3GKZA

Crystal structures of a therapeutic single chain antibody in complex methamphetamine
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
242
structure length
233
Chain Sequence
b'EVQLQESGPSLVKPSQTLSLTCSVTGDSVTSGYWSWIRQFPGNKLDYMGYISYRGSTYYNPSLKSRISITRDTSKNQVYLQLKSVSSEDTATYYCSYFDSDDYAMEYWGQGTSVTVSSGGGGSQIVLTQSPAIMSASPGEKVTLTCSASSSVSSSHLYWYQQKPGSSPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAASYFCHQWSSFPFTFGSGTKLEIKRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords anti-methamphetamine single chain Fv
publication title Crystal structures of a therapeutic single chain antibody in complex with two drugs of abuse-Methamphetamine and 3,4-methylenedioxymethamphetamine.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 56
structure length 233
sequence length 242
ec nomenclature
pdb deposition date 2009-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gkzA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gkzA01
5KG9B 3JTTB 2VLRE 4AQOA 1QHOA 4Z78B 3N06B 2AGJL 2NY2D 3TBVA 4ORGA 2IGFL 4MQ7B 4KKBC 3JV0A 3ROLA 3VXUD 4U1LA 5JA8B 1FYTD 1FNSH 2CKBL 3PQYA 2K9UA 3U6RA 3O4OC 4N8VG 4L5FH 2P4AB 1FYTB 1WF5A 1G0YR 2W9DL 3PV7A 1FNAA 5SWSE 4JAMA 4ONOA 4WI5A 3UYRL 2Z31C 3O6KH 1K4DA 4UT6L 4I9WE 5I18L 2C5DC 1IFHL 5JOEA 1QKZL 1E6OL 5FUZL 3FCTB 5DZOA 4MQSB 3VA2C 2KKQA 4R97C 4FZ8H 5EBMB 1MFAH 3OKLA 4JKMA 4TRPH 5TE6L 1MCOL 2HTLD 3PHQA 4J3SA 5IIEA 2NY5C 1MF2L 3NH7H 3VI3E 2YEZA 3DYMA 4ZTOH 4WI7A 1S7QA 5CEZL 3ZKMD 2WK2A 2KQNA 3H7LA 3IXTA 1OW0A 3VXRD 1RUAL 4N0RA 1L4IA 3BPOC 4NQXB 2ZWLT 4D3CH 1KF9B 4LPVA 4OLVH 3VD3A 1QBBA 3DX9A 1A64A 5B8CC 4HBQA 3VXRB 3V6OC 1S9VB 1YEDB 1S7RB 2B2XH 4QCIA 1ZWIB 4PRPD 5IJKA 4C83B 2Y36H 3L95B 3FRUA 5EO0A 2FBOJ 3UTQB 4Z8FH 4P2RE 5EUKA 3RUGA 5AD0B 4QOKE 3T0EC 2YPLE 1TCRA 1U8PA 1OVZA 3AM8C 5CIPH 1KYOJ 2RCSL 1K3ZA 4F9LA 4H88H 3SO3B 5LGKA 1SJXA 1UZ8A 2AJVL 4MZ2A 5CJ5A 3DROA 3EYQC 1QP1A 4GRWB 2A77H 4ODWA 2B0SL 3NZHH 4EI6A 3C08H 4IRSA 4B5EA 5DLMH 4ZMAT 1U8NA 2PO6A 3S4SG 3HNTH 4E0RB 1HKLH 5IG7A 4L5FL 3AREA 1MWAB 4OBRA 4LL9A 2D9QB 3O6KL 2VAAA 4NQSA 5GGQH 5IVXE 4Y2OA 2MCG1 5IR1A 5CGMA 2NY4C 2V5SA 4FZ8L 4HIXH 3BX7C 4JQVC 3OJDB 3RHWF 1MFAL 1KJVB 1I1YA 2ZKHH 1FFNA 4TRPL 1T1XB 3RA7H 3UTZB 4HLJA 1AJ7H 2GW5A 5IMMB 2B1HL 4H0IA 2G60L 3NH7L 1JWMB 3MNZA 3O0RL 4ZTOL 4KK6C 3ZDZF 2AABL 4R4NC 4Y5VC 5BRZA 4KKNA 2IAMD 3U2SB 1PKQE 2DLHA 4KK5D 5TDOB 4RGOL 5I16A 1X4XA 2W65A 2YKLH 3MBEC 5DF0A 4D3CL 1BQSA 1MAML 1EEZB 1P7KA 4KJPD 2IAMB 4JRXD 4WW2A 3EYSL 2ZUQC 3UTPE 2R2EA 3T3PE 4FFWC 2Q87A 2Y9RT 3FB5B 4Z8FL 3DO3A 4WHDA 3NOIA 3NPSC 2YD2A 3W0WD 3FQTB 1I7UB 5EOCH 1WV7T 4LHQB 5I6XC 5E0QA 4NZRH 3QIUC 2YPKB 4ELMB 1D9KD 3CH1B 2VC2H 4FQHB 4WU7A 1LO5B 1OL0A 4YHOH 4H88L 4DFHA 4ZFOB 3W0WB 3QI9B 5KSAC 1J86A 1PX4A 5K33A 1JI2A 2ARJQ 1D9KB 4KI5D 1I8IB 5CBAB 3ESUF 3U79A 3C08L 1SM3L 5DLML 4CGTA 5TDPA 3BP6B 3PWJA 3HNTL 1ETZB 1HKLL 4WJ5B 5F7KC 2X5PA 2ORBH 5DT1L 4G9FA 2J12B 1W8NA 2NTSP 2VLJE 1DBJL 2ATPB 3SY0B 5CD5D 1ZHLB 4NPYA 4L9LC 1HNGA 5CLTA 1NGPH 1RSFA 1T66D 3H9SD 4NKMB 1G9MC 1BLNA 5HGHA 1YEKH 5GGQL 3CX5J 12E8L 2D7TL 3VCLB 2OR9H 3QRGH 4J3VA 1KJ2B 2CIIA 2A83A 1MFBH 4ODUA 3H9SB 4HIXL 3BUYA 2ZKHL 3IFOA 5EBLA 4EN3A 1LK3L 3V8OA 3IAPA 2H32B 3LKSA 2BCKA 2EKSB 4XB7A 3WE6A 1NBQA 2AJYH 2DI8A 1U3ZA 2QLVB 3QQ9C 3LQMA 2DYPD 3MV7B 1JV5B 2CD0A 1SVCP 2NYYD 2YKLL 4G43A 3TFKC 4LF3A 1TVDA 2I9LA 1FCCA 1LEGA 2J3SA 2XFXB 3EDFA 4HK0B 2XG4A 4MNQE 2DYPB 4JM2B 4F58H 1X44A 2YD5A 5IW6A 5C71A 3IKKA 5EOCL 2Y7QB 2P5EA 1NGYB 4RIRA 3ILQC 4NZRL 2VC2L 4L9DA 4QNPF 3B2UD 4YHOL 1Z0NA 1GYAA 3TBSA 3TIEB 2A38A 4ZUVA 1BFVL 2EYRA 5GRWA 4I2XE 1MCWM 4ZPVB 5LXGL 3HE7D 3ARGA 4JHAH 3PF2A 5B39A 4M8VA 5F88A 2O26U 3QUYA 4L8SC 3L3DB 1RHHA 3FQUB 4ZQKA 1F3DH 3HE7B 1H8SA 4J3WA 4XBGB 2ORBL 1JPFB 2WBWB 3JWOH 1VHPA 2Q76B 3CMOH 1L7TL 1QBMH 3MJGX 5FUOH 5GZOC 5KVMC 3O3AA 2DLFH 4HS6B 1YEHH 4L4TA 3QNZB 1NGPL 2OQJB 3PL6A 4KRNA 5BQ7B 4DUXA 3WFBH 3L3GA 4M8QA 1LD9A 2VXQL 4QWWD 4Y4FA 1YEKL 1RIVL 1U8HB 4HW6A 4P2OD 3M45A 2OR9L 3QRGL 4BA8A 1IGJB 4MZ3A 1MFBL 1NC4A 1OTUD 4Y1AA 4XPFH 2BP3A 4XI5C 1EVUA 4LOUD 1KTRL 1JRHI 5CP7B 3VXTA 2IH3B 4NO2A 3IXAA 3LPGA 3CVHL 3PJSA 3AB0C 3UROR 2AJYL 4Y19A 5DXWA 4YLQT 1RZFH 1ZHKA 4I9WD 1G9EA 3R1GH 2DB8A 1CFSB 2Z91B 3GSRA 2QSCH 3C6LC 5EC2A 4I1NB 3UPRB 5IK3B 4Z76B 1QLFB 1EZVX 1WLHA 4LEOA 4OGYH 2QHRL 3PDOB 4F58L 5GRXG 5JOFB 4MDJB 3IETB 3IFNH 3C5SA 3RUGF 4OT1H 4NM8L 1DQLH 5FYLD 3QQ3A 5EUOA 2HTKC 1QTYT 4N0FB 2IMNA 3RBGA 1XGRA 2BVQA 5EPMA 3VFNB 1QLRA 5DI8B 4HULB 4JEGB 2FJHA 3QO0A 3D85D 4LCUA 4Z7UE 3OBAA 3RIFF 4XCNB 3WD5L 1CDGA 1BQHB 5C9KA 2WIIA 3QULB 3BP7B 3Q1SH 3KWWB 5GSRA 3EIFA 2A6JB 3HMXA 3RKPA 1HK6A 4YQXH 4PY8J 1DVFC 3VFSA 4G9DB 1NBVH 1S7VA 3LN4B 4TNWF 4OZ4A 4XNZB 5IP4A 2YPLD 1Q1JH 2FIRT 4R7NB 3CMOL 3CZFA 3BEWA 3GIZH 1QBML 4NFBA 4Y5XA 1IEHA 3WJLA 2DLFL 5H94B 3B9AA 2HFTA 5ISZB 2FIKA 2IADB 1YEHL 2Y06H 3ULSB 4GG6E 3GGWA 1LE5B 1KT2B 2MSPA 3N9GH 2CSPA 4JZJC 3S4SA 3WFBL 3G04A 5LVEA 5EZJB 1TQCB 1QSEE 2O5XH 3UBXI 3D3VE 1QSFE 3VFVA 5I66B 4C57C 1LDPH 5LGJB 4O2EB 5DC0A 4PLJC 1P84K 3BD5A 1GOGA 1JI1A 1YYLH 2ZJSH 3RGVD 4RMWA 4XPFL 2DQEH 3BFOA 3ALXA 