3GKLC

Following evolutionary paths to high affinity and selectivity protein-protein interactions using colicin7 and immunity proteins
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
82
structure length
82
Chain Sequence
KHSISDYTEAEFLQLVATICDADATSEEELDKLITHFGEMTEHPSGSDLIYYPEEGDDDSPSGIVNTVKQWRAANGKSGFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Colicin-E9 immunity protein
publication title Following evolutionary paths to high affinity and selectivity protein-protein interactions
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 24
structure length 82
sequence length 82
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 3gklC00
2WPTA 2JB0A 2JBGA 2VLPA 1CEIA 1GXGA 2GZIA 3GKLC 4F37A 2ERHA 1UJZA 1EMVA 4QKOA 4UHPB 3U43A 1AYIA 1MZ8A 1E0HA 2VLNA 5EW5E 2NO8A 2GZGA 2VLQA 1ZNVA 1IMQA 3GJNA 2K0DX 2VLOA 1IMPA 2GYKA 1FR2A 7CEIA 2GZJA 2K5XA 1GXHA 1BXIA 2GZFA 2JAZA 1UNKA 2GZEA
chains in the Genus database with same CATH superfamily
3CCRP 2FADA 2JYGA 2CG5B 4COCA 3MGEA 1IUQA 1VQMP 3OW2O 3DS5A 2DNWA 4XRQA 2FVEA 5BS1A 2EHSA 3CCLP 2FVAA 3RG2A 2BUOA 3DS1A 5KP7B 3CCVP 1DNYA 5F2OA 2PEQA 5EJDA 2KGCA 2MVVA 4UHPB 1KQSO 1KD1Q 1YJNP 2NO8A 3H0DA 2N5HA 2K0DX 2PY8A 2KORA 2Z44A 3DPHA 3CCEP 2LIUA 3G6EP 1YJWP 1VQ5P 2M5RA 2LPKA 1VHNA 1EOQA 1YI2P 5BS2A 1K73Q 2KWLA 3CC7P 4HKGA 2PEOA 4XFXA 2P9XA 2JYLA 5DCKA 1L0IA 1IMQA 4XFYA 2QNWA 7CEIA 2KG9A 5F2KA 1ACPA 1VQOP 2MR8A 3EJBA 2L9FA 1Q81Q 5HGOA 2JBGA 2JGPA 4QNBA 4DG9A 2GZIA 1HQBA 2L6EA 4F37A 2K0YA 1NJIQ 3G26A 1QVGO 1RO0A 1K30A 3H47A 1Q7YQ 3CC2P 2VLOA 4GR6A 2K5XA 5KP8B 2DGYA 3E2DA 2GZEA 2LMLA 2KW2A 2KOSA 3NTEA 3CCQP 3CCUP 1VQPP 5HGNA 3WBHA 1RNIA 1GPJA 2VLQA 2KGDA 2AVAA 2GZJA 2QA4P 2JQ4A 2GDWA 1BXIA 2FQ0A 3CC4P 1EIAA 3CCJP 1W2BO 1NQ4A 2ERHA 2FQ2A 2XZ1C 4WYMA 4H2WC 3VRLC 2VLNA 2K94A 1D1DA 1GXHA 1VQ7P 2LF4A 2JU2A 1CEIA 1QVFO 5HGMA 3GKLC 3DS2A 3HYBA 5HVCA 1Z6MA 3CMAP 1VQ6P 2ROQA 2XZ0D 4BPHA 4U0FA 1FR2A 2PEJA 3CCSP 2N5IA 1UNKA 2WPTA 4BPGA 4QKOA 2PNGA 2LIWA 3I56P 4R0MA 2XV6A 1E0HA 5EW5E 1M1KQ 2FHSC 1M90Q 2EFJA 2OTJP 2N50A 2N98A 1T8KA 2MVUA 3B5IA 3LMOA 5F2NA 1Q86Q 3CMEP 1N8RQ 2GDXA 2BHVA 3G1GA 2N6ZA 4COPA 3G21A 4U0CA 1VQNP 3I55P 4PH0A 1VQ4P 4BPFA 1IMPA 2PENA 3CD6P 2FACA 3DS3A 2QEXP 2EG5A 4PWVB 4GR2A 2KGAA 3CPWO 2Z46A 1KC8Q 1VQ8P 1YJ9P 2CQ8A 1UJZA 1YIJP 1S72P 4PH1A 3U43A 5I4TG 1VKUA 1K8AQ 3LRYA 4U0BA 2MF4A 1M74A 1DV5A 1M6EX 4CA3A 4U0AA 4M0IA 2KG8A 2ONTA 2KOQA 1F80D 2Z45A 2CGQA 2JAZA 1AF8A 1K9MQ 2JB0A 2M8NA 2CNRA 3EJDA 2PEKA 2KOOA 1GXGA 2CWOA 4XROA 3RG6C 2L0QA 2GZGA 1ZNVA 2LL8A 4NEOA 2X2BA 1QRJA 4IPYA 3DS0A 1JJ2O 5JPAA 2M8LA 