3GKZA

Crystal structures of a therapeutic single chain antibody in complex methamphetamine
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
242
structure length
233
Chain Sequence
EVQLQESGPSLVKPSQTLSLTCSVTGDSVTSGYWSWIRQFPGNKLDYMGYISYRGSTYYNPSLKSRISITRDTSKNQVYLQLKSVSSEDTATYYCSYFDSDDYAMEYWGQGTSVTVSSGGGGSQIVLTQSPAIMSASPGEKVTLTCSASSSVSSSHLYWYQQKPGSSPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAASYFCHQWSSFPFTFGSGTKLEIKRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of a therapeutic single chain antibody in complex with two drugs of abuse-Methamphetamine and 3,4-methylenedioxymethamphetamine.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords anti-methamphetamine single chain Fv
total genus 56
structure length 233
sequence length 242
ec nomenclature
pdb deposition date 2009-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gkzA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gkzA01
2EYSB 4E5XA 4AT6A 3DIFA 2CIIA 3S3PA 3BZEB 5GS1A 4ZSOA 3VCLA 5MHSE 1UC6A 4KTEH 4YHML 5AWNH 5IWLA 3W39B 1Q72L 3GMPB 4NO0A 3L95A 4NOFA 4MJ5A 3WNOA 3ARGA 5C0BD 1I7ZA 4NO2B 3LKQA 3UJIL 4DOHE 3OB0H 5D1XD 2PXYA 3VFSB 25C8L 2BVQA 1K85A 1MJJA 3IDXL 4KK6C 3TGXA 1U3YA 3KPPA 1FL3A 4EJ1C 3QEGL 3PQYA 3RY4A 2UZXB 3CLFL 1TITA 3SKMA 1VSCA 1U2CA 5IB4B 3G08A 4LLDB 1JK8A 1ZLWH 1P9MA 5L7XH 5CEYA 5TF1L 2NZIA 1Q9KB 2VQTA 1GZPA 3PDDA 5L2JA 4I5BB 2X4NB 1TVBA 1HDMA 2VDNL 3N1PC 3WO4B 2EDRA 5DK0A 3RGVB 4B5EA 3ORJA 4I9WE 1V05A 4LLUB 4OLVL 4MLIA 4ONGH 1TMCB 3QUZD 1IT9H 3WD5H 2P5WE 1X4XA 3OJVC 4U6HB 1FO0H 4QRQB 1KELH 4WTZG 3LKOB 4OZ4A 4PGBB 3U30C 2X4RB 3Q3GB 2MFNA 3JV4B 4KK9C 1FAIH 1HHJA 4HGWB 3E1F1 1X5FA 5BO1H 4M48L 3O2DH 3MFGB 1TJGH 2HT2C 3F6IA 1UM6L 4JFFE 3VXUE 1KIQB 4TSBH 4WW1A 1YEGL 1IBGH 3WS6A 3ARGB 1ZEAH 5GS0C 4WHCA 1EHLH 1RZGB 1MAMH 1FP5A 2ZNWA 3QFDA 4Y5VA 5DEFA 2FIKB 2IWGA 4QEGA 4OCSL 5BJTA 1A9BB 3F7VB 5FM4A 1DLFH 3DRTB 3NCEB 3UBXI 4JHZA 3FOMA 5EU4A 1AFVH 2BCKB 3TWCL 3B8YA 5CINH 2CR3A 3ZE2E 2NX5B 5EC1B 4Q6IB 4XB8A 4PJXE 2EIBA 3THMH 3OX8B 1C1EL 1F00I 1HE7A 2G60L 2WQ8A 3ZL4L 5TFSL 3ARUA 5BQ7A 4APQA 2AJXH 4ZUWA 1D6EA 1U36A 4HH8A 1YEEL 4JG1L 4S1RL 5FCSH 3IFNH 1XGUB 4X5LA 5MERA 1DBJL 2B4CC 4PY7B 3AY4C 4L8DA 4R97B 5DK0B 5FYLD 3RUGE 1FJ1B 1ONQA 3MBEA 4JHAL 4YEEA 4Z7UA 4PJDA 4A6YB 4LHUG 3T65A 3GIZH 4WO4D 3A6BL 3QDMA 1FFPA 3PWPB 1WISA 2X1PA 1EJOH 4ZFOB 1MFAH 3FFCB 2Y4SA 4JM2C 1N4XH 3STZB 1VACA 4OCYL 3HB3D 5JR1L 2NZ9D 5DVOA 3BSZH 4U1HB 5D5ME 4ESKA 4J3UA 5HHNB 1E4XI 2E7LC 2WLZA 3MUGB 3CFKB 2PTTB 3FCTA 3ZKMD 5C0CE 2V2TB 1B2WH 1KB5L 4XNXH 5B38B 1BBJA 3TCLB 4FQXC 3BAEL 5DZNA 1A9BA 5E94B 3H6JA 3G5YB 1UACL 4PJAA 1BP3B 1UCBL 1TTGA 3ECBA 4MQSB 4JGJA 2H32B 1FE8H 15C8L 2A6KB 5IQ7L 2AV1A 3IRPX 4X4MA 3OX8A 1L6XA 3OB0K 5I71B 2VDPL 2HA1A 3EZ8A 5BQ7B 3PNWB 3ELAT 5HD8C 1NGYB 