3GKLC

Following evolutionary paths to high affinity and selectivity protein-protein interactions using colicin7 and immunity proteins
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
82
structure length
82
Chain Sequence
KHSISDYTEAEFLQLVATICDADATSEEELDKLITHFGEMTEHPSGSDLIYYPEEGDDDSPSGIVNTVKQWRAANGKSGFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Following evolutionary paths to high affinity and selectivity protein-protein interactions
rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Colicin-E9 immunity protein
total genus 24
structure length 82
sequence length 82
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 3gklC00
1CEIA 2GZJA 2ERHA 1UNKA 1AYIA 2VLQA 2VLNA 2K5XA 1E0HA 4UHPB 1MZ8A 4F37A 1BXIA 3GKLC 2WPTA 2GZFA 2NO8A 2GZEA 1IMQA 1FR2A 2VLOA 1UJZA 2GYKA 3U43A 3GJNA 2GZGA 2GZIA 5EW5E 2K0DX 2JBGA 1GXHA 1GXGA 1IMPA 4QKOA 2JB0A 7CEIA 1EMVA 1ZNVA 2JAZA 2VLPA
chains in the Genus database with same CATH superfamily
2EFJA 2MVVA 3CCUP 2Z46A 4WYMA 2PEMA 1KLPA 1E6JP 2ROQA 1Z6MA 3G28A 3GJNA 1VQPP 2N6YA 4PWVB 3H0DA 4U0CA 1K8AQ 3CCEP 2FQ2A 2FQ0A 3RG2A 3CMAP 1T8KA 2JGPA 5F2KA 3CD6P 1GPJA 2X2BA 2NO8A 2CNRA 2EHSA 2KG9A 3LMOA 3DS5A 2BHVA 3M1MA 2M8LA 1VQ4P 3MGEA 2L0QA 5KP7B 3G29A 3NTEA 2CWOA 2K94A 2KORA 4GR2A 1QVGO 2JYLA 1M90Q 2LKIA 5F2NA 2N5IA 2GDXA 2VLOA 1UJZA 4COCA 1L0HA 3G71P 1GXHA 3CPWO 4U0FA 2P9XA 3H4EA 7CEIA 2LPKA 5CZDB 1K30A 4COPA 4H2XC 2XV6A 1W2BO 2K92A 2QA4P 4F37A 3GKLC 1Q81Q 3CCVP 2GYKA 4XFZA 1IMPA 2OARA 1YJWP 2JB0A 2KOQA 2L6EA 2ERHA 3GZMA 1ACPA 1QRJA 5BS2A 3CXCO 4NEOA 3CMEP 2FAEA 5HGMA 3E2DA 3CCLP 1ZMBA 3OW2O 2MD9A 2L9FA 1EMVA 2EIAA 1VQ9P 4U0EA 3G1GA 3G26A 1HY8A 5HVCA 3DS3A 2KG6A 2K0YA 5EJDA 1FR2A 2AVAA 2KOOA 1L0IA 4IZ6A 4BPFA 2M8PA 1M74A 5HGOA 3I56P 2PEKA 1D1DA 3G1IA 2LF4A 1DV5A 4PXHB 2GZJA 5KP8B 3CCSP 1KC8Q 2PEJA 2PEIA 2JQ4A 3RG6C 3WBHA 1YI2P 2JU1A 2E1MA 2GZEA 1YHQP 2N50A 3HYBA 3DPHA 5JPAA 2OTJP 1VQNP 3CE7A 2DNWA 2KODA 3DS1A 3CC2P 2LMLA 2FADA 2PEOA 2FQ1A 3CC7P 2K5XA 2GDWA 1F80D 2JU2A 1VQOP 3CCRP 3P05A 1M6EX 2GZGA 1OR5A 1Q82Q 1VQKP 1BAJA 4U0AA 4QKOA 1NJIQ 4IPYA 4PH0A 1AYIA 5HGNA 4PH1A 2EHTA 4XFXA 2KG8A 4XFYA 2MR8A 1Q7YQ 3B5IA 1AUMA 4UHPB 3EJEA 1A8OA 1BXIA 2KWLA 2EG5A 1IMQA 2PENA 1K73Q 2AFEA 4DG9A 2K0DX 1VQ6P 2KW2A 2ONTA 2KGDA 2XT1A 1YJNP 2K93A 3G4SP 2GDYA 1KQSO 1YJ9P 1S72P 3G21A 3B4QA 2VLNA 3CCMP 5F2OA 2XZ1C 1VHNA 2WPTA 2JO0A 1DNYA 2KR5A 4QNBA 2XZ0D 2QNWA 2MY5A 2CG5B 3EJDA 1RO0A 2MVUA 3NY7B 2MF4A 1NQ4A 1UNKA 2VLQA 5HGLA 1VQ8P 2AF8A 2LIUA 3VRLC 2M8NA 2N5HA 4MRTC 4U0BA 5KP6B 2LL8A 1KD1Q 4H2YC 3CCJP 2CGQA 1A43A 1ZNVA 2Z44A 4R0MA 