3RI5K 4DK3A 3GMNB 1GZQB 1PLGH 5ILTL 3GMOB 4KFZC 2HT4C 5H2BB 2HLAB 4WTZA 1RZFL 4XHQA 1NBZA 2Q7NA 1UENA 3R1GL 4MJ6B 4NUJB 3B9KD 2QSCL 4XX1E 5DWUL 1J0YA 3RWFA 3UP1A 3SJVB 4PIRF 1VPOL 3MFGB 4U6XB 2GCYA 1JNHA 3MUZ1 4PJAA 3G08B 3B9KB 5ALCH 4GW5A 2WW8A 5ELIA 3QXUA 3IFNL 1VKXB 2V2WB 4OT1L 2MQCA 4PJIF 4MJIA 2ZOLA 1EUTA 4PJ8D 4RQQB 4GRMB 5EBWB 4WFGE 1TIUA 2EE3A 3VJ6A 3ZDXE 3RZCA 1FZJB 2DQGH 3HZYB 2BOBB 4WEBH 4DZ8B 3GBLA 4M4PA 1Z3GH 4DEPC 4HBCH 5JQHC 1J18A 4IS6A 3HC4H 4JJHA 5BVJA 4Z7NE 3TYFA 3DVGB 1WITA 1N59B 1G7QA 1JVKA 1OGTA 3OKKB 3L3IB 3MRMB 4R0LB 3HNSL 2NMSA 4YQXL 5EZLA 5K9OA 2HTLC 1KCUH 1PDKA 3IB4A 4K7FA 1Q1JL 4MDIA 2Z8WC 1I3RB 1DDHB 3MLRH 3ZKMC 4JE4B 3GIZL 5EU6A 1FFRA 3O45B 3MNWB 1H3PH 1WBXB 3N1FC 2Y06L 4PR5A 5IVNA 3DUSA 5EIIB 4QRRA 3P4OB 1DQDH 2E9IA 4OF3A 1CWVA 2BMKA 2O5XL 5LCVL 1KTLA 4P5KB 4ETQB 3SGJA 1KNOB 2NY7H 1WCBA 1BM3H 4U33A 1JWUA 3OKEB 4P5TA 4LSSH 3FOMB 1YYLL 5CJQL 1JTOA 2ZJSL 3Q6FA 1U92B 3SO3C 5CEXA 2C3HA 2DMKA 4XPTL 2X40A 2QKIB 4P2QE 2VLJD 1AKJA 1DUZA 3CUPA 1PLGL 1DQQB 4CVZB 2IC2A 4JVWA 3TNMB 3U4BH 5AYQA 2BNQE 3P4MB 4N0CD 4BQ9A 2A6DB 4Y16A 5I8EA 5D5ME 3NCYS 1ZLSH 1V05A 2ZCLL 5D7LE 1XR9A 4X7EC 5ALCL 3DV4A 4JFOB 3JTSB 3PWNB 4D8PB 5FYJU 2DQHH 1KYOK 2J88L 4DQOL 1GC1C 2ZNXA 2OX5A 1K8IB 4IMLA 1MHCA 2YK1L 4LHUG 4UU9B 4WO4D 4PP2B 2DQGL 4H0GA 4HCRL 5D72H 1FFPA 2BSRB 1YY9D 2O61B 1Q8MA 4J8RB 1Z3GL 2WWMD 3F7VB 3PWVA 4HBCL 4QXTA 2PYFA 4WO4B 4MNQD 3C60A 5IB2B 1BZ9A 1C12A 1I9EA 2DQTL 3NFNB 3RAJH 4CADA 4N5UA 3NZ8B 5ID0A 1KCUL 5D2NA 3B3IA 3D69A 3MV9E 5DJ8B 1TVBA 5E8DH 5I1CH 4H8WC 1GIGL 1IILE 3HAEA 4LU5H 3GO1H 3DGCR 2IAMC 2GUOA 5F1IB 4LLMB 1LO3H 3RNQA 4OZIE 4X8JB 1OQXA 5I1EH 3PXJA 1DQDL 4KK5C 4HPYH 3SKMB 4WI6A 3MJ6A 1F8TH 2UWEB 4KJPC 1T4KA 3DPBA 3GSOB 4KGJA 1VADB 1G6RB 3VXPB 1BM3L 3VXOA 1NGWB 4LSSL 3SBWA 4BQ8A 4UINH 3RX7A 4LBEA 1L0YA 3LS4H 3QI9C 3WLWC 3GUTB 3RDTD 1U3HA 3TBTB 4P57B 1D9KC 3MROB 4AM0A 1XIWB 5E2WL 4N1HB 3K8KA 3O4LA 3OPZL 3RDTB 1B6DA 2PR4H 4NHUB 4F2MA 4KI5C 1BD2E 4Y5YB 1H3TA 5C0CD 1CFQB 2I5YH 4LASL 1ZLSL 4H20L 4OCWH 1HCVA 1T0NA 1M7XA 5C0CB 4J4PA 1JRHH 2CH8A 5EUOF 4DOHB 3CDYA 2EH8L 1CBVL 4OKVB 3I6GB 1RK0B 5INCA 2IPUG 3FT3A 3MC0A 4K7PY 5CD5C 4JRYE 2DOCA 3S35H 1BHGA 1S7XB 2CDEB 2PTUA 4TNVK 3BMWA 2AEPH 3EO1A 4M6NL 4MNHA 5D72L 3CK0H 5HGAA 2QQNH 2E6PA 5AAMA 3VD7A 4JFDE 4N1EA 4Q2ZB 4RAVB 1XH3B 3NCFB 3RAJL 1RUPH 3IU3B 3RVWC 3BGMA 1B88A 3L3HB 4U1SA 1Q0XL 1RQ5A 3T8XA 2B4CH 5E8DL 5I1CL 1R3KA 2V5MA 3FFCE 5KVFH 3GO1L 1KBGH 3DX6B 1BAFH 1LO3L 5ETUB 5KZCD 4MNGA 5I1EL 3F6LA 4JM2C 2R29H 4HPYL 1ZVHA 2GJZB 4LCWA 3CX5K 4R2GD 2NYYC 3JV6A 1F8TL 2ESVE 2CKBB 32C2B 2AXFB 3O11A 4ZUWB 4JO3H 3KYNB 4TSAH 3F6IA 3NFPB 1BVKA 2P8PB 4KMTH 2A6KA 3GI9H 3OXSB 3GSUB 3LS4L 4FMKA 4YBQD 1C7SA 5DJDB 1KLUB 2FYYA 3RU8H 4EDWH 2X4TA 1NCAL 1H9VA 4G6MH 4JFFD 2PN5A 3TP4A 5A2IH 3ULUL 4QHLA 5CEZD 2PR4L 2C1PB 2EDLA 1C5DB 1PG7X 4JFFB 4R26H 3D3VD 3HE7C 4PJXB 3I9GH 2I5YL 3MRGB 3D39E 3DURB 4PJAF 4QT5A 4FTVE 4OCWL 3E1F1 3T0XA 4UDUB 3UYOD 4W4OC 2G5RA 4UDTA 3BO8B 2D0FA 2R0KH 4H5SA 3VRIA 3T2PA 1JRHL 4JHWH 1CU4H 4UT7H 2G5BB 3IRPX 1QD0A 1J8HE 4NKOB 1SMOA 1PQZB 4DGIH 3S8WA 1F3JB 3VH8B 1IKNC 5C0BB 5JW3H 5KSBF 3S35L 1QRKA 4I3SL 4DCQA 3GZKA 3KPTA 4X6EA 5JW4N 4I18A 4RGMB 3BDBA 5DRZA 3EOAB 4NO0A 4GKNB 3OKNA 4E5XB 4QWWC 1WBYA 2VMFA 4JPVH 2WBJD 5F89B 3IF1B 3KPQB 3MRCA 4ODHH 1KOAA 3L6FB 2BVYA 5MEND 1AGEB 1OTUC 3CDGB 3L5WA 1WAAA 4WRLA 3BP5B 1RUPL 3LQAH 3CCHB 2WBJB 1XCQA 2MNUA 4I0KA 4MB4A 3ROOA 4LOUC 4GKOA 3QXAA 2MQ3A 2VLLB 5MENB 4WFGD 4ZUTB 4MSWB 1KBGL 4KH2A 3ES6A 1BAFL 2YXFA 2FLBT 4YHLH 5I9QB 4GXVH 5D93B 2D9CA 1X5LA 2R29L 4X83A 1EEUA 2CK2A 4B53A 1FV1B 3T4YA 1YJDH 4R7DA 3MXWH 5D71H 1WSST 3DGGB 2D7NA 1AO7B 5GRUL 4LDEB 4N8PA 1LO2L 3TGXA 2HFGL 4EQ3A 4U2ZA 4JHBA 3R8BB 4U7SA 4KMTL 3U46A 1WGOA 4QEGA 1K2DA 3GI9L 4WWKD 3VXNB 3AS0A 4XBPA 1J0JA 5GHWH 4CVXB 3RU8L 4EDWL 1GOFA 2R15A 4OD2B 5IW1B 1VENA 5FB8A 2VIRA 4G6ML 1NDGA 1H5BB 3PIQA 4PJ7A 2YBRA 1ZA6B 3ARFD 3EW3B 3QZWA 4HK3J 4WWKB 2H1PH 4HC1H 3ALPA 2V7NA 5BVPH 3ZE0E 3KPRE 1K9TA 4R26L 4F8QA 5I1JH 3ARFB 4XNZC 3I9GL 1L0XA 4HIEA 3NA9H 2E7MA 3V9FA 3KS0J 5E6ZA 1NAKL 3WEXA 3WNMA 4BELD 2R0KL 4PLOB 5GXBB 3JVGC 4JHWL 2DKUA 1PAMA 5JDSA 3D2UD 4CDHA 4MJ5B 4F7EA 4P9MH 3D0LA 3QFDB 2BNUA 3MLYL 1TQCC 4DGIL 3WSQH 1HHHB 3IJHA 3ZKNC 3DTXB 2UVEA 2X4NB 5JW3L 4D0CA 4OFVA 4GAYA 3LRHA 3WLBB 1OAZL 2R0WH 5F71A 3VI4E 5I1LA 4JPVL 4LSUL 4ODHL 3FOLA 5IM7B 3PWPA 4X6DF 3RRQA 3BWAA 5CIPB 1OB1A 3CDFA 4LHUA 4XWOD 4RFNB 3HZKA 5HHOD 3RWGA 1KXTB 1JP5A 4LKCB 3OR7B 4DVRH 3LQAL 4PJBE 2GITB 1IQDB 4HUVA 4UNVA 4MXQD 3T65A 5C7XH 2AEQL 3EDJA 4AEIH 1IGTB 3MRIB 5HHOB 4KPHH 1AGDA 1OD9A 5K59E 4X4XA 1ONQB 3LKOB 5C0IB 4WDIB 3B9KC 4P5MB 3ZSSA 1CLOH 2VISA 5D71L 4QHNB 3X3GL 3T3MF 1U9KA 1DZBA 4XAWL 4XNMA 3O3BA 4PYGA 1QQDB 3PQYE 4QRSA 1MI5E 5GHWL 2RJMA 4FQ1H 5HPMA 4XWGH 5J1TC 3U0TB 7CGTA 4LVNB 2PW1B 4DN4L 5JOPE 4HT1L 1QEWB 4AT6B 6FABL 4WUUD 3V6FB 3ZKXB 1NFKA 1FNFA 2H1PL 4IHOA 4HC1L 1UGNA 5BVPL 1A6AB 3ARSA 4R0LC 5AUMA 2OK0H 4FP8H 1DLFH 1CI5A 1IVLA 1BFSA 2X10A 4AG4H 1INDH 4WUUB 1YQ2A 5GGRA 2BX5A 4D9QE 4OZIB 1DLHB 3NA9L 2DF3A 4MMZC 4E42A 2D7PA 3FFDB 3QWOB 4D94A 1RZKH 