3GKLC

Following evolutionary paths to high affinity and selectivity protein-protein interactions using colicin7 and immunity proteins
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
82
structure length
82
Chain Sequence
KHSISDYTEAEFLQLVATICDADATSEEELDKLITHFGEMTEHPSGSDLIYYPEEGDDDSPSGIVNTVKQWRAANGKSGFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Colicin-E9 immunity protein
publication title Following evolutionary paths to high affinity and selectivity protein-protein interactions
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 24
structure length 82
sequence length 82
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 3gklC00
2GZFA 2K0DX 2VLQA 1E0HA 1GXGA 1FR2A 7CEIA 2WPTA 2JBGA 2GZEA 2VLNA 2NO8A 1EMVA 1MZ8A 4QKOA 1BXIA 1GXHA 2GZJA 1ZNVA 4F37A 2VLPA 5EW5E 2ERHA 1IMPA 1UNKA 2K5XA 2GZIA 1AYIA 1IMQA 2GZGA 3GKLC 3GJNA 2VLOA 4UHPB 3U43A 2GYKA 1UJZA 1CEIA 2JAZA 2JB0A
chains in the Genus database with same CATH superfamily
1VQMP 2P9XA 4PXHB 7CEIA 3CMAP 2PEJA 1KQSO 2EHSA 1EOQA 5HGNA 4XFZA 4F37A 3CCRP 2L9FA 2CG5B 3B5IA 1DNYA 1A43A 3CCSP 1UNKA 2KOPA 3I55P 1AYIA 4BPHA 2FADA 2KG9A 2EHTA 1M74A 2ROQA 4HKGA 4IPYA 5HVCA 5KP7B 2FAEA 2WPTA 2FVAA 3DS5A 2KG8A 1M90Q 1YJNP 3CCEP 2JO0A 2GDYA 1N8RQ 2M8NA 1QVGO 2MVVA 2KWLA 4MRTC 1ACPA 3CE7A 1QRJA 3GKLC 3DS1A 2CQ8A 3EJBA 2FVEA 2ONTA 2GZFA 2MR8A 2OARA 1E6JP 1K30A 2XZ1C 2AVAA 2FACA 3RG2A 3MGEA 1VQLP 2MY5A 1EIAA 1CEIA 2JYLA 3M1MA 3OW2O 5I4TG 1VHNA 2K0YA 2L0QA 2DNWA 2FVFA 2BUOA 2QNWA 3G29A 1BXIA 2PNGA 1VQ8P 1L0IA 1OR5A 1VQ6P 1KD1Q 1RNIA 3G1GA 4BPFA 1F80D 2JQ4A 3DS3A 1NJIQ 4WYMA 3EJEA 1HQBA 2CWOA 1VQ5P 1Q86Q 2CGQA 3G71P 3NTEA 3I56P 2K94A 1QVFO 1GXHA 5JPAA 1K9MQ 2PEKA 5EW5E 3CD6P 3NY7B 1Q82Q 2LIWA 3GJNA 2PENA 2MR7A 3CPWO 3GZMA 2E1MA 1GXGA 2PEMA 4U0DA 2LMLA 5F2OA 2JYGA 4QKOA 3H0DA 2GDXA 2Z44A 3DPHA 3CCQP 1YHQP 1AUMA 4R0MA 5EJDA 3LMOA 4XFYA 2XV6A 5DCKA 2KOOA 2BHVA 1Q81Q 1VQ9P 1ZMBA 5HV8A 1K8AQ 1M1KQ 3GZLA 3G6EP 1IMPA 1YJWP 2K5XA 2M8LA 2GYKA 2PEOA 2M5RA 1Z6MA 2QEXP 2NO8A 2LIUA 3CC7P 4M0IA 2N98A 3CC2P 2LTEA 3HYBA 1A8OA 3G28A 2QA4P 2N6ZA 4U0AA 3CCJP 2L4BA 1IUQA 2XT1A 4GR2A 1T8KA 3G1IA 3CC4P 2LL8A 2KG6A 2EIAA 4XRQA 2M8PA 5KP6B 4BPGA 1JJ2O 3HZQA 2CNRA 2DGYA 1L0HA 4XFXA 3CMEP 4H2YC 5HGMA 2LKIA 4H2WC 1RO2A 2N50A 2KGAA 5HGLA 2N5HA 1YITP 1VQNP 2VLPA 2FQ2A 4U0FA 3G21A 1K73Q 2GZIA 3Q20A 2KODA 2L6EA 2K0DX 1VQOP 3CCUP 2JBGA 5HGOA 1AF8A 1MZ8A 3CXCO 2LPKA 4XROA 3H4EA 2KGCA 4IZ6A 2OTJP 1RO0A 1W2BO 2VLQA 3CCMP 2K2QA 1YIJP 3CCVP 4COPA 3DTJA 1VQKP 2KOQA 2GZEA 3G0VA 3DS2A 4U0CA 1NQ4A 3E2DA 2MD9A 2AFDA 2GZGA 3U43A 2OTLP 1D1DA 