2KGAA 1VQ7P 2FVFA 5I4TG 1HQBA 2LTEA 4XROA 2QEXP 3DS4A 1RO2A 1N8RQ 2PNGA 2GZIA 2PEQA 3G0VA 1YITP 2JAZA 1VKUA 1CEIA 5DCKA 4GR6A 5BS1A 1QVFO 2CQ8A 2N98A 3LRYA 4BPHA 3CCQP 1EOQA 2DGYA 3I55P 1AF8A 4M0IA 2LIWA 2FACA 1X3OA 4CA3A 1JJ2O 5EW5E 2L22A 2FVAA 2LOLA 3DS2A 3EJBA 1M1KQ 3Q20A 3DTJA 2KGCA 4HKGA 1E0HA 1RNIA 2L4BA 2GZFA 2JYGA 2Z45A 2JBGA 2XXMA 1EIAA 2KOSA 5HV8A 1VQLP 2M5RA 2K0XA 4BPGA 1Q86Q 3GZLA 1IUQA 3CC4P 2MR7A 4XRQA 3U43A 2KGEA 2FHSC 2FVEA 2PY8A 2VLPA 1K9MQ 4U0DA 2OTLP 2N6ZA 1VQMP 3DS0A 3G6EP 2KOPA 2BUOA 3HZQA 1MZ8A 1M6NA 2VSQA 4H2WC 1YIJP 1GXGA 1VQ5P 2AFDA 2K2QA 3H47A
chains in the Genus database with same CATH topology
1CEIA 2GZJA 2ERHA 1UNKA 1AYIA 2VLQA 2VLNA 2K5XA 1E0HA 4UHPB 1MZ8A 4F37A 1BXIA 3GKLC 2WPTA 2GZFA 2NO8A 2GZEA 1IMQA 1FR2A 2VLOA 1UJZA 2GYKA 3U43A 3GJNA 2GZGA 2GZIA 5EW5E 2K0DX 2JBGA 1GXHA 1GXGA 1IMPA 4QKOA 2JB0A 7CEIA 1EMVA 1ZNVA 2JAZA 2VLPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CEI A;  2GZJ A;  2ERH A;  1UNK A;  1AYI A;  2VLQ A;  2VLN A;  2K5X A;  1E0H A;  4UHP B;  1MZ8 A;  4F37 A;  1BXI A;  3GKL C;  2WPT A;  2GZF A;  2NO8 A;  2GZE A;  1IMQ A;  1FR2 A;  2VLO A;  1UJZ A;  2GYK A;  3U43 A;  3GJN A;  2GZG A;  2GZI A;  5EW5 E;  2K0D X;  2JBG A;  1GXH A;  1GXG A;  1IMP A;  4QKO A;  2JB0 A;  7CEI A;  1EMV A;  1ZNV A;  2JAZ A;  2VLP A; 
#chains in the Genus database with same CATH topology
 2EFJ A;  2MVV A;  3CCU P;  2Z46 A;  4WYM A;  2PEM A;  1KLP A;  1E6J P;  2ROQ A;  1Z6M A;  3G28 A;  3GJN A;  1VQP P;  2N6Y A;  4PWV B;  3H0D A;  4U0C A;  1K8A Q;  3CCE P;  2FQ2 A;  2FQ0 A;  3RG2 A;  3CMA P;  1T8K A;  2JGP A;  5F2K A;  3CD6 P;  1GPJ A;  2X2B A;  2NO8 A;  2CNR A;  2EHS A;  2KG9 A;  3LMO A;  3DS5 A;  2BHV A;  3M1M A;  2M8L A;  1VQ4 P;  3MGE A;  2L0Q A;  5KP7 B;  3G29 A;  3NTE A;  2CWO A;  2K94 A;  2KOR A;  4GR2 A;  1QVG O;  2JYL A;  1M90 Q;  2LKI A;  5F2N A;  2N5I A;  2GDX A;  2VLO A;  1UJZ A;  4COC A;  1L0H A;  3G71 P;  1GXH A;  3CPW O;  4U0F A;  2P9X A;  3H4E A;  7CEI A;  2LPK A;  5CZD B;  1K30 A;  4COP A;  4H2X C;  2XV6 A;  1W2B O;  2K92 A;  2QA4 P;  4F37 A;  3GKL C;  1Q81 Q;  3CCV P;  2GYK A;  4XFZ A;  1IMP A;  2OAR A;  1YJW P;  2JB0 A;  2KOQ A;  2L6E A;  2ERH A;  3GZM A;  1ACP A;  1QRJ A;  5BS2 A;  3CXC O;  4NEO A;  3CME P;  2FAE A;  5HGM A;  3E2D A;  3CCL P;  1ZMB A;  3OW2 O;  2MD9 A;  2L9F A;  1EMV A;  2EIA A;  1VQ9 P;  4U0E A;  3G1G A;  3G26 A;  1HY8 A;  5HVC A;  3DS3 A;  2KG6 A;  2K0Y A;  5EJD A;  1FR2 A;  2AVA A;  2KOO A;  1L0I A;  4IZ6 A;  4BPF A;  2M8P A;  1M74 A;  5HGO A;  3I56 P;  2PEK A;  1D1D A;  3G1I A;  2LF4 