3MREA 5IESH 1S9KC 4LLDB 3CFJB 4PJHE 4OCMC 4NQEB 3WSQL 2G2RA 2Z31A 3VD4A 5JO5B 3CFBA 4WGVB 1ZLWK 1OPGH 4PJDB 4FNLH 1Q9OA 4FOMA 4M6AA 2A6IB 2CUIA 1KN2H 1E4JA 1BD2D 4ODSH 5FDYA 1CG9B 5TPWH 3MRKB 3VWKA 3EDEA 4WGWB 3FONB 2P49B 5AZEH 4HJGA 1QSZA 4DVRL 3EZJB 3P0VH 3IAQA 5FGSA 4Y4HA 4CN1A 3MSPA 4OV6F 15C8H 5C7XL 3GIVB 4P46D 4JRYD 4AEIL 4X4ME 3P3YA 3NCEB 4BSWA 3W81A 5D7SH 1I9RH 1HQ4B 1JPTH 4KC3B 5F1KC 5GJTL 5B8CA 1RAMA 1MCNA 4P46B 1KXQE 1HQRA 1N8ZA 4LLQB 3HS0A 1YA5A 4NRYA 1J7VR 2VLME 2X4OA 3L5HA 4JFDD 1KUMA 3T0EA 4NQDA 3AM8A 4G8IB 4HGKC 3P4NB 1P2CB 1JUFB 4R96A 3I3DA 2APFA 4FQ1L 3ZKSD 2JLLA 1CE6B 3WS6C 2VXSH 3FFCD 3EJYC 5IB1A 4MLIA 3O8XA 1GAFH 1WZMA 3KLAB 4WO4C 1OD7A 1Z9SA 3BH9A 4TTDC 5DJXA 1DLFL 4NYLB 3SE9H 1YY9C 2AV7B 3QHTC 1HH9A 2VXUH 2WWMC 4AG4L 1KPRB 3T2OA 4V2BA 1WUNT 5FM8A 4UNUA 4U1JB 3MGTB 5CSZB 3X14A 2PUQT 1G7PA 1W8OA 3CVHB 3HAEH 4RCAA 4PGJA 3DO7B 2FWOA 1RZKL 4V1DA 5IESL 5T1MB 4XH2A 5E2VH 4Z0XA 4JZNA 4LAQH 3O9WD 1KCLA 1A5FH 3QEQD 1EHXA 2AV1B 2XKNB 4U1GB 1MCEA 1OY3B 1PJ9A 1NFIB 4WI8A 4FNLL 4HKJB 1KN2L 4XP6L 1RK1A 2H8PB 3O9WB 4U4BA 5C0EA 4O51B 3QEQB 5EZOH 3G6JB 3WXWH 2RAMA 3D39D 2K3TA 2WV3A 4PJGA 5MEQA 1CXLA 4EDXA 3ESVF 1EGJA 2OXHA 1WAAF 1KCSH 1TETH 1JZ6A 4PV8A 5AZEL 1XIWC 4AJ0A 3HUJE 1ZT7A 1J8HD 1LE9B 3RDTC 4O2CA 4XXDA 2XWTB 3KJ4B 1N0XH 1FSKB 15C8L 1JK8B 3L7EB 3HG1B 2JB6B 1KN4H 1N2RB 3ZT6A 3LEYH 4OGXL 4Y5YC 1QO3B 5FO9A 3MBEA 1IGYA 2X4SA 5D7SL 4EBQH 1HWGB 3FQRB 3MGOA 2C3WA 3U7YH 3BVNA 1JHKL 5C0DA 1U8JB 1GGIH 3IDMA 2FHCA 4OZHA 5CP3H 5A16B 4LCCB 4F9PA 1C1EL 2AK4D 4HIIA 1PEZA 1TVHB 4OLUH 5KBNC 3QIUA 4YPGA 1XR8A 5EO1B 3FTGB 4ZFZB 4P49A 2VXSL 3IGAB 2AK4B 5KSAA 1KB5H 3GHBH 4QGTA 1GAFL 3QDJE 1AD9A 3JWDL 2W0LA 1B0GA 2DMCA 3SE9L 4MX7B 2V7HA 5SWQB 5L2KD 2IPKA 4K7PH 1L6ZA 4O2FB 5T1KA 3BESR 3GMQB 4LCIH 5DJ0B 3UO1H 3JWNC 2BSSB 1WZ1H 5F8RC 2FJFA 4M9PA 4BZYA 1H15A 4PREB 5L2KB 2UV3A 3RL2B 1X7QA 2D7OA 2EIZB 3F7QA 4NN5B 5E2VL 3T09A 4LAQL 1XGPB 1A5FL 3THMH 2IANB 3KHOA 1PYWB 1EMTH 2CLRB 5HYSG 4PRNB 3KPRD 2MHAB 4M43H 4CDGC 4R2GC 1UKTA 2WP3O 2QV2A 2ED8A 4S1SL 5EZOL 3WXWL 1P7QA 1E4WH 4QTHA 2XKUA 3MRPB 4YEEA 1KCSL 2WBKA 4FXKA 1IAMA 2VLKE 1FVDA 3RVVD 5EU4B 4F7CB 4N0UA 3ZDYE 1FHGA 2VL5B 1SY6A 4YBQC 2AJZB 3PDDA 1JNLL 1KTDA 1O0VA 4XPAL 1N0XL 2P5EE 1KN4L 5F7MC 1UWXH 3HR5B 3LEYL 3A6CH 3OAUL 4JKWA 4KVCH 4WTWA 3V0VA 3QEHA 3R06A 4BFIA 1LWRA 1IC5L 1B0WA 1I7ZA 1OF2B 5L2JB 2A2QT 4FQ2H 4X80H 3U7YL 2EDFA 3HZVB 1JZ7A 5C09B 4HIHB 1GGIL 3RVUD 3E6HA 1VACA 3TBYB 5M7QA 1FLTX 4KQ3H 5T1LD 2IQAB 1RUKL 1LVEA 4WEUD 5CD3A 1MVUA 4RGMC 3BPNC 2QSQA 4NN6B 3RNKA 4MYWB 1KB5L 3TA3D 3GHBL 1YY8A 5T1LB 1R0AH 3F12B 3ARDD 2AK1L 3NABH 4JCMA 3IFPB 2RQ8A 1RFDL 4L4TE 3VFGL 2QQKL 4NBXB 3TA3B 5D8JL 3NIGE 5CKAA 3GBNH 2WBJC 4LMQE 1EFXB 2P8LA 3ARDB 2ICES 4X6CA 4K7PL 3BH8A 2IH1A 5GGVY 2XPGB 3KYOA 1ACYH 4A2LA 4LCIL 4OLXH 2DIJA 3UO1L 5FGRA 1WZ1L 3EYUL 5I1DA 1UQSB 1WTGT 1WWCA 3JBG7 1VFBB 5I9QC 1EAPA 4G8EB 5GSVA 5D93C 1QFWI 4HF5H 1A3QA 3QUXB 5C08B 1QYGL 1LDSA 5JOPD 1AP2A 4EVNA 4ZS7H 1GZPA 3THML 3I75B 4QRUB 4Y19E 1AGFA 1EMTL 4M7LL 4OZFH 4PRAA 4PGCA 4HKZA 5L88H 1ED3A 3QYCA 4TSCH 5EC1A 4HAFA 5ADOH 2XYCA 4FFVD 4H25A 3W9DB 1E4WL 4KQ4H 4MXVF 5EOCJ 1G6VK 4R4FH 4FMFA 5E8PB 2WANA 1H5BC 3AXLA 3B2VH 4S11A 3VMOA 1RZIA 4G42A 3EBAA 5I73C 4XAKE 4ALAH 5IUSA 3GKWH 4WWKC 5DUBA 5D70H 4PJEB 4MD5A 5C07A 3I6LE 2BJMH 4NZJA 5C0ND 3A6CL 4KVCL 3ARFC 2HYMA 2OJEB 4KXZI 5ERWB 3FB8B 3OHXB 2ZSVB 1J5OL 4ODXA 1Q9KB 4X80L 1GGTA 3KPPB 3TEUA 3QFJA 1A7QH 2HFEA 1KULA 3RWCB 4QHMA 1BZ7B 3BMVA 1X5HA 4Z0BL 4KQ3L 3RIAK 4JG1L 4U1IA 3T1WA 3K74B 5DS8B 4AH2A 2ZUTA 4XXCC 1HSBA 1KLGB 1YEGH 1N26A 1FZKB 1FLRH 1R0AL 3GHEH 5D1QA 1OGAE 3NABL 3BDYH 3U0PA 1X5ZA 1KIQB 4HXBH 4FQLH 3RZWA 4ONFL 4RFNC 4QRPA 1P4BH 4JPKH 1NFDE 5E6YA 5I1AA 5HYFA 2ZG1A 3GBNL 2VLMD 3QH3B 4JRWA 2E5EA 1DVFA 1JFQL 1SMAA 4XNUL 2DQDL 1ACYL 1MRFL 4YZFE 4OLXL 4WW1B 3QIWB 3FO0H 1LP9A 1M05A 4GW1A 2HH0H 4HF5L 4Y4KD 3X3FH 5C0FB 4MXQC 5A3IC 2ARJB 5FFLA 1UVQA 1YMME 2YWYA 4JZJA 1IAIM 1W72B 4ZS7L 2EDJA 1QVOA 5HVGB 4ZDHA 3EYVA 5KJRH 3CIQA 4YNYA 1KGCE 4Y4KB 5L88L 4TSCL 4EZMA 2P5WD 1JTPA 3OJMB 1AH1A 2B5IB 3MLZH 4PJGF 4WTXA 4KQ4L 3ARBA 4A6YH 4NQCA 5DUPH 2QQLH 3KPLB 4LVNC 3MRQB 3SGKC 5IHLB 2P5WB 1XMWA 3B2VL 1F2QA 4YBHA 3ZKXC 4ALAL 1YEJL 1YQVH 5CSBA 1ZEAH 2RBLA 4MQ7A 1S7UA 4FXGB 1VERA 5H37G 1AI1L 2EC9T 3MACH 4YFDB 4OD1L 2ITCA 4KKCD 3BKYL 3HE6D 2X4QB 2C4XA 2H2SD 3VFWB 1I8LC 3VXUA 3NPZB 2R56H 5I76A 1F3DJ 1OWRM 5CINH 4OZHF 1A7QL 3MV8E 5JXEA 1RULH 1S3KH 3HE6B 5DJCA 3QQNA 3TO4D 2YRPA 4Z7VB 2CPCA 2O5ZH 3S7GA 1T21A 3D25B 1MCPH 3HN3A 4KDTC 4DZBB 4KUCD 3TO4B 1FLRL 2XRAL 1DBKH 3GHEL 1CDBA 4XMPH 4CW1A 3X17A 1AR2A 4HXBL 3LKQB 2X1PA 5CCKH 4JPKL 4WENB 3ULUD 5MERB 4YR6B 4E41B 2LFGA 2BHYA 4HS8L 1BGXH 1YUHB 2OMBA 3QNYB 3LEVL 4J6RH 3V7AE 2HH0L 3AU1B 1MOEA 4PJCF 2V9RA 5IVZA 1A6WL 1S5HB 3VXRA 3X3FL 5DMYA 1S9VA 1YEDA 1I8MB 1UKSA 1S7RA 4P46C 1CGUA 1ZWIA 4HS3B 3IFLH 4C83A 3QDJD 4IRJA 5KJRL 3MLUL 5AD0A 1T04B 4EUPG 4FQIL 1UYWH 1MJJB 1AHWB 2AI0L 3MLZL 4PRPA 5FCUH 3PGDB 5C6TH 1S8DA 4I3RH 4Y2DD 5DUPL 2WZPD 3MRHA 1HSAB 4L8DA 2P8MA 3LRSB 2PCPB 1OT1A 5HYSA 4ZFFA 1IL1A 4XMKH 2ILLA 1YQVL 