3GKLC

Following evolutionary paths to high affinity and selectivity protein-protein interactions using colicin7 and immunity proteins
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
82
structure length
82
Chain Sequence
KHSISDYTEAEFLQLVATICDADATSEEELDKLITHFGEMTEHPSGSDLIYYPEEGDDDSPSGIVNTVKQWRAANGKSGFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Following evolutionary paths to high affinity and selectivity protein-protein interactions
rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Colicin-E9 immunity protein
total genus 24
structure length 82
sequence length 82
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 3gklC00
2K5XA 2GZJA 2JAZA 1BXIA 2VLOA 1EMVA 1UNKA 3U43A 2GZGA 2K0DX 4QKOA 5EW5E 4F37A 1AYIA 2ERHA 2WPTA 2GZFA 2GZIA 1ZNVA 1IMPA 3GJNA 1MZ8A 1IMQA 2GYKA 1CEIA 1FR2A 1GXGA 1GXHA 3GKLC 2VLQA 7CEIA 1UJZA 2GZEA 2VLPA 4UHPB 2JB0A 2NO8A 2JBGA 1E0HA 2VLNA
chains in the Genus database with same CATH superfamily
2PEJA 2BUOA 2AF8A 1AYIA 4H2YC 5KP6B 2KGCA 3CXCO 3CE7A 1FR2A 2JBGA 2QEXP 2KR5A 1EIAA 2GDYA 3CC7P 3NTEA 4QKOA 4F37A 2PEKA 3M1MA 4COCA 4U0CA 2GZIA 1MZ8A 1E6JP 3CMAP 3G6EP 1YIJP 1HQBA 1VQLP 1VQNP 5HGMA 2L6EA 3CPWO 2KG6A 2MD9A 3H0DA 1BXIA 1EMVA 3WBHA 1Q86Q 5F2KA 2M8NA 2CWOA 2K92A 4XROA 4U0DA 4R0MA 4MRTC 3GJNA 2PEIA 1KLPA 2JU2A 3DS0A 4QNBA 2LKIA 3RG2A 2XZ1C 4H2XC 1VQ8P 3EJDA 3H4EA 2AFDA 3CCQP 1KQSO 4WYMA 3DS4A 2KORA 4IPYA 1K8AQ 1GPJA 3G26A 2FHSC 2M5RA 2FQ0A 2N6YA 5BS1A 1DNYA 1K30A 2MR7A 1E0HA 1JJ2O 2ONTA 4XFZA 2LTEA 1DV5A 2FQ2A 3OW2O 1YJWP 2PNGA 1ZNVA 3G29A 1W2BO 2FVAA 1QVFO 4PXHB 2MVVA 2EHSA 2KODA 1RO2A 2JAZA 2K93A 3GZMA 1YITP 2VSQA 3CD6P 2L0QA 2FADA 2JO0A 2KG8A 2KOOA 2MVUA 1X3OA 1VQ6P 3CCRP 2LOLA 1N8RQ 1VQMP 2VLPA 2L9FA 2Z44A 2AVAA 3VRLC 2M8PA 1NJIQ 3RG6C 4U0AA 3DTJA 3CCSP 3P05A 1ZMBA 3MGEA 4XFYA 2XT1A 1VQ9P 4BPGA 2KW2A 3G28A 3G4SP 5F2NA 1T8KA 3CCMP 1M1KQ 2GZEA 1VQ5P 2LF4A 2PEMA 2EG5A 3E2DA 2FQ1A 2VLOA 1UNKA 3U43A 2BHVA 3EJBA 1K9MQ 2CGQA 1AF8A 2OARA 2EFJA 3CCUP 4PH1A 2EHTA 5CZDB 2PEQA 4U0EA 1M74A 2K94A 2JYLA 5BS2A 3HYBA 4BPFA 1VQKP 1KD1Q 2GZFA 2L4BA 2Z45A 1IMPA 2KGEA 4U0BA 1VQOP 3CCVP 2N50A 3GKLC 3NY7B 1VKUA 1UJZA 1VQPP 4H2WC 5HGLA 1A8OA 3Q20A 2Z46A 1M6EX 2LPKA 2PENA 1M6NA 1K73Q 4IZ6A 1QVGO 1YHQP 2GYKA 2KGAA 1ACPA 2XXMA 2L22A 2XV6A 1YJ9P 2N5HA 2QA4P 5DCKA 3H47A 4GR2A 3CC2P 2K2QA 1VQ7P 2ERHA 2KOSA 2AFEA 2KOQA 2OTLP 2K0YA 1QRJA 3DS2A 3G1GA 2LMLA 2DGYA 3CCJP 2KWLA 4CA3A 2N6ZA 1NQ4A 1M90Q 2K0XA 3LMOA 4BPHA 2LIWA 2M8LA 2LIUA 4DG9A 2FVFA 5JPAA 2FVEA 3DPHA 1IUQA 1CEIA 1GXGA 2PY8A 2MY5A 1L0HA 1YI2P 1Q82Q 1Q7YQ 1S72P 2PEOA 2GZJA 