 2F9IB 4QIIA 5DZKA 3GF3A 3BF0A 5FIFA 3MYBA 3TVWA 2VSSA 3RSIA 5DUCA 4ZDEA 1ON9A 4ZDFA 3BEZA 1OD2A 3GMAA 2DUBA 4FN7A 2CE3A 4FN8A 3H02A 4K2NA 2PG8A 3H0SA 1SZOA 2BZRA 3TT7A 3FF6A 3MT6A 3PZKA 3BPTA 3DORA 2CBYA 3V5EA 3KTJA 4ELSA 3T3WA 3HRXA 4Q1IA 3L3SA 4JCTA 3OMEA 2X58A 3QK8A 3K8XA 3Q1TA 1YG8A 4OG1A 3R9TA 4QFEA 2J5GA 2F9YA 2VX2A 3KTGA 2IEXA 4FZWC 2GTRA 5G1SA 4EMLA 1K39A 3GKBA 3QYRA 4MXIA 5E0NX 5DU4A 5KJPA 3VIVA 3HLN1 5CTCA 4EMMA 1W2XA 4FB8A 3QWDA 3OC7A 2FBMA 2F9YB 3ZWBA 3OT6A 5MGBA 3N6RB 4JYLA 3KQFA 3ISAA 3R9SA 4JCSA 1FCFA 2ZL4A 4EMPA 3G64A 3JU1A 5DTPA 1XNVA 4RYFA 2VSSF 1RJNA 4WZ8B 2VSUA 4IZDA 2C8TA 1UIYA 3P85A 4JOTA 2F9IA 3H0QA 1K32A 4ZDCA 2J5SA 4ZDDA 3MOYA 4ZU2A 4K29A 1N6DA 5E0SH 2VSSE 4JWVA 2FZSA 4HC8A 4U0GH 4OMRA 4JSBA 4L8KA 4NNQA 2NP9A 5CTBA 1WZ8A 4ASIA 4I42A 3M6MA 3Q7HA 3TZ3A 4DI1A 1SG4A 1TYFA 4G2RA 3V5IA 2X24A 3ZW8A 3GLMA 4NEKA 4JFCA 1JXZA 5INIA 3KTKA 1YG6A 3BPPA 2ZL3A 4NARA 3NJDA 2ZL2A 3MFMA 5G1QA 4I4ZA 3U9RB 4Q0GA 5DKPA 3DJAA 3ZW9A 3H0UA 1NZYB 4JJTA 4QIJA 2ZQQA 5C90A 4FZWA 3TVUA 2A81A 1WDLA 2J5IA 3LKEA 1UYVA 1DUBA 1Q51A 1RJMA 1XNWA 5DZKH 3WG5A 1TG6A 3HINA 5HUQA 2J5IB 3TRRA 2PBPA 2W3PA 3Q0GA 2YJGA 1O8UA 3P2LA 3TT6A 2QQ3A 3T88A 3Q0JA 3U9SB 4JCRA 3TLFA 3GF7A 2ZL0A 5DTWA 2J5II 2J5GD 3R6HA 3T8AA 2VSUE 2UZFA 4YLHA 4L6WA 3RRVA 5JBXA 4OLQA 2A7SA 2D3TA 3T89A 3IAVA 1HZDA 3ZWAA 3STAA 2Q35A 2FW2A 4JCQA 5DU8A 4MI2A 2F6IA 4I52A 4JVTA 4KD6A 3PEAA 3PE8A 4J2UA 1PIXA 1J7XA 1XO6A 5DUFA 3K50A 4RCNA 4HNKA 5DU6A 4Z0MA 1WDKA 3QMJA 3U9TB 2DEOA 3R0OA 1XNYA 1ON3A 4B3IA 3PGQA 1UYTA 1VRGA 1MJ3A 3P5MA 1NZYA 4LK5A 5C9GA 4ELXA 4RYFH 4JYJA 3I47A 3QXZA 5DL1A 2ZQRA 1N6FA 4U1AA 4ELWA 4KWBA 4HDTA 5KDRA 4B3HA 1UYRA 3IB9A 2EJ5A 4U18A 1XX4A 2VREA 3RSTA 5G1RA 1DCIA 3TV5A 1X0UA 2PPYA 5KDRB 1EY3A 1UYSA 5JBWA 2VSUF 4FNBA 4U0HA 4WYOB 4F47A 4FJWD 1HNUA 4GHNA 4MOUA 4K3WA 5E0SA 1PJHA 5IKLB 3QXIA 3KTIA 3T8BA 4U0GA 1FC6A 1OD4A 4FNDA 3H81A 1Y7OA 5INGA 3NJBA 4WCZA 1Q52A 4KPKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q2X