4YAQB 3DUUA 2BVTA 1ZEAL 1KIPA 3VDCA 5DYOB 3PWUB 1RJLA 4NNYB 4WFFE 4QXUL 4RNRB 5BJTB 2YD8A 4OZGE 1U8IB 3CX2A 3DIFB 3O6LL 3MFFB 1QG3A 1NJ9A 3F7PC 5CINL 5ALBH 1MWAA 3DXAE 1D6VH 3FN3A 4H1LB 1S3KL 2B39A 1YECL 2VLKD 5DK0B 2O5ZL 1MFDL 5IMKA 3QG6B 4U1GC 3CFKB 4HPOH 3RVTD 1ES0B 5ACLA 5D2NE 3RWHB 4G7YH 4XP5L 3LKPA 1TDQA 1BFTA 5GGUA 3O9WC 4KJYB 8FABB 1DBKL 4YGVA 3RKDD 3UTZA 4K9EL 4D9RE 5IMMA 3MMEB 3TIDB 3W5MA 1IGIH 1JWMA 1JGVH 5CCKL 2XN9D 3REWB 3EYOA 5DHXB 1R3LB 5SWZD 2CDGA 1Z5LA 3U2SA 2NX5D 3KJ4C 1UB5A 4LNRB 5FEBA 4PV9B 2GTZB 4Y8AA 2XN9B 4ZS6D 5DMGD 1EEZA 2C3VA 5SWZB 1ZTXH 1T80A 1OAYH 2IAMA 3G6AA 5F9OL 2VR4A 5F9JA 2NX5B 4HH8A 4YDVB 2LVEA 3UBXB 3IFLL 5B38A 3WNPA 1OAKH 5MEOB 4LCCC 3I3BA 3MRJB 3EJZD 3FRPA 4JRXA 1YPZB 1J1XH 1CICB 2OZ4A 5CKGA 1UYWL 1FL5B 4YE4H 5D96B 3CH1A 5FCUL 4QHUB 5BXFA 1EV2E 1LO5A 4XVJH 5C6TL 8CGTA 4I3RL 3ZTNL 3W0WA 1HHIB 1II4E 1U58B 4NRXB 1OTSD 4TNVF 1EO7A 2EIDA 4KU1A 4XMKL 1D9KA 1M7DB 5FM5O 2ENYA 3IDJB 5DMKB 5AEAA 3FN9A 3O2VL 3WFHA 2XG5A 2YD4A 3BP6A 5KVGH 2DQIH 3I6KB 2HFFB 3I02B 3QPQD 3PNWB 3LMJH 2ATPA 4MD0B 5ALBL 2ZUVA 1D6VL 4OKDA 4L3ED 4NN5C 5FXCH 3DBXA 2ZUYA 4XAKD 1KG0A 4NO5B 1G9MH 4HPOL 1KJ2A 4H26B 4L3EB 4MA7H 3O3DB 1KCVL 3VRJB 1U2HA 5ANME 3C8KA 4KXZH 3MO1B 1LO4H 2H32A 4CVWA 3F5WA 3G5YB 1IGIL 2EKSA 3UTTE 2DMBA 2W91A 1J05A 5BMFH 5HDOA 3BIAX 3INUH 4APQD 5IFHH 4DW2L 3RVVC 1LP9F 4ZYKA 3RWEB 1ZTXL 4HHAA 1OAYL 2NY6B 5D7KE 4HK0A 4N0YH 5I1GL 3EO0B 2DBLH 5GJSH 1OGAD 3DV6B 2EH7L 1NSNH 1IM9D 5AYUH 2GSIB 3SDXB 2LU7A 4NOFA 2APVA 4YE4L 2JCCE 3RVUC 4I0CC 4XVJL 4C58B 4NN6C 1Y6NR 2ADJB 4LQFH 2XICA 2VUYA 2CR3A 4R4BB 1QFWL 3ILPB 5C86A 3NCCB 5JIKA 4F3FA 3UAJC 1K5NA 3TA3C 3G5VB 5DRXB 5KVGL 2DQIL 5CWSA 3ARDC 5DDHA 3W9EB 3WIIH 3EO9H 1KGCD 3HE7A 1N4XH 2HG5A 4XBGA 4U6YB 2F54E 4HGWB 2ZG3A 4PG9B 3TVMD 5I71B 2Q76A 5TJWK 1G7JB 3LMJL 1ORQB 1FVEA 3LN5A 4LGSB 5FCSH 4W4OA 3H0TB 4HS6A 4PJ9D 2GT9B 2J8UB 3NCBB 3VFUB 2AXHA 4TOYH 3H3PL 3WN5A 3UJIH 3TVMB 4TUJA 3LKRA 1G9ML 1U8HA 1IKNA 5F3HB 4LVOB 2WINB 4PJ9B 1CYGA 1H8OA 1IGJA 2R4RH 4XCCL 1MFEL 5SX4I 4OLZH 4DN3H 4KKLD 1WWAX 4RSVA 1LO4L 4S0SD 3VMPA 1B0RB 1Z6JT 4U1KB 5EFIA 3MXVL 4H0HB 4IOFD 4WU5A 2OR8A 5GISH 4P2OA 1EO8H 1B90A 1AGBB 5CP7A 4LLVB 1D5BB 2IH3A 3T08A 4JJ5A 5BMFL 3KPMA 3INUL 3MV8D 1YMHA 1E6JH 2I60L 3EDKA 1ZMYA 5GIRA 3ULVF 4L3CB 3QT2A 5HI4D 1CFSA 1OSZA 4XC3H 1I75A 1UXWB 3RPIB 3QIBD 5IK3A 2Z8RA 4AL8H 4N0YL 4JGUA 2DBLL 4BKLB 1U8KB 2VZSA 4F37K 5C0NC 5HVFB 3IDYB 4JZOA 5JOFA 2J8OA 4MDJA 4O58H 1NSNL 4PJ7E 3IETA 3EHBD 3SDCA 3QIBB 4PLKD 5AYUL 4CU6A 2JB5H 2HVJB 2CRMA 1J8KA 3K1KC 4N0FA 3UZVB 4LARH 5KSVB 4HH9A 1EO5A 4XTRD 3CFCH 1R5IB 3VFNA 1NUFA 4FABH 1NAMH 5DI8A 1KLFA 4EQ2A 1WK0A 4QHKI 3M17B 4XCNA 3OKDA 1ZT4B 3QULA 5TDNA 1ZHNB 3BP7A 4GFTB 4POYA 1T83C 4LCYB 4MJ4A 3D85A 4WHYH 5D6DA 2EDNA 3AAZB 1JZ3A 3MJ9A 4CNIB 4POUB 5JPNA 2DD8H 4G9DA 4PUBH 4Z7WB 5I0DA 3EO9L 4XRCA 2GHWB 2FL5B 4WY7H 1N7MH 1SBBA 5D7IE 2CKNA 3QIWC 4UILH 3DVNB 3R0NA 1CDYA 3CGTA 4XNYL 4P2RA 5H94A 4K8RH 2IADA 1KT2A 3JVGA 3PWPE 4LLYA 2YPLA 5JQ6H 4TOYL 3SDYL 3QWQB 3OKMB 4XNXH 2B20A 1EHLH 1EEYB 3OR6B 3QNXB 3NVQA 2J1KA 4KTDH 4RRPG 1HDMB 4Z95H 5GS2D 1NGZB 4Y4KC 2F5BH 1MLCB 1SEBB 1I3GH 4L29A 3HFMH 2R4RL 4O2EA 5DEZA 5GGVL 2GAZB 4DN3L 2B5IC 5GISL 3T0AA 4U6VH 1OP9A 1HHJA 1KIRB 2Z35B 1A9BB 3DRTB 4YHMH 4HG4J 2KUTA 2DI7A 1TJGL 2ADGA 1GZQA 2W60B 5T3XH 3DXAD 4ERSH 1NUNB 3RGVA 1E6JL 5ESVB 4MD4A 1D5XB 2PTTB 4MJ6A 4NUJA 4XC3L 3TC9A 3HPLA 3D87B 4U6XA 3GSXA 5L8LB 3ME0A 5FYKU 1JF1B 1R3HB 3QJHB 5IQ7H 3VGDA 2ZCKH 3MPCA 3C09B 2DWEB 5IVXA 5FDWA 4MQTB 1ODAA 4KKCC 3HE6C 1TQBB 2JB5L 2H2SC 1VA9A 1Y18A 3O6MH 1PZUB 1S7SB 4L4VD 4LARL 4RQQA 4GRMA 5EBWA 3CFCL 1U93A 3V5HB 1NAML 1FZJA 3IJSB 3HZYA 3TO4C 1T1WB 4XX1G 3WIFA 2NQCA 1IAOB 1UB6A 3MODL 1CGWA 1DP0A 4HKBA 4GS7B 4L4VB 4PJ8A 4DZ8A 5BZWA 1JNNH 4JG0H 1JPGA 1INQA 1N59A 1FZOB 4YGAB 3OKKA 1F6AB 3L3IA 5ECJE 4LGRB 4R0LA 5DJ6B 2BRQA 2GK0B 2DD8L 4PUBL 3EFFB 3VXSB 1V3MA 1T22B 5ABDE 3IDIA 1I3RA 1DDHA 4NKQB 1ZSDB 4G6JL 3Q5YA 3O45A 3P9MB 1REIA 2HT2D 3ULUC 2BVPB 2LU4A 4PY7B 4FQCL 4ZOBA 4LEXL 5TGBA 4K8RL 1G7HB 5EIIA 3P4OA 5JQ6L 2CK0L 3DX8A 4XNXL 3QDGE 3ARRA 5HHMD 2KBGA 3MTRA 4AIZB 1EHLL 4KTDL 4DVBB 3DMMD 2F53B 1OM3H 5CS7A 4XBEH 4ETQA 1OAXH 2F5BL 1KNOA 2E27H 3HFML 3PG2A 4OUUB 3OKEA 4QLRA 1AHWC 4X5XB 5HHMB 3FOMA 2D0HA 4R8WH 4X9FA 3DMMB 4HWUA 4U6VL 3MRNB 2QKIA 3LRGA 1AD0B 4X99B 1CK0L 3LB6D 4YHML 1UACH 2NXYD 3V6OE 4CMMB 4GAGH 5T3XL 4ONHB 4ERSL 3N50A 2W0KA 3T0DA 2C7UA 4GRWH 5F1NB 4Y2DC 2SEBB 1HEZB 2AS5M 2W1NA 1DQQA 1DQJA 5J57B 1KB5B 3STLB 1TLKA 2AJ3B 2VLJA 4K55A 1RJZB 2NXYB 4TQEH 4NQDE 2EE6A 2A6DA 1XEDA 3CSPA 1CT8B 3OB0H 2DLEA 3CC5A 3KYKL 4XP1H 5C70A 4R6UA 4X6FB 3SQOL 5CJBA 5IQ7L 2ZCKL 5GGTA 5E4IA 1IEBB 2DS4A 4GW4B 4JFOA 1BPVA 3MLWH 3PABB 3O6ML 3ZYOA 5DSCB 1JN6B 1I7RA 3S35X 3GSQA 3WDHA 4PP2A 5DD0H 4CN4A 5E5RB 1IKFL 4XCYA 5BCAA 4LPXA 4GBXD 3WS6A 2BSRA 3P73B 5DR5H 1LEIA 1J87A 1JNNL 3DHMA 3RVTC 4J8RA 5D7KD 2JK5B 2DLGA 2OTWB 4JG0L 4V1DE 1UM5H 5E9DD 3GSNL 2LAGB 4OSUH 4QXGL 1EFQA 5DJ8A 3HB3D 1A7PH 3BYTA 4MNQA 1DQMH 3JXAA 4LSPH 5E9DB 4U1NA 5IBUG 4O5LH 4ZUUB 4XT1C 2VR5A 5IV2B 1A1MB 3KHQA 4S2SB 4X8JA 4ZG1A 