3GKZA

Crystal structures of a therapeutic single chain antibody in complex methamphetamine
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
242
structure length
233
Chain Sequence
EVQLQESGPSLVKPSQTLSLTCSVTGDSVTSGYWSWIRQFPGNKLDYMGYISYRGSTYYNPSLKSRISITRDTSKNQVYLQLKSVSSEDTATYYCSYFDSDDYAMEYWGQGTSVTVSSGGGGSQIVLTQSPAIMSASPGEKVTLTCSASSSVSSSHLYWYQQKPGSSPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAASYFCHQWSSFPFTFGSGTKLEIKRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords anti-methamphetamine single chain Fv
publication title Crystal structures of a therapeutic single chain antibody in complex with two drugs of abuse-Methamphetamine and 3,4-methylenedioxymethamphetamine.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 56
structure length 233
sequence length 242
ec nomenclature
pdb deposition date 2009-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gkzA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gkzA01
2HJKA 5J13C 1C16B 4POZD 4N9OB 4GG6E 2VDML 1A6AA 2M2DA 3GBLA 2DIBA 4WWID 3S37L 3OL2A 2BCKA 4F15B 4L3AA 1AC0A 5F3HA 1FLRL 2VL5A 4I9WD 4POZC 2LE9A 4LGRB 2UUDH 4FFWC 4F37F 1A3RL 1FNEB 1AXSA 1HKLH 5C6TL 4NFBA 3V7AE 1FZOB 1X5HA 1MCCA 5LQBL 2FYYB 1G0DA 4FP8H 4IOSD 5HYJE 2I9LB 5E8EA 2X40A 1BFOB 3DRQB 1J18A 5C0IA 3MLPA 1BBDH 3AROA 3SO3B 1MHPL 3RVXC 1MHEB 3QCUL 1TVHB 4Y8DC 3GM8A 4JZOA 3W39A 1GGYA 5EUOA 2BSSB 5KVGL 3O4LE 4G8GB 4F9LA 5C2UB 5T3XL 1LO5B 4P57B 2DQHL 2X4QB 4EDXB 5GRZA 5E70A 1AO7E 2DQDL 3TA3D 3MBXH 3ARWA 4Y2DB 3IDNB 3PE9A 5C09B 3RJDA 3VFWA 4JN1L 3CLFH 2X4RA 2A6IB 4PGBA 3O6ML 3BT2L 1NPUA 3DO3A 3TIEB 4Q0XH 4RA3A 4Z7QE 2EYTA 2ADJA 4OGAD 5C08B 1H8OA 2JJSC 4I77L 1UENA 4HMDA 4RWYH 4Y5YC 4ONFL 4HKBA 3BHBB 1T1YA 4HHAB 5DUPH 5D9SA 1P1ZB 3HC0B 2DMCA 1A1NB 2FHFA 2Y4SA 4LIQE 1MFDL 3MV7B 43C9B 2VITB 1YEGH 4WEBL 4PJIE 4G6JL 3QCTH 4HLZH 1AQDB 4PJXA 2BVOB 1PYWA 1ZA6B 4Y1AB 1U58A 3VXUA 4M6OL 4H5SA 5DJ6A 3MPCA 3PIQA 3OAZK 4LK4A 4OGYL 3WNMA 4U1NA 1RJYA 3FQWA 3EW3B 3DVGA 5D1QC 4ZO8A 1PEZA 5J7CC 1IARB 3FT3B 5GGSA 3FT2A 5DD3H 5LCVL 5E2VL 3FB8B 5KG9B 2DIAA 1J8HD 4S1SL 4G8FA 2ZSVA 4MZ3A 5J1SC 4F15C 1S3KL 1T03H 2QKIA 1EBPA 1MCNA 4F33B 1KIRB 3QHTC 2NX5A 5DFWH 2HH0H 5F1OB 3WJJA 2EZ0D 2OR9L 1WLHA 5CD5C 3U0PA 1RZFL 5JW4M 1ZVSA 3MUGB 3MRRB 4I8DA 1WBXB 4U6TA 5DK2A 1FSKB 3KVQA 3I3EA 4EQ2A 3E6FB 5E9DA 4ISVB 1FCCA 3PHQB 3U9PL 4G8GD 2G2RA 4LL9A 3SO3C 1T83C 4PRPB 1U91B 2R4RL 1RU9H 3SGKC 2YPLE 4KMLB 5HDBF 2DQUL 3WDHA 1W2KT 4LRIA 5CLWA 3TCXA 5KVMC 3MZGB 4X6EA 4FQIL 1QYGH 4YBQD 2GJ6B 3AGVA 5C08D 5IEKB 3TPUA 3OX8A 4Y2DC 1XT5A 12E8L 1V3LA 4K9EL 3RIAK 5IGXH 1ZHLA 4N0YL 4ZTPH 1OAUH 3VFVB 3QUML 4P2OA 3RWGA 2ITCA 2VKWA 3IDIA 4R9HA 5KTEH 1KPUB 4ZS7H 4CBPA 1WT5A 3WLWD 4K3HA 5CEZE 4LU5H 2X4TA 3RZCB 4LPUA 4LPCA 4Y1AD 1A6TB 4LPVA 3WLWC 2YWZA 2BNRA 2XN9A 2JCCE 2CDFA 4AQOA 4QGTA 1KCRH 3AS0A 3V52L 5DEZA 5F6IB 4JO3L 1CG9B 2AEWA 2GHWB 1MREH 2KPNA 2ATPB 1A7NH 5IUSA 5I16B 3W0WA 3Q2CA 5E8OB 4OZIE 4Y4HA 1BEYH 3S37X 4W6YB 1B2WL 1UVQA 5IJVB 3KPRD 3VFRB 1ZEAH 3DSNA 1JUFB 1NJ9B 3QEHA 3LKSB 1IQWH 3VXSB 2BK8A 2PW2B 2ADIB 4OLVL 4URTB 4TULH 4OZHB 2AJUL 4JPIA 1ZANL 3DBXB 1P9MA 3NN8B 4DUWA 1JP5A 3SE4A 5EO1A 1D5ZA 1S7QA 1S7WB 2HP4A 4KTYA 1FSKC 1NSNL 5J8OA 2MQ0A 5D8JH 1A3QA 1AY1H 4PJ5A 3MRHB 3QEGH 4WI8A 5D5ME 2GJ6D 5IV2B 1Y6MR 4KXZH 2Q6WB 3UTSB 2B0SL 3P9MA 4LLYA 3NCFB 1XCTB 3GJFB 2YD8A 1NFDF 4O9HL 5D7IE 5F7LB 5GXBB 4PRIA 5KOVC 4MB3A 5FA4B 1FE8H 5E2TL 4APQB 2G9HA 3RZCD 4OFPA 5I1CH 1OW0A 5IHZB 1U3YA 5F9JB 3LKOB 2YEZB 5IG7A 4PFEA 4JO2L 5B39G 4QGYA 4D3CH 1IKNC 3QQ4A 4AL8H 1TMCB 1CFQA 2IMNA 3HAEA 5EOQL 3IDMA 4OT1L 3BDYH 4XGZA 1PZUB 4KHXH 3AXLB 1TJIL 3BEWA 4HLZG 4D8PA 4OIAA 1RD6A 5F6IC 4DTGL 1JGLL 2VL4A 4U1SB 5FYJD 2DQTL 3T0XA 1Q0XH 2PYFB 3RP1A 4LDLB 3KDMA 2H6PA 4C58B 4KPHH 1M6OA 3KPPA 3WXWL 1GH7A 1NGPH 3QEUA 5FM5O 4TSCH 3UTTD 4ZFFB 1FNGB 2FO4A 3NCYS 5T33L 5C0CE 3X12B 4K55A 4PJFF 3GGWA 1A1OB 4FTVA 4MA3A 3O6FB 1OSPL 1YPZA 1TZHA 1T4KB 4CADA 2IPTH 4NKQB 1LP9F 4M02A 5HI4C 3UTOA 4IRSA 5D2NB 5EWIL 1NL0H 2X4OB 1PG7W 3H3PL 2JTDA 2A83A 3MTRA 5JA8B 3MV8B 4FZ8L 4N0UA 5L2JB 5DQDL 4ODWB 3UTZB 3L7EA 4J3TA 1B4JL 3U79A 5M7QA 3O2VH 1HWHB 4NGHH 4JRYE 3UJJL 1A9BB 2C3HA 1I8IB 2QADB 1OGAA 4PJAE 4NQDD 4APQD 5M95B 4RQQB 3S5LA 5E94B 4TNWK 1TTUA 4XNMB 1JF1B 2VISB 2ZCKL 5KW9L 5C0DA 3FB6A 1N4XL 3KPSA 4NNPH 5BMFH 3NZ8B 5CP3A 5EC1A 4ODVH 4R8WL 1J0YA 3V7MA 1OTSC 1YMHA 3EYSL 2HKHH 4X5WA 1QLRA 4EVNB 3RGHA 4FQ2L 1BZQK 2QSCL 3BH9A 1RAMA 1N7MH 3I9GL 5EZJA 2NTFB 3HKFA 5GRUL 3HE6B 5DRNB 2JJSA 3SKOB 4Y5YA 1ZK9A 1J10A 3SE8H 5E00B 1DFBL 3MRNA 2CIKB 2V7NA 3RUGF 3TVMA 1G7PB 5FM5M 5B3NA 4HJ0C 2DS4A 4WFEE 4LHQB 2FLRT 4NZRL 3O6FD 1AC6A 1WJ3A 4PUBL 5JHDE 4XXCC 1MUJB 4JHWH 4ZFOA 4K3EL 4AENB 2MWCA 1MLCA 5EU7C 1HCVA 2F58L 5DYOA 5JO5A 3B8SA 3O6FC 4O2FB 4PRHB 3ZE0F 5D1QA 1UWGH 3MLYH 3TNNB 5I8EA 2D03H 4RFEB 2NLJA 5D2NC 5LGHH 4BZ1L 5KS9E 2V6HA 5B38B 5C70A 2QADD 1H3PH 2V5YA 1DSFL 3O3EB 3ULUF 1QP1A 2XRAL 4ZUSB 2WBKA 4XPTH 4KWUA 3O6LH 2YD1A 2CK2A 3KWWB 3E3QC 1J11A 5I75B 1ZGLM 2QADC 3W2DL 4XB7A 1IM9D 3JWDC 3ARRA 1TFHA 4DZBA 4PJ8B 1BF8A 4JFZL 1CU4L 2FYYA 3RY4A 5BV7B 1UZ6F 1C5DB 