A;  1WDM A;  1N6E A;  4GM2 A;  3LAO A;  3ZWC A;  2HW5 A;  3H0J A;  3KTH A;  4KNP A;  1EF9 A;  1HNO A;  1FC7 A;  3QRE A;  3SLL A;  5FUS A;  4IZB A;  3M6N A;  3FDU A;  3QKA A;  2F6Q A;  1FC9 A;  3ST9 A;  2A7K A;  2WTB A;  3TDC A;  3R9Q A;  5INF A;  4B3J A;  3HE2 A;  3IBB A;  4U19 A;  3SWX A;  3HP0 A;  1EF8 A;  4IZC A;  2Q34 A;  4ZDB A;  2VSU C;  2F9I B;  4QII A;  5DZK A;  3GF3 A;  3BF0 A;  5FIF A;  3MYB A;  3TVW A;  2VSS A;  3RSI A;  5DUC A;  4ZDE A;  1ON9 A;  4ZDF A;  3BEZ A;  1OD2 A;  3GMA A;  2DUB A;  4FN7 A;  2CE3 A;  4FN8 A;  3H02 A;  4K2N A;  2PG8 A;  3H0S A;  1SZO A;  2BZR A;  3TT7 A;  3FF6 A;  3MT6 A;  3PZK A;  3DOR A;  2CBY A;  3V5E A;  3KTJ A;  4ELS A;  3T3W A;  3HRX A;  4Q1I A;  3L3S A;  4JCT A;  3OME A;  2X58 A;  3QK8 A;  3K8X A;  3Q1T A;  1YG8 A;  4OG1 A;  3R9T A;  4QFE A;  2J5G A;  2F9Y A;  2VX2 A;  3KTG A;  2IEX A;  4FZW C;  2GTR A;  5G1S A;  4EML A;  1K39 A;  3GKB A;  3QYR A;  4MXI A;  5E0N X;  5DU4 A;  5KJP A;  3VIV A;  3HLN 1;  5CTC A;  4EMM A;  1W2X A;  4FB8 A;  3QWD A;  3OC7 A;  2FBM A;  2F9Y B;  3ZWB A;  3OT6 A;  5MGB A;  3N6R B;  4JYL A;  3KQF A;  3ISA A;  3R9S A;  4JCS A;  1FCF A;  2ZL4 A;  4EMP A;  3G64 A;  3JU1 A;  5DTP A;  1XNV A;  4RYF A;  2VSS F;  1RJN A;  4WZ8 B;  2VSU A;  4IZD A;  2C8T A;  1UIY A;  3P85 A;  4JOT A;  2F9I A;  3H0Q A;  1K32 A;  4ZDC A;  2J5S A;  4ZDD A;  3MOY A;  4ZU2 A;  4K29 A;  1N6D A;  5E0S H;  2VSS E;  4JWV A;  2FZS A;  4HC8 A;  4U0G H;  4OMR A;  4JSB A;  4L8K A;  4NNQ A;  2NP9 A;  5CTB A;  1WZ8 A;  4ASI A;  4I42 A;  3M6M A;  3Q7H A;  3TZ3 A;  4DI1 A;  1SG4 A;  1TYF A;  4G2R A;  3V5I A;  2X24 A;  3ZW8 A;  3GLM A;  4NEK A;  4JFC A;  1JXZ A;  5INI A;  3KTK A;  1YG6 A;  3BPP A;  2ZL3 A;  3NJD A;  2ZL2 A;  3MFM A;  5G1Q A;  4I4Z A;  3U9R B;  4Q0G A;  5DKP A;  3DJA A;  3ZW9 A;  3H0U A;  1NZY B;  4JJT A;  4QIJ A;  2ZQQ A;  5C90 A;  4FZW A;  3TVU A;  2A81 A;  1WDL A;  2J5I A;  3LKE A;  1UYV A;  1DUB A;  1Q51 A;  1RJM A;  1XNW