1A7QH 1NDMA 3FT3B 2R4SH 3ZSSA 4U3XA 1CI5A 2BNQD 5E2TL 2X9XA 3GHEH 5I1AB 3KPOB 1FJ1A 1ONQB 2CK2A 2X7LB 3IJSA 4DQOL 3F7YA 3FTGA 4PB0L 4QYOB 4HFWB 3C5JB 5D7IF 3JUYA 4IOSD 3BGMB 4R90L 2YD9A 4Y5XB 3QXDA 5D70L 1PDKA 2ZUQC 4Q74A 4GG6B 1PSKH 2VN7A 3KLHC 2DKMA 5IJKA 3D69B 2MJWA 3DMMA 4YDKH 3PHOB 2R9HC 4P4RA 5HHNA 1UM5H 3B2VL 1TLKA 3G6AA 3KYNB 2XT1B 4PD4K 1BZQK 3O41A 1RIVL 2NXYB 1W0VB 5JA8B 2HT3D 2DYPA 1WCBA 4PRBA 4K71B 3QDJB 1FC1A 4WNQB 4ZO8A 5DZLA 4Y8DC 3TZVD 3SJVD 2PETA 2JELL 3VD7A 3ECBB 3IAQA 2B4CL 4JANA 1T21B 3B9KD 3FFCD 3NCBB 5F1NA 4RMTA 1MJ8L 1CFVH 5DYOA 3BQUD 4HKBB 1WIPA 4H5SA 4EUPG 3U4EB 5CLWA 3VXQA 1KEML 5I0ZA 2X4SB 4UQ3B 1RD6A 2DICA 3BVNA 3QIUD 3FO9B 4D0BB 5EUKB 5EU6B 4KI1A 1KIRA 1QSEE 1U3HA 3IF1A 3FQNA 3K3QA 4RNRB 3FQXB 5I76A 4WVRA 4RDQF 1SEBA 3R8BB 1VA9A 3LS4L 4OZGE 1KNOB 1F11A 1W8NA 5D7LD 4P3WA 3MRNA 4FABL 3DURA 4I0PB 2AEPH 3KPNA 4Q58C 1VERA 2EDYA 4E41B 5D1ZA 3SCMC 4OUUA 3KPMB 3B9KA 1DFBH 3OTTA 5IFAH 2GAZB 1U41A 1JF6A 5I1KH 4DTGH 4NCC1 3N9GL 3PL6C 2DYPB 2P5WB 1DL7L 4NKQB 2FD6L 3K0WA 1RUMH 5L88H 3JSSA 2GUOB 4DKAA 5F9OH 4JEGB 3L3OB 3B5HA 4OQTH 4UV7L 4UT9L 3S5LG 4BK4A 5FYLL 2CLRA 1BQSA 2W92A 2R8SL 3B3IA 1H0DB 2H2PC 1KCUL 5HHVL 5F7LB 4J2XA 5JDSA 3AM8C 4X9BA 2YPVL 1N5YH 1T3FA 2D2OA 3D25B 4E42B 2AJZB 5ALCH 5ACLA 1QFHA 3MLYL 1S7WA 2NY7H 1BD2E 4O51A 4ZQKB 4YAQA 1RI8A 1U8KB 3HPJA 4WUUD 2YC1B 1XGPB 2CRYA 3LRSA 1AIFA 4JN1H 1KN4H 1QFWL 2HJLB 2CIIB 3L6FA 3V6FB 1WV7T 2NR6C 3U4BL 4OD3H 1YEIL 3BP6A 5D1QA 4JFPB 3RWEB 3RHWF 4JZNB 5DXWA 2ZUVA 1QHPA 3DRQA 3MOQA 3CDCA 1KOAA 5GS1C 5IIEA 2ZZUT 1BZ9A 1SYVB 4UV4L 4ZAKD 5DSCB 5BMFL 2VDLL 5A2KH 1JZ5A 2EZ0D 2NY1D 4XNUH 1JUFA 4JM4H 4U49A 3ZE0E 3V6OE 5FUZL 2GAZA 4HKJA 1ORSB 4JLRA 4TUOB 4R3SB 3MLPA 1I3GH 1CT8A 5F8RC 1OP5H 2LQRA 3G08B 1PG7H 2N7AA 3CVHL 3QXTA 1CD1B 3MO1B 3D0VA 8FABB 4KMTL 4P2YA 5F9AC 3KNBA 2FHCA 5CS7A 3MNZA 4ETQA 1DEEB 1BVKA 3LQAL 1PQZA 3KVQA 3RGVA 3P0VH 1GAFH 4NJ9L 3WV0A 4IS6B 4P9HH 1WTGT 3HA0A 3HE7C 4X6EA 4NRZA 4RMRA 1GGIL 3HZMA 4E41D 2L7JA 4L4VE 4UTBH 3X14A 4IRSC 4ORGB 4X4YB 5JIKA 1U8KA 3MLWL 1I9IL 1M6OB 3CVIH 2RJMA 2DQIH 2OL3A 5HHQA 5HGDA 4IRZL 4J4PA 3N1MC 1JV5A 5JW3L 4LSDA 1IAKB 2XTLA 4Y4FC 4OSUH 1KIQA 5IESL 3CFJB 5EZJA 4IIQB 3UPCA 3TYFA 4LCWA 3DRQB 1Q0YH 3HI1A 2QSCL 2V9QA 2AKRA 5MENE 2H2SC 5DEFB 4H25B 3ARGC 1K4CB 2XWJA 5ADPH 4KPHL 1D9KD 4RMVA 3E2HB 5C08A 5KSBB 3BEVB 4ZPVB 4WFFD 5EA0H 4O58H 1ORSA 5DR5H 1ZT1A 3ZKXB 1HXMB 3OJDB 1MCCA 4QTIH 4UILL 1NKRA 2VL5B 5BVJB 4JZJC 1EZVX 1GHFH 4YHYC 1MHHB 5JPNB 4DGYL 1K6QL 1DBBL 3ZHDA 3MNZB 2JJUA 1K9TA 1EEYB 1EGJH 3RIFK 4LU5L 1BWWA 1XF3A 3MRHB 2ADFH 5E6YA 3VWJB 4Z77B 2VZTA 3HZVA 1M71B 3MLSH 5DQDL 4NQCD 3MXWH 4XBPA 3UYRL 1ZTXL 5D5MF 1UG9A 4GAJL 2GJZB 3GRWA 4NKDA 2BVEA 2OZ4H 2AABH 3S36H 4ZNEA 2EDKA 1Q9WA 3QXAA 3ULSB 1HKLL 2DQTL 1X5ZA 3V6ZB 1RULH 1FFRA 