1KCUH 1BFOA 4M6NL 3DRQA 3O2DA 4JANA 3KPMA 1UH4A 3RHWK 1HSAB 4HWUA 1T83A 1Q9KB 1FPTH 1QA9A 1MHEA 1TVHA 1X5FA 3SGKA 2XZQL 5F7HA 2MNUA 4LSPH 2BSSA 3ZSTA 4X4MA 5IK3B 4Y8AA 4G8GA 4WI2A 1JNHB 4FQJH 1LO5A 1T89C 4P57A 4ORZC 1G6RB 3O3UN 2X4QA 1J1OH 4XP5H 1Q1JL 5H8DA 4Y2DA 1FNSL 5C09A 3C5JB 4OGXL 2Y06H 4TQEH 4BFEA 4E9LA 4YC2C 4YXKL 4UTBL 4ZTOL 2V9RA 5CBEB 3GKWH 3HE6C 4HJJL 5CGMA 4MHHG 5EC2A 5F1SA 3K2UH 1Y18A 3LH2L 4HUWB 3SKMB 5GHWH 1KJ2H 4HHAA 1P1ZA 3HC0A 4YEFA 3ELAT 4KVCH 4KKBC 1UM5H 4Q9CA 4ZNEA 1KN4H 3GRWL 3MV7A 3PQYB 2DMBA 2YD6A 1M4KA 1WFTA 3SE9H 2VITA 4PRHD 1JWSB 2DAVA 2W1NA 1AQDA 5DRXB 1UG9A 4A6YL 1MSPA 2BVOA 1QEWB 1ZA6A 3C60A 4GO6B 4LEXH 4DGVL 2VDRL 2D7MA 3MRQB 2EIDA 4S11A 2YWYA 1HHKA 2GK2A 3WFDH 3MYJB 1V8HA 3FT3A 3TH3T 4JB9L 2WNGA 1T22B 3FB8A 4M03A 1MCWW 3OKOB 1A4KB 4JKMA 1HCFX 3VWJB 2W91A 1VGEL 1I3GH 3L5JA 1I9RH 2R69H 4PJ8D 5CSGA 2EE9A 5ERWB 5GGRY 5ABDE 1JYVA 1T7XA 4KV5F 1OGTB 4RAVB 2UWEE 5I75C 1U41A 1KIRA 1MWAB 2DOCA 5GS0D 1GIGH 3H9YA 3QUXB 4GXUN 1L7IL 5FAAA 3AS2A 1ACZA 5BV7C 3MUGA 3MRRA 1WBXA 5FYKH 3QSKB 3FZUC 3E6FA 4FXGB 4ISVA 1PSKH 4JRXD 1YMME 2X10A 4KI5E 4LQFH 5D7JA 5HHOE 5GS0C 3QXDB 4PTUB 1QSZA 1F3DH 1JNLL 4PRPA 1EGJA 1T80A 1U91A 1A6VL 2FECI 2R0WH 1A7QL 4Z7UA 4XVJL 4DUXA 3ULVE 1X4ZA 4LLMB 3L5IA 2EDDA 1U6AH 4RMSA 1RMFH 1AE6L 2NY0B 4MX7B 2GJ6A 5IEKA 2VE6B 3T0WA 3VFVA 3E6HB 5SWSE 5A1AA 3BOVA 2EIZB 1CVSC 5D7KE 1KPUA 3P4NA 2GITA 1PLGH 1S7XB 3MXWH 3GK8L 1F4WH 1GOGA 5AD0A 1I9IH 2AEQH 4FQQB 3JUZA 4QLRA 5FB8A 1A6TA 4PB0L 2Z92B 3VXUE 2P8LB 4DVRL 3QRGL 1RZJL 3WE6A 2X05A 4ZYKB 4QOKD 2A0LD 3WS3B 1K8IA 4FS0A 3T0DA 4HT1H 5EORL 2KZWA 2OTPA 1R0AL 2VZSA 4FG6D 4XAWL 1A6UL 1GGCH 2ATPA 3DV6A 3QUYB 3VWJD 2D2OA 1LE5B 1MAML 3VGAB 2CLRB 5E8OA 1G6VK 4YE4L 1IQDB 2HFGH 5IJVA 3VFRA 3ARVA 1BFSA 5IVZA 1PY4A 3VWJC 3EJYC 4S0SD 4AIOA 2PTVA 3N50A 4G9DB 1MCQA 3HAEG 1JPST 1RFDH 3MACH 3A6BL 3VXSA 4OD1L 2PW2A 2ADIA 5DHYB 3HCVB 4LLUA 3QUXC 1T7YA 4TOYH 5I2IA 1S7WA 2YPKB 3GBNH 1SHMA 3D3VD 4RIRB 1F97A 1CGTA 2RFXA 3O3DA 5CJQH 3JSSA 2NY0D 3WIHA 3MRHA 2Q6WA 3UTSA 4W70A 3QNXB 3KYAA 3DV4B 1GGUA 5KZCD 1MFCH 4JEGB 2MMXA 2NY0C 5MEQB 1XCTA 3NCEB 5E6ID 3N1FC 5FA4A 2Q20A 4XI5D 4OQTH 4O02L 4PJ7B 5FIEA 1RURL 5IHZA 4WTZA 4NN6B 5EBWA 3IJHB 5F9JA 4EI6B 3LKOA 4P9HH 2E5EA 2YEZA 3FB5B 4R7DB 3CH8A 2IQAA 3OAZH 4P49A 4PRAB 2RCSH 1CDBA 1CL7H 1T1XB 5FCUH 5I1JH 5LXGL 3TGXA 4BSWB 4X4YA 2DQCH 3AXLA 4O00A 4WGWB 3TLRA 3HTLX 3QUYD 3QPQD 3S5LG 2QSVA 1E6OL 5FGRA 1MQ8A 1VFMA 4G8EA 4WCYL 5HHVL 2KBGA 1HILA 1UC6A 4U1SA 2Q3ZA 2Y23A 2XPGB 3QPQC 2PYFA 4C54A 1ZTXL 3IGAB 3LQMA 3VGAC 2VLKB 1EGJH 5GGRB 2BNQD 3GI8H 2I60H 5ESAB 4P48A 5F7KC 3HUJB 2P8MB 1FNGA 5BVJB 5CJ5A 3EAKA 4O2CB 3TBYA 3X12A 3QDAA 4G9FB 2VDLH 3L9RA 2UY7A 9CGTA 3O6FA 4EEEA 1T4KA 4PJCA 3B43A 1HH9B 5EULV 5D2NA 3DTXB 4NSKA 1M7DB 3WFCH 4S1RH 3EOAB 1MI5D 3MV8A 3L7FB 5L2JA 1IGMH 4ODWA 2AQ2A 4XC1L 3UTZA 5C07B 4I4WB 4NC0B 3V2AR 3O3BB 5GS2H 5J1AA 3EOYG 3MNVB 1U93A 5DI8B 1B0RA 4M4RA 2DLFH 1UKSA 1CE1L 4XNMA 3ARZA 1JF1A 4XWOD 2VISA 1OAKL 2PKDA 3O6KH 2YKLH 1KPRB 1L7TL 4R4FL 5C9JB 4XCFH 3WNNA 5I18H 3O45B 4HS6B 4NN6C 4XWOC 3RVWC 3NZ8A 4XNQB 4I5BB 3MUHL 1H3TA 3F7YB 3QEQB 4UT6H 1RUMH 4MDIB 4UU9B 3T3PE 4EDWH 5L2KD 2A9MH 2HFTA 1T89A 2H8PA 1L0XA 4PGCB 1BHGA 2VDQH 1HYSD 3SE3A 1TENA 3L6FA 3QISA 1FO0L 4AQ1B 2OTUB 3HNVH 2NTFA 5BXFB 5F3BB 1MFAH 2P5EB 3HE6A 4PRBB 5DRNA 5DZNA 3PDOB 3SKOA 2XQYK 4GRWB 4R2GB 4XAKE 5E00A 4JQIH 3F7QA 2CIKA 3GSXB 3CSBA 2FBOJ 1FNFA 3WIHH 1G7PA 3LCYA 1OLLA 1XGRB 4WTWA 2V9QA 5D2LB 2W9EH 1EO5A 1EHXA 1MUJA 4D9LL 1T2JA 2Z8WC 1FBIL 4F57L 1K3ZA 4RMRA 4CL7A 4MA7H 4L29A 1P2CA 4JHAL 5LJYH 2W0FB 3CX5J 2R8SH 1E28B 4J4PD 2AJZB 1CXEA 3TNNA 2DDQL 3GIZL 5KSVB 4RFEA 1WIOA 4C57C 4ODUB 4HIJA 3EIFA 4ODHH 2HN7B 3G5VB 3L1OH 2X5PA 2YSSB 4GW1A 3LIZL 3O3EA 3QDMA 4J4PC 1KLUB 4ZUSA 2PUQT 3KWWA 1JHKL 5DD6B 5BVPL 2QV2A 3FJTA 4OCYH 2FGWH 4I9WE 4PJ9D 3UBXA 1HHIB 1I3UA 4BQ8A 2VJXA 4YK4B 4NQSB 1C5DA 1X6NA 4JFYB 4TVPE 4GLRH 1XMWA 1AH1A 4M61A 5C0BD 4L8SB 3V0WL 5GIRA 3V5HB 1NCUA 5JPMB 3MQIA 5F9WB 2EH8H 2DYPB 1U3ZA 1Q9KA 5DR5H 1WFNA 1MCFA 1EMTL 5AYQA 1AD9A 1BM3L 5GJTL 5IK3A 4QWWD 3B2VH 1E4KA 1G6RA 3MRCB 3DOSA 5DHXB 32C2B 1XF5B 4R2GD 3C5JA 4QWWC 5D96B 3EYUH 4NJAH 4X6BB 3ZL4L 2VZVA 5CBEA 3GNML 1D6EB 4NM8L 2YA1A 2HAZA 4IOIB 3STBA 1CLCA 3DYMA 4HUWA 4R2GC 5F7WC 4HFUL 2BY3A 5TF1H 3SKMA 5HSFA 1F4YL 4LPTA 2PXYB 3WHE1 1JZ5A 2JB5L 4E0RB 1NC4B 5DSCB 3QNZA 4ERSH 3PQYA 4RAHA 4CUCA 4L4VD 1JWSA 4OTXH 2AI0H 3JWDH 4YZFF 5DRXA 5DMIL 3MRQA 2YHGA 1LK2B 1GAFL 1QHOA 4LSDA 2LU7A 4PV9B 2ICEB 3MYJA 3CLEH 3N1MC 4H88H 2O5YL 1KTRL 4ZO6A 5GRVK 1P4BL 1Q94A 1T22A 3OKOA 1NMBL 4ODBD 3FL7A 3VWJA 2XY1A 3REVB 5KANI 1J8HE 4D9QD 1IGIH 5ERWA 3HMXA 1WK0A 3DX9B 1YEIH 1OGTA 4RAVA 1IBGL 3ARQA 4NNXA 1MWAA 2JKXA 3QUXA 2DYPD 1IAMA 4YK4C 3C5SB 3LPWA 2DQJH 4U1JB 2AKRA 4BM7A 5AYUH 1MJUH 4FXGA 4L8SC 3QXDA 4G8GE 5ILTL 5F9WC 2GJZA 1A1MA 1FL3B 2AXHA 2R9HD 3LKQA 3T0BA 5BO1L 1I1AB 4HUNB 3HZYA 5FM8A 3OV6A 4ZD3H 4LCUB 4LLMA 4ZOCA 5IVXA 5IB1B 1FAIL 4MXQD 5IEHB 4BQ6A 2YUVA 3QYCA 1ZSDB 1QOKA 4MX7A 4OCRL 4WU5B 5C08E 4LEOA 3KJ6H 2VE6A 3FN0L 1H0DA 4UIMA 1MNUH 2W59A 4MS8D 5D96C 4JO4H 2EIZA 