2PEQA 2L22A 1X3OA 1BAJA 2KOSA 1S72P 2LOLA 2AFEA 2GZJA 2KGEA 1Q7YQ 2Z46A 1GPJA 2GDWA 3G26A 2KORA 2Z45A 4U0EA 1KLPA 2EFJA 1M6NA 2MVUA 2AF8A 5CZDB 2XXMA 3LRYA 4DG9A 1VKUA 1EMVA 4QNBA 2EG5A 1ZNVA 4PWVB 4U0BA 3CCLP 2JU2A 1VQPP 1M6EX 2JGPA 2KGDA 4UHPB 3WBHA 2K92A 2N6YA 2K93A 3VRLC 1YI2P 4H2XC 1E0HA 2KW2A 2PY8A 2XZ0D 3P05A 2N5IA 2FQ0A 2MF4A 1VQ7P 2VLNA 2PEIA 4CA3A 2FQ1A 2K0XA 2LF4A 3EJDA 4PH0A 4NEOA 3DS4A 3G4SP 5F2NA 1HY8A 3B4QA 1IMQA 3RG6C 2KR5A 5BS1A 4COCA 1UJZA 2FHSC 2JB0A 1FR2A 1VQ4P 3H47A 5KP8B 1KC8Q 1DV5A 5BS2A 2JU1A 1YJ9P 3DS0A 2ERHA 2X2BA 5F2KA 2VLOA 4PH1A 4GR6A 2JAZA 2VSQA
chains in the Genus database with same CATH topology
2GZFA 2K0DX 2VLQA 1E0HA 1GXGA 1FR2A 7CEIA 2WPTA 2JBGA 2GZEA 2VLNA 2NO8A 1EMVA 1MZ8A 4QKOA 1BXIA 1GXHA 2GZJA 1ZNVA 4F37A 2VLPA 5EW5E 2ERHA 1IMPA 1UNKA 2K5XA 2GZIA 1AYIA 1IMQA 2GZGA 3GKLC 3GJNA 2VLOA 4UHPB 3U43A 2GYKA 1UJZA 1CEIA 2JAZA 2JB0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GZF A;  2K0D X;  2VLQ A;  1E0H A;  1GXG A;  1FR2 A;  7CEI A;  2WPT A;  2JBG A;  2GZE A;  2VLN A;  2NO8 A;  1EMV A;  1MZ8 A;  4QKO A;  1BXI A;  1GXH A;  2GZJ A;  1ZNV A;  4F37 A;  2VLP A;  5EW5 E;  2ERH A;  1IMP A;  1UNK A;  2K5X A;  2GZI A;  1AYI A;  1IMQ A;  2GZG A;  3GKL C;  3GJN A;  2VLO A;  4UHP B;  3U43 A;  2GYK A;  1UJZ A;  1CEI A;  2JAZ A;  2JB0 A; 
#chains in the Genus database with same CATH topology
 1VQM P;  2P9X A;  4PXH B;  7CEI A;  3CMA P;  2PEJ A;  1KQS O;  2EHS A;  1EOQ A;  5HGN A;  4XFZ A;  4F37 A;  3CCR P;  2L9F A;  2CG5 B;  3B5I A;  1DNY A;  1A43 A;  3CCS P;  1UNK A;  2KOP A;  3I55 P;  1AYI A;  4BPH A;  2FAD A;  2KG9 A;  2EHT A;  1M74 A;  2ROQ A;  4HKG A;  4IPY A;  5HVC A;  5KP7 B;  2FAE A;  2WPT A;  2FVA A;  3DS5 A;  2KG8 A;  1M90 Q;  1YJN P;  3CCE P;  2JO0 A;  2GDY A;  1N8R Q;  2M8N A;  1QVG O;  2MVV A;  2KWL A;  4MRT C;  1ACP A;  3CE7 A;  1QRJ A;  3GKL C;  3DS1 A;  2CQ8 A;  3EJB A;  2FVE A;  2ONT A;  2GZF A;  2MR8 A;  2OAR A;  1E6J P;  1K30 A;  2XZ1 C;  2AVA A;  2FAC A;  3RG2 A;  3MGE A;  1VQL P;  2MY5 A;  1EIA A;  1CEI A;  2JYL A;  3M1M A;  3OW2 O;  5I4T G;  1VHN A;  2K0Y A;  2L0Q A;  2DNW A;  2FVF A;  2BUO A;  2QNW A;  3G29 A;  1BXI A;  2PNG A;  1VQ8 P;  1L0I A;  1OR5 A;  1VQ6 P;  1KD1 Q;  1RNI A;  3G1G A;  4BPF A;  1F80 D;  2JQ4 A;  3DS3 A;  1NJI Q;  4WYM A;  3EJE A;  1HQB A;  2CWO A;  1VQ5 P;  1Q86 Q;  2CGQ A;  3G71 P;  3NTE A;  3I56 P;  2K94 A;  1QVF O;  1GXH A;  5JPA A;  1K9M Q;  2PEK A;  5EW5 E;  3CD6 P;  3NY7 B;  1Q82 Q;  2LIW A;  3GJN A;  2PEN A;  2MR7 A;  3CPW O;  3GZM A;  2E1M A;  1GXG A;  2PEM A;  4U0D A;  