3MLXH 1FIGH 3M8OH 1XF2A 4PJBE 2E8ZA 4PGJA 5LGJB 2DJUA 5EBMB 1V3MA 5BOZG 1AO7A 5KTEH 3MUGA 3CFKA 4QGYA 3WDJA 2YRPA 2YRZA 5DD5H 4D8PB 4LCWB 1OHQA 4YE4L 2BXYA 4G8GA 5E9DD 3QQ4A 2NX5E 3I9GH 5EUOA 3NFSH 2VR4A 5J6GA 4Y0GA 4HWNA 5EN2A 5FKAB 3MRCA 1JNHB 2AI0H 2Q7YB 2EDLA 3EO9L 1YA5A 5K9KB 4W81A 3ARFD 1KIPB 1O5DT 1MLBA 1RZKH 4PJ7B 2D7MA 1NDMB 3FT3A 3WFDH 4NBZB 3MV7E 4WW2F 4YQXH 3GSVB 4NWUL 4MNQB 2QSQA 2R2HB 2X7LA 4KUZL 1CLZH 3V79C 3EOBA 2HH0L 4P2OB 3DMMC 2VYRE 2CDEA 4FZ8H 3O3BB 4KHXL 3HR5B 4XPBH 3VI4E 4I9WD 2LAGB 4LQFH 5C08E 4XVUC 1IFHL 1F97A 3WHE0 4P4RB 4P0DA 1FBIL 2E3VA 5J11C 5GGRY 1WWCA 1ACYL 3T3MF 4LL9A 4L8SC 1NSNH 4W4NA 2C4XA 5DD1L 2C3WA 3UCRA 1LE5A 4HIJA 4WI2A 2OYPA 1EXUA 3VFOB 2I60L 3BP4B 1BVLB 3O2WL 1AY1L 4MCYA 1B4RA 5D1XA 3RWHB 1HQRA 1X5XA 5GS2H 2A9NH 3AREC 3MOAH 3BRGC 2GY7B 1OTUC 4XNYL 1L7IH 3HNSL 2BNRA 1KPRB 3NA9L 4GUPA 5CJ8A 4M02A 2BMKA 5CILL 3LN5B 1CGTA 1G9NH 5BOPA 5D6CB 2B8OT 4Z0XA 5F1NB 1MRFH 3CDGB 3BUYB 4R97C 2E5EA 4EBQH 4MQXD 2MOVA 3ILPB 3IS1X 3P4NB 4MD4B 2UVFA 3B9EA 4IBLT 3DVNB 4LSQL 3EOTL 5HI3D 2WNGA 4RAUA 1EO5A 3QHTC 2BRRL 3DTXA 5F3BA 1YMMA 3BKJL 4PJBF 4R9HA 1OW0C 3KAAA 1ZANL 4JPVL 1JHKL 5BW7C 5CP7B 2X4QB 3FQNB 2JJWA 1XF1A 5JHDE 3VFMB 1VGKB 5IFJA 1J88A 2F5AH 5J1TC 3V7AG 1CFTB 1U91B 2FNBA 4ODXA 1F11B 3EW3B 4DN4H 5DC9B 3H7BB 4LVEA 3ZYIA 4G6KH 4MXVE 1S5HB 3H9SD 3ARSA 2AGJH 3EO1A 3DUHA 5I8EB 4Z7NF 4D9QE 4DGIH 3DXAA 1P2CA 3C2SA 3GSUA 3QO0B 4LP4A 4CMMA 1MPAH 1CE6A 1X44A 4PG2A 4PJFA 5HHXH 5IF0B 5I1DB 1WBYB 2ZUYA 5M94B 1DQTA 2QQKH 2AXFA 3SE8L 4PYHA 4OLYL 1XGYL 4NUGH 3SBWC 2IH3A 3H2WA 1JYVA 3EJJX 5DQ9B 5EZOH 4FXLA 5FGRA 5L2KD 4QLRA 2GFBB 1LMKA 1LO0L 4FMKA 2GIYA 4QRTA 1BGXL 1BJ8A 3TIEA 1WVZA 4PGCB 2HRPH 1BF2A 3MTRA 4DVBA 4FFZH 4YNYA 3ROOA 4XT1C 3P4NA 1ZLSH 2IALA 2P8PA 4M8VA 3DARA 4DKDC 5I1LA 4O4YH 1CGSH 3IAGC 3AREB 4KJPD 3ULUL 4NPYA 1FQ9C 1CDJA 2ZCKL 4JFEE 4NQXB 5ERWA 2VUOA 2AK1H 3QIWC 4UDTB 1YC8A 1NCAH 5FA3B 1CZ8H 3MV8D 1YNLH 4S1SL 4DZ8B 2BVOB 4XC1L 4BH8A 3DI3B 2J88L 2ADGB 5JOPE 3GSQA 4ODXB 1S7QA 4G42B 3U6RA 5TDPB 4OJFL 1BQLL 5BZWB 3W81A 5ID1B 1BZ9B 1SYVA 2VC2H 1AGBB 3G5VB 1HI6A 3PWPD 2ED9A 1JPFA 5J1AB 4ODSL 2NY6B 4CVXB 2W0FA 4JQVC 2EC9U 4TVPE 3VXMB 2C4FT 4HKJB 1UKSA 5IBTH 2DTML 3VG0H 4P9ML 2W0LA 1XR9B 3T1FB 5HDBF 1KIUA 5JW4R 5JTWA 5FUOL 4JM2D 4WEMB 1N8ZA 4CW1A 2CXGA 2XACC 5EU6E 3VXSB 3IDGB 4WO4C 2O5ZL 2J12B 1LD9B 1G84A 5B21A 2LVEA 5I9QC 4MS8D 2R23A 2EDDA 3QUKB 4V1DA 4EI6A 1A47A 1KPVA 3G9AB 3OHXB 3QDGD 2IALB 2P8PB 2XZQL 3MJ9H 4X7DC 1KBGH 4NFDA 4A2MA 1MRCL 1R3JA 5I1LB 1AC6A 3BIKB 3LOWA 3FN0H 5HVGB 5ERWB 1HHIB 3VWKC 1WBZB 4ONHB 4B41A 2DQCL 4EEEA 3MV9B 3VFUB 3QIWD 3QULB 4P3CL 1KLUB 1FORH 2CLZA 1EVTC 1LK2B 2HKFH 1IRAY 1R3HA 3ZKSD 1QSED 3U6RB 5L2KB 5TDPA 3GNMH 1MQKH 1CVSC 4NNYA 2YPLB 1LEGB 2VR9A 1JGDB 1HQ4B 1AGBA 1WFNA 2B5IC 2ZNXA 5K59F 