3BP4B 3BEVB 2FX7H 2I07A 1BX2A 5LVEA 2X9WA 4EUPH 4XXDB 4HS8H 5D1XB 1S7XA 4YFEA 4IS6B 1T5XA 3OXSB 3ZKXB 5E8PB 4CVZA 2HT4C 1Z2KA 2PXYC 3ZHLA 5C0FB 1FRGH 4Y1AE 2P8LA 1B6UA 4ZYKA 3WS3A 4P0DA 4I0PC 4HH9B 4TVSa 1MJ8L 1MHCB 3OB0K 4LCIL 3MX0A 1OT1A 1NGWB 4S0TD 1CGYA 1F90H 2YD9A 1ZT7B 4QT5B 1LE5A 1OPGH 4WTZG 2CLRA 1VERA 2BX5A 1IQDA 3F12B 4UT7L 1KBGL 5E03A 5T5NF 3KPRE 3QZWB 1NMAH 3CVHL 4QNPF 4NKOB 2G60H 1XGYH 1MF2L 1OAZL 4MNQA 1ZLWK 5TE7L 3HN3A 3HCVA 2X44D 3LKNA 4NJ9H 4PTTB 3MZTA 4DGYL 1N26A 3NZHL 1KJMB 2YPKA 1GGIL 3NCMA 1I1AD 4GAFB 5L8LB 4CU7A 5J9PB 5T3ZH 1M7IA 3VRJB 1YQVL 2DN7A 4LSRL 5F8RC 1FH5L 5JHLL 5K9QG 2GJ6E 3SDCD 1I1AC 1C1EL 1SEBB 2ZNXA 3PWPB 3QNXA 2H2SD 3DV4A 3F65A 5J12B 4LOUC 1GPOL 1HXYA 3SDYH 5MEQA 3U83A 5IB2B 3O0RH 3NIDF 4JHZA 2J8UE 1KB9K 5DURB 2P42B 3CFDB 4DEPB 4TPRL 3GMPB 4M8QB 3FTGB 3HNTH 4PJ7A 4JPWL 2BXYA 5IW6B 1BD2A 3X13B 1DEEA 4HF5L 5D1XC 3STZB 4JO1L 2FL5A 3FB5A 1TETH 4JM4H 4R7DA 3ZKXC 1AR1D 5F6HI 3OF6A 4ZXBB 4PRAA 5EUOF 1IRAY 1I1YB 3HMXH 1QLFB 3CDYA 2BRQA 4DQOL 2OYPA 4PJDE 4ODTL 3V5DB 2X2YA 5ICYB 4ZUUB 1KIQB 2Z91B 1MWAH 4BSWA 4UQ3B 1J1XL 4MJ5A 5ADPL 1GZPB 2ZG2A 1VEOA 4JPVL 1AR1C 3P2TA 1TQBB 5C2BL 5F7NC 3BJ91 3OJDB 3ZTJH 4HUVB 3WKNA 4OKVB 1YC8A 4OZGB 3WO3B 4RCAA 5FYJE 3MJ9L 4XCCH 2Q8AH 3IGAA 3QDGA 4XPFL 1BFTA 2VLKA 1RZ7L 1V7NH 1YNTB 1Q72H 1P6AB 5ESAA 1IAIM 3N9GL 3HUJA 2P8MA 3SCMB 3MLWL 1CZ8L 3UTTE 5BVJA 4OZHE 5EN2B 4G9FA 4F3FB 2N7BA 3ORJA 1HZHL 1F4HA 4H26B 5C9KA 3S35L 1ORQA 4NWTH 1HH9A 4OLUL 3NBNA 3DTXA 4NRZA 1M7DA 3CSYA 1NGXB 4L3CA 3EOAA 4YHNB 3QXAA 3QXTA 1BGXL 1ZLVK 4I0CC 4NO0B 1X5KA 4J4PA 5KVFH 4UDTB 5C07A 4ODSL 3TYGH 1I9JL 5CSBA 3O3BA 3D5OF 5GISL 3ZT5A 3MNVA 4MLIA 5J12C 4NQDE 3RU8L 3IKKA 5GS1B 4YO0B 1Z3GH 1FVDA 1BOYA 2C4XA 3ZT7A 3OPZH 4G6FD 5LGKA 5C9JA 4ZXBD 1CFVL 4L8DB 1F8TH 3M17B 2VC2H 3O45A 4HS6A 1OAYH 4XNQA 4OJFH 1IC5L 2APXA 2VWEC 3QEQA 4L8CB 4MDIA 3BPOB 1UWXH 4GKNB 4UU9A 4ZXBC 3TJEL 5E08L 3BGFC 4PGCA 3VG0H 1W72L 4LNRB 2V17L 3VRLE 3GHBL 3UBXG 2UZIH 2GYSA 1JRHH 2PYED 2HTLD 4RISL 4UZGA 4AEHL 3JWNC 1TQBC 2A1WH 2OTUA 5BXFA 2OJEB 5T1MB 3VFUA 5F3BA 1F42A 2P5EA 4PRBA 4F58L 5C0NC 3DO7B 5GJSH 3WS6C 3PDOA 3C87A 2HTKD 3EZJB 3NA9L 2P46B 4IEFB 5IB4A 1P7QA 1ZV5A 4OCSH 4HKXB 2QJDA 3N85H 3FFCB 4RGOL 5I19H 5F7EL 3LRGA 4GKZB 1XGRA 1AD0B 4Z78B 5D2LA 5IOPB 3SCMC 1XAUA 2KQMA 1UCBH 3C6LB 5A40E 1Z5LA 2GEEA 2AW2A 2J5LB 3L5XL 1EHAA 5EBLB 3ZKMC 5CWSA 1MFNA 2A9NH 3MV9D 3IB4A 2W0FA 1E28A 3AC0A 4PD4K 4ELMA 2AJZA 1UH2A 4JG0H 1ADQL 4OAWB 2ZCHL 4EXPX 1UQSB 4WEUD 1KCVL 4M3KB 2HN7A 4FXLA 4HZLB 4YFDB 3MA7B 2NY4B 4K71B 4KK9C 2Q86B 5HHPB 3U4AA 3BP7A 5DD6A 3FO1B 1KPVB 3WKML 4WUKH 3UCRA 1LQSR 4HKJB 4U33A 3THMH 3GSRB 1HHIA 3QIBD 4IM8A 2AK1H 4OCMC 4O58L 5GS1C 2D9QB 4HXBH 5I8CB 3H3BC 3UPAA 3HB3D 1KFAL 1RVFL 1Z0MA 2EDYA 3V5HA 5JPMA 2X7LB 2HMID 3CFEB 1HDMB 1WC7A 4LMQI 3QP3A 1M1SA 3BKML 3P30H 4D0BB 4LIQL 4NOFA 1MPAH 3TV3H 5TE6H 4DJMA 3NIFF 2WZPD 2MKLC 32C2A 3RGVC 3BD3A 4NN5B 1XEDA 2JJVA 3SOBL 2Y07L 1R3LB 4JY5L 3ARUA 5CZVL 1E4XH 3MOBH 4X6BA 1I8KB 1BPVA 1D6EA 4E41B 1JGDB 4ETQB 1EH9A 5FECA 1OOAA 4JFQB 3MA9L 1U8KB 4LASH 5J06A 3NAAH 2PXYA 4E0RA 1NC4A 4Y4FB 3F7VB 3T2QA 4GQ9L 5F89B 2E9BA 3ULVH 1UACH 4PRHE 2AQ1A 1NCDH 2NZIA 3C6LC 4I0PA 1WCBB 4JM2F 4NOBA 1P4LA 2J5LC 4Z7VF 5K9KB 4DGIH 3IDXL 3T4AB 4C83B 4S1QH 1RZKC 1LK2A 1G0XA 3DVFA 3LQZB 4KH2A 5TDNB 4DW2H 2XZCL 2AV7B 2ICEA 5FYLD 4YGAB 1KCSH 3EFFA 3WFBL 1UKTA 2B4CC 1FNAA 2GUOA 2AJVL 2NY4C 5GGVL 5I8KL 3REVA 4WY7L 3DX9A 5TFSH 4YX2L 2WBJA 1LDPL 1AXIB 1N8ZB 4OM1H 4U31A 3B4NA 5CLTA 25C8H 5IIEA 3CDFA 1Q0YH 1YPZF 4JR9L 3OTTA 3AAZB 5C6PB 4U1JA 2W38A 4NCC1 4GAGH 4QRRD 1GGTA 2FX8L 2R1XB 4JRXE 2E7LC 3QHZH 3MLZL 1I4FA 2QTEA 5CEZL 4RGNB 2X4NB 2EDKA 4KMTH 4AK1A 5J0BA 2ICWI 5HHXH 3L3GB 1I1AA 4QXWA 3SGEI 3ZE2E 3SKNA 4XPBL 4LCUA 4NIKB 2OTWB 4LQ1A 4XPGH 4EBQL 1ZSDA 3C8DA 4WU5A 4E41D 1F00I 4NN5C 2CPCA 1HQRA 5IKCB 1A3LL 3T2PA 4QXUL 1URLA 4TUJB 1NLDH 3BE1L 5E0QA 3BP4A 2Q7YB 1GGBH 5SWZB 1PQZB 2D9CA 3GJEB 4Y4FD 3CDCA 4XXDA 5E4EB 3V9FA 3S3SA 5D1XA 2QL1A 3O4OB 1JVKA 3VU2A 3W81A 2FSEB 2MTPA 2E9WA 5E8PA 5ANMB 4NKDB 4NWUH 1XZ0B 3RBSA 2B20A 4WWKB 2YZ8A 2A73B 5C0FA 5DUMH 4Y4FC 3NIGE 5BZDB 1JGVL 2BVQB 4QOKE 5ITBH 5CS7A 1MHCA 3T0EB 1NGWA 1DQML 1KELL 4Z7NE 2C4FT 4CDGC 2VR9A 4CVXB 4HUMB 4OV6F 4WI6A 1HN1A 4KQ3H 1J05B 2N4IA 3KR3H 5IQ9B 1R5WA 1FZJB 3F12A 5F7FA 3EFDH 5MENB 4K8RL 5IR1B 3V6FA 3G5ZB 4HJGB 3QZWA 3IFLL 4M5ZL 4NKMB 1HH6B 1RK0B 3H9HA 3RBGA 2WP3O 1DE4B 3P0GB 4P2RB 3FQTB 5ADOL 1EDQA 2HFEB 2HJLA 1QFWH 3GSNB 3MFFB 4PTTA 2NXZB 2DKSA 4RGND 4PG2C 2EKSB 4E5XA 4K3JL 2CXGA 5CJXC 3LEXB 1X5AA 4TTGA 4KC3B 1JTOA 1CXKA 1JMXA 2ED8A 3D3VE 4OLXH 4Q58C 5TPWL 5TQ0H 5J9PA 3WCYA 3ARBB 5L88L 4G6AD 3VRJA 4KZDL 5DJ0B 1R3KA 3A6CL 4RGNC 3PDDA 5D7LA 2NY6B 3PWPA 5F9AC 1CT8A 1MQKH 3RIFK 3MRGB 2DQEL 4KRNA 5KSBA 3IAQA 5SWZD 3DVNA 5IB2A 2XNAB 3WFEH 4XNYL 4NCDA 1AGBA 2APWA 1QD0A 3WD5H 2FGZA 4CN6A 3GMPA 3TJHC 2RR3A 1Y6KR 4WWKD 4U2YA 3NFSH 4HFWB 5IW6A 5E4EC 3N1GC 3X13A 3STZA 5I17A 2XQBH 3O4OC 5JMRA 4ZXBA 2VB5A 4WWKC 1QLFA 1QSEB 3GMMB 3OSKA 4Z7OE 5ICYA 4K94H 1KIQA 1MAJA 1BVLB 2Z91A 4UQ3A 1GZPA 5FO7A 1GCFA 4K23H 5ISZD 1IM3B 