A;  5DZK H;  3WG5 A;  1TG6 A;  3HIN A;  2J5I B;  3TRR A;  2PBP A;  2W3P A;  3Q0G A;  1O8U A;  3P2L A;  3TT6 A;  2QQ3 A;  3T88 A;  3Q0J A;  3U9S B;  4JCR A;  3TLF A;  3GF7 A;  2ZL0 A;  5DTW A;  2J5I I;  2J5G D;  3R6H A;  3T8A A;  2VSU E;  2UZF A;  4YLH A;  4L6W A;  3RRV A;  5JBX A;  4OLQ A;  2A7S A;  2D3T A;  3T89 A;  3IAV A;  1HZD A;  3ZWA A;  3STA A;  2Q35 A;  2FW2 A;  4JCQ A;  5DU8 A;  4MI2 A;  2F6I A;  4I52 A;  4JVT A;  4KD6 A;  3PEA A;  3PE8 A;  1PIX A;  1J7X A;  1XO6 A;  5DUF A;  3K50 A;  4RCN A;  4HNK A;  5DU6 A;  4Z0M A;  1WDK A;  3QMJ A;  3U9T B;  2DEO A;  3R0O A;  1XNY A;  1ON3 A;  4B3I A;  3PGQ A;  1UYT A;  1VRG A;  1MJ3 A;  3P5M A;  1NZY A;  4LK5 A;  5C9G A;  4ELX A;  4RYF H;  4JYJ A;  3I47 A;  3QXZ A;  5DL1 A;  2ZQR A;  1N6F A;  4U1A A;  4ELW A;  4KWB A;  5KDR A;  4B3H A;  1UYR A;  3IB9 A;  2EJ5 A;  4U18 A;  1XX4 A;  2VRE A;  3RST A;  5G1R A;  1DCI A;  3TV5 A;  1X0U A;  2PPY A;  5KDR B;  1EY3 A;  1UYS A;  5JBW A;  2VSU F;  4FNB A;  4U0H A;  4WYO B;  4F47 A;  4FJW D;  1HNU A;  4GHN A;  4MOU A;  4K3W A;  5E0S A;  1PJH A;  5IKL B;  3QXI A;  3KTI A;  3T8B A;  4U0G A;  1FC6 A;  1OD4 A;  4FND A;  3H81 A;  1Y7O A;  5ING A;  3NJB A;  4WCZ A;  1Q52 A;  4KPK A; 
#chains in the Genus database with same CATH topology
 2Q2X A;  1WDM A;  1N6E A;  4GM2 A;  3LAO A;  3ZWC A;  2HW5 A;  3H0J A;  3KTH A;  4KNP A;  1EF9 A;  1HNO A;  1FC7 A;  3QRE A;  3SLL A;  5FUS A;  4IZB A;  3M6N A;  3FDU A;  3QKA A;  2F6Q A;  1FC9 A;  3ST9 A;  2A7K A;  2WTB A;  3TDC A;  3R9Q A;  5INF A;  4B3J A;  3HE2 A;  3IBB A;  4U19 A;  3SWX A;  3HP0 A;  1EF8 A;  4IZC A;  2Q34 A;  4ZDB A;  2VSU C;  2F9I B;  4QII A;  5DZK A;  3GF3 A;  3BF0 A;  5FIF A;  3MYB A;  3TVW A;  2VSS A;  3RSI A;  5DUC A;  4ZDE A;  1ON9 A;  4ZDF A;  3BEZ A;  1OD2 A;  3GMA A;  2DUB A;  4FN7 A;  2CE3 A;  4FN8 A;  3H02 A;  4K2N A;  2PG8 A;  3H0S A;  1SZO A;  2BZR A;  3TT7 A;  3FF6 A;  3MT6 A;  3PZK A;  3BPT A;  3DOR A;  2CBY A;  3V5E A;  