2XWJB 3UTSD 1CDIA 4PLJD 4X6BB 4HK0A 1J0IA 3BGFB 4LCYA 3A6CL 3VXMA 3EJZC 4HMCA 1BMGA 1A1OB 3FFCE 5FYKU 1ZT1B 1E4KA 3F8UB 4N8PA 1NGWA 1X4YA 4R2GB 3TO4A 5KS9A 3SOBL 5LVEA 5BVJA 1FRGL 3T1FA 3NGBB 2X9YA 4DWHA 1OWRM 2DIAA 3TT3H 3RAJH 5H37G 1WAAA 4L4TD 4CVZA 4WWID 2IAND 4CW1B 3VXSA 1LE9B 3VFNA 3D39A 2PCPA 3CH8A 2A9ML 2EDXA 4PUBL 1QNZH 2DQHH 3GO1H 3OKKA 4FFYH 5GJSL 1K2DA 3NMEA 4BSJA 4NZDA 2EE6A 2HMIC 1KPVB 2OJZH 4JZJA 2DWEB 3TVMB 4NQEB 1F8TL 3C60C 3LB6D 2I9TB 5HGHB 3TBVB 4K9EH 1J8KA 3S35X 4GBXD 5F9JA 1NL0L 4IOIA 4ZFFA 1P5UA 2ZCLH 4YX2L 4EN3A 2ZP0T 1I1AC 3V6ZA 5GS1B 3DSFH 3ZO0A 5C9KA 1T66C 1QO3A 3W39A 1CICC 3O2VL 3TV3H 2H6PA 5LAXA 3IDYC 4QCIB 2ZOLB 4AH2A 3RNQB 3LRHA 2D03H 2QEJA 1I8KA 3Q5YA 4HS8L 4LEOB 1EEUA 3OJ2C 2XYCA 3RHWK 4OZGF 5JXEA 1B0RB 1J8HE 1YYLH 2NTFB 3D5OF 2XKUA 4QRPB 3HE6C 3KPPB 4KDTC 3QCUL 2MQ0A 2H26B 1U93A 4KK5C 2A74A 1FLRL 4AZ8A 4LCIL 2VLKD 3EAKA 1BIIB 5I66A 4LK4A 1QLRA 1EK3A 4XMLH 5IB1A 3SJVB 4NT6B 1GOHA 3VGBA 4TVPH 4H88L 1RZIA 1IAIH 3NTCH 2P24B 4QHKI 5AD0B 1AGDB 1N0LA 2OQJB 2EDWA 2DLEA 4LHUA 3FONB 4NZUL 2R69H 3HAEG 4PRPD 2R0LL 4F57H 3JTTA 4Q0XL 2BC4B 2J8OA 5F1IB 5HY9B 1K8DB 3T0EB 5EIIB 3C08L 4OZ4B 4PGBA 4DUXA 1ZT4B 3BH8A 3T0EE 5GIRA 1M7DA 4G6FB 2YD5A 4NCC2 2WZPD 4XNZC 4IOIB 3UYOD 4ZFFB 4RFNB 3DV4B 4G3YL 1T0NA 2OSLB 3WE6A 12E8H 2PR4H 1CE1L 4UT7H 1S9VB 3G04B 3MJ8B 4P3DB 5IM7B 3RUGF 5K33A 4UT6L 4JPIA 4Y1AD 2CLVA 1HZHH 3LEYL 4LDOB 4OFYA 1BFSA 2H6PB 2E6QA 2VQUA 4MA1C 3O11A 2KBGA 1D5XB 3QFDB 4YIQA 3U9UA 1TJHH 5F7WC 4ZUUA 4FNLL 4BQ6A 1JTOA 2IAMA 4FZEH 1KB5A 3C8KB 3E8UL 4NDMA 1FYTD 2OMNA 2OM5A 5K9QG 1WF5A 1T22A 4X0KA 3EYFB 5D6CA 5L7XL 4HBCH 3CDGA 2FZ3A 4JFDE 1N7ML 2QJDA 4ZUWB 4YEFA 5DD3L 2A38A 3VI4F 2R0WL 1CXFA 3X3GL 4EIGB 1FO0A 5CSGA 3TN0D 4M6AA 1KJ3H 5AG9A 1PAMA 3HFML 4QTHA 1TIUA 2WSKA 3V52L 5L8KB 5HYSB 5CIPH 2YA1A 2BY2A 2GTZA 5CZXD 4ONGL 1UKQA 3BUTA 4Z7UB 5E8PA 2YA0A 4A6YA 5TPWL 3BP5A 3P40A 3JWNC 5HDOA 1RZ8B 4PJ5D 4LRNL 1MWAL 4WUKL 1F3DH 1M7DB 5DURB 1HKFA 1BQUA 5C0FA 2UYLA 4LFHD 5I30L 1C5BL 4WHYH 3SCMB 5CEZD 4O2CA 2PXYD 5GPRA 3BKML 3WIHH 5EU3A 1A9EB 1IJ9A 2ZSVB 1IBGL 3CMOL 4S1DC 4UZGA 2PTTA 3MCKB 1F6LL 4D94A 2L0DA 5I8EA 2F74A 1RUKL 3GEWB 3IGAB 4MDIA 3SJVE 4DKFH 1IVLA 1P2CB 2IFFL 3BGAA 5T3ZL 2HG5A 2YUVA 5LGHH 3W2DH 1XEDA 3BT2H 5D9SB 3MJ7B 3H9YA 4N0CD 4PYGA 1CXHA 3IVKB 2LU7A 5IEHB 3LZFL 5EZLA 1MLCB 2P7TB 1MJ7H 1Q38A 1ZHKB 4PY8I 4DN3L 4XAKD 3Q6FA 1J18A 4PS4H 2IPTL 4YGVB 5ISZE 4GKZA 2V5RA 6FABH 1CICB 4C54A 3RVXC 3ARGD 3EFDL 2CRZA 2W38A 3NABH 4M1CC 4WI8A 4BQBA 2H2SD 2RCSL 2JB5H 4FXKA 5IUSA 3EGSA 3JVGC 2IG2H 5I1AA 3L5WB 4I3RH 1A1NB 1AHWA 2ZSWB 4MA8H 1RIHH 4Y4FD 2ZCHH 2VWEC 4ZYKB 3K46A 4N9GA 3F7YB 1V7ML 3FTGB 3P4MB 2VABB 1MFAL 2UY6A 4K23H 2YD8A 4OCYH 4JO2H 3VXRA 1U8IA 4Q9CA 4G6AD 5D8JL 1CU4H 4ZUTB 4QF1A 4GMSH 2J5LC 3G6JE 3RDTA 3E6HA 5TQ0L 