2O5ZL 2P7TB 3LV3B 3T0EC 1AKJA 4Y19D 4HUVA 2ESVB 3OJDA 1FL6A 5MEND 5D7SL 3WS6A 3ME0A 2ZUXA 4OZGA 4WI9A 3BGAA 3VXPB 1VHPA 3CH1A 3MJ6A 3SJVB 5EIQA 4AMKL 1YNTA 2D4DA 4FQCH 2OR8A 2IH3B 1CF8L 2BNQE 5FUZL 3INUL 3SCMA 4D0DA 2L4OA 1NFKA 1MCOL 3GSOB 3VI4F 4RMTA 5EN2A 1KLFA 1MLBB 4NQUA 5K59F 2R2HB 5HI5D 4YHPB 3ARBD 4L4TD 2NXZC 1OD9A 1BVKA 3QXUA 3EYVA 3QG7L 2ADFL 1NGXA 2NY6D 2BHYA 4X99A 4YHNA 2FEEI 3CMOH 5HI5C 5DQ9A 5KAQG 4X6DE 3ARBC 4NO0A 2X70B 4UDTA 3LPGA 1MRDH 1VFUA 1KCLA 1N5AA 1IEAA 3T77B 3MRBB 2NY6C 4N8CH 5F7YC 4ZAKA 1UB6B 1QBMH 3PG2A 2BNUB 4ZS6D 2OXHA 1U95B 4AT6A 1AGEB 1JF5A 3K81A 1J12A 4YO0A 1DN2A 3JBG7 2ZNWA 4KGJA 1YEJL 3TBVA 4LAQL 2CUIA 5DJ8B 3ARDB 4ZS6C 3M17A 1QSED 1NFDB 3C9NB 1OF2B 2RBLA 3JTTB 1X5ZA 2J12B 4PJGF 2OL3B 2NY2D 5HVFB 4L8CA 5KVEH 3CZFB 3KYKL 4GKNA 1DUYB 3QCVH 4LKXA 1N6QH 5E8DL 3IDYB 5L2KE 3K0WA 4HCRA 1WIPA 3IF1B 3NACL 4LFHG 4LNRA 3RGVA 4G6KH 1Q9WB 3BDXA 5IMOB 2BC4B 2QQLL 4X6CF 4NM4H 3U4BH 3SJVD 1QFPA 3CUPB 4RWYL 5T1MA 2D7OA 5E5MB 3QG6B 4O51B 5E2JA 2NNAB 5DEGB 1KB9J 1MIML 4R97B 2F74B 1GZQB 1QPPA 3O8XB 4HKXA 4YHIB 4YWGH 1ZLWH 2Z8RA 3FFCA 2DICA 4GKZA 3RIAF 4HZAA 1AD0A 4Z78A 5IOPA 4NYLB 5LAXA 1T20B 3C6LA 3NFNB 1RIVH 4ZFZB 4DCQB 1I85A 2MFNA 4MD5A 5HGDB 3R8BB 4JE4B 1T6VN 1BIHA 4MB4A 1L9MA 3UDWC 1YJDH 4FABH 4QXTB 4QRUB 4OAWA 5HYIA 3X3FH 1A2YB 1UQSA 4WHYG 2IPUG 4AEEA 1CLYH 1X5XA 3MA7A 4MXWL 4GG6F 3HI1B 3DLQR 5IBTL 2Q86A 3CFKB 2EE3A 4ZOEA 1RJZA 4WO4A 3FO1A 3IRZA 4OIIL 1KPVA 3D2UD 1S9YA 5CEYA 4HKJA 4XNXH 4R7NB 1IAIL 4HQQH 1X44A 4FQXD 5DVKA 5I8CA 4NRXB 4FFYH 2JE8A 2VLMD 4Q9RL 1C5BL 5C0BE 1LEGA 4JFFD 3OAUL 5I71B 5DJ2B 2E7LA 1RU9L 3ARDC 5I1HH 4OZFA 2ZUYA 4XP6L 1L6ZA 1OWRM 1HDMA 1S7RB 4KVNL 4XZUA 4BZ2L 3KLHD 5D72H 4XC3L 1HIMH 3MGTB 1QYGL 4D0BA 1ZLSH 1WIUA 3FMGL 2VDKH 1KF9B 1GVIA 4P46B 1OAUL 1N2RB 3KLHC 2NZ9D 4Y4KB 5I1DA 4UV7L 3G6DH 5DRWB 2PO6B 2R0KH 5JMOC 1F4XL 3O8XD 1GC1C 1E6JL 4YHML 1I8KA 4WUUA 1ED3B 2E9JA 4Z7QF 1RUAH 3BW9B 4KJWD 3V0VB 1N64L 1U8KA 3RWDB 4R97C 2CUMA 4HSQA 3O8XC 1UM4L 2QQKH 4KZEH 4PREB 5JORB 4Y4FA 5CJOL 4G7YL 1NEUA 4LVEA 2PN5A 4ZUTB 4L4VE 3LEYH 1WCBA 4PJIF 2FBJH 3OR6B 4KY1H 3RUGB 3QDJB 1ZLVH 1IKFL 1AIFB 1J86A 4I3RH 4XCNA 5EU5A 4ZG1A 1INDL 5IM7B 4P3CH 5EIIB 3T4AA 4C83A 4H8WH 3ZKNC 4V2BA 3ARFD 5TDNA 2F54B 4HK3J 2MQCA 1QSVA 2AV7A 2YUWA 1QVOB 4YR6B 1SYSB 4XBEH 1B0WA 1INEL 2HRLA 3FRPA 3BQUD 4HWNA 4KXZI 4A2LA 3QHFL 1KB5L 3EYFB 4D9QE 4MGXA 4TUKL 3H9SB 3NCJL 3KXFA 4HCRH 1TDQA 5A2JH 3T65B 1N8ZA 4PYGA 1TITA 4V2CB 3TNMA 1XCQB 4FQLL 2FEDD 3AAZA 2ED9A 4JY6B 4YAQA 1G9NL 5D8JL 5CJXA 2FATH 2R2EB 1U8MB 2R1XA 4PJBE 3RL2B 3CK0L 4PD4J 3TWCH 4BH8B 1DBBL 2X1PA 4M00A 3O81A 1AFVL 3SDAA 1WZ1L 1ZS8A 3LRSB 5SX4H 4Y4KD 3QZWG 3TN0B 2WLYA 3UMTA 2OTWA 5D4QA 5B8CB 2CJUH 1T7WA 1A6WH 2VOTA 4P46C 2NXYB 2CRZA 4Y4KC 3U82B 1RZKH 5IKCA 4MHHI 4TUJA 2AQ3A 2DI9A 1DVFA 5C86A 2PO6C 4ONGL 2Q7YA 1PQZA 3NABL 1JNNH 4D3CL 4OFYD 4L4JA 4TNWF 2VH5H 1JWMA 1HK6A 1XZ0A 2XY2A 2NY7H 2XXMB 4X7CC 3LKPB 2CGRH 5I1IH 2BVQA 3BSZL 3H7BB 1NGZB 2F54D 2IFFH 2MCPH 2YA2A 5DK0B 3VXNA 4MA1B 3T0EA 4NO5B 1YY8B 1U2CA 4JKKA 2HT3D 1DLFL 1NMCB 4YHLH 4CVXA 1ND0B 5I30H 2OCFD 2EDFA 1KENH 1G1CA 4OZFH 4Y5XA 5IQ9A 1FZJA 4TSCL 1FDLL 5GRJH 3G5ZA 4HJGA 3W5MA 4IRJB 3G5YB 4NKMA 1HH6A 3DUSA 3TIDB 3M07A 3WO4B 1RK0A 2CUHA 4XHJD 1UCTA 1DQJA 4P2RA 1ZWIA 1S7TB 3FQTA 5HJ3B 3WLBB 3HZVB 3U9UB 2HFEA 1RUPL 3FRUA 5I0DA 3GSNA 2OZ4H 1LO0H 4PY8J 3ULUC 3VFGH 4XCEB 3T8XB 3HG1A 4YJZL 4NQTA 2ZJSL 5H35A 3LEXA 4S1DD 4IDJH 1IAOA 3MRDB 3ARBA 4IMLA 3OXRB 3OZ9H 4WV1B 2F5BH 3QWOA 4NQCB 4KHTH 1SVCP 2NXYD 5D5MF 1IGYA 4IJ3B 3TN0C 3BPNB 3MRGA 3HE7B 5B8CC 4X7DC 4LDEB 5T5FH 3BAEL 1TCRB 5D7IF 4HAFA 4TN9A 5GRXG 1YY9C 4RAUA 4GRLD 1BLNB 4ODVL 5DO2D 1RZGB 3DIFB 4HFWA 3H42L 3O9WD 1T7VA 2X41A 5AZ2L 1TVDA 2BJML 3T3ME 3OAYK 2F5AL 4G7VH 2HKHL 1DQQB 3CMGA 4P5TB 4BQ9A 3GMMA 3D39B 5DO2C 2I27N 4OCXH 2KDGA 4Z95H 1ZOXA 2NCMA 3RHWF 1BVLA 3CXDH 1RJLB 4JDVB 2WWKT 4MA1C 5D70L 3P4MB 2ESVA 1XF3B 5TDOB 1LO3L 1LHZA 1SEQL 1NMCC 2LV4A 3S7GA 4R26H 4DFIA 4HPOH 4IRJD 2K9UA 3SJVA 3P4OA 2EO9A 1A02N 1H3XA 5I1EL 3VFMB 1F4AA 2F15A 3LPFA 5I15L 5FCSH 3C2AH 1KNOB 1DTUA 4IRJC 1CQYA 3GSOA 3WO4C 2Y7QB 4XP1L 3RAJL 4K7PY 3H2WA 4P4RB 4Z0BH 1Z0NA 4YHPA 1WGOA 1CICB 3LKRB 4G6MH 4M1CD 3B9KB 4QRQB 3HR5B 4U1KB 5ECJE 1I1FB 2ORBL 4NQCD 2FJFB 1O5DT 3TZVD 2BY2A 5EZOH 3DHMA 4XPTL 2VTFA 4WV1C 1A5FH 4JDTH 3LMJL 5J89A 1BQLH 4KUCF 3WEXB 2EDXA 1G7MB 1AQKL 4EZMA 4IJ3C 3ET9F 3BPNC 1UB6A 3HE7C 3LVEA 5HHMB 4PJAF 2BNUA 1AGEA 3DNKA 2ZCLH 4P99A 1DL7L 2E7CA 4Q97A 1FPTL 5EA0L 1EFXB 3D9AH 2ZSWB 2X89A 3ARDA 5GSVA 1NFDA 3C9NA 1OF2A 4LSPL 3MLSL 3JTTA 4G5ZL 3FQUB 4GRMB 5DA0B 4LSTH 1S5IL 4O4YL 4NZTH 4FQJL 1DUYA 1J1OL 3EHBD 4WW1B 3W9DB 1V7MH 5C0AB 4P5TC 5IVXF 4Z8FL 3GMQB 4J6RL 2WK2A 3VFNB 3HMWH 4F7TB 1LO2L 1FGNL 4OZGE 2H9GB 1CE6B 1FYTB 2PYEE 3EHBC 1IGFL 4Z7WB 1D5MB 3CUPA 3NCBB 4LSUL 3IJSB 2NY5L 1IC4H 3QG6A 1CQKA 3I3BA 1SM3H 1NCBH 4O51A 2NNAA 5DT1H 4UI2A 2D7TH 2F74A 4FQ1L 4YHIA 4OZFG 5E2WL 3BN3B 2R2BB 1NCNA 4PR5B 1WQVT 4NYLA 1CICD 4MAYD 1T20A 1UYWH 4YDJA 3NFNA 4P9MH 4DN4H 4U4BA 4PLKD 4ZFZA 5IW1B 4DCQA 4QO1A 2DL2A 2V2XB 1TVBB 5HGDA 1KC5L 3WFDL 4AG4H 3MV9E 