3KTJ A;  4ELS A;  3T3W A;  3HRX A;  4Q1I A;  3L3S A;  4JCT A;  3OME A;  2X58 A;  3QK8 A;  3K8X A;  3Q1T A;  1YG8 A;  4OG1 A;  3R9T A;  4QFE A;  2J5G A;  2F9Y A;  2VX2 A;  3KTG A;  2IEX A;  4FZW C;  2GTR A;  5G1S A;  4EML A;  1K39 A;  3GKB A;  3QYR A;  4MXI A;  5E0N X;  5DU4 A;  5KJP A;  3VIV A;  3HLN 1;  5CTC A;  4EMM A;  1W2X A;  4FB8 A;  3QWD A;  3OC7 A;  2FBM A;  2F9Y B;  3ZWB A;  3OT6 A;  5MGB A;  3N6R B;  4JYL A;  3KQF A;  3ISA A;  3R9S A;  4JCS A;  1FCF A;  2ZL4 A;  4EMP A;  3G64 A;  3JU1 A;  5DTP A;  1XNV A;  4RYF A;  2VSS F;  1RJN A;  4WZ8 B;  2VSU A;  4IZD A;  2C8T A;  1UIY A;  3P85 A;  4JOT A;  2F9I A;  3H0Q A;  1K32 A;  4ZDC A;  2J5S A;  4ZDD A;  3MOY A;  4ZU2 A;  4K29 A;  1N6D A;  5E0S H;  2VSS E;  4JWV A;  2FZS A;  4HC8 A;  4U0G H;  4OMR A;  4JSB A;  4L8K A;  4NNQ A;  2NP9 A;  5CTB A;  1WZ8 A;  4ASI A;  4I42 A;  3M6M A;  3Q7H A;  3TZ3 A;  4DI1 A;  1SG4 A;  1TYF A;  4G2R A;  3V5I A;  2X24 A;  3ZW8 A;  3GLM A;  4NEK A;  4JFC A;  1JXZ A;  5INI A;  3KTK A;  1YG6 A;  3BPP A;  2ZL3 A;  4NAR A;  3NJD A;  2ZL2 A;  3MFM A;  5G1Q A;  4I4Z A;  3U9R B;  4Q0G A;  5DKP A;  3DJA A;  3ZW9 A;  3H0U A;  1NZY B;  4JJT A;  4QIJ A;  2ZQQ A;  5C90 A;  4FZW A;  3TVU A;  2A81 A;  1WDL A;  2J5I A;  3LKE A;  1UYV A;  1DUB A;  1Q51 A;  1RJM A;  1XNW A;  5DZK H;  3WG5 A;  1TG6 A;  3HIN A;  5HUQ A;  2J5I B;  3TRR A;  2PBP A;  2W3P A;  3Q0G A;  2YJG A;  1O8U A;  3P2L A;  3TT6 A;  2QQ3 A;  3T88 A;  3Q0J A;  3U9S B;  4JCR A;  3TLF A;  3GF7 A;  2ZL0 A;  5DTW A;  2J5I I;  2J5G D;  3R6H A;  3T8A A;  2VSU E;  2UZF A;  4YLH A;  4L6W A;  3RRV A;  5JBX A;  4OLQ A;  2A7S A;  2D3T A;  3T89 A;  3IAV A;  1HZD A;  3ZWA A;  3STA A;  2Q35 A;  2FW2 A;  4JCQ A;  5DU8 A;  4MI2 A;  2F6I A;  4I52 A;  4JVT A;  4KD6 A;  3PEA A;  3PE8 A;  4J2U A;  1PIX A;  1J7X A;  1XO6 A;  5DUF A;  3K50 A;  4RCN A;  4HNK A;  5DU6 A;  4Z0M A;  1WDK A;  3QMJ A;  3U9T B;  2DEO A;  3R0O A;  1XNY A;  1ON3 A;  4B3I A;  3PGQ A;  1UYT A;  