2FZ3A 4YHKH 3SKMA 3KPSD 1KJ3L 4ZS6C 5DMGC 2QSVA 1OM3L 4XBEL 1MJUH 1OAXL 1MVFA 1VADA 4C56D 4I2XA 3KPSB 1D5MA 1NGWA 5D96C 3WO4B 1KPVB 1CCZA 2WWKO 4QF1B 2VZOA 3U1SH 2F54D 2WUBL 4C56B 3H6JA 5I15H 2OJZH 1MJ7H 4P57A 4GAGL 3PWLB 4W6YB 3N85H 1ZVSA 4OZHE 3CXHJ 1CR9L 3BE1H 1OTSC 3RDTA 1S7TB 3CSGA 2H45A 4TQEL 5FKAB 4Y5YA 4NJAL 1CFQA 5HDLA 4LLUB 5SX4H 4XP1L 5J0BA 4NWTL 3PGCA 1SBSH 3LQAC 3OKOA 5CGTA 3MLWL 2V2XB 5C0CA 3BXNA 3QPQC 2Z93B 1U8OA 2C1OB 5DUML 5KW9H 3OJ2C 3WFZA 3AY4A 1OWWA 1A14H 1S7XA 3VI3F 4Q9CA 3BZEB 5M94B 5F7DB 1BBDL 2UUDK 2X4RA 1X4YA 5I30L 5IBTH 5FHAH 5E95B 2XTJB 3REVA 3MLSH 3AFLA 4Z77B 4OZFB 3ZYZA 1NQBA 4ODBD 1JPSL 1AIFB 2R1XB 3PP3H 4Q2ZA 1UM5L 4RAVA 5IEKA 2NLJB 3JV4B 1XH3A 4OCRL 1T5WA 1ZHBB 4YDLC 4OF6A 3IU3A 4OSUL 1VB9A 1Z2KA 4K3JH 4Z9KB 2QADD 1A7PL 2VDKH 4NNXB 43C9B 1RZJC 1DQML 4LSPL 1A1OB 4O5LL 4QRTB 2NY6C 4APQC 1K85A 5HY9B 1C7TA 5ETUA 4NJ9H 1AR1D 2QADB 2B8OT 4LK4A 3P9LB 4YHKL 2GJZA 3SHSA 3E6FA 4DTGH 2BVOB 3MUGB 2XXCB 4FFYL 2CKBA 2QEJA 1PG7H 1MCBA 2AXFA 3NIFE 1A9EB 3NFPA 1CD8A 4DGVL 1A7NH 4MCYA 4XMLH 3EOTH 1A3RH 4MCZA 3U1SL 3U36B 4ZFOL 1QNZH 1UH4A 1JGUL 3V0WH 4RRPA 5I15L 3TNNB 1XGYH 2LAAA 1SYSB 3N85L 1ADQH 4G6KH 4PRIE 3BE1L 1ND0B 1AGCB 2A0LC 3T1FA 4JFFA 3V5DB 1N3NB 3CPLA 2V2TB 4PJXA 1BJ8A 3LEXA 3S5LB 4EOWH 3MRGA 4Q9QL 5I71C 3TZVD 1U8MB 4TPRL 5D7JD 5IVXF 5LGHH 5DJZA 3RL1A 5I19H 2AEWA 3D3VA 4GLRI 1FVCB 4MAYB 4ISVB 4HUWB 2J6EH 1HXYA 3TVMC 4NKOA 1PQZA 5C8JA 5D7JB 3RTQD 4RGNB 3VH8A 4CKVX 4LVOC 5CJXC 1A14L 4PJ9C 4X6CE 3EOAA 4GKNA 4KZEH 5IBTL 2VZTA 2XQBL 5FHAL 4E5XA 1KSRA 3MLSL 3RTQB 1YZZA 4HJJH 4JN2B 4HJ0C 3G6DH 3QQ4B 1O7SA 2Z92B 3L6FA 4X5LA 1U6AL 1HXMA 2ADIB 3CDGA 3E2HB 4KKLC 3BP5A 1A21A 1CL7I 3FB6B 3SCMD 1PKOA 1S7WB 1FNLA 2NR6C 1C08B 2WBJA 4RA3A 4O02H 3T3PF 4JFEB 5J4MA 1NH6A 3U30B 5MENA 3C5ZD 4ZUTA 4BSJA 4RFEB 1JWSA 4MSWA 4S1DD 2X05A 2RIKA 1F6FB 2FJGA 4WVRA 4NJ9L 1CDHA 1BFOB 5HI4C 1B2WH 4MA8L 5EG6C 5JZ7D 3KYMA 1XGQB 3IDYC 3MCLH 4P2CG 5FV1L 4DTGL 3S98A 5B3JE 4JCLA 5KS9E 5CJOH 2VWEC 3QIBC 1FO0B 3B9DA 1DR9A 2BSED 3DGGA 4WEMB 5FO8A 5C07E 4J23A 3VXME 4ZAKD 1ZS8A 1MQ8A 1A7NL 3CVIH 4XMLL 5E1HB 1A3RL 3EHBC 1RZKC 1YYMH 1QNZL 5FYLH 1BJ1J 4ZAKB 3V0WL 5IW1A 3BZFA 4XTRC 4LFHD 1H5BA 1XGYL 4JY6B 5DMIH 1PBYA 1KV3A 1ADQL 4WWKA 3L3KA 1OARH 3QDGD 4G6KL 4KDVA 4CAGA 3N1QC 1NBYA 2E3VA 1E4KC 2R23A 3MRRB 2YSSB 3ARFA 2ZSWA 3QCUH 4EOWL 3NMEA 4Z7OE 2EDQA 3GJEA 4ZUSA 3MRBB 4PGBA 4U0RB 4XCEA 1J10A 4I4WB 2EICA 5LGHL 1A0QL 3K8MA 3BPCB 5JXAH 3RWJA 3HRPA 2X9WA 1X5KA 4QY8A 2X4NA 4GKZA 2NW2A 1WWBX 2DQJL 4Q74A 2LU3A 3D2UA 2IFGA 5ITFB 5CZVH 4U2YA 4Q7DA 4HJJL 4A2MA 2GSGB 3G6DL 1J0KA 2OCFD 3BD3A 5D2LE 3WS3A 3WNLA 1C5BH 4MB5A 4PG2C 5CIPA 3Q6GH 2BNQA 4YHNA 5DD6B 4ZSOB 2QBWA 4LKCA 4I3GA 5D5MA 4O02L 1CLYH 1CGXA 5D7LA 4BUGA 4RMQA 5IROC 1KCKA 4L8CA 2V17L 3JWDC 3MRIA 3MGAA 1DEEB 1CTOA 1JCKA 2F5AH 1ONQA 5C0IA 3SDAD 1JYXA 3C09C 5F70A 3MCLL 4U1LB 5T3XE 1TQBC 4OCNC 3VU2A 5DRWB 4XCFH 3SDAB 3RJDA 3CVIL 4LGPB 3B6SA 1QQDA 1MIML 2OBGA 4HG4K 5J6GA 2PNDA 5HGGS 1SJVA 4HMDA 4I13B 3HI6L 2QL1A 4MMXC 5DGRA 4CJ1A 4GS7C 4JAMB 2VDNH 3SGKA 5IWLA 5DMIL 3IKCA 1FYTE 5E99H 4AT6A 4TVPH 3V6FA 3CLFH 3MV9A 5D6CB 3ETBF 4XPBH 1NCTA 1OARL 1A4KB 3C2AH 4FN0A 2I9TA 3BP4B 2H3NB 4KK6D 4O9HL 1CDJA 3TN0D 3GB7A 1O5DT 5DZNA 1UH2A 2X1OA 4WUUA 3QCUL 4OZIA 3PHQB 3BRFA 4W4NA 5IIEB 1QLEH 35C8L 5DEGA 1IAIH 3SE4C 1I8LA 1GSMA 1S7QB 5FIEA 3TN0B 3WXVH 2YPVL 5JXAL 1BWMA 1ZANH 1UM4L 3IXTB 5ITBH 2F19H 4LLDA 4ACPA 3TH3T 4IRZH 3VFOB 2HAZA 4PJDA 2COQA 1NEZB 3DX9B 4KDTA 1CDCA 1TJIH 1A7BA 1BVZA 4QCIB 3DMMC 5FA4A 2IMMA 3FRUB 5EO0B 1B4RA 2APBA 3ABZA 3VXRE 1EJOL 3G5XA 3SDDD 4Y7MA 3RUGB 5L7XH 3P9WB 1YEIH 3Q6GL 5I75B 5JW4M 4RWYH 1BD2A 5IB3A 1MIEH 1R3IH 4P4RB 4M9OA 1T0PB 3KJ6H 3LB6C 3WFEH 3SDDB 2VXVH 2NXYC 1UZ8B 5LAXA 3GIVA 4NQVB 2OTUB 5EORH 4HUXA 1PVHA 4ODWB 1DL7H 1HQ4A 3MYJA 2APTA 4EI6B 2MMXA 4UTBH 5E94B 4IRSB 2DM7A 1A4JB 4JRYA 4P46A 5GGTH 3FO9A 3OG4B 4D0DA 4Z7UF 1U8NB 4GRWE 2NTFB 2PO6B 4X7FC 2UZYB 4XCFL 3S34H 4FQQA 4U6HB 5T3ZH 4C54A 3AREB 4G8IA 1LILA 1P2CA 2PXYA 2OM5A 4JFDA 2XZAH 1CE6A 1UWEH 4NP4H 2VDNL 4X98B 5J8OA 4GXUM 3VG9B 2CIKB 2AQ2A 5E99L 2VAAB 4WNQB 2YZ8A 3SQBA 2P48B 1P69B 5JORA 5IR1B 5E7BA 2XV6B 4GBXC 3FFCA 4UB0H 2UZIH 4GG6F 1I1YB 1FFNB 4JO2H 4RBPH 5DVLA 3EDDA 3MGTA 1P9MC 5CSZA 1NL0H 1QLEL 3CVHA 5GRVL 3MNZB 4W81A 5CZXD 1FYHB 3WXVL 1ZANL 3HB3C 4Y0GA 1N6QL 3MR9B 1IAKA 2F19L 3KXFD 4IRZL 1AXTL 5I16B 2W65B 3WUWG 4PRID 1NFIA 1G6RH 5EH1A 4HKJA 1TJIL 3WO4C 2H8PA 3ILQD 3O9WA 3KXFB 4O51A 1S9YB 3QEQA 2NXZD 2OI9B 2DI9A 1CQKA 2ERJC 5L7XL 3AC0A 4PJIB 3TCLB 4RWYL 4RFOH 2JJUA 1R3IL 2NPLX 2NXZB 4WU7B 3D39A 1W0VB 1LE9A 3HI1B 3WFEL 5CHNB 2XWTA 2VXVL 3L7EA 5EORL 1I8KB 3BEVA 4ELME 1U8QA 1WFNA 1I9JH 3QWRD 5HYJD 1DL7L 1J8HA 3W0WE 2AJXH 5EU5A 4G9FD 1X5XA 3ZDXF 4L3AA 5TDPB 1JGLH 3K4ZA 4P9HH 3EYFA 3PWJB 2D03H 1OP3H 5HYJB 3PUCA 1L0QA 5C9JB 1CL7H 3S34L 3VG0H 5SX5H 4G9FB 4JM4H 5T3ZL 2IFFH 1QA9A 1TVHA 4X7TB 3UJJH 1NGQH 1N64H 4Z7NF 2MPAH 4KI5E 4RMRA 4ZFZA 2XZAL 3IGAA 2XTJC 2AK4A 1XT5A 3MCG1 3CXHK 4EN3D 1BLNB 2J7LA 5IF0A 1X6LA 2CIIB 2E7LA 1UEYA 3U82B 4UB0L 2UZIL 1QOKA 5EBLB 5SWQA 4EN3B 2NY3D 4JO2L 4YC2B 