1C5CH 2PKDA 3IDNB 5HHOB 4PRHD 3UPRA 3HE7D 1D7FA 3G6AB 4JVUA 3O4OB 1F42A 3RPKA 3VFGH 1LO3L 4KVNH 1OP3H 2SEBA 5DMJB 4YZFE 4XNQB 3TA3C 4R4BB 5KW9H 4J3WA 2GI7A 4FFVD 4R26L 1Q94B 1YZZA 3LCYA 4KTDH 4P5MB 5DMIH 4ZFZB 3C2AH 3MROB 1CWVA 3S96B 5EBWB 4PBVC 4NO0D 4PBWD 3F7PC 1A8JH 4KZDH 5DVKA 1I9RH 15C8H 5IQ7H 5IBLD 4XP4H 2EE3A 3GBML 2Z91B 3QWRD 5IVXE 4HXAH 4XCCL 1UYWH 3NA4A 3ZTNH 4EUPH 4BZ1L 4V1DB 4EI6B 1MVFA 3NPZB 5A43C 3IB4A 1A7QL 4UAOB 4G7VL 1EFXD 4M9OA 5DYOB 1U8PA 3RVVC 4PTTB 1AXSB 1XH3A 4K3EH 4YH6A 2KL6A 2DYPD 3CAFA 3BIKA 4EI5C 4KI5D 3BKCH 4NO5A 2DD8H 3MX0A 1TNNA 5CGTA 4EUPA 2FL5A 2D4DA 4PB0H 5HSFA 5F1KC 4RNRA 5I76B 4Y4HC 2A83B 3MV9A 5DJZA 3V0AC 2ZJSH 1WBXB 4ZFGL 4JRXB 2HFTA 5B8CC 1GC1H 4YDLB 4M7ZC 1U8IB 5L2KA 2ARJQ 3T2NH 1SM3H 1IGML 4PJGE 3QUZA 1G0XA 5BRZD 1N59A 3LEVL 2V2XA 3OPZL 4JFFA 4LKXA 2J8HA 1T0PB 2ZUXA 1G7JA 3S3JA 2DWDA 3U30B 2J6EH 2YRLA 1QBML 2XNAB 3RTQB 2O93L 3KPRD 4X80L 1WSST 2NX5D 4NHUB 3UROR 3PABA 1I7UA 1S5IH 4ISVA 3ALXA 5HJ3B 4JDZA 4ZFZA 5DMYA 2NY6C 4GXUN 4OFDA 3S96A 5GRUH 4ZTOH 4WW2B 3CLEH 1LDPH 4KRPC 3PGDA 5I18L 3L3GA 1NAMH 1H0DA 3ARBB 3NFPA 3WFHB 1FLTX 4L1HA 5FF6A 3OKKB 4QRSA 4X5WB 5ACMA 2A0LC 3RBGA 5DK2A 3HS0B 3L9RA 1OAQL 2AJZA 1XH3B 4YHIA 1EPFA 2O5XL 2NY2C 3TFKC 2VE6A 1OM3L 1NEZG 4JQVA 3ARQA 5BVPL 4PD4J 2WUCH 4JFEB 5CJBA 2VXSL 5GSRB 2A83A 4LIQL 3UTTA 4RISH 3LS4H 1N2RB 4ZPTB 2QHLA 4JZNA 1YECH 3LN4A 4YJZL 3CFCH 5C07B 4HG4J 3X11B 1HH6B 1WFTA 3O3EB 3AXLB 1KJVB 2WP3T 3VXTA 1GJIA 4PGDA 1BQHB 4Q9QL 3U46B 2H8PA 4HHAB 4OZFB 2DWDB 1EFXB 4M7JL 3PDGA 4PJ5B 4MGXA 3ZSTA 1KTLA 2Z8VC 4MXVF 3PF2A 3MOBL 4LHQB 2W1NA 3Q0HA 2UUDH 1Y18A 1NC4B 2ERJB 2FX8H 5A2LH 4WW2A 4KKNA 5E1HB 3MRDB 3L3GB 4MA3A 5EIQA 4PJBA 1QR1A 4LHUB 2CDGB 5J89A 5KVGH 4FQXB 2NPLX 3SEPA 4X6EB 5B22A 1XGRA 3VG9C 3PP3K 1FN4A 1YY8A 2CDFA 4KJQD 3IFPA 1PZ5A 1MJUL 4F33A 2I26N 2QHRL 1V3KA 5LBSL 1QLEL 4AIXA 3U0WH 1U8NB 3FO1A 2V7NB 1E28B 1HN1A 3L5IA 5HGDB 4AMKH 4YFLF 5C92A 3T0EC 2DMBA 2EDHA 5D4QA 1ERNA 1GIGL 1IGIH 1YEKH 2E9IA 5FYKH 1IGYB 1IAKA 2E9JA 3MJ8A 4KKLD 4P3DA 5FM5O 1MFCH 4WU5A 1Y0LA 2IBGA 5IB3B 2P5EE 3MRPA 4LSTH 1VEOA 2FECL 4GRLD 4PRIE 3O3EA 1OP5K 5E8NB 2EXWC 2XRAL 5ACZB 5FUZH 5E70A 1OW0A 5DJ8A 2ITDB 5KVDL 4JDTH 5C6PB 1MNUL 1OY3B 3QG7L 5J0BA 4JB9H 4M3JA 5F6IC 3CU7A 1S3KH 5T1KD 2IF7A 5B4MC 4JE4B 4XZUA 3LMJL 2JJSA 1U58B 1WT5A 5B8CB 2N4IA 5A16A 2Z92A 1H3VA 5B39G 4IMLB 1F4AA 4HH9A 3HR6A 3KYKH 3QNXA 4N0FA 5JW5B 4LSSH 2CQVA 2R0ZH 3GSWB 1MVUA 3WNKA 1FZMA 4WUUA 3BD5A 3QH3B 4N90E 4KY1L 1FC2D 1WAAE 2CK0H 4LPVA 1Z6JT 2AQ3A 2FH8A 1KC5L 4HCRH 2LTQB 3F5WB 3OAUL 3LQZB 1DE4B 3Q3GA 4ELKA 4JFQB 3SBWA 2DQIL 3RWIA 1JPSH 5EO1A 4LSUH 5JW3H 1IAOA 3GMNA 2OTWA 5KG9A 3MZTA 1UWXK 1WWWX 2BOCB 2ADJB 1T1WB 2VKXA 3K74B 3PV6A 2QQNH 5I8KH 4QHLA 5FO9B 5IESH 1A9EA 2ZSVA 3NPSC 3GSOA 1FVEA 1IEBB 1JVKA 2GW5A 