1VRG A;  1MJ3 A;  3P5M A;  1NZY A;  4LK5 A;  5C9G A;  4ELX A;  4RYF H;  4JYJ A;  3I47 A;  3QXZ A;  5DL1 A;  2ZQR A;  1N6F A;  4U1A A;  4ELW A;  4KWB A;  4HDT A;  5KDR A;  4B3H A;  1UYR A;  3IB9 A;  2EJ5 A;  4U18 A;  1XX4 A;  2VRE A;  3RST A;  5G1R A;  1DCI A;  3TV5 A;  1X0U A;  2PPY A;  5KDR B;  1EY3 A;  1UYS A;  5JBW A;  2VSU F;  4FNB A;  4U0H A;  4WYO B;  4F47 A;  4FJW D;  1HNU A;  4GHN A;  4MOU A;  4K3W A;  5E0S A;  1PJH A;  5IKL B;  3QXI A;  3KTI A;  3T8B A;  4U0G A;  1FC6 A;  1OD4 A;  4FND A;  3H81 A;  1Y7O A;  5ING A;  3NJB A;  4WCZ A;  1Q52 A;  4KPK A; 
#chains in the Genus database with same CATH homology
 2Q2X A;  1WDM A;  1N6E A;  4GM2 A;  3LAO A;  3ZWC A;  2HW5 A;  3H0J A;  3KTH A;  4KNP A;  1EF9 A;  1HNO A;  1FC7 A;  3QRE A;  3SLL A;  5FUS A;  4IZB A;  3M6N A;  3FDU A;  3QKA A;  2F6Q A;  1FC9 A;  3ST9 A;  2A7K A;  2WTB A;  3TDC A;  3R9Q A;  5INF A;  4B3J A;  3HE2 A;  3IBB A;  4U19 A;  3SWX A;  3HP0 A;  1EF8 A;  4IZC A;  2Q34 A;  4ZDB A;  2VSU C;  2F9I B;  4QII A;  5DZK A;  3GF3 A;  3BF0 A;  5FIF A;  3MYB A;  3TVW A;  2VSS A;  3RSI A;  5DUC A;  4ZDE A;  1ON9 A;  4ZDF A;  3BEZ A;  1OD2 A;  3GMA A;  2DUB A;  4FN7 A;  2CE3 A;  4FN8 A;  3H02 A;  4K2N A;  2PG8 A;  3H0S A;  1SZO A;  2BZR A;  3TT7 A;  3FF6 A;  3MT6 A;  3PZK A;  3BPT A;  3DOR A;  2CBY A;  3V5E A;  3KTJ A;  4ELS A;  3T3W A;  3HRX A;  4Q1I A;  3L3S A;  4JCT A;  3OME A;  2X58 A;  3QK8 A;  3K8X A;  3Q1T A;  1YG8 A;  4OG1 A;  3R9T A;  4QFE A;  2J5G A;  2F9Y A;  2VX2 A;  3KTG A;  2IEX A;  4FZW C;  2GTR A;  5G1S A;  4EML A;  1K39 A;  3GKB A;  3QYR A;  4MXI A;  5E0N X;  5DU4 A;  5KJP A;  3VIV A;  3HLN 1;  5CTC A;  4EMM A;  1W2X A;  4FB8 A;  3QWD A;  3OC7 A;  2FBM A;  2F9Y B;  3ZWB A;  3OT6 A;  5MGB A;  3N6R B;  4JYL A;  3KQF A;  3ISA A;  3R9S A;  4JCS A;  1FCF A;  2ZL4 A;  4EMP A;  3G64 A;  3JU1 A;  5DTP A;  1XNV A;  4RYF A;  2VSS F;  1RJN A;  4WZ8 B;  2VSU A;  4IZD A;  2C8T A;  1UIY A;  3P85 A;  4JOT A;  2F9I A;  