5D9SA 1GJIA 3VXMD 2C3XA 4O2FA 2IALB 4GMSL 1NL0L 3H9SE 1U42A 5JIIA 5DJ0A 2E9WA 3GK8L 1MHHA 1F90H 4YK4B 3CNKA 2KH2B 2QADC 2NY3B 1FH5H 1G9NL 5SV3A 3Q2CA 3H7BA 3U9UB 2EIZA 4M62H 4UTAL 1XGPA 3MRLB 4G43B 1AR1C 4LF3B 2I9LB 3GSWB 1LEGB 1G6RL 1MCDA 3HHRB 3MV7E 4MJ2A 4ONGH 4U7KA 3NIDE 1MCSA 4BH7B 5IW6B 4BFGA 3C8DA 3KPRA 2DKMA 4G80A 4NC2B 5F9DC 1ORSB 5I18H 4RFOL 4PLNC 4RIRB 4UOW0 5EU4A 3P30L 5DK2B 5D5MF 5ICXB 1E6OH 3CFDB 1NMBH 4JVPA 3WV0A 3TBSB 4ZUVB 2EYRB 3P0GB 4AIOA 3HR5A 3PXHA 5TE6H 3QUYD 1MCOH 2VKWA 1EEQA 1I9JL 3WJJA 1MF2H 3TLRA 5E8NA 2D31A 3LD8B 3MRFB 3HZVA 1JGLL 5F88B 3MBXH 3QUYB 4K8RD 4MAYC 4P9HL 1RHHB 4ZQKB 2D03L 4LVEA 1FL3A 5I8CB 1UXSA 2BVEA 2FNBA 5IHBA 5D7JC 3A0OA 4RGNC 3U7WH 2IQAA 1CIUA 1J11A 3UJJL 1NGQL 4ENED 1N64L 5DJYB 2MPAL 3O3AB 3LPWA 4FQJL 5GS3A 4JFPB 3RTQC 2RGSA 1DTUA 4Y1AD 5T1LA 4M8QB 4PJBA 1LD9B 4LP4A 1EX0A 4Y4FB 1KENH 1Q9LA 4N8VB 1P4LA 3E2HC 5KAQG 4RX4D 3OQ3B 3MCKA 5T3XD 2X70A 2RCSH 1F00I 3HPJA 4UUJA 4Y1AB 5B39G 3ARDA 4OZIF 5EULV 2XY2A 3K0WA 3U30C 4URTB 2AJVH 3QEUB 3C2SA 1UWGH 3VXTB 4F7MB 4NO2B 3SCMC 1F90L 4C55A 1UQSA 3PJSB 1VFBA 1FH5L 3NBNA 2B0SH 1OLZA 5JMRA 4M62L 3C5ZC 4S1DC 4BFBD 3GSRB 1MI5A 4F37F 5K9QG 4OFPA 2NNAB 3T2QA 1I4FA 3WBDA 2Y4SA 5JZ7C 1S78C 1UA6L 2BY1A 4ONGL 1F3RB 4LEOB 3W9DA 4N9GB 2HVKA 4YJZL 1SYVB 3O2WL 3C5SB 4EXKA 4ZAKC 1CZ8L 4PP1C 5E8PA 5FV2A 1QRND 5EUOB 1EGJL 4NCDA 4D2NA 4F80A 1RD6A 3S36L 1FORL 2BVQB 4K3EH 5EPMB 4PJEA 1QLRB 1CD0A 1NMBL 2ICEA 2FJHB 3QO0B 4HCRA 4LCUB 3LDBC 3ARWA 1QRNB 2GTWA 4K9EC 3RP1A 2BOCA 2WIIB 3FB8A 2B1HH 4U0RC 2G60H 5FYLE 4PJHA 3O0RH 5GSRB 4AY0A 5FK9B 3GSNB 1FPTL 3BSZH 1GGUA 2AABH 3MBXL 4OCYH 4GQPH 4CJ0A 3FB7B 3EFDH 5H35B 4B7IA 1S7VB 3GRWH 1BZ7A 3W39A 1MQKH 4OZ4B 3O6FA 4S10A 1G7LB 4MB3A 3A6BL 5EN2A 3U7WL 4RGOH 3CZFB 3BEWB 1MAMH 2N4IA 3BJ91 4Y5XB 3OG6B 4S0TD 2X6MA 1ZK9A 3EYSH 2FIKB 3GGWB 3O3UN 1YN7B 3UZEA 3QDAA 3S4SB 3ARQA 2VDQL 3G04B 1QFUL 1EPFA 5ISZE 1KENL 1T83A 1R3JA 1VFOA 1XGTB 4X4MA 2EEBA 2W92A 4YUEL 1MRCH 3S37H 1CFTA 1YNTB 2AJSH 4OFDA 2CDFA 4WW1A 4FXLA 1UWGL 3PHOA 4B41A 4BH8B 4JREB 1A8JH 4U7MA 4OV5B 5IJVB 1SM3H 5C0FA 2ARJA 1NBZB 5F7HA 2VZVA 5F3BA 5DHYA 3BKJH 3RWFB 5DT1H 1E0OB 4Y4KA 3SDAC 2GCYB 1DBJH 4PJAB 4TSBH 4GW5B 3WHXB 1CS6A 3SJVE 4M3KB 2BC4A 5HYQB 3MRQA 4MJIB 1UADC 1S9XB 2P5WA 2ZOLB 3WUWA 1Q9WB 12E8H 2D7TH 1WBZA 4JDZA 4K3EL 3VJ6B 3L7FA 3M1BB 4LRIC 3RZCB 5KSBB 3IDNB 4FXGA 4WTZG 5GRZA 2X1QA 2VDMH 4JFXA 1LK3H 4J1UB 1UWXK 3HC3H 3U48A 4IS6B 1TZGL 3LSOA 1G7IB 3TYFB 1CD9B 3BSZL 3TN0C 1OGTB 4OQ1A 1U91A 4OCYL 4M5YL 3PGFL 1JGDA 3B8SA 4LSTH 4TVPE 3EFDL 5EZLB 4XP9H 2CGRL 3GRWL 3HE6A 1MQKL 2Q8AH 5DD1H 4HGMA 2EDOA 5HHNA 1UFUA 1OOAA 4PTUA 1FNGA 4DZBA 1B4JH 3QJFA 2OYPA 3TO4A 4QRRB 4OGAC 4FFZH 1KFAH 3X12A 2F58H 3HUJA 3QI9D 3QUKA 1KTLB 1NGXA 3WLWD 5I75C 1WCBB 4Q6IA 5EA0H 4GRLD 5C3TA 3TH4T 1MY5A 2MTPA 3DETC 1MRCL 4UV7L 3Q6FB 4F9LC 5CEXB 1CIDA 3S37L 2AJSL 3SDDC 3ZTJG 1BFVH 1YUHA 2WMPA 2M1KA 4FG6D 1AKJB 4GRLB 2FX9H 3CUPB 5LXGH 3AU1A 4GKSA 4LSVH 2XWBA 3QAZB 4ZTPH 3MYZA 1V7NH 2VQ1A 3I50H 4JLRB 2CLVA 5FM5M 2R4SL 4LIQH 4LSQH 5GRJH 4Y16B 5I8EB 3BKJL 4JQIL 1ACZA 4N9OB 5T33L 3BIBX 3AREC 1L7TH 1MJJA 4UQ2B 3QDJA 4TSBL 3DV4B 3V7AG 3U7AA 3ZE0F 4OFYD 5B22A 2A1WL 3VG9C 3MNVB 2PCPA 2FH8A 2VXQH 4OLYH 1RIVH 1E27B 4IMLB 3M8OH 4Y2DA 3C60D 5CLWA 4OCXH 5T3ZE 3LZFL 2VDML 2VDLL 2AW2A 3SKNB 4NNYA 3D0VA 1FFPB 3RBSA 3RVWD 3VDAA 5TQ2H 3MA7B 3AS2A 3HC3L 3PWVB 4ELKA 3WHE0 2PYFB 3C60B 3MV7D 4FRWA 1XF3A 2EDEA 1BZ9B 3CVHH 1C12B 3MZTA 4X6DB 3SOBH 4LSTL 4XP9L 1HZHH 3VI4F 1TVBB 2Q8AL 4JM2D 5DK0A 4RMVA 5DD1L 5CZXC 1UM6H 3RQ3A 3QG6A 3CFKA 1NANH 1IE5A 4M7JH 3VWJA 2GUOB 4RISH 1B4JL 1HI6B 2VLKA 3RNQB 4POZC 5JDJA 2QHRH 4FFZL 4KJYA 3QUMH 4PJBF 8FABA 1KFAL 2D3VA 2OI9C 4X6BA 5FA3B 4ZFGH 2F58L 1YN6B 4NM8H 1T4KB 4JKKA 1LNUB 3FQWB 3TIDA 5EOTA 5EA0L 3VGGA 4KHXH 5CEYB 1A1NB 2NXZC 5CBEB 2UWEE 5K59F 1R3LA 4LBEB 1W0WB 1JNJA 4LNRA 3WD5H 3K1DA 1EIBA 4PV9A 3ULVH 4M5ZL 2FX9L 3HMWL 7FABH 1NDMA 3HAEG 5SWZA 4HDIA 3SPVB 3VA6A 4AM0B 4LSVL 1F4YL 3O4LB 4ZTPL 2NCMA 3UBXA 1V7NL 2HT3D 3I50L 1D6EA 2Z4QA 1Q38A 4LIQL 4LSQL 5GRJL 2WP3T 5MEOA 2CUHA 3BHBA 1CD1B 1YPZA 4KV5E 2UYLB 2ATKB 4FQXD 1FL5A 1TTUA 2XKSA 3EUUA 1U2CA 1YC7A 5DMJB 2IG2L 1HHIA 4NRXA 1U58A 3LAFA 5INCB 3FT3B 4OLYL 4FQXB 1MH5A 1U3JA 2E9BA 1M7DA 3IDJA 5DMKA 5C0CE 1M6OA 3HNVH 3M8OL 4DOHE 5F6IB 3UDWC 3ZO0A 2CR6A 2L7UA 4UMGA 4OCXL 4EN3C 4YC2C 3I6KA 3KR3L 5HGAB 1A7RH 5TQ2L 3F7YB 4PJHF 3PNWA 3LQZB 2VOTA 4YK4C 3SOBL 4HD9A 2IBGA 5ILTH 2NY3C 3B43A 4DUVA 1HZHL 1MELA 1VCAA 1UM6L 2Y25A 5JW4Q 4UIMB 4NO5A 4M7JL 5DWUH 1HN1A 1VPOH 4H26A 4RISL 4UIKH 4WI3A 4L3EA 4F57L 4MNGB 1U41A 3BQUD 3QUML 3MO1A 4LCWB 1EBPA 4ZFGL 5E2TL 5D1ZD 3T77A 5E24E 3HKFA 3G5YA 3O11B 4WHCA 5HGDB 4KY1L 4KHXL 3BQUB 4XHJC 4F7PA 5D1ZB 1GHFH 2P45B 4K94L 1BWWA 4CMHB 1T2QH 4IEFB 1FNEA 1H8NA 2X4TB 3ULVL 3OB8A 3WNNA 7FABL 5FAAA 5J7CC 4HC1A 4APQA 1D5ZB 3LD8C 4QHLB 3HNSH 4GUPB 3QUYC 2EDRA 4AMKL 1F58H 4HZAA 5ISZD 5IFJB 1R5WA 4OIAA 5E8OB 5A2JH 5AG8A 1A6VH 2FEDD 4OM0L 1XCTB 2ZOKA 1KPUB 5IHZA 1OGAA 3ZKND 4JFFE 4K8RC 3U0WH 2G75A 1IM9A 1A2YA 4PJXE 3U4EA 4UDTB 4H5SB 1UCTA 3N1GC 3BZDA 1NFDA 3KLSA 5CEZE 2HN7B 