4MDIB 1DBML 3EYQD 4Z76B 1BZ7A 4XRCA 2GSIA 1PY9A 1KCSL 5DJCB 2VSCA 4CDHA 2F8VA 2VZ1A 3TLRA 4KJYB 3EHBD 3GMRA 1MLCA 5C09D 3SDAB 5B38G 2QADC 5EU4B 1JZ2A 1ADQH 4HIXL 5KSBE 2XIDA 1OAUH 3RJQB 4YGVA 1NAMB 5F9WC 1CL7H 4GW5B 4ZXBD 5AWNL 4KQ4H 4LCUA 4PJ7A 4APQB 5D71H 4IMLA 5DHXB 5CJQH 1JRHI 4HH9B 2YUZA 2YWZA 2AJVH 3BXNB 4LPXA 5LWYL 1MVUB 5GS0D 3WJJA 3MLSL 5DFTA 5IOPA 3IDXH 3FQUB 4PJHF 1MCOH 5CP3H 3PWNA 1TZHB 1QSFE 3WBDA 2VKWA 3NCCB 5DVMA 3SY0A 1DN0B 5EOCL 3QXUA 5MI0B 1G6RB 1AHWC 1FGVH 3SGJA 1RULL 4UBDD 4ODHL 4LLQA 4F7MA 3QXVA 1Z0NA 4YZFF 1NCCL 3MCG1 5EPMA 5J13C 3BZ4B 1JWUB 2HN7A 3OMZA 2DQEH 1WEJL 4IMKC 4Z7VF 4XRCB 5GRYA 3SPVB 3TN0A 2V2TA 5AZEL 4OLVH 2LFGA 2NY0B 1FGNH 3SN6N 4JFHD 1IT9L 2P8LB 5EO0A 1TQBC 2CIKA 3TO2A 3RWHA 4ZTPH 2NY3D 5D1QD 3SDAA 4YBQC 2I9LA 1GPOL 1S7VB 3CFDB 1PX4A 4NKOA 3WFEL 3BHBB 4WO4B 3DNKA 1F4XH 1RV6X 2UZYB 3LV3B 1WZMA 5BO1L 1NAMA 1N6VA 3WSQL 1TJGL 3NCFB 4NJAH 3C6SB 3WFDL 5C0AB 1F3JB 3PP4H 4GFTB 3MJ9A 1C7TA 2AQ1A 2YD4A 5E95B 1J1XL 3QEUA 2A1WL 5KOMC 3HUJF 4V2CB 3PIQB 2VXQH 4PJIE 5DEGA 1AGCB 1J05B 2J6EA 3S4SA 5H35A 4JKPH 1F5WA 1EAPA 1WWAX 1A3LL 5KZCB 4XVSL 4U1NA 3WHXA 4PJGF 1BM3L 3FQWA 3IYLW 2E9BA 1A6WL 4ACPA 1ETZB 2ICWA 4PJFE 3CNKA 4R4FH 4U3CA 5SX4I 2AJXL 4LKXB 1A3QA 4HQQL 4IMKA 4JCLA 4X9GA 4NSKA 3U7YL 2HN7B 4Z0BH 3F58L 3JWOH 5INDB 4KKAD 5IT2L 5JA9A 4CMMB 1AY1H 3T8XA 4PRHE 4JDZB 4MZ3A 1OWWA 3ES6A 3BEWA 3QEHA 3V9FA 4QRRA 3HNSH 3V5HB 1G7PB 3WXVH 1S7VA 4YXKH 1P4BH 2VITA 5TE6H 1N4XL 4ZUVB 4WO4A 5CILH 4K7FB 4YGAB 1NFKA 4LOUC 4K7PH 3IJHB 2DLTA 4DJMA 5ANMB 1MRFL 3I75B 4QRSB 4X4XB 4MD5B 3O6LL 3U0PB 3WIIH 3SGDI 1RZ7H 3BKJH 1T04A 3VXQB 3A0OA 1MFDL 4KKCD 4D0CA 4CN6A 1JHKH 4OM0H 5GS3A 2A6DA 4JDVB 4XNXL 3SGEI 4CAGA 3MRLB 3TNNA 1LO2H 4TTDC 3S98A 2EC8A 2NY2B 4MVBC 2F5AL 5DVNA 4XMPL 3PXJA 5HYJE 2AEWA 4ZNCD 2YUXA 3DOSA 4GG8A 3I02A 5TF1H 1FE8L 1FNEB 1FNFA 3GUTB 1EMTL 1ETZA 2ICWB 1YUHA 1JHTA 4I0PA 2HFEB 1I9EA 5TQ2H 2AGJL 1O7SA 3GGWA 3BPNC 4WCYH 5FO8A 4NSKB 4UOJA 3MR9B 4NUJA 4CVXA 3MBED 1A21A 1KYOJ 3QYCA 4FQHA 3TO4C 4NRXB 2G5BA 1KTLB 2CUHA 4N5EC 1NPUA 5I6XC 5C0EA 3OQ3B 1G7IB 1RPQA 4Q6YA 4S2SA 3O4LA 4RRPG 4I48B 3HC3H 3V5HA 4M48H 4OBRA 3DXAE 5T1MA 3EYVB 1UH2A 3I3BA 1NUNB 1A6ZA 1L0YA 2J8UF 1J12A 4L3EE 4TSBL 1QPPA 1SEQH 4Y4KB 5D7LB 4J1UB 3UP1A 4QKXB 4GXVH 4PJFF 4EIZC 2CDFB 2NY0C 1C08A 4EDWH 4PP2A 1DLFL 1CDYA 1ZHBB 3ARFA 1G7LA 2XI9A 3I6KA 2W9EL 1T1XB 3EBAA 5JHDA 2B1HH 2UYLB 3KYMB 2HTLD 2EYSA 1MCQA 5IQ9A 1YY9D 3QUML 4OZIB 3L3IA 4OLXH 3QULA 2BVUA 3I02B 4NQCE 4ODVH 3GMPA 1JGEB 3LKSB 1AD0B 1MJ8H 3O6FC 1CFVL 3RDTD 1NBVH 5E5UB 3WLWC 2PXYB 3AVEA 4AEEA 1OPGH 1AI1L 1JGUH 4JFOA 1KEMH 3CX5J 3UAJD 4U1IA 4GKNB 1FL3B 1UZ6E 1YDPB 5FO7B 2NXYC 4XZUB 1OGAB 3RY5A 1G7IA 5B8CA 3QIBB 4U7SA 3D0VB 3QDHA 8FABA 1FG2A 1S9WB 2BP3A 4X6DA 2RR3A 4KVCH 3CFBA 3UTSE 3E6FA 5T1LD 1BVKB 