3H0Q A;  1K32 A;  4ZDC A;  2J5S A;  4ZDD A;  3MOY A;  4ZU2 A;  4K29 A;  1N6D A;  5E0S H;  2VSS E;  4JWV A;  2FZS A;  4HC8 A;  4U0G H;  4OMR A;  4JSB A;  4L8K A;  4NNQ A;  2NP9 A;  5CTB A;  1WZ8 A;  4ASI A;  4I42 A;  3M6M A;  3Q7H A;  3TZ3 A;  4DI1 A;  1SG4 A;  1TYF A;  4G2R A;  3V5I A;  2X24 A;  3ZW8 A;  3GLM A;  4NEK A;  4JFC A;  1JXZ A;  5INI A;  3KTK A;  1YG6 A;  3BPP A;  2ZL3 A;  4NAR A;  3NJD A;  2ZL2 A;  3MFM A;  5G1Q A;  4I4Z A;  3U9R B;  4Q0G A;  5DKP A;  3DJA A;  3ZW9 A;  3H0U A;  1NZY B;  4JJT A;  4QIJ A;  2ZQQ A;  5C90 A;  4FZW A;  3TVU A;  2A81 A;  1WDL A;  2J5I A;  3LKE A;  1UYV A;  1DUB A;  1Q51 A;  1RJM A;  1XNW A;  5DZK H;  3WG5 A;  1TG6 A;  3HIN A;  5HUQ A;  2J5I B;  3TRR A;  2PBP A;  2W3P A;  3Q0G A;  2YJG A;  1O8U A;  3P2L A;  3TT6 A;  2QQ3 A;  3T88 A;  3Q0J A;  3U9S B;  4JCR A;  3TLF A;  3GF7 A;  2ZL0 A;  5DTW A;  2J5I I;  2J5G D;  3R6H A;  3T8A A;  2VSU E;  2UZF A;  4YLH A;  4L6W A;  3RRV A;  5JBX A;  4OLQ A;  2A7S A;  2D3T A;  3T89 A;  3IAV A;  1HZD A;  3ZWA A;  3STA A;  2Q35 A;  2FW2 A;  4JCQ A;  5DU8 A;  4MI2 A;  2F6I A;  4I52 A;  4JVT A;  4KD6 A;  3PEA A;  3PE8 A;  4J2U A;  1PIX A;  1J7X A;  1XO6 A;  5DUF A;  3K50 A;  4RCN A;  4HNK A;  5DU6 A;  4Z0M A;  1WDK A;  3QMJ A;  3U9T B;  2DEO A;  3R0O A;  1XNY A;  1ON3 A;  4B3I A;  3PGQ A;  1UYT A;  1VRG A;  1MJ3 A;  3P5M A;  1NZY A;  4LK5 A;  5C9G A;  4ELX A;  4RYF H;  4JYJ A;  3I47 A;  3QXZ A;  5DL1 A;  2ZQR A;  1N6F A;  4U1A A;  4ELW A;  4KWB A;  4HDT A;  5KDR A;  4B3H A;  1UYR A;  3IB9 A;  2EJ5 A;  4U18 A;  1XX4 A;  2VRE A;  3RST A;  5G1R A;  1DCI A;  3TV5 A;  1X0U A;  2PPY A;  5KDR B;  1EY3 A;  1UYS A;  5JBW A;  2VSU F;  4FNB A;  4U0H A;  4WYO B;  4F47 A;  4FJW D;  1HNU A;  4GHN A;  4MOU A;  4K3W A;  5E0S A;  1PJH A;  5IKL B;  3QXI A;  3KTI A;  3T8B A;  4U0G A;  1FC6 A;  1OD4 A;  4FND A;  3H81 A;  1Y7O A;  5ING A;  3NJB A;  4WCZ A;  1Q52 A;  4KPK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...