A;  1DV5 A;  4PXH B;  2GZJ A;  5KP8 B;  3CCS P;  1KC8 Q;  2PEJ A;  2PEI A;  2JQ4 A;  3RG6 C;  3WBH A;  1YI2 P;  2JU1 A;  2E1M A;  2GZE A;  1YHQ P;  2N50 A;  3HYB A;  3DPH A;  5JPA A;  2OTJ P;  1VQN P;  3CE7 A;  2DNW A;  2KOD A;  3DS1 A;  3CC2 P;  2LML A;  2FAD A;  2PEO A;  2FQ1 A;  3CC7 P;  2K5X A;  2GDW A;  1F80 D;  2JU2 A;  1VQO P;  3CCR P;  3P05 A;  1M6E X;  2GZG A;  1OR5 A;  1Q82 Q;  1VQK P;  1BAJ A;  4U0A A;  4QKO A;  1NJI Q;  4IPY A;  4PH0 A;  1AYI A;  5HGN A;  4PH1 A;  2EHT A;  4XFX A;  2KG8 A;  4XFY A;  2MR8 A;  1Q7Y Q;  3B5I A;  1AUM A;  4UHP B;  3EJE A;  1A8O A;  1BXI A;  2KWL A;  2EG5 A;  1IMQ A;  2PEN A;  1K73 Q;  2AFE A;  4DG9 A;  2K0D X;  1VQ6 P;  2KW2 A;  2ONT A;  2KGD A;  2XT1 A;  1YJN P;  2K93 A;  3G4S P;  2GDY A;  1KQS O;  1YJ9 P;  1S72 P;  3G21 A;  3B4Q A;  2VLN A;  3CCM P;  5F2O A;  2XZ1 C;  1VHN A;  2WPT A;  2JO0 A;  1DNY A;  2KR5 A;  4QNB A;  2XZ0 D;  2QNW A;  2MY5 A;  2CG5 B;  3EJD A;  1RO0 A;  2MVU A;  3NY7 B;  2MF4 A;  1NQ4 A;  1UNK A;  2VLQ A;  5HGL A;  1VQ8 P;  2AF8 A;  2LIU A;  3VRL C;  2M8N A;  2N5H A;  4MRT C;  4U0B A;  5KP6 B;  2LL8 A;  1KD1 Q;  4H2Y C;  3CCJ P;  2CGQ A;  1A43 A;  1ZNV A;  2Z44 A;  4R0M A;  2KGA A;  1VQ7 P;  2FVF A;  5I4T G;  1HQB A;  2LTE A;  4XRO A;  2QEX P;  3DS4 A;  1RO2 A;  1N8R Q;  2PNG A;  2GZI A;  2PEQ A;  3G0V A;  1YIT P;  2JAZ A;  1VKU A;  1CEI A;  5DCK A;  4GR6 A;  5BS1 A;  1QVF O;  2CQ8 A;  2N98 A;  3LRY A;  4BPH A;  3CCQ P;  1EOQ A;  2DGY A;  3I55 P;  1AF8 A;  4M0I A;  2LIW A;  2FAC A;  1X3O A;  4CA3 A;  1JJ2 O;  5EW5 E;  2L22 A;  2FVA A;  2LOL A;  3DS2 A;  3EJB A;  1M1K Q;  3Q20 A;  3DTJ A;  2KGC A;  4HKG A;  1E0H A;  1RNI A;  2L4B A;  2GZF A;  2JYG A;  2Z45 A;  2JBG A;  2XXM A;  1EIA A;  2KOS A;  5HV8 A;  1VQL P;  2M5R A;  2K0X A;  4BPG A;  1Q86 Q;  3GZL A;  1IUQ A;  3CC4 P;  2MR7 A;  4XRQ A;  3U43 A;  2KGE A;  2FHS C;  2FVE A;  2PY8 A;  2VLP A;  1K9M Q;  4U0D A;  2OTL P;  2N6Z A;  1VQM P;  3DS0 A;  3G6E P;  2KOP A;  2BUO A;  3HZQ A;  1MZ8 A;  1M6N A;  2VSQ A;  4H2W C;  1YIJ P;  1GXG A;  1VQ5 P;  2AFD A;  2K2Q A;  3H47 A; 
#chains in the Genus database with same CATH homology
 1CEI A;  2GZJ A;  2ERH A;  1UNK A;  1AYI A;  2VLQ A;  2VLN A;  2K5X A;  1E0H A;  4UHP B;  1MZ8 A;  4F37 A;  1BXI A;  3GKL C;  2WPT A;  2GZF A;  2NO8 A;  2GZE A;  1IMQ A;  1FR2 A;  2VLO A;  1UJZ A;  2GYK A;  3U43 A;  3GJN A;  2GZG A;  2GZI A;  5EW5 E;  2K0D X;  2JBG A;  1GXH A;  1GXG A;  1IMP A;  4QKO A;  2JB0 A;  7CEI A;  1EMV A;  1ZNV A;  2JAZ A;  2VLP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...