4M4PA 2HFFB 4HUUA 3KPSB 4HAFA 2UVEA 2JJTA 3ZE1E 5GRVK 2QSTA 3VU2A 1PBYA 3KPLA 5CJOH 5L9DL 1PJ9A 4PTUA 2EYTA 4GT7A 5JHLH 4FMFA 3BAEH 1TPXC 5I1KL 3KR3H 4AL8L 3X14B 1CN4A 3DYMA 5F7KC 1ZHBA 5CSZA 3WIHA 3RQ3A 4V1DD 4MJIA 4XHJD 1QSVA 3QDGA 1WTLA 2FJFA 7CGTA 4TNVK 2PW2A 4NQED 1KG0B 3GBNH 3ULVD 1AE6L 5D2LF 1KCUH 4U4BA 5LAXB 1IM9D 4D9RE 4Z76A 1ZE3C 5T1KA 2AKRB 2R4SL 3UDWC 5E00A 3LDBB 3DUUA 1ADQA 2CMRH 4JFFD 1K4CA 1QRNA 4Z7WF 2YD1A 2X40A 2J8UE 3BYYA 3IT8D 2E7LA 4QHMB 2R2CA 1R5VA 4R90H 2VL5A 35C8L 2J7LA 4HUWB 4H20H 2VTFA 2PUQT 2WMPA 5D2LA 3OG4B 1A7PH 1E4XH 3KHOA 2PYED 4L29A 2NY4B 5JIPA 4LCUB 2QKIA 4OD3L 1U8LA 2OZ4A 4N1EA 4J3SA 1FNLA 1D6EB 3HPLA 1V3LA 3CFBB 5E4EC 4PJHE 4NC1E 5FYJL 5AD0A 1QNZL 3GO1L 4FFYL 5IVXB 3KPSA 4OLWH 3STLB 1G9NC 3MV7B 4YK4C 3KS0H 2DQUL 4Z7VB 4PTUB 3KWWA 1TZHA 1R3IL 3MLUL 4NKDB 5DEZA 1FFPB 1ZT4A 3BH8B 2E6PA 4MJIB 2VXUH 3VJ6A 4A2LA 4RDQG 3PHQB 3AU1A 4U1SA 4QWWD 5KSBF 1I8LA 3QPQD 1KG0A 3BZ4A 1OP3K 5D93C 1AO7B 4KDVA 4KMQA 1MI5E 3F62A 4G9FA 2ICWJ 2DQJL 4BFIA 3SPVA 3O11B 4IRJC 5LQBL 4LVOC 2MPAH 1TCRA 1YYLL 2QR0A 3DUUB 4LSPL 1W72B 4CJ0A 1BWMA 4OZFH 5FYJD 4XCYA 4C4KT 2C1OB 4QHKJ 1S8DB 2OR9L 1OTTD 3ILQC 3C8KA 1G9EA 4FOMA 3QCUH 4FTVD 4G43A 1JNHA 4NDMB 3CXHK 4KJWC 3MV8B 3U9PH 4I3GA 2LAAA 2F58L 2B0SH 1QG3A 2G5RA 3DWTA 3FOLA 4KK8C 3SDAC 1MCFA 2O61B 3PV7A 1F3JA 5C07E 4L3CB 1EUUA 2XZCH 3T4YA 3C87A 5DK3A 2D4FA 4OCMC 3BRDA 1G9ML 3IFLL 2R2BB 3STLA 5JPMA 1FZKA 1E27B 4YLQT 5CKGA 1SJVA 3EJYD 4I13B 1AGCA 1J05A 2VLJB 3D9AL 5J9PA 4AM0B 2H3NB 3C08H 5EA0L 4U1NB 3WHXB 4F7EB 2MHAB 2OX5A 3BGMA 1G1YA 3KPQB 5I15L 5IEKB 1WZ1L 5F9OL 1PKQB 4UT9H 3RZCD 2PR4L 1LEIB 1CDGA 6CGTA 3UZVB 3SDXA 4AIZB 5E2WH 1EEZB 4K8RL 4DGYH 3D69A 5HHVH 4UT6H 3PHOA 5JXED 1N5YL 3RNKA 2W0PA 2X41A 1HZHL 3LEYH 5CKAA 3MCKA 4NYLA 3UTPE 2ADFL 5C0DA 4G9FB 4OIAA 2IJ0C 3QRGL 5ALCL 3GMMA 2A77L 3REVB 4WI6A 3CSYB 2AK4B 5EORH 1HK6A 4FZEL 3EFFA 3UTTE 2A73A 5SV4A 4XCYB 3E8UH 4XPGH 2P7TA 2VLLA 1A6TA 4GBXA 4JRWA 2Y9RT 1X6LA 2AABL 5CEXB 4EN3D 1ZA6B 4QHNB 1CFQA 1YEIH 4WY7H 3S35H 5DQJB 1JF1A 4Y1AB 4HDIB 4X8JB 3DECA 4JPWH 2ICWI 4HKBA 1YPZE 1HH9B 3MRFA 3CZJA 4PV9A 5DHVH 4WFGE 1FZKB 1VEPA 3HMXL 5EU6A 5ELIA 3RVUD 1EHXA 4LF3A 5CP7A 4L4TA 1R24B 5INCA 3INUH 4LRNH 2Q20A 2NXZC 1RZJC 4Y4HB 4PG9B 4WUKH 3CVHH 3VI3E 1U91A 3LS5H 1BBDL 1HSAB 4PRIA 2IQAB 1PKQA 4MAYC 4HMDA 3RI5K 5ITFB 3JBG7 5E8EB 1TTUA 3IXAB 1JMZA 4G6MH 3BESR 3E6HB 3BZDA 3MLZL 3CVHA 4KAQL 3UPRB 3MREB 4MNQE 4OUUB 3GJEB 3CC5B 1RUKH 3KYAA 4PGZA 2Y5TA 4ALAL 2LV4A 2FGZA 2CUIA 2P4AB 4M6MH 3B2UD 2AQ2A 4A6YL 1CE6B 2NXZD 4PJFB 2G9HA 2OI9C 4X4ME 4NZTH 3EUUA 3MRJB 2AXJA 4FQQB 1G1CA 3KLDA 4S2SB 3CVIL 1MHCB 2UY7A 4XWOC 1QUNA 1QBBA 4LARH 3ARPA 3UTQB 1ZA6A 3LVEA 4PS4L 2GFBA 5IMMB 2AXGB 3TVMC 4IHOA 1U8HB 1IFHH 3GMLB 3RKDC 1Q0YL 4XXDA 3BFOA 4DVBB 4NN7B 5IVXF 4M43H 