2CQ8A 2CG5B 2GDXA 2JQ4A 2E1MA 3B4QA 1Q81Q 2P9XA 2OTJP 4PH0A 1GXHA 3DS3A 2N5IA 1AUMA 2FAEA 5F2OA 2VLNA 5HGNA 3G71P 1BAJA 5KP7B 1Z6MA 2XZ0D 3HZQA 1EOQA 2K0DX 1VHNA 2JGPA 5EW5E 4M0IA 2EIAA 3G0VA 1IMQA 4COPA 3LRYA 4NEOA 5I4TG 2MR8A 4UHPB 1VQ4P 2KGDA 2GDWA 3G21A 2DNWA 2JYGA 1A43A 5HV8A 2CNRA 3EJEA 2QNWA 5KP8B 2N98A 3B5IA 1D1DA 2KOPA 2MF4A 2JU1A 3DS1A 1OR5A 1L0IA 3CMEP 3G1IA 2JB0A 3GZLA 1KC8Q 2ROQA 1F80D 4GR6A 2K5XA 1YJNP 1RO0A 3CCLP 1RNIA 4HKGA 2GZGA 4U0FA 4XRQA 2WPTA 3CCEP 5EJDA 3I56P 2X2BA 1HY8A 2FACA 2LL8A 2KG9A 3CC4P 3I55P 4XFXA 2VLQA 5HVCA 7CEIA 5HGOA 2NO8A 3DS5A 4PWVB
chains in the Genus database with same CATH topology
2K5XA 2GZJA 2JAZA 1BXIA 2VLOA 1EMVA 1UNKA 3U43A 2GZGA 2K0DX 4QKOA 5EW5E 4F37A 1AYIA 2ERHA 2WPTA 2GZFA 2GZIA 1ZNVA 1IMPA 3GJNA 1MZ8A 1IMQA 2GYKA 1CEIA 1FR2A 1GXGA 1GXHA 3GKLC 2VLQA 7CEIA 1UJZA 2GZEA 2VLPA 4UHPB 2JB0A 2NO8A 2JBGA 1E0HA 2VLNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K5X A;  2GZJ A;  2JAZ A;  1BXI A;  2VLO A;  1EMV A;  1UNK A;  3U43 A;  2GZG A;  2K0D X;  4QKO A;  5EW5 E;  4F37 A;  1AYI A;  2ERH A;  2WPT A;  2GZF A;  2GZI A;  1ZNV A;  1IMP A;  3GJN A;  1MZ8 A;  1IMQ A;  2GYK A;  1CEI A;  1FR2 A;  1GXG A;  1GXH A;  3GKL C;  2VLQ A;  7CEI A;  1UJZ A;  2GZE A;  2VLP A;  4UHP B;  2JB0 A;  2NO8 A;  2JBG A;  1E0H A;  2VLN A; 
#chains in the Genus database with same CATH topology
 2PEJ A;  2BUO A;  2AF8 A;  1AYI A;  4H2Y C;  5KP6 B;  2KGC A;  3CXC O;  3CE7 A;  1FR2 A;  2JBG A;  2QEX P;  2KR5 A;  1EIA A;  2GDY A;  3CC7 P;  3NTE A;  4QKO A;  4F37 A;  2PEK A;  3M1M A;  4COC A;  4U0C A;  2GZI A;  1MZ8 A;  1E6J P;  3CMA P;  3G6E P;  1YIJ P;  1HQB A;  1VQL P;  1VQN P;  5HGM A;  2L6E A;  3CPW O;  2KG6 A;  2MD9 A;  3H0D A;  1BXI A;  1EMV A;  3WBH A;  1Q86 Q;  5F2K A;  2M8N A;  2CWO A;  2K92 A;  4XRO A;  4U0D A;  4R0M A;  4MRT C;  3GJN A;  2PEI A;  1KLP A;  2JU2 A;  3DS0 A;  4QNB A;  2LKI A;  3RG2 A;  2XZ1 C;  4H2X C;  1VQ8 P;  3EJD A;  3H4E A;  2AFD A;  3CCQ P;  1KQS O;  4WYM A;  3DS4 A;  2KOR A;  4IPY A;  1K8A Q;  1GPJ A;  3G26 A;  2FHS C;  2M5R A;  2FQ0 A;  2N6Y A;  5BS1 A;  1DNY A;  1K30 A;  2MR7 A;  1E0H A;  1JJ2 O;  2ONT A;  4XFZ A;  2LTE A;  1DV5 A;  2FQ2 A;  3OW2 O;  1YJW P;  2PNG A;  1ZNV A;  3G29 A;  1W2B O;  2FVA A;  1QVF O;  4PXH B;  2MVV A;  2EHS A;  2KOD A;  1RO2 A;  2JAZ A;  2K93 A;  3GZM A;  1YIT P;  2VSQ A;  3CD6 P;  2L0Q A;  2FAD A;  2JO0 A;  2KG8 A;  2KOO A;  2MVU A;  1X3O A;  1VQ6 P;  3CCR P;  2LOL A;  1N8R Q;  1VQM P;  2VLP A;  2L9F A;  2Z44 A;  2AVA A;  3VRL C;  2M8P A;  1NJI Q;  3RG6 C;  4U0A A;  3DTJ A;  3CCS P;  3P05 A;  1ZMB A;  3MGE A;  4XFY A;  2XT1 A;  1VQ9 P;  4BPG A;  2KW2 A;  3G28 A;  3G4S P;  5F2N A;  1T8K A;  3CCM P;  1M1K Q;  2GZE A;  1VQ5 P;  2LF4 A;  2PEM A;  2EG5 A;  3E2D A;  2FQ1 A;  2VLO A;  1UNK A;  3U43 A;  2BHV A;  3EJB A;  1K9M Q;  2CGQ A;  1AF8 A;  2OAR A;  2EFJ A;  3CCU P;  4PH1 A;  2EHT A;  5CZD B;  2PEQ A;  4U0E A;  1M74 A;  2K94 A;  2JYL A;  5BS2 A;  3HYB A;  4BPF A;  1VQK P;  1KD1 Q;  2GZF A;  2L4B A;  2Z45 A;  1IMP A;  2KGE A;  4U0B A;  1VQO P;  3CCV P;  2N50 A;  3GKL C;  3NY7 B;  1VKU A;  1UJZ A;  1VQP P;  4H2W C;  5HGL A;  1A8O A;  3Q20 A;  2Z46 A;  1M6E X;  2LPK A;  2PEN A;  1M6N A;  1K73 Q;  4IZ6 A;  1QVG O;  1YHQ P;  2GYK A;  2KGA A;  1ACP A;  2XXM A;  2L22 A;  2XV6 A;  1YJ9 P;  2N5H A;  2QA4 P;  5DCK A;  3H47 A;  4GR2 A;  3CC2 P;  2K2Q A;  1VQ7 P;  2ERH A;  2KOS A;  2AFE A;  2KOQ A;  2OTL P;  2K0Y A;  1QRJ A;  3DS2 A;  3G1G A;  2LML A;  2DGY A;  3CCJ P;  2KWL A;  4CA3 A;  2N6Z A;  1NQ4 A;  1M90 Q;  2K0X A;  3LMO A;  4BPH A;  2LIW A;  2M8L A;  2LIU A;  4DG9 A;  2FVF A;  5JPA A;  2FVE A;  3DPH A;  1IUQ A;  1CEI A;  1GXG A;  2PY8 A;  2MY5 A;  1L0H A;  1YI2 P;  1Q82 Q;  1Q7Y Q;  1S72 P;  2PEO A;  2GZJ A;  2CQ8 A;  2CG5 B;  2GDX A;  2JQ4 A;  2E1M A;  3B4Q A;  1Q81 Q;  2P9X A;  2OTJ P;  4PH0 A;  1GXH A;  3DS3 A;  2N5I A;  1AUM A;  2FAE A;  5F2O A;  2VLN A;  5HGN A;  3G71 P;  1BAJ A;  5KP7 B;  1Z6M A;  2XZ0 D;  3HZQ A;  1EOQ A;  2K0D X;  1VHN A;  2JGP A;  5EW5 E;  4M0I A;  2EIA A;  3G0V A;  1IMQ A;  4COP A;  3LRY A;  4NEO A;  5I4T G;  2MR8 A;  4UHP B;  1VQ4 P;  2KGD A;  2GDW A;  3G21 A;  2DNW A;  2JYG A;  1A43 A;  5HV8 A;  2CNR A;  3EJE A;  2QNW A;  5KP8 B;  2N98 A;  3B5I A;  1D1D A;  2KOP A;  2MF4 A;  2JU1 A;  3DS1 A;  1OR5 A;  1L0I A;  3CME P;  3G1I A;  2JB0 A;  3GZL A;  1KC8 Q;  2ROQ A;  1F80 D;  4GR6 A;  2K5X A;  1YJN P;  1RO0 A;  3CCL P;  1RNI A;  4HKG A;  2GZG A;  4U0F A;  4XRQ A;  2WPT A;  3CCE P;  5EJD A;  3I56 P;  2X2B A;  1HY8 A;  2FAC A;  2LL8 A;  2KG9 A;  3CC4 P;  3I55 P;  4XFX A;  2VLQ A;  5HVC A;  7CEI A;  5HGO A;  2NO8 A;  3DS5 A;  4PWV B; 
#chains in the Genus database with same CATH homology
 2K5X A;  2GZJ A;  2JAZ A;  1BXI A;  2VLO A;  1EMV A;  1UNK A;  3U43 A;  2GZG A;  2K0D X;  4QKO A;  5EW5 E;  4F37 A;  1AYI A;  2ERH A;  2WPT A;  2GZF A;  2GZI A;  1ZNV A;  1IMP A;  3GJN A;  1MZ8 A;  1IMQ A;  2GYK A;  1CEI A;  1FR2 A;  1GXG A;  1GXH A;  3GKL C;  2VLQ A;  7CEI A;  1UJZ A;  2GZE A;  2VLP A;  4UHP B;  2JB0 A;  2NO8 A;  2JBG A;  1E0H A;  2VLN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...