2K92A 1YITP 4IZ6A 2PEIA 2MY5A 3B4QA 2GDYA 3H4EA 3GZLA 1ZMBA 1X3OA 2K93A 2GYKA 2K0XA 2XXMA 3GZMA 2LOLA 2AF8A 3CE7A 3Q20A 2JO0A 2L22A 2KG6A 1BAJA 2E1MA 5HV8A 2KGEA 2EHTA 5HGLA 2MD9A 2FVFA 1E6JP 1M6NA 2JU1A 3DTJA 1Q82Q 3HZQA 5CZDB 1L0HA 2LTEA 3M1MA 3NY7B 1EMVA 2MR7A 4H2XC 1AYIA 3DS4A 3G29A 4PXHB 2FAEA 2EIAA 3GJNA 2AFDA 1VQ9P 1A43A 2KR5A 3G0VA 2GZFA 1RO2A 2LKIA 2KOPA 3P05A 3G1IA 1A8OA 2OARA 1VQLP 2M8PA 3EJEA 3CCMP 2AFEA 3CXCO 2K2QA 2KODA 4H2YC 1KLPA 3G71P 2VSQA 1MZ8A 2N6YA 2FQ1A 1AUMA 1VQKP 4XFZA 4U0EA 2VLPA 2XT1A 1YHQP 2OTLP 3G28A 4U0DA 5KP6B 1OR5A 2L4BA 1HY8A 2PEMA 3G4SP 4MRTC
chains in the Genus database with same CATH topology
2WPTA 2JB0A 2JBGA 2VLPA 1CEIA 1GXGA 2GZIA 3GKLC 4F37A 2ERHA 1UJZA 1EMVA 4QKOA 4UHPB 3U43A 1AYIA 1MZ8A 1E0HA 2VLNA 5EW5E 2NO8A 2GZGA 2VLQA 1ZNVA 1IMQA 3GJNA 2K0DX 2VLOA 1IMPA 2GYKA 1FR2A 7CEIA 2GZJA 2K5XA 1GXHA 1BXIA 2GZFA 2JAZA 1UNKA 2GZEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WPT A;  2JB0 A;  2JBG A;  2VLP A;  1CEI A;  1GXG A;  2GZI A;  3GKL C;  4F37 A;  2ERH A;  1UJZ A;  1EMV A;  4QKO A;  4UHP B;  3U43 A;  1AYI A;  1MZ8 A;  1E0H A;  2VLN A;  5EW5 E;  2NO8 A;  2GZG A;  2VLQ A;  1ZNV A;  1IMQ A;  3GJN A;  2K0D X;  2VLO A;  1IMP A;  2GYK A;  1FR2 A;  7CEI A;  2GZJ A;  2K5X A;  1GXH A;  1BXI A;  2GZF A;  2JAZ A;  1UNK A;  2GZE A; 
#chains in the Genus database with same CATH topology
 3CCR P;  2FAD A;  2JYG A;  2CG5 B;  4COC A;  3MGE A;  1IUQ A;  1VQM P;  3OW2 O;  3DS5 A;  2DNW A;  4XRQ A;  2FVE A;  5BS1 A;  2EHS A;  3CCL P;  2FVA A;  3RG2 A;  2BUO A;  3DS1 A;  5KP7 B;  3CCV P;  1DNY A;  5F2O A;  2PEQ A;  5EJD A;  2KGC A;  2MVV A;  4UHP B;  1KQS O;  1KD1 Q;  1YJN P;  2NO8 A;  3H0D A;  2N5H A;  2K0D X;  2PY8 A;  2KOR A;  2Z44 A;  3DPH A;  3CCE P;  2LIU A;  3G6E P;  1YJW P;  1VQ5 P;  2M5R A;  2LPK A;  1VHN A;  1EOQ A;  1YI2 P;  5BS2 A;  1K73 Q;  2KWL A;  3CC7 P;  4HKG A;  2PEO A;  4XFX A;  2P9X A;  2JYL A;  5DCK A;  1L0I A;  1IMQ A;  4XFY A;  2QNW A;  7CEI A;  2KG9 A;  5F2K A;  1ACP A;  1VQO P;  2MR8 A;  3EJB A;  2L9F A;  1Q81 Q;  5HGO A;  2JBG A;  2JGP A;  4QNB A;  4DG9 A;  2GZI A;  1HQB A;  2L6E A;  4F37 A;  2K0Y A;  1NJI Q;  3G26 A;  1QVG O;  1RO0 A;  1K30 A;  3H47 A;  1Q7Y Q;  3CC2 P;  2VLO A;  4GR6 A;  2K5X A;  5KP8 B;  2DGY A;  3E2D A;  2GZE A;  2LML A;  2KW2 A;  2KOS A;  3NTE A;  3CCQ P;  3CCU P;  1VQP P;  5HGN A;  3WBH A;  1RNI A;  1GPJ A;  2VLQ A;  2KGD A;  2AVA A;  2GZJ A;  2QA4 P;  2JQ4 A;  2GDW A;  1BXI A;  2FQ0 A;  3CC4 P;  1EIA A;  3CCJ P;  1W2B O;  1NQ4 A;  2ERH A;  2FQ2 A;  2XZ1 C;  4WYM A;  4H2W C;  3VRL C;  2VLN A;  2K94 A;  1D1D A;  1GXH A;  1VQ7 P;  2LF4 A;  2JU2 A;  1CEI A;  1QVF O;  5HGM A;  3GKL C;  3DS2 A;  3HYB A;  5HVC A;  1Z6M A;  3CMA P;  1VQ6 P;  2ROQ A;  2XZ0 D;  4BPH A;  4U0F A;  1FR2 A;  2PEJ A;  3CCS P;  2N5I A;  1UNK A;  2WPT A;  4BPG A;  4QKO A;  2PNG A;  2LIW A;  3I56 P;  4R0M A;  2XV6 A;  1E0H A;  5EW5 E;  1M1K Q;  2FHS C;  1M90 Q;  2EFJ A;  2OTJ P;  2N50 A;  2N98 A;  1T8K A;  2MVU A;  3B5I A;  3LMO A;  5F2N A;  1Q86 Q;  3CME P;  1N8R Q;  2GDX A;  2BHV A;  3G1G A;  2N6Z A;  4COP A;  3G21 A;  4U0C A;  1VQN P;  3I55 P;  4PH0 A;  1VQ4 P;  4BPF A;  1IMP A;  2PEN A;  3CD6 P;  2FAC A;  3DS3 A;  2QEX P;  2EG5 A;  4PWV B;  4GR2 A;  2KGA A;  3CPW O;  2Z46 A;  1KC8 Q;  1VQ8 P;  1YJ9 P;  2CQ8 A;  1UJZ A;  1YIJ P;  1S72 P;  4PH1 A;  3U43 A;  5I4T G;  1VKU A;  1K8A Q;  3LRY A;  4U0B A;  2MF4 A;  1M74 A;  1DV5 A;  1M6E X;  4CA3 A;  4U0A A;  4M0I A;  2KG8 A;  2ONT A;  2KOQ A;  1F80 D;  2Z45 A;  2CGQ A;  2JAZ A;  1AF8 A;  1K9M Q;  2JB0 A;  2M8N A;  2CNR A;  3EJD A;  2PEK A;  2KOO A;  1GXG A;  2CWO A;  4XRO A;  3RG6 C;  2L0Q A;  2GZG A;  1ZNV A;  2LL8 A;  4NEO A;  2X2B A;  1QRJ A;  4IPY A;  3DS0 A;  1JJ2 O;  5JPA A;  2M8L A;  2K92 A;  1YIT P;  4IZ6 A;  2PEI A;  2MY5 A;  3B4Q A;  2GDY A;  3H4E A;  3GZL A;  1ZMB A;  1X3O A;  2K93 A;  2GYK A;  2K0X A;  2XXM A;  3GZM A;  2LOL A;  2AF8 A;  3CE7 A;  3Q20 A;  2JO0 A;  2L22 A;  2KG6 A;  1BAJ A;  2E1M A;  5HV8 A;  2KGE A;  2EHT A;  5HGL A;  2MD9 A;  2FVF A;  1E6J P;  1M6N A;  2JU1 A;  3DTJ A;  1Q82 Q;  3HZQ A;  5CZD B;  1L0H A;  2LTE A;  3M1M A;  3NY7 B;  1EMV A;  2MR7 A;  4H2X C;  1AYI A;  3DS4 A;  3G29 A;  4PXH B;  2FAE A;  2EIA A;  3GJN A;  2AFD A;  1VQ9 P;  1A43 A;  2KR5 A;  3G0V A;  2GZF A;  1RO2 A;  2LKI A;  2KOP A;  3P05 A;  3G1I A;  1A8O A;  2OAR A;  1VQL P;  2M8P A;  3EJE A;  3CCM P;  2AFE A;  3CXC O;  2K2Q A;  2KOD A;  4H2Y C;  1KLP A;  3G71 P;  2VSQ A;  1MZ8 A;  2N6Y A;  2FQ1 A;  1AUM A;  1VQK P;  4XFZ A;  4U0E A;  2VLP A;  2XT1 A;  1YHQ P;  2OTL P;  3G28 A;  4U0D A;  5KP6 B;  1OR5 A;  2L4B A;  1HY8 A;  2PEM A;  3G4S P;  4MRT C; 
#chains in the Genus database with same CATH homology
 2WPT A;  2JB0 A;  2JBG A;  2VLP A;  1CEI A;  1GXG A;  2GZI A;  3GKL C;  4F37 A;  2ERH A;  1UJZ A;  1EMV A;  4QKO A;  4UHP B;  3U43 A;  1AYI A;  1MZ8 A;  1E0H A;  2VLN A;  5EW5 E;  2NO8 A;  2GZG A;  2VLQ A;  1ZNV A;  1IMQ A;  3GJN A;  2K0D X;  2VLO A;  1IMP A;  2GYK A;  1FR2 A;  7CEI A;  2GZJ A;  2K5X A;  1GXH A;  1BXI A;  2GZF A;  2JAZ A;  1UNK A;  2GZE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...