4Q6IB 1KGCD 4HPYH 5BRZB 1CICC 2R23B 4QXTA 2R4SH 5GGTH 4TVPL 3B9KC 5BW7C 4NZUH 1S7VB 4GMSH 3RVVD 4UT9H 3BN9C 4PJFA 1A2YA 4K2UL 5KS9F 4PS4L 1I9RL 3HI5H 5A43C 2O5XH 2AJSL 2GFBB 2Q1EA 1LP9A 3RVVC 3CFKA 2EEDA 5INCB 5BS0B 1C5CL 4MJIB 5TE4L 4HIEB 2XTJB 1EFXD 4R7NA 3UYRL 5DWUH 5E2UH 3BUYA 4HBCH 4KFZC 3V6FB 3GMLB 5E7BA 5CUSH 5J6HA 1YEFL 3P73B 4J23A 1PZ5B 2BVPB 2LAAA 5C0AD 5EO9B 3MLXL 3FRPG 1JPFA 1S7RA 4ZFOL 5JQ6L 3HRZB 4HIXL 2XWTB 1G7LB 1R24A 1JHLH 1OTTD 2CDEB 2CKBB 3MGTA 3PP4L 3WUZA 1FYTD 2ZPKH 1JZ2A 4NP4H 4PLNC 3G6JA 4P46A 1BOGA 1Q9OA 4YDIL 5T1KB 1OTTC 4GOSA 1KTLB 5DRWA 4JFHD 2PO6A 4L3EB 1CGUA 5KVDL 4CVWA 3MXWL 1ED3A 5L7XH 5EU3A 3BW9A 3U0TA 2XFXB 2JK5B 3V0VA 4LVNC 3RWDA 4R90H 5DD0H 4KK8C 5EPMA 1JWUB 2NR6C 4ORGB 4PREA 5JORA 4XVTH 5HHNB 4QTHB 1YNKL 4P59H 4HT1L 2ZUQB 5A2IH 2YUZA 4K3DL 3OR6A 1LO4L 3QDJA 4LPXA 1AIFA 5F71A 3O2DL 3ZYZA 5IM7A 1I7TB 4Q6IC 2I9TB 1LNUB 2F54A 1MFBL 1MRCL 1KJ3L 2IQ9L 5JNYA 3L3IB 1FVCB 3HC3L 4YR6A 4EQ3A 4JJ5B 4P2QA 5HI3D 5FYLE 1BBJB 2WQRA 5BS0D 1YUHB 3JTSB 1I1CA 2XTJD 1OAQL 1J1PH 3LZFL 1A6PA 3MACL 4DKEH 4BYHA 3OGOE 1DANU 3H9SA 4XMLH 3T65A 3KNBA 3F58H 3S36L 2UWEF 2WSKA 2XKNA 2XTJC 4HIIA 1XCQA 4BA8A 5JZ7D 2E7HA 4KTDH 3GBNL 3NPZB 3VXMB 4GMTH 4H25B 2NTSP 4JY6A 3H6JA 2R2EA 1XGQB 1U8MA 4QRRE 4Z18A 4BUHA 4GAJL 3RL2A 5JZ7C 5IMMA 4KI5F 4M7KH 3MV01 1UA6L 5GZOD 3B6SA 1DDHB 3LRSA 1EPFA 3LS4L 4XNUH 1F3JB 5T1KD 4POYA 1HHHB 3TN0A 2VXTL 3RTQD 4FN0A 5B8CA 3ULVF 5GZND 4L3ED 1SY6L 2DM3A 3H3KA 4K8RD 1KEGL 3LY6A 4E41E 1KIUA 4ZSOB 1HE7A 1SYVB 3K8KA 1KUMA 4FMKA 4LSVH 4OSUH 5TJWK 3DSFH 3D25B 1R5VB 3FFDA 4J12A 3C09B 2DLGA 3BD5A 3LKPA 3EYQD 2ZUQC 1NGZA 4C56B 5JXAL 5L8KB 5DK0A 2IANA 1YY8A 2JJTC 1D6VL 3EO9H 2XZZA 4OIBA 5IESH 3BZFB 2J8OA 4M8VA 4KUZH 1ND0A 2QHRH 3GBML 3IETA 1B6DA 2DMKA 4NQED 3M8OH 2AJYH 3TPKA 4PB9L 4TYUA 1EHNA 4U0RB 5E6YA 4E42B 3TEUA 1EO7A 1QRNA 1RJCA 2ADGB 3MRFB 5DJAB 2BDNL 3G5YA 4JY4B 1MCEA 4XP4L 5ALBL 3VXMD 4M6ML 1S7TA 1H3WM 3PWVA 3HZVA 3WLBA 4UINH 5DXWA 1JYWA 4K07A 4I48A 4ELMF 5DMJB 3BP6B 4CU8A 4XCEA 4RGNE 1WAAE 5FUOH 2Y6SD 3MRDA 2PR4H 2DRUA 3OXRA 4MAUL 4WV1A 1KLGA 1G7HB 2D7QA 2ZG3A 1BECA 5FYJU 1JYNA 1CD8A 4ZOAA 2Y36H 2VQTA 3ES6B 3HE7A 2COQA 5D6CB 5DZOA 1FJ1B 2YKLL 5B39B 4HS3A 3VXOB 5SWZE 1TNMA 2H41A 1U8NA 3UP1A 1ZHBA 3BZEB 3QUZB 5ANME 1BLNA 4ZO9A 1WFUA 5FYJL 1RZGA 3DIFA 1JGUL 1HXMB 2DI7A 1PEWA 4AZ8A 5IMKB 4C56D 3DUUA 3MRIB 1KIPA 3C09C 2EO1A 1VCAA 1HKFA 1M71B 2AXGA 2VDQL 1CLOL 3X17A 4P5TA 3D39A 2Z31D 3CCHB 5DJZB 1QBLH 1QR1B 5TQ2L 2F53A 5L9DH 2PW1B 4JDVA 5ISZE 2XOTA 3HRPA 1IE5A 1XF3A 4Y19E 3DXAB 5TDOA 2P5WD 5TF0A 4JQIL 1HOCB 4LLDB 5MENE 2WINA 1SBSL 5EB9A 3VGDA 3RX7A 3EDJA 4MNHB 4GKOA 4GBXD 3V6ZB 2BY1A 4U0RC 3A67H 2R1WB 3S9DB 4XBGA 1IGTA 2FD6H 1HEZA 3PV6B 2AK4B 1KNOA 1IZKA 3S36X 5IFJB 2OK0L 1G7IB 3E1F1 5DHVA 3BPLB 2Y7QA 2I25N 4NZDA 1QTYT 2R8SL 4DK6A 5I9QB 2VDMH 3MBED 3QFDB 4NO3B 4P4RA 5HGGS 4GLRI 5IHUL 3LKRA 2WANA 3S37H 4F7EB 1PKQB 2LVEA 3B9KA 2EC8A 4QRQA 3HR5A 5BW7A 4U1KA 1EHLH 3PDGA 1FLRH 2FJFA 2EYRB 3OKDB 4TSBL 3L1OL 5K9QI 5CINL 2E6JA 1A3RH 2H45A 2J8HA 35C8L 1JI1A 1KYOK 5LQBH 2FB4L 4PBVC 3S6CA 4OCYL 3WEXA 4X0KA 2C7UB 3ZKSD 1QZ1A 1G7MA 2H2PD 6FABL 3VI3E 4LHUB 3QUZD 2W0LA 3QCUH 2YXMA 1RIHL 3MLRL 4U1LB 3SDXE 4RMQA 1PJ9A 5HYQB 5MP6L 2BVUA 5KOMC 5KVGH 5I76B 5F3HB 4HKZB 5LGJB 2VL5B 3QA3B 4Y7MA 5T3XH 1EFXA 2DQHH 2VLJB 3ESVF 5KANG 2ZSWA 15C8L 3QUZC 2DQDH 1AXSB 1QSEE 3WL9B 5I73B 3BRFA 2WUBH 4GRMA 3O6MH 2X4SA 3BT2H 2YD4A 4KJPD 4UOW0 1T0NA 5E8EB 1J7VR 1UADC 3ZSSA 3GMQA 4TRPH 4I77H 5HVHB 5C0IB 1T1WB 4ONFH 3EYUL 1P84K 2ZG1A 3W39B 4AM0B 1CE6A 2HRPL 5EUOB 1D5MA 3SJVE 1MFDH 3IJSA 2BRRL 4WEBH 4G6JH 3EKCA 4FXKA 3VFWB 4M6OH 4PGEA 1QNZL 1OSZA 1WCQA 4OGYH 4GS7B 4PGBB 4N5ED 2R2BA 4PR5A 2ADJB 4PGJA 3ARED 4HKBB 3DARA 3BPLC 5IW1A 4NT6B 1R5IB 3QB7C 1TVBA 3QQ9C 4N5EC 5E2VH 3U6RA 5I9QC 4YXHL 1YEEL 5BRZA 4S1SH 1RK1B 2X1WL 2R23A 1VESA 1S7VA 3LEVL 4MYWB 2WQ8A 4PJXB 1PYWB 4H5SB 4L5FL 2OR9H 2W60A 1RZFH 2GFBA 3DVGB 4L9LA 4XVUD 2HWZL 5BS0A 5HDQL 2E7MA 1OP5K 3U9PH 4MJIA 3FT2B 2R0LL 4N0CD 2VLJD 3KJ4B 4AEIL 2P49B 2VYRE 2OMNA 3MR9B 1MJ7L 2FCBA 2QQNH 2R4RH 3GMLA 4XVUC 2YPVL 3OAYH 2DQUH 4KTEL 1T04A 4HK3N 2VLME 1YYLL 2QKIB 1N0XL 4N0CC 5HY9B 4JFFE 5EZIL 2Z93B 5EO9A 4BUGA 1DQTA 5I73C 4ZMAT 1FGVH 12E8H 2J88L 4K9EH 3U0PB 1K6QH 4N0YH 3SO5A 3IS1X 2FIKB 3QUMH 1YECL 1ZVSB 1T66C 2CDEA 2CKBA 4OLWL 5DK2B 4PLJD 3UBXI 4XPHL 5JIKA 5E9DB 5DHVH 3DMMB 3PP3K 4LF3B 3WNPA 4ENEC 5AAMA 5KSBF 4JG1H 5HVHC 1J0ZA 2G2RB 1UJ3C 2GIYA 2O93L 4OKDA 5HVGB 3V6OE 4L3EA 5IQ7H 1ZVHA 4IHOA 1I8MB 5E7FA 2MSPA 2Y72A 43CAB 3ZDYE 2JK5A 3V52H 1ZHLB 4P2OB 4JO3H 1M7XA 4GS7C 3K4ZA 5HHNA 3BMWA 3K4AA 3X11B 3VFSA 1U8JA 1JTPA 4M48L 5BV7L 3OKKB 5D1ZB 1B2WH 2JJTA 2FR4B 4ZOBA 5GS0L 1OCWL 1CGXA 1ZLUK 3VXUD 1I7TA 1LNUA 1WWBX 2BNRB 3L3IA 1FVCA 1PDKA 4JJ5A 5EO0A 1BBJA 4KJQC 4OLVH 4XX1G 1FFNB 3JTSA 5FDYA 3ZYIA 2AJUH 1FL5B 1G6RL 1ZANH 1XGYL 1NKOA 4ZO7A 1NSNH 2XG4A 3W9EA 3QIWA 1CTOA 4Y4HB 5DVLA 5DF0A 3HHRB 5F97E 2CK0L 3KJ4C 2NX5D 3BIAX 4XNZB 3QFJB 4H25A 1NBQA 2B0SH 1H3UA 1XGQA 1IGCL 3GFUA 5E9DD 3DMMD 4O9HH 2J7LA 1NC2B 1DDHA 5EO1B 5E2TH 1S7QB 3RWCB 1F3JA 1HHHA 3DX8B 2EDOA 