3F7RA 5TFSL 4ENEC 4HUUA 4R4BA 4Y4FC 5LCVH 3ILPA 3HNVL 4X7SH 5JMOC 3KPNA 4DCQB 4X6EB 5DRZB 1GVIA 1I3VA 5DRXA 1PW3A 3OKNB 2YN3A 5CJQH 3W9EA 5C0BE 4NDMA 1A7RL 5FGBA 4XPTH 1FAKT 3MRCB 1NCBL 1VEPA 1YMMA 3V0AC 1QFPA 2MFNA 4PG9A 1IQWH 4AENA 3P77B 2R39A 3SJVD 5FECB 3TPKA 2J8UA 1XCQB 3ROOB 3QXAB 3TVMA 2DQUH 3C5JB 3DRQB 3LPFA 5FOJA 4WW2F 5L9DH 2W0FA 2HJFA 2DRUA 4FZEH 4UIKL 4UT9L 2ZCLH 2YUWA 5MENE 1CDUA 1T7WA 3BW9A 3EGSB 3EOBA 5E7FA 3NFSL 3HUJF 5CMAA 1B0RA 1FDLH 3T4YB 4R7DB 1W0YT 43CAA 4KUCF 2J88H 2A74B 4LLVA 4DQOH 3V7MA 4TVPD 2QR0B 4JY4B 2PW2B 2UUDH 1WJ3A 2YK1H 2YUVA 1GHFL 3U46B 2FBJH 1T2QL 1AO7E 4XBPB 4HCRH 5FB8B 5ESAA 1T6WA 4LQ1A 4WFEE 3H42H 3MV8A 2YBRB 5T5FH 2YMXL 5L8JB 1BOGB 1R6VA 4DUWA 3UEZA 4JPWH 4PJ5D 2DQTH 2VQUA 4BKLA 1U8KA 2D2OA 1F58L 4PB0L 4BQBA 1RMFH 5D1XD 1WC7A 3BN3B 3QIBA 1RUQH 1A6VL 3WMSA 2WNGA 4RMUA 4EIZC 1G84A 5HHPB 1W2KT 4PJ5B 1GIGH 2APWA 1KC5L 3R0MA 5IB5A 1TZIB 2OZ4L 4Y5XC 3U0WL 3ZE1E 1HOCA 2BHZA 3WJLC 5D1XB 3OX8A 2R0ZH 3IDGA 1A7OH 1KJMA 2D0GA 4S1RH 2DJUA 1DN2A 5JDSB 2JKXA 3M17A 4F7EB 5DA4A 2BNUB 4AEFA 3IJHB 4OIBA 2X7LB 1ZHNA 2XACC 4X7SL 3RIFK 3QZWG 2O5YH 3AAZA 3IRZA 2Q6WA 1XF4B 4Z7WA 5I1LB 4EXPX 1E4KA 2L0DA 2VUOA 3C9NB 3FOLB 1DE4A 4LDLB 1IQWL 5CZKA 3BWAB 4NC1C 1OB1B 2JE8A 4JREC 4LHUB 4TNWK 1H3VA 2ZUUA 3MLXH 4R90L 5E2WH 3OPZH 1I1FB 5J56B 2JTDA 4NM4H 3BN9D 1W72H 2DQUL 3T65B 3CXDH 1PY9A 4QHKJ 3QNXA 3OR6A 5L9DL 1HDMA 3EJJX 1NGZA 4LASH 3O3EB 1MLCA 4FZEL 1AGDB 1I7TB 1SEBA 4HKXA 4NGHH 4H20H 2WSKA 4X4XB 2KL6A 5T3ZD 2NW3B 5J9PB 2GAZA 3ZDYF 2OMNA 1FDLL 5HHOE 4HUNB 2DKSA 5I1HH 2EH8H 2Z35A 1A9BA 1CBVH 3DRTA 1KACB 2ITDB 3EJYD 4PG2A 4PPTA 4LPTA 2VNCA 3OZ9H 2W38A 4OZGA 2FBJL 4PGZA 4M6NH 4GG8B 1D5XA 4TTDD 3H3BC 5IROA 1HWHB 5KAQF 1RJCA 1HHGA 3DXAA 3H42L 4J7RA 5T5FL 1OP5H 5F21B 1ZXQA 3LVEA 4IHOB 1FFQA 2YR3A 4JPWL 3D18A 1F11A 2EZ0D 5AUMB 5IMOA 3GJFH 1QFWM 1RMFL 1Q0XH 1RUQL 2OSLA 3GM0A 5GGRB 4JN1L 1RPQA 1DQTA 1S7SA 3OAZH 4OAWA 3GSVB 2BDNL 1FRGH 2R0ZL 4WUUE 1A7OL 4IIQA 3ZL4H 4S1RL 5F1OB 3NIGF 5ACMA 3MREB 5L0QB 1VGEL 1H0DB 4X9BA 4OBSA 4WV1B 3TPUA 3VGEA 3CFBB 1GCFA 4PBVC 4XVSH 5JW4R 2O5YL 3LIZH 2P7TB 4EUPH 1BMGA 1Q9OB 1F6AA 4NQEE 2GK0A 1XIWD 3EFFA 4KDWA 3VD5A 5EOQH 3TV3H 4PJDE 1A22B 3VFPA 3VWKB 1NCAH 4GRLC 4K3GA 3SE4A 2A9MH 4PY7A 3MLXL 4XGZA 4OB5L 4HJGB 3QAZC 3ULUH 1CN4A 4Y4HB 4NM4L 4Z7QE 4FG6C 3TO2A 1W72L 3CJJA 2BSTB 3CXDL 1ZGLM 3OF6D 5ESQA 2RHEA 1X5FA 4Y16C 4DVBA 4PRHD 4NGHL 1K8DA 1MLBA 1FL6B 5B8CB 2FHFA 2MKWA 1CFNB 1GPOL 1NKOA 1R5VB 1JZ2A 3IVKA 4IOIA 5CFHA 4IJ3B 1T03H 1B9ZA 3DMMA 1HQRB 5I1HL 1DN0A 3HS0B 5CP3A 4NRYB 4PRHB 1AD0A 4YFLI 1RU9L 3EZ8A 3ZE2E 3VFRB 4ONHA 3T0EB 3O8XD 2AKRA 1AC6A 5HDBE 3OZ9L 4I3SH 4HEPG 5BW7C 2SEBA 2XWJB 3QHZH 3QO1A 1HEZA 4R96B 2GJ6D 1KB5A 2AJ3A 1RJZA 5EBGA 5IB1B 3O8XB 4DKEL 3H8NA 3C60C 2GJ6B 2EDWA 1VESA 4M7LT 4ZPTA 3S3JA 1IEBA 1IT9H 3IYLW 1HH9B 2J5LB 4H1LH 5J3HC 2VABA 3X11B 5ANMA 1CGTA 4LPYA 3X14B 1JTTA 1G7PB 3GMLB 1T1ZB 1XZ0A 1FRGL 5EU3B 3TJHC 2EDBA 2XTLA 4ZD3H 3ZL4L 2FWOB 1NFDF 3UC0L 3QCTH 3UTTA 4RAUA 4XH2B 2EDYA 3FO2A 3P73A 2X9YA 4YZFF 3QR2A 2ICWI 5BOPA 5GRUH 1LO2H 4XVSL 2HFGH 2N56A 1CTNA 3LIZL 4YDJA 2NY4B 4GBXA 3MUHL 3SBWC 2Q3AA 3Q5OA 4M1GL 3MJ9L 1MJ8L 2XQYK 1RK1B 5MHSD 5C0EB 2FSEA 1T7XA 5EOQL 4I5BB 3TV3L 5E00A 3D9AH 4PJGB 5KVDH 5MEQB 4EDXB 4GSDL 1P9MA 4OGZA 5E9DA 1C16A 4B7LA 1ULVA 2A9ML 5E8EB 2XT1B 3QEQE 3G6JE 4ZUUA 5TH2A 3X13B 1MCQA 5IV2A 3FQXB 1A1MA 4S2SA 1RUML 4PJFB 1ZT7B 1AXSA 4XC1L 4OD3H 4O2CB 3BJLA 4NRZA 2JCCA 1F2XK 1RVFH 4R3SA 2M8XA 1LEKB 3GMMB 5FO9B 2Y72A 4X0KA 4HUMB 2X4SB 1C8PA 2LTQB 2HT3C 1NAKH 3HG1E 1ZT1A 1NLDH 2VDRL 3KPSA 3MGOB 1T5XA 5C0BD 1KPVA 1T03L 5C2UB 4QF1A 2N1KA 2I07A 1P5VA 1MCIA 3MLYH 4C56A 4FQXC 4NO3B 4K3DL 3PWLA 4HIIB 3VW3H 5IOPA 2BVUA 3L3JA 5F6IC 3QIUB 4M00A 3QHZL 1OAZH 2A9NH 2F54A 4YPGB 1XR8B 1Z0MA 2I27N 1S7TA 4XZUA 4W6XB 1F97A 4LSUH 1Z9OA 4M7ZB 4G6AD 4LLUA 4YBLB 3BGFB 4BK4A 1X6NA 1B0GB 2AK4E 3OGCB 1IT9L 1IC1A 2IPKB 4I0PD 5DD3H 3VRLE 2MJWA 2YN5A 5T1KB 2C1OA 2AEQH 2YOCA 2ZPKH 1P6FA 5EWIH 3UJTH 1SHMA 1V3LA 1MAKA 4LLAA 1AO7D 5F7DA 4ZD3L 4I0PB 2BNRD 4PJCB 1ROWA 3QCTL 1OTTC 1X7QB 3HC0A 4G5ZL 4WFED 2P44B 2E7HA 4Z77A 1P7QD 4OZFA 3WL9A 5L2KE 3X3GH 4HWBH 2YD7A 2R1XA 2BNRB 1EK3A 3L3OA 5JNYB 1PZ5A 2NLJA 3JV4A 3BQUC 4XAWH 1IEAB 3DARA 1V8HA 5FYJH 5D1ZC 2IANE 2EYTA 4CMHC 1P7QB 4QTHB 4YXKL 3NCYP 3D9AL 5KVDL 43C9A 3LS5H 2EE9A 1PSKH 3VD9A 4DN4H 1RZJH 4HT1H 4FXKB 3ZSTA 6FABH 4AZ8A 1A1OA 4QRTA 5C6WH 5HY9A 4N0UB 4HZLA 5TQ0L 1OAQH 1ZA3B 3VE0A 4HWEL 4OD3L 4NT6B 2BVOA 1YNLH 1RVFL 2IBZY 3OWEA 3V0VB 3OTTA 3QEHB 1N5YH 3ISWA 1DJSA 3B83A 1A9EA 3RWDA 3DI2B 1NLDL 4HFUL 1J1OL 5IEHB 1IGMH 2PETA 2FEDC 3U36A 3LH2H 2AERT 3K4DA 3E6HB 1VACB 3HCVB 2YA0A 4ORZC 1MCKA 4OZGF 5C09E 3VW3L 1XGUB 3IS0X 3D6GA 5HGBA 2CLZB 5D7IA 2A9NL 3HI5L 3QDMD 3CU1A 1IGCH 5HJ3B 5IBLD 3RNKB 1AGCA 3V6BR 3WFDL 1YY8B 2HA1A 5FF6B 5LG1A 4O4YH 3DJ9A 1WWWX 4HXAL 3S5LA 4F8TA 4PGEB 1WZKA 3OB0K 3QDMB 1U8MA 3FT4B 1IC4L 1FVCA 2R1WA 4Z6AT 3BH8B 5DD3L 1MY7A 2YD9A 5DA0B 1ZLUH 5A3ID 3KYOB 2ZPKL 3QSKB 3TZVA 5D7JA 2G9HA 4WIQA 5FHBL 3ZYIA 5EWIL 3UJTL 1WQVT 1T20A 2JJVA 2VSDA 5I1DB 1MFNA 1A6UL 4YX2H 1EAPB 3AVEA 5GJTH 