1XF5B 5DD1H 3VRIB 5A40E 1ZVHA 3HG1A 1YJDL 1N5AB 2FWOA 4GJTB 4MA8L 1F4WL 4QRPD 2D3VA 1T1XA 1TNMA 1MF2L 4C55A 1URLA 4OZHA 5IVZB 4LAQL 5DUML 3STBA 2QQQA 1P84K 2VQ1B 5D2NA 4P2OC 1YQVH 5IB2B 4F2MB 1TDQA 4W68A 2NY4D 3K7UA 3OAZH 1UH4A 1K6QH 4IEFB 1Q72H 4GMSL 3WNLA 2VAAA 3O8XA 5TQ0H 5ITFA 1I1YA 1EGJL 4MDJA 4EBQL 4PRDA 2YPLD 5TE7H 1B6UA 1JE6A 5CZVH 5DSCA 5IBUG 1UWEH 3T04D 3UJIH 3UC0H 3ARVA 2AW2A 1I4FB 2C1PA 2W0FB 3UTSB 3DYOA 3C6LC 3V4VH 1ZT7B 1ZGLM 4XPAH 4Y88A 4RAVA 4YC2B 4GAJH 4TUOA 3PABB 3TBYA 2AAVA 1I1AA 1CTOA 3BO8B 3CLFH 1EUTA 4QHUB 2DQTH 2GHWB 3SGEH 4HPYL 3UTQA 2FYYA 3VGGA 5I1IH 2V5SA 4HLJA 5DJ2A 3I85A 2J8UB 1MWAA 2IH1B 3O3DA 1U8HA 1R3LA 4X8XA 5DD5L 1YNTB 4MQ7B 1I1RA 4EVNB 3VI3F 5I1CH 4J8RA 5CCKL 3OHXA 2H45A 3KDMB 4M6OL 2X10A 3Q1SL 1HCVA 2MKWA 3NIGF 1UB6B 3FQTA 1UWXH 1R3JB 1EA9C 1NGPH 4AYFA 3O9WD 1FO0L 1KELL 5CIPB 4U6YA 3QJHA 4K7PX 2EYRB 1HHIA 4XVTL 4JG0H 4OGAC 1FAIL 2C3VA 3HUJE 3WL9B 1KLUA 3O2DL 2Z35B 3RY6C 1LK2A 1UM6H 5HDBE 4OF6A 4Z7WE 3TYFB 2MQ3A 4NQSB 1IMHC 3LEVH 1HQ4A 1HYSD 3LKRA 4Y2DB 2VXVH 3UMTA 2H8PB 4HHAA 5KSUB 1QBMH 3QNZB 2W91A 4JY6B 2HH0H 1KT2A 2DKUA 3ARZA 1MCWW 2JIXA 4OCSH 4RMWA 1JNNL 3BN9C 4RGMB 2VR5A 5CMAB 4QHMA 5AUMB 1KN2L 4PREB 2P45B 2GTWB 4OCLC 4RGOH 1BLNB 1EDQA 5CINL 3SE3C 2OBGA 5JO5B 1LDPL 1T89C 4XPTL 5IW6B 4WFFE 4OKDA 3MLTA 1NUDA 1B0GA 2EDJA 1BQLH 1T7ZA 1ZLUK 3MC0A 1CLOL 3VXUD 5I71C 1NEUA 1RQ5A 3O45A 3MV7A 1X5YA 4GKSB 5F7YC 1H15B 1DBJH 5AYUH 4BSWA 3FHQA 4NQEA 3GIZL 4KDTA 4JHWH 3A6BH 3LSOA 43C9B 3FQRB 3PQYE 4MZ2A 4P9MH 1UH3A 5CIPA 3MPCA 4KXZH 4D3CL 1D5BA 4LIQH 5D7JA 1TZIB 5EUOE 5KSAC 2ATKA 3ARBD 3QIUA 3W11C 2UWEA 2HJKB 2YKLL 2BK8A 4P23C 3WO4C 2JJSC 3ULVC 5IB3A 3ZDZF 1I8LC 2JLLA 4G8GB 4MAUL 3U36B 1KB5H 1S78C 4CADA 4P5KA 4WTZA 2NTFA 4PJ8C 1NBYA 5A2FA 1ITCA 2XICA 3MJGX 3QNYA 3B9AA 3GM0A 3IDJB 4X7SH 3MV8A 1MH5A 32C2A 2H26A 2NTSP 2A74B 1LVEA 4DCQA 4OZFG 4JRYB 4G8GE 4G9DA 3ZE0F 4KI5E 3NIGE 2WBJB 1UQSA 2EDBA 2P5WD 5FV1L 1QLRB 5JQ6L 2FDBP 4KUCD 2EECA 1UGNA 2VDPH 1LK3L 3ROLB 3T0VA 4NT6A 2V17H 2Z93B 1B0GB 3REWA 5AG8A 1AKJA 1UJ3A 2O5YH 3D2UD 4MNQA 2WIIA 1E27A 4DGIL 3GM8A 1MPAL 3H7LA 1D5IL 2F9BT 3QDAA 3ZDYE 4AM0A 5JLZB 4PJEF 2Y5EA 3OKOA 4IJ3B 3SE8H 4LMQI 3PWVA 1QVOA 1XGYH 1DE4A 1FRGH 1ZGLP 3WLWD 4EI5A 5F7HA 3NN8B 4UINL 1IGIL 1YEKL 1F4YL 1KCKA 2CKNA 3O6FD 4KWUA 4OFIA 1S9VA 2ADJA 2Y6SD 2I07B 2W0KA 3HNVH 4JFHE 3VH8G 4YDKL 3GSOB 5I73C 5TGBB 3FN9A 3BRFA 4HV8B 1D5XA 1YY9C 2VN4A 4NZRH 5DWUH 3D85B 1LHZA 4OQ1A 2ENYA 1MHEB 4X99B 1EGJA 2IAMB 4JDTL 3EDDA 1KB5B 2Y1VA 4I3SH 1BFTA 2VZ3A 5CEXA 1CZ8L 4AG4H 1IAMA 2NLJB 4WEBL 2GCYB 4QXUL 2AEIT 4DZBB 3QWOA 1YPZF 4GW5A 3T3PF 5DQJA 1NFDB 2FZ3B 5M95B 4I4WA 4F37K 4FN0A 3SO3B 3NGBC 1Z9LA 2VC2L 3TV3L 1UZ6F 1ULVA 4LSSL 1OD7A 2LU3A 4FG6C 3P4OA 1KXQE 1IC1A 5M7QA 3P3YA 5HYSA 1YMMB 4U6TA 5C09A 1JN6B 1WC7A 1I3VA 