1NUNB 5F7DB 3PV7A 3DMMC 4U3HA 4JO2H 1YEKL 3A6OA 4ZSOA 1WTGT 2XXCB 3P9MB 4OFDA 5EOQH 4OT1H 4P5MA 2EC9U 4P2OD 2B1AL 3UJIL 1TETL 2APFA 1TJIH 4N5UA 1MRFH 2CD0A 1F3RB 4DTGH 1JGLH 3RUGE 3K3QA 2GI7A 1MWAL 4P2OC 2DQTH 3HFML 3QNYA 5ITFB 1RQ5A 1A7PL 2F54E 3ETBF 2BNRD 2XN9D 2H1PL 5D1ZC 3TH4T 4N9GB 1EFQA 3WXWH 2B8OT 3BZFA 1QRKA 3LHPH 3IDMB 1YQ2A 2EDRA 5T33H 4XGZB 3W11D 5CZXD 4JM2B 5FGSA 5E6ZA 4D8PB 4R6UA 4YNYB 4E42A 4Z7VB 1RUQL 4ZNCD 3MLTB 3W0WD 1NCAL 1T7ZA 4Y4HD 1OSPH 2IGFL 2HT2D 2DB8A 2P44B 2ADGA 5K93A 3QXVA 3S3PA 3MRFA 5DJAA 3BFOA 1JE6A 5EWIH 1MEXL 4FZ8H 4NUGL 4F8TA 1M6OB 2CIIB 2YR3A 5KSUB 5DQDH 3KPPB 3HI6L 2R2CA 1B4JH 3QEUB 1SMOA 4XNZC 3OG4B 4QRPA 3UJJH 1NC2D 2ENYA 2HVKB 5A2LH 2YUXA 3GGWB 4KRMB 3TYGL 4FTVB 2YK1L 2AVGA 3VXQA 1G7HA 1YPZB 4CADB 2ZCKH 5KW9H 1P9MC 4PJ5D 3D0VB 3I6LE 1N4XH 1OARL 5J13B 3ES6A 4N0UB 5JDJA 1FJ1A 1JRHI 1KJ2B 3L7EB 2APTA 3BIKB 2HJFB 4R8WH 3N06B 4PRID 5IJKC 2J8UF 1OGAB 3QUZA 4MXVE 4CN1A 4FQ2H 3OMZA 2QSCH 3LRHA 1HXMA 5LG1A 5IMKA 3AMKA 3I9GH 3RA7L 3MRIA 1A64A 5GRUH 2BSRB 1JN6B 2WV3A 1WZMA 5DJZA 4PJDF 1DFBH 4KMQA 1OQOA 5HGBB 2KH2B 5EC1B 5JXEC 4PJEA 2PW1A 2EDQA 3QWQB 2NQCA 4NZRH 3DXAA 4PUBH 4BKLB 1HOCA 4LLDA 5DC0A 1YMHB 4JFDB 3VWKB 4K3EH 3VA2C 3CC5B 2OI9B 4LKCB 4MNHA 2F58H 2CR3A 4PP1D 5IBUG 4JM2C 3SY0A 1AJ7L 4TSAL 2R1WA 4M7LT 3U7WL 1F2QA 3V4PL 3PV6A 3DURB 2AK4A 4ODXA 1ZGLB 3VMPA 1QPXA 4PP1C 1V3KA 4BZ1H 2X4PA 4OZHF 1SJVA 3TVMB 4KV5E 1DSFH 2FWOB 1R3JA 4NO3A 3FO0L 3I6GA 4FTVD 4NHCH 2XRAH 3V5KB 3LS5L 1PKQA 4F7EA 1JK8A 3HZMB 2EYRA 3S96B 4NQCE 3W2DH 4IRSD 1FYHB 3IT8D 4JFZH 4JFXA 1A7OL 1NANH 2AJXL 2B1HH 3THML 2QLVB 3DPBA 2RAMA 4M6NH 2DQFB 2NLJB 1NLBL 5MEPB 2NY3B 3Q1SL 4ETYA 2VN7A 4LCCA 4LHUA 3CSGA 1OGAD 4FFWD 1NDGA 2QSTA 1E4XI 4U1LA 2XZQH 1N5YL 5HYQA 1DUZA 5I76A 3PXHA 4HKZA 5LGJA 3QA3A 4MSWB 3CJJA 2VLJA 2DQGH 2VDNL 1Q1JH 3KPSD 1NDMA 4DZBB 3WL9A 4F7PB 4X7FC 3RVXD 4OGXH 4GW4B 4TVPD 2RJMA 3K1DA 4YXKH 2C3VA 4UTBH 2VIRB 4ZTOH 2JLLA 4JANB 5E56A 3KPMB 1YN6B 1BIIA 4HJJH 4HLJA 5KJRL 2F8OA 3ARGC 1CK0L 1T1WA 3LH2H 1QA9B 2VXQL 1UJ3A 3VRLF 1EERB 4AM0A 3I02B 1NKRA 4PLOB 3GRWH 2XV6B 1IL1B 1U8IB 4M3JA 1ZGLP 3ZHDA 3QO0B 3NAAL 3VWKC 2OI9C 4A6YH 5FYKD 1Z9LA 4RX4A 2VDRH 2HLAB 2OLDA 3TVMD 3GEWB 1NCDL 1U3HB 3ALWA 3O2WL 3F7RA 3QDHA 5EC2B 3E8UL 1Y18B 2EXWD 4JB9H 1EVUA 3TVMC 4NT6A 1DP0A 1R5IA 5IVNA 2P47B 3H9ZA 4YGVB 1VGEH 1RK1A 1KGCE 5IHBA 2EXWC 4PJHF 5D1QD 3LQAL 2LABA 4UDUB 3C60B 4Z76A 3KPNB 4W4NA 1V3JA 1L7IH 4JZJB 3CD4A 1HHKB 4OM1L 3RVTC 2YZ1A 2NY3C 1NUGA 1D9KB 4LMQE 2VLRA 1JNLH 1A6VH 4YPJA 1U92B 3MR9A 4YQXL 2XWJB 3F7PC 4XVJH 2YBRB 2CLVB 3CXHK 5CD5D 4U05A 4WFGD 4OBSA 3GUTB 5HY9A 1AE6H 3MOAL 2Z93A 5HHXL 5C0AE 2SEBA 3CFCL 2IJ0C 4UIKL 1IC1A 2FIKA 3ZDXE 1FYTE 3DMMA 4LF3A 4Z7WE 5EUKB 4MQTB 4QHUA 5D7JB 5EG6C 5D71L 2ARJA 4PJGB 5FUCC 3UEZA 3ZMRA 5CGYD 1X3DA 4Z7UB 4Y2DD 3TP4A 3TBWB 5C09D 4JFHE 4PB0H 3K46A 4DVRH 1HYRC 3BO8B 3QRGH 1QLEL 1I8MA 3VD7A 2N56A 1FNLA 4JCMA 3RIFF 43CAA 5CGYC 2DD8L 2VNCA 5EORH 1CI5A 4X6CB 3MLVL 3D0LB 3QQNA 5H37H 1CD1B 1WSST 1R0AH 1F58H 5ITBL 4XAWH 1A6UH 1U3HC 3P4NB 2GITB 3X11A 4NPYB 5DVMA 3QIUB 3MV7D 3UO1L 3OKKA 4YE4H 1QFWI 4UILL 5D1ZA 3Q6FA 2VERN 2IG2L 5AD0B 3X3GL 2FR4A 5K33A 3S34L 5FB8B 3C60D 3VXRA 3WE6B 1CLZL 3EFDL 1N0LA 1K8IB 1LEIA 2R0ZL 3A6BH 4OD1H 3HPJB 2R56L 1U9KA 2W07A 3C60C 1FFNA 5BS0E 1FL5A 2XTJE 2G75B 3VGGA 4JZJC 3DV6B 1JF6A 2JB6A 1TJGL 4LVOB 1D9KC 4P9HC 1I3VA 5IVZB 3QFJA 4HWBL 4XTRC 3ALXA 1Y0LB 4HWEL 4BK4A 5IBLC 4EOWL 2FHCA 4LLUB 3UZVB 5IMLB 5C7XL 5D7JD 1XF1A 1NC2A 4PRPD 2W9LA 3RWCA 5I2IB 3DX8A 4JKPL 4LBEB 1RURH 5HYJB 1H15A 5F7DA 2RFXB 3O3DB 5DJDB 4L3EE 5D7JC 4YDKL 3DX6B 5IHLB 3K80A 3UX9B 4YHOL 3WIIH 4HW6A 5IJKA 2X09A 3J7HA 4LDOB 4Z0XB 3PL6B 3O4LB 4PRNB 3HC4L 3DROB 2CQVA 1E6OH 2ZUVA 2FH6A 3RWJB 4RFOL 3R4DA 4WCYH 1ZE3C 5HHVH 4WTXA 3ROOB 1IFHL 4K23L 5EBWB 3QIUC 5ITFA 1ZTXH 5JXEA 5E4IA 5GS2D 3U7YH 1HQ4B 2IQAB 4N9GA 3R1GL 5DEFA 2EICA 1RUKL 4NQEE 4X4YB 3OKLB 1OP5H 4JM2A 4PJIB 1G9EA 4KAQL 4YNYA 4Z7VA 3MLTA 3H0TB 4X9FA 6CGTA 2DWEB 4G8EB 1AXTL 4B50A 1HILB 3ZHKA 5DVNA 4DZ8A 2DKUA 4FNLL 3VXME 3IDJB 3KPTA 3TCLA 4LVOC 2CIIA 5KSUA 3TM6A 4XC1H 2P43B 3VXSD 3IFNL 1S78D 1CBVL 4MNGE 1UM6H 3CMOL 1BAFL 1FAKT 4UUJA 2E8YA 3PP3H 5HI4D 3TBYB 3L9RB 2HVKA 1MRDL 2YC1B 2Y1VA 1CE1H 4M62L 1S78C 1YDPB 2X1OA 1NCCL 2G5BA 1F02I 1OAKH 4GH7B 4PJCB 1L7TH 4R4FH 3PWJB 3D0VA 3NTCL 4NSKB 5DFVD 3UTSD 1MHHB 3ALPA 4JFOA 4YPGB 4J7RA 1KJ2A 3PL6D 3T2NL 3VA6A 2XI9A 5T1DL 3CZJA 5T5NG 3BIKA 5DFVC 1KTKE 1XGTB 2HJFA 5J1AB 1XIWA 4R4NC 1KEML 1BQUA 4JFEA 1U93B 1A0QL 1B0RB 4G3YL 1MCLA 1BJ1J 3PL6C 3AUVA 5KVEL 1A14L 1IMHC 1OB1B 4GFTB 4C56E 4JVUA 5H37G 1VFBA 3ARGA 2BSRA 1JN6A 1OTSD 3U4BL 5CZKA 1FIGL 3JWOL 3G6JF 4XMKH 5L6YH 1CXIA 2E27L 4BK5A 1BVZA 4LHUG 4Z7OF 5HGBA 1RHFA 1K4CB 1EIBA 1BQSA 1NCWH 2AEPL 2IMMA 3QJHB 4QHKJ 4P4KB 1IGJA 4BKLA 2H8PB 4WW2A 2P5WE 4JFDA 1U8QB 4W6XB 4D9LH 3VWKA 4YWGL 1FBIH 3CC5A 2JIXA 1MIEL 4I3SL 4F57H 4LKCA 3V0AC 3L6FB 4YC2B 4JHAH 3VXTB 1BJ1H 2B7DT 4YHZL 3DURA 3CSPA 1YYML 4HJ0D 4KKAC 1ZGLA 2YRZA 1QSFB 2DDQH 3BZ4B 3GIZH 4MDJA 3QH3B 1SJXA 3R0MA 4RNRB 5GGQL 4V1DA 2FWOA 3F62A 4HXAL 3LIZH 3GMRB 5I1KL 4GKSB 4CGTA 4HDIB 3V5KA 1JHKH 5BVPH 4JAMB 3HZMA 2BY0A 3S96A 2KKQA 1DQDL 1BWMA 5TDPB 2VDPH 4L29B 1JPGB 1P2CB 2WWMC 2Z8SA 3MV8D 4YFLF 4X6DF 5FF6B 2FJHA 2J6EL 2YS4A 3FOMB 3WNLA 1LK3L 2DQFA 5CCKL 5MEPA 4HIJB 4EUPB 3HR6A 3V0WH 4M9PA 1G7QB 4GW1B 3QDMB 1D5IL 1EMTH 3IU3A 5GJTH 3RZWA 4MSWA 4OB5L 3UBXB 4G43A 3PWLB 2IADB 1FCGA 4F7PA 3MOQA 5D7IB 1GSMA 1IT9H 1O7VA 2D0HA 4GW4A 1PGRB 3O41B 4DN3L 5DMYA 1S9XA 4XHQA 4ELKA 2VIRA 4M61B 3CDGA 5F9OL 3ZL4H 2BHZA 3GNMH 1QKZL 4NM8H 3U4EB 1YN6A 1PG7H 5GIRB 2FNBA 2XKSA 4HFUH 3UC0L 1F4YH 1AD9B 2JB5H 2I24N 3I02A 4Y16C 1IL1A 1U8IA 4P4KC 3KYMA 1FC1A 3QO0A 4KK6C 2ITDB 3HE6D 3V4VL 1QSFD 5ID0B 5DMIH 3SE3C 1R3IL 2CMRL 1B0GA 2HLAA 5CSZA 3AU1B 3LEYL 1U3HA 4KKBD 4DAGH 5FV1L 1P5VA 3D6GA 4P3CL 1DEDA 2O5YH 2CSPA 1P4BH 4XT1C 4QNPE 1G9MC 3WDIA 1NMBH 3B83A 4YGVA 1JZ7A 3QNZB 4X9IA 1N6UA 2AABL 2VQUA 2W9DL 4XBEL 1H3VA 3AMLA 4U6HB 1DBAL 1TTFA 3Q3GB 1VFAB 3FAXA 1IBGH 2H26A 1W0YT 4PV8B 3EDFA 4UDUA 4KQ4L 4JVWA 3KPNA 5SX4I 2GSGB 4LGPB 1W0WB 4JZJA 1F3DJ 4OQTA 3QDMD 3B2UC 3NCYP 3KLAB 4WHTB 1OWWA 5F44A 5KN5B 1D9KA 5ILTH 1TZGL 1Q94B 3IAPA 2VLJE 4U6YB 1U92A 3FN9A 1CGSL 2GCYB 2XWJA 4K7FA 5BO1H 2FATL 2AGJL 1NGQL 2YBRA 2BFVL 2CLVA 3DHJA 1U8PB 1FAIH 3GUTA 4NNXB 3FZUD 4OCRH 3ZTNL 3MRKB 4AYFA 3FN0H 1UXSB 4BFIB 2AKRB 2UUDK 1A6WL 3IVKA 3BKYL 5EUOE 5EUKA 4UQ2B 5F93C 1U36A 3E2HB 1KTDB 2GJZB 1A1MB 1FZKA 4PJGA 2J4WH 1T21A 3LKQB 3OR7A 3TYFB 3U36B 1PKOA 3HZYB 4LSQL 3TBWA 3VJ6B 3UPRB 3KPLA 1Z6JT 4W81A 2B4CL 3BO8A 5IVXB 1CDIA 1ULVA 2B5IB 3GMOA 1E4KC 3VD4A 2I5YL 1GHFL 1MJ8H 4LEOB 5FYLL 4LCIH 5EBMA 1H0DB 2NY7L 4UIMB 4X6CA 3D0LA 2A2QT 5F1IB 1CD1A 1ZAGA 3GSVA 5T3ZD 2XA8L 2I07B 1BX2B 1UB5B 2K3TA 3GI9L 4PGZA 5LBSL 2MCPL 4NPYA 3QIUA 2X6MA 4H20L 2DTML 3PQYD 4Z77A 2FECL 1T5XB 1MAKA 1KXQE 4UT7H 4CVZB 1KBGH 4PJXE 1VGKA 3ZDZF 1ACYL 2AXJA 3CVHH 1JL8A 5JHDB 7FABL 3SDDC 4O5LL 3BWAA 3BWUC 1YNLL 1T2XA 1OAZH 3HPJA 1JPSL 1X7QA 1EK3A 3D85B 2G75A 2IH1B 3FT4A 4DGYH 3NZHH 3EJYD 1MFEL 1GGIH 1EZVX 4KUCD 1VEPA 4OF7A 5K9JH 1UEYA 1XFPA 3UZQA 5KS9B 1YQVH 4LSRH 1FH5H 5JHLH 4GG6A 2FRGP 2NX5E 2VXUL 4EI5B 1NBVL 1LD9B 3QUXD 1C1EH 3C8KB 1Y0LA 3RDTB 1ODAA 4PY8I 2EDEA 1LE9B 3GHEL 5FHBL 1GPOH 1EJOL 4MNQB 3VFPA 2EDNA 1JPTH 4YUEH 5E9DE 4PJBF 5IMLA 3LKNB 3AM8C 4WENB 3GB7B 3BKJL 4NBYB 5JW5B 1PW3A 5ACLA 2CRMA 4LBEA 5HYJA 5T5FL 4JPWH 4CVUA 1ADQA 1J5OH 4J3VA 1X9QA 5DJDA 1M7IB 4HF5H 4JO1H 3DX6A 3E2HC 2JF1A 2EDJA 3I50L 1OP9A 3VGHA 1QO3B 3BH8B 5F7MC 4DQOH 2Z0BA 1BP3B 4Z0XA 4ODTH 1OY3B 3O4LA 3PL6A 4PRNA 1HXYB 2B5IC 1J1XH 5ADPH 3DROA 4JPVH 3CXHJ 1AO7A 4G7VL 3RQ3A 5C2BH 3RWJA 4Z95L 3UROR 3ROOA 5JIIA 3TF7C 2VAAB 1DBKL 1EO8L 3B9AA 4MWFA 1JMZA 2C3XA 1BD2B 1DEEB 3QJFA 2FL5B 4H0HB 1RZ7H 3TT1L 2BNRE 1E0OB 1HQ4A 2XN9E 1VEMA 3N9GH 1CCZA 3MLWH 1CZ8H 1DZBA 1FP5A 3OKLA 2VAJA 4MJ5B 4PJIA 4XH2B 3U48A 3MJ8A 2PCPB 3ARTA 4FZEL 1RI8A 1P4IL 5BZWA 5T1LB 1K4DA 2XACC 3SQOL 3H0TA 1YEDB 4XWGH 3W0WE 3WXVL 3S35H 2DWEA 1UWEH 4U1GB 5ETUB 4OLUH 4X98B 4M9OA 1NFIB 4HX1B 5CBAB 2G5RA 3JV0A 4HGWB 3P0VL 3IDJA 3QDGB 5TGBA 1BGXH 3TBSB 5FEBA 4NFDA 5BCAA 4MNQD 4ODSH 1I9JH 2M1KA 4EI5C 3UAJC 5EZOL 5E24E 5GISH 1CDCA 3RDTC 3S98A 3I2CL 4RMUA 1S7SB 5EBGA 2YC1A 2UWEB 3RU8H 1BWWA 1I3RA 1YDPA 1JZ8A 4KROB 3REWA 1ORQB 3KHQA 1U8OB 4M5YL 4MJ6B 3PWJA 1W8OA 4PJ5E 4NRZB 1CFVH 3CSYB 4QTIL 3WBDA 4L3CB 1MHHA 3QXAB 2ZCLL 3K4DA 4YPGA 3MRPA 4U2ZA 1J0KA 4NKIH 1IC5H 4GSDL 3P77A 3D9AL 1D3CA 4LCYA 1XGTA 3TJEH 5E08H 2YPLA 4PRIE 2DJSA 4KDTC 1W72H 2E6PA 2V17H 1JFQL 4Y5VB 3GHBH 2YRPA 2CDGA 3RVWD 1BD2D 4RISH 1OB1A 3RWEB 4WI7A 3WJLC 4AEHH 1N3NA 5F21B 1FVDB 4MQ7A 3HMWL 5BJTB 5SWQB 3T3MF 5E99L 4F58H 3OF6D 3WFZA 3GSNL 3PGDB 4GXVL 3NA9H 3VCLB 2MJWA 2CO6B 3IU4L 4S10A 1K4CA 4RGOH 4Y16A 5J4MA 5F7EH 1NCBL 3QJHA 4P4KA 4OI7A 4LPYA 2VLLA 4UV4L 3QR2A 1A6ZB 1U8QA 1AGFB 1A22B 1GOFA 3L5XH 2JCCA 3UYPA 1RIUH 4QXGL 3QDGD 3VXTA 2VLKD 3VFUB 4P9ML 4U1MB 4U1GC 4DN4L 2CLZB 1QSFA 3BZ4A 4JQXC 3SQBA 1ADQH 3QH3A 5IB4B 2ZCHH 4RNRA 1P7QB 1WFOA 1KCVH 3MJ7B 4HPYL 4OZIA 5CAYB 4G9FD 2R4SL 4HEME 3GMRA 4GKSA 4JHBA 3U30C 1I8LC 4FTVE 4HDIA 4KROD 1YPZE 3PWUB 4JAMA 1Z5LB 3MREA 3WKMH 1VKXB 4L1DA 4GXUM 3UYOD 3T08A 5CWSB 4YHKL 5TDPA 1JPGA 4O58H 4KROC 2RIKA 4N0UE 5FF6A 4OM0L 4ELMB 5I8OL 3FOMA 5TH2B 3IDUA 5C07D 1KFAH 1RVFH 5FDWB 2BSTB 2IAMB 4EUPA 1NBZA 2P8PA 4X8JB 4H0IA 1G7QA 1NCTA 4J3OC 1OGAE 4KI5C 4C4KO 5FM4A 3VG9B 3BKMH 5D5MA 4LIQH 1O7SA 3BP7B 3U1SL 1OM3L 3K8LA 3ULVC 1QFHA 3OWEA 2MKWA 4YIQB 1Z9SA 3WHXB 3PWLA 4CN4A 3KPSE 4Y5VC 2IADA 3SOBH 5D7IA 2Y07H 4JY5H 3O41A 5CZVH 3IXTB 3QEQD 3ARSA 3U4EA 1RV6X 3BVNB 1G7JB 5FOBB 3FQRB 2D7NA 3MA9H 4FOMA 2CRIA 1WTLA 1H3GA 3BKCL 1WC7B 5CMAA 4GQ9H 3MFGB 4WNQB 2ZP0T 2ITDA 2P5ED 3BRDA 5ID0A 5FYKE 4X7SL 3IDXH 1P7QD 3AU1A 2GSIA 1IAKB 4XPAL 1WVZA 2OJZL 2XZCH 3NH7L 3R8QA 2O61B 5FECB 8FABB 3WFBH 1FFPA 2DQIL 1G0YR 2VDOL 3WHE0 5KSAB 5GGVH 5I8KH 4U6HA 3SDDA 4YX2H 3Q3GA 1VFAA 2DLIA 2OL3L 4I0PB 1LDPH 3EDKA 1X6LA 1MCPL 1P4LB 4PV8A 3EJZC 2GSGA 4JR9H 1W0WA 3QPXL 4XMLL 4EN3B 4ZFGL 3HNSL 3PXJA 4UOJA 4LRNL 3KLAA 5AZEL 4WHTA 2GQHA 1MJJB 2FX8H 2IAMC 1GC1L 3EFFB 1EZVY 4LARL 4MD4B 4ZODA 3VFOB 3WFHA 5KN5A 3MLZH 4LFHD 5CEZH 1M05B 4BFBD 4U6YA 2GUOB 4B7LA 2GCYA 2Q8BL 3CGTA 4PG9B 3VG9C 4XPBH 5CP7B 2VABB 1U8PA 1CDYA 4WFGE 2WBJB 1F6LL 3FHQA 4EBQH 4X4XB 4PJAA 2XICA 2R39A 3MRKA 5IIEB 4OD2A 3AM8A 1UXSA 5DD1H 4QXUH 4BFIA 3GIVA 1UEMA 5DJYA 4GT7A 1EEYA 4UQ2A 3PJSB 4X4ME 5H94B 5IWLC 3D69B 1I4FB 1G9MH 2EIBA 2PTTB 1KTDA 2D31B 2MHAB 3BX7C 3TYFA 3U36A 2EKJA 3MLUL 3UJTL 3LN5A 3VJ6A 3UPRA 1AI1L 1WEJH 3SKNB 5C09E 3U46A 1YEHL 4NCC2 1JGVH 2XA3A 3NGBB 1BFVL 1SQ2N 3DETC 3QBTB 1HQRB 1DQMH 1KELH 5JQHC 5J57B 5F1IA 3V7AG 2HT4D 2PXYD 1UB5A 1NC4D 2A77L 4ZNEE 4M1GL 4CJ1A 3MV7E 3UTPD 4PJEF 5FHAH 4KJYB 4I0PD 1DBML 3M8OL 3RY6A 3AVEA 2UZXB 4JGMA 5KSAC 4EJ1C 5CGTA 4HG4K 5K59E 3IFLH 4M5ZH 1F11B 4OLEA 4JQVA 4LLQB 5JHDA 4J3XA 3MSPA 3P40A 4NUJA 2GTWB 4X80H 3F6LA 3D85A 4EN3C 2IH1A 3BGMB 3K2MC 3PGCB 4K3JH 4UINL 5TPWH 4IRZL 5KS9A 1R5WB 5L88H 4KZDH 2WBJD 3A6CH 1WITA 5LWYL 4EI5A 1LD9A 1K8DB 3SBWA 3C8KA 3RDTA 1QFUL 4KRLB 3H9HB 4P23A 1LE9A 2DQEH 5CILL 2WBJC 3SKJL 3QUKB 4K94C 4EXKA 1PX4A 2HJLB 3OGCB 5BOPA 3ZZ1A 1HNGA 4XNYH 5FKAB 3GB7A 1K2DA 5JW5A 3RX5A 4PRPE 4E5XB 4Z7UE 4LOUD 1GYAA 1R3KB 5DD5L 5FO8B 5D7LB 2W92A 1QO3A 3BH8A 4QF1B 2NW2B 1S5HB 3FOLA 1ES0B 1CT8B 4KDTA 1L6XA 2BERA 2OMBA 5KSBB 1DBJL 4FFZL 3DVNB 3NGBC 4Z9KB 5B21A 3WJLA 2F19L 5D1XD 4XCYB 2O5ZH 1AGBB 1MH5B 4FHBD 5I74C 5JW3L 3SPVB 2A6JA 2VAAA 1KG0A 4M1DH 3MUZ1 3ULUL 4OF0A 5I17B 4DUVA 1J0JA 4HV8A 3X14A 4MCYB 3T0VA 2B39A 4J3WA 1CF8H 3BGFB 5FUZH 1CXLA 3INUH 3G08B 5EU6B 1MCOH 3OJ2C 4WIQA 3KHOA 1ETZB 4R0LB 4XH2A 5SX5K 1VA9A 2PCPA 5FO7B 4BH7B 4P3WA 5T1LA 3OKNB 3RKDC 1YEDA 1AKJB 1FL6B 2WM0A 5ETUA 5IROA 2CH8A 4JQXA 3V8OA 3TO4B 2IPKB 4X98A 1NFIA 3QG7H 4HX1A 4AY0A 3L5WB 4D94A 5CBAA 2ADFH 2NY5C 1F6AA 3CH1B 1ZKAA 4HGWA 2B2XL 1EHLL 3TBSA 3VXSE 1I8LA 4D0DB 2GAZB 1J8HB 3GO1H 3GSWB 5JW4R 1WAAF 1S7SA 5IT2L 2N7AA 2UWEA 3JV5A 3F5WA 5BQ7B 1U8OA 4MJ6A 1BVKB 3EYVB 5D7LD 1YEJH 4RRPA 1L0YA 2ILLA 4LAQH 4XMPL 4ZPTB 2EEBA 4X99B 3PWPD 3UTSE 5DQ9B 5HHOA 4YDLB 1YMMA 1NGYA 1C12B 5JR1H 5C0GB 5I1GH 4NQXA 1KB5A 5FO9A 3KYKH 1N5AB 1IEAB 5E8DH 5I1AA 2VXSL 5DURD 2WUBL 4ZAKB 2VXVH 3NACH 4Y5VA 3SHSA 4AT6B 2QQLH 3S88L 2HVJA 3RWEA 4UB0H 1NQBA 4U6VL 4TRPL 3TA3C 5BJTA 5SWQA 1YJDC 5SWSA 3TBVB 1WUNT 1CD9B 3PGDA 3WUWA 1MIMH 3VCLA 5KBNC 4EUPG 5EU6D 2IBZY 4OGAC 2OP4L 4LKXB 5FXCH 3JV6B 3ARXA 1AKJD 1WV7T 1A6ZA 5C0ND 3TH2T 1AGFA 1KXVC 4M7LH 3RGVB 3TO4D 4WRLA 4R0LC 2XZAL 1UKQA 2VZUA 3JV4B 2W0KA 4ESKA 4U1MA 2CLZA 3TO4C 3SCMD 2CRYA 3IFOB 5C92A 4JKWA 1CGWA 2P24A 4OLZH 5FGCB 3MJ7A 4Z5RA 5JLZA 3CU1A 5EU7E 3ZKMD 4MXWH 1NAKH 3KYNB 1DN0B 5IBTH 3KPRB 4LP5A 1PVHA 3MO1B 4G42A 3PWUA 5LAXB 3M45A 4OIIH 4PJCE 1VKXA 2VZ3A 2BOCB 1W0VA 5D2NE 1IAIH 2L7UA 4JRWA 4MD5B 3RPIA 3B9DA 4X7TB 3MV8E 2Q3AA 4NO0D 1ONQB 4AIXA 2VMFA 3KPOB 4X9GA 5TH2A 2EZ0C 1C5BH 4Q9QL 4Q9RH 4KK9D 4DKFH 5FDWA 3OAUH 2BSTA 2IAMA 4GG8B 5ICXB 2QQNL 3E3QE 4X8JA 5JUEL 4ZAKD 4XP6H 3VI3F 4YDLC 3K1KC 3MC0A 4KVNH 4BZ2H 4X8XA 1PAMA 1IC7L 4XC3H 3SDXF 1RJZB 4WO4B 3FMGH 5F96L 1S9YB 5CEYB 4YIQA 1FGVL 4QY8A 4ZAKC 1OAXL 3FN3A 1K6QL 3G9VA 3WHXA 2WWKO 4B0MM 4UV7H 4JLRB 1B90A 2VRAA 4YBQC 3RKPA 1WBYA 5HYSA 4UNVA 1F4XH 2J8UB 1NBYB 3IXTA 1E6JH 4H8WC 4JG1L 1GOHA 3QWRA 4YHMH 1LEGB 4F7MB 3QI9A 3BVNA 1G7JA 1RULH 5IWLA 5FOBA 1CDUA 3FQRA 1F13A 1N64H 2Z35A 4N68A 5DUBA 4OZFB 8CGTA 1KT2B 5IQ7L 1TNNA 4XZUB 3RGVD 1UM4H 4U1HB 5ACZB 3ARPA 2EH7L 1TQCB 5CJOH 4G7YH 4R4BA 4WNQA 4MB5A 2WLZA 3P11L 4PJDB 5I1DB 1QSFE 1P7KB 1IKFH 3C2SA 1INDH 3MNZB 5LKNA 1T0MB 4JN2B 4ZUWB 3FFCD 3ECBA 1IAKA 1WZKA 2YOCA 4WUUB 3ZTJG 4Q2ZB 5MHSD 2O61A 8FABA 3N1PC 1INEH 3C6LD 3GSQA 4HGKC 3U0WL 3EUUA 3QHFH 1KB5H 5KSAA 4IDLA 1FVEB 4CNIB 4TUKH 3NCJH 3T1FB 3UTTB 2ZUSA 1FORL 5EU5B 4XCNB 1I85C 1MVUB 2JELH 1C08B 1E4WL 4FQLH 4EN3A 1SJEA 2NY4D 3GJFK 4TUOB 3VGEA 3G9AB 3QDME 1G9NH 3P9WB 1H9VA 1MJJA 2FJGB 4WO4D 3CK0H 4MD4A 3VFOA 2YRLA 3SGDH 3Q5TA 1DBBH 1M05A 3HZKB 1I9EA 4POUB 5B3JE 1AFVH 5DS8A 1WZ1H 4PG9A 3KXFB 2VABA 5CP7A 4WO4C 3MNWA 1ZVYA 4X4XA 4QYOB 4NQDB 3TNMB 4M43L 1I7ZB 1CXHA 2NYYD 4RWHA 4YAQB 3MXVL 4ONGH 3NABH 5EOCL 3C08L 3PJSA 4XP9L 5H94A 3RZCC 3A0OA 3D69A 2PTTA 2D31A 2NYYC 4HC1A 1V5JA 4IIQB 2C4FU 3SDAB 2MHAA 1ZS8B 3OKYA 3CX5K 2N1KA 3C5ZA 2W65B 1TQCC 3FCTA 4OGZA 2OXGA 3BSZH 1MRFL 3IJYB 1CR9L 4WUUD 3VH8B 3ZDYF 5C0RH 1ORSA 4XVSL 4LSSL 1DVFB 1DLFH 1A7RL 5T3ZE 3E0GA 4OCWL 3L3JB 3SKUD 1H5BB 3TT3L 2AXFB 5IFAH 1XR9A 3PQYE 3G04B 1JWMB 3LHPL 4KJYA 1FDLH 5IFHL 4DKAA 4WW2F 1F11A 4NDMB 4LLQA 4H1LA 4UTAL 3EO0B 3KLDA 2CKBL 3VXNB 1RUPH 1I75A 2FZ3A 2GTWA 4LLAA 2V7HB 4A2MA 1ZA3A 4ZPVB 1QQDB 1VPOH 3BGMA 5EDXA 4PJHB 3PGCA 2ZJSH 1TJHL 1RSFA 4Y5XB 3KXFD 3PGFL 3MCKA 2R29L 4ZQKA 1K8DA 3EOBA 3DUSB 2MPAH 3P0YL 1DQJB 1ZWIB 4JGJA 3QUKA 3FRUB 3OGCA 1JI2A 3BAEH 4L8BA 2ZOLB 2QSQA 4K7PL 1IM9B 5I6XB 1F45A 4APQC 2GTZB 5FKAA 2EYSA 3MGAA 4RDQF 3HG1B 3SDAD 4X4ZA 4PBXA 5H35B 1IAOB 4IMLB 3H42H 5IVXE 1DCLA 5FO8A 5AZ2H 2BJMH 2DIJA 3QWOB 1BZ7B 4IIQC 3SDAC 2F5AH 4QF1A 4TNVK 2NW2A 1S5HA 4JZNB 3VD5A 3O11B 1IGYB 1ES0A 4YEEA 1DVFD 4J3UA 3TJHD 2KZ1B 2CXKA 4XCYA 3WN5B 3TA3A 3DWTA 5D70H 3RI5F 1MH5A 3CVIL 1LO3H 1DVFC 1SEQH 4RAUB 3SPVA 3MODL 5ALCL 2HKFL 4RRPG 1H5BC 4OLYL 3NFPB 3OHXB 3MUJA 1CDGA 5I1EH 4MCYA 4ALAL 5I15H 3I6KB 4C4KT 3T0ED 1QG3A