5GSVB 3DLQR 1M71A 2BK8A 3OGOE 4TVSa 4EVNB 5DK3A 4HFWA 1OCWH 1XF5A 1BVLA 1BBJA 4HWBL 4PRAB 3LY6A 5C08E 2ADIA 3MOAH 5EC1B 5ICZA 4BFEA 3TCXA 3FB6A 5FYJL 4JANA 4H25B 1S7WA 4HWNA 1T1YB 4A6YA 5C0GA 2PKDA 3LS5L 4M61A 1PSKL 1BIIA 1RZJL 3QCVL 1LK2B 3AXLB 3SCMA 1RZIB 2DTMH 3O2DH 5DUBB 1OAQL 4MD5B 1BFOA 5DTFB 2R1YA 1BF8A 3C5ZA 1YNLL 4NHCH 3KG5A 4JGMA 2LABA 3QFJD 2RFXA 1DBBH 3Q5TA 4HX1B 4PJEE 1N5YL 5F9WB 4N1CA 1P1ZB 3PV6B 4NQED 4L8BA 4K07A 4ODXB 2DN7A 2VE6A 3CLEL 4RZCA 1GGCH 5D1XC 5I2IA 5IMLA 1IGML 3QFJB 2HFEB 3LH2L 2FHBA 4QHMB 4ZAKA 2HRLA 5IB4A 1DSFH 4WI2A 4P3DA 1BEYH 5D1QD 2QTEA 4AH2B 2H26A 4WUKH 5JPMA 2FATH 4NIKB 2KQMA 1IGCL 3F58H 4QKXB 4XP6H 5GGSA 1UH3A 4KJQC 1MUJA 4O4YL 2YSSA 5D1QB 4MQXD 4OLEA 3U0PB 3MRBA 4U6TA 4JDVA 4RDQF 3QDGA 4G8GD 5IQ9A 3TM6A 4QRPB 2KZWA 5I1AB 3MLPA 3BPCA 5A2KH 4X5WA 1DVFB 4JB9H 4KRPB 4G8GB 1NC2D 4GQ9H 1NMCB 4OGXH 5TE4H 1ZE3C 4BYHA 2ICCA 1ZOXA 1LP9B 1JMZA 1FN4A 4YX2L 3QA3A 3BN9C 3V6OA 1UVQB 1NC2B 4PD4J 1JHKH 1Q0YH 1QVOB 4ZDHB 1OCWL 2GSGA 3T4AB 3ZT5A 5GS2H 3ARBD 1C1EH 5C3LD 4YNYB 1A6ZB 3K46A 3PP3K 3MOAL 4WHYG 1VFUA 2X1XR 4ZSOA 2XQYG 1WIOA 4AQ1B 5C2BH 3ARBB 4NQCB 2XNAA 4X9IA 4EEEA 1UJTA 3QXDA 3WIHH 3I2CH 1MHEA 4MA1B 2DTML 1RZ8A 3JWDH 1DEEA 1CXKA 3O2DL 3RX5A 4CL7A 2X41A 4JVUA 4M3JA 2JCCF 1S7UB 2K7PA 1FG2B 2P5WE 5JHLH 2WLYA 4NHCL 3VGBA 1XF1A 4OFKA 5DQ9B 5TF0A 1HH6A 2NY2B 1DBBL 3UZQA 1DEDA 2ITCB 5DRWA 5CGYD 5JXED 5DHVH 1V7MH 2EZ0C 2XOTA 3SDAA 3VXUB 4CRPA 1G9NC 1GGCL 5I76B 1QFHA 4CN6A 3CSYB 3IT8D 4HMCA 5DJCB 5HHVL 4N5ED 1MCWW 5L0QC 1DSFL 4WV1C 1BEYL 5EZIH 5D6CA 1T21B 5FGCB 3P11H 1A4KA 3H9HB 2FATL 4LRIA 4NC0B 3BP4A 4WUKL 3F58L 1WICA 2H3NA 3V8CA 4JQVA 3QUMB 3MRDB 4Z7VE 4S1SH 1HIMH 4CW1B 3VWKC 4DEPB 3HG1D 4EIGB 2XXMB 5DURD 4NZUH 3ULVD 3V52L 2ID5A 3TN0A 5JR1L 4Y5VA 1CFBA 4Y4HC 1JNLH 4JB9L 4XPAH 2B1AL 2FR4A 4OF7A 5DURB 1R24A 4GQ9L 4KROD 3OAUH 5TE4L 3VFOA 4IRJD 4E41E 1FG9C 1IC5H 1HYRC 1NEZA 2DQFA 1N6UA 5IVZB 4OI9A 4BSVB 4KMLB 4P9HC 4IJ3C 4KROB 1Q0YL 5J6HB 1FZMB 2XZQH 4IRJB 3ULUE 4QYOB 4YWGH 1INEL 4IDJL 1Q72L 1SQ2N 1DANU 2QQQA 4U1MA 1BJ1H 1T0MB 1RUKH 4GAFB 3RY4A 4PRPB 1WVZA 2B7DT 4P4RA 5C2BL 4ZXBD 1VFAA 2RB8A 1S8DB 4P59H 2GJJA 3KNBA 5DQJA 3RVXD 3SDDA 2X89A 3MRHB 4PJ7F 1EERB 2GQHA 4NQVA 2OTUA 2P8MB 3O8XC 3I2CL 4L8DB 3WIHL 2AK1H 5HYSB 4ZFFB 1IL1B 1RFDH 4WCYH 3VFGH 4ZXBB 3FL7A 2P42B 2XZCH 3DUUB 2QQKH 1KIPB 3LV3B 5E94A 3N0PB 4HLZH 2UZXB 5D8JH 1A4JA 4KRLB 5JHLL 2AQ1A 5C0AD 2J5LC 1FNSL 1RJLB 2NTFA 2Y23A 2WWKT 1V7ML 5ENWB 4U6HA 3EYUH 2LQRA 2IAND 3B9VA 3FO1B 5C0AB 1NJ9B 2Y6SC 4L9LA 5KSUB 3EOYG 1QYGH 4X98A 5CJ8A 2CIKA 5IKCA 4WNQA 1TCMA 4TUOB 1CF8H 5EZIL 5IMKB 4M7LH 5D7IF 2R2HA 3UYPA 1CE1H 3P11L 4YFEA 2EDDA 4G3YH 5BOZG 5KANI 3LKPB 5GGUB 3WYRA 1TNNA 1HIML 4YGVB 4NZUL 5AWNH 3VDBA 1ZGLA 4OM1H 1RJYB 2Q86A 3EYOB 3MR9A 3FAWA 1IM3A 4UBDC 2CDGB 1Z5LB 5FKPB 3FHQA 1UB5B 5C09D 4HWZB 2GK2A 2AQ3A 1YDPA 4FHBD 4PRDB 2BFVH 2C3VB 4OLVL 1J5OH 2LTQC 3G6AB 4MGXA 1SJEB 5F9JB 3VGAB 2F74A 1G0DA 2B2XL 2XN9E 3KXFA 1S9YA 5LKNA 4M6OH 5K9KB 5E08H 5B38B 2Y36L 2XZQL 5SWZE 3BDXA 4YWGL 4PRIA 1EH9A 4F9PC 2NX5E 4Z0BH 5TE7H 4JRXB 4JFYA 3S36X 4PJIA 3TCLA 2M26A 4JG1H 5E6ID 4DJMA 5A40E 5ID1B 1FP5A 5BXFB 1QR1B 1W0VA 3HI1A 4UAOB 4P3WA 4P59L 4XNQA 1YPZE 5CHNA 3UAJD 2RR3A 5ADPH 4QRQB 1I8KA 4X9HA 1EFXD 4M7ZC 5E6IB 3PDGA 1X3DA 4YBLC 1H3XA 3BGFC 1QBLH 4WCYL 5I17A 2A77L 2XZCL 3OAYH 3NZHL 4ONFH 3S96B 3WFHB 4YHPA 1HNFA 4L8SA 4G6AC 5DVKA 4LKXB 1FIEA 3QXWA 1JFQH 1N5AA 3NACH 5B38G 1OSPH 3QUXD 4XNUH 2DQDH 3QWRA 5C08D 5HYJA 1MRFH 2Q7YB 5C9JA 3FRPG 4X7TA 3FQNB 5DQDH 4I0PC 3O41B 1E28A 2NY0D 4P2YA 3DBXB 3K7UA 4JQXC 1CF8L 5LWYH 4KK9D 1KG0B 3R8QA 1CE1L 1FAIH 4KGLA 4BQ6A 4GOSA 4G3YL 4NKDB 3UDWA 1KEGH 2NY0B 1Y6MR 2HJLA 3C8KB 5ICYA 3RA7L 1AJ7L 2Y1VA 2OP4H 2IALA 3GMPB 3F5WB 4L3EE 5AWNL 2UVFA 5KS9A 2HRPH 2PYED 4OM1L 1K4CA 3BIKB 2DJ4A 1J05B 5GRVK 1YEJH 1UZ6F 3VXMA 4P23D 1MCJA 3U9UA 3AROA 1AI1H 3MV11 3BZ4B 2H9GB 2PYEB 5FYJE 2VRAA 6CGTA 4OD1H 4ZYKB 3MRLA 3C6LA 3UTSD 3BKYH 5B4MD 2BFVL 2ED9A 3GSWA 4OFIA 4F7TA 4HHAB 4P23B 5F1SA 5JHDD 4M6OL 5E08L 1KXVC 1MCRA 3L9RB 3UTSB 4BH7A 5TE7L 1NMAH 1ORSA 1Z9MA 2Q20A 5DK2A 1NAMA 5JHDB 5ICXA 5DJAB 3CFDA 3SDXE 3G5ZB 5ADPL 1UJ3B 2XRAH 3SKOB 4FA8A 5J1SC 3KDMB 5JIPA 2BHUA 1QBLL 4X9GA 1M1SA 1Y0LA 4MA3B 5IBLC 3QIWD 4F3FB 3HLAB 3RI5F 2P24B 1K5NB 3CD4A 3MRFA 5IHUH 2VYRE 4KJWD 5CWSB 5DDHB 3NACL 4G8FB 5I8CA 1OSPL 4HS8H 2HG5B 4MWFB 3LEVH 1CLCA 4RWHA 3ECBB 2AXGB 3SGEI 5DQDL 5DJYA 1FVEB 3LN5B 5D2LA 1A6WH 5ACZB 2VLRD 2Q1EA 4JFPA 3WN5B 4Z5RB 5LWYL 3MLUH 3IJYA 3ARZA 3LKRB 4MHHG 4TUJB 1FAIL 1EXUA 4N8VA 2J8UE 2VLRB 4FQIH 1KEGL 4UQ3A 2AI0H 3S37X 2A73A 2GFBB 5KG9A 1NLBH 1Y6KR 3JTTA 4WU5B 5EFIB 2OP4L 4RBPK 1X5YA 4P2OB 1BX2B 3QEUA 4RX4A 4Z78A 4F33B 2HRPL 4F7MA 4JJ5B 3KPMB 1BP3B 1YMHB 3KPOB 1JGEB 4OQTH 5SWSD 4BQCA 5GIRB 3HA0A 4Q97A 5KN5B 4J12A 4N8CH 1OSZB 4QXUH 1FO0H 5L6YH 5F9WC 3SDCD 5SWSB 2NNAA 4LHJB 3O6LH 1F42A 1N6VA 1FYTA 3GJFB 2EIEA 4JZOB 4N9GA 3MLTB 4JFQB 1SYVA 1RY7B 1JJUA 3SDCB 1YECH 3RY5A 1NMAL 1MFDH 2IPUK 4HH9B 5HHQB 5C0JB 2AVGA 2VWEE 3FCTA 4XP5H 3BUTA 1QPPA 5EBMA 3CFEB 1QRNA 1QUNA 3OKDB 4NCC1 4PTTB 5D1QC 4E41D 4K9EH 4YIQB 3QXTA