2LML A;  5F2O A;  2JYG A;  4QKO A;  3H0D A;  2GDX A;  2Z44 A;  3DPH A;  3CCQ P;  1YHQ P;  1AUM A;  4R0M A;  5EJD A;  3LMO A;  4XFY A;  2XV6 A;  5DCK A;  2KOO A;  2BHV A;  1Q81 Q;  1VQ9 P;  1ZMB A;  5HV8 A;  1K8A Q;  1M1K Q;  3GZL A;  3G6E P;  1IMP A;  1YJW P;  2K5X A;  2M8L A;  2GYK A;  2PEO A;  2M5R A;  1Z6M A;  2QEX P;  2NO8 A;  2LIU A;  3CC7 P;  4M0I A;  2N98 A;  3CC2 P;  2LTE A;  3HYB A;  1A8O A;  3G28 A;  2QA4 P;  2N6Z A;  4U0A A;  3CCJ P;  2L4B A;  1IUQ A;  2XT1 A;  4GR2 A;  1T8K A;  3G1I A;  3CC4 P;  2LL8 A;  2KG6 A;  2EIA A;  4XRQ A;  2M8P A;  5KP6 B;  4BPG A;  1JJ2 O;  3HZQ A;  2CNR A;  2DGY A;  1L0H A;  4XFX A;  3CME P;  4H2Y C;  5HGM A;  2LKI A;  4H2W C;  1RO2 A;  2N50 A;  2KGA A;  5HGL A;  2N5H A;  1YIT P;  1VQN P;  2VLP A;  2FQ2 A;  4U0F A;  3G21 A;  1K73 Q;  2GZI A;  3Q20 A;  2KOD A;  2L6E A;  2K0D X;  1VQO P;  3CCU P;  2JBG A;  5HGO A;  1AF8 A;  1MZ8 A;  3CXC O;  2LPK A;  4XRO A;  3H4E A;  2KGC A;  4IZ6 A;  2OTJ P;  1RO0 A;  1W2B O;  2VLQ A;  3CCM P;  2K2Q A;  1YIJ P;  3CCV P;  4COP A;  3DTJ A;  1VQK P;  2KOQ A;  2GZE A;  3G0V A;  3DS2 A;  4U0C A;  1NQ4 A;  3E2D A;  2MD9 A;  2AFD A;  2GZG A;  3U43 A;  2OTL P;  1D1D A;  2PEQ A;  2L22 A;  1X3O A;  1BAJ A;  2KOS A;  1S72 P;  2LOL A;  2AFE A;  2GZJ A;  2KGE A;  1Q7Y Q;  2Z46 A;  1GPJ A;  2GDW A;  3G26 A;  2KOR A;  2Z45 A;  4U0E A;  1KLP A;  2EFJ A;  1M6N A;  2MVU A;  2AF8 A;  5CZD B;  2XXM A;  3LRY A;  4DG9 A;  1VKU A;  1EMV A;  4QNB A;  2EG5 A;  1ZNV A;  4PWV B;  4U0B A;  3CCL P;  2JU2 A;  1VQP P;  1M6E X;  2JGP A;  2KGD A;  4UHP B;  3WBH A;  2K92 A;  2N6Y A;  2K93 A;  3VRL C;  1YI2 P;  4H2X C;  1E0H A;  2KW2 A;  2PY8 A;  2XZ0 D;  3P05 A;  2N5I A;  2FQ0 A;  2MF4 A;  1VQ7 P;  2VLN A;  2PEI A;  4CA3 A;  2FQ1 A;  2K0X A;  2LF4 A;  3EJD A;  4PH0 A;  4NEO A;  3DS4 A;  3G4S P;  5F2N A;  1HY8 A;  3B4Q A;  1IMQ A;  3RG6 C;  2KR5 A;  5BS1 A;  4COC A;  1UJZ A;  2FHS C;  2JB0 A;  1FR2 A;  1VQ4 P;  3H47 A;  5KP8 B;  1KC8 Q;  1DV5 A;  5BS2 A;  2JU1 A;  1YJ9 P;  3DS0 A;  2ERH A;  2X2B A;  5F2K A;  2VLO A;  4PH1 A;  4GR6 A;  2JAZ A;  2VSQ A; 
#chains in the Genus database with same CATH homology
 2GZF A;  2K0D X;  2VLQ A;  1E0H A;  1GXG A;  1FR2 A;  7CEI A;  2WPT A;  2JBG A;  2GZE A;  2VLN A;  2NO8 A;  1EMV A;  1MZ8 A;  4QKO A;  1BXI A;  1GXH A;  2GZJ A;  1ZNV A;  4F37 A;  2VLP A;  5EW5 E;  2ERH A;  1IMP A;  1UNK A;  2K5X A;  2GZI A;  1AYI A;  1IMQ A;  2GZG A;  3GKL C;  3GJN A;  2VLO A;  4UHP B;  3U43 A;  2GYK A;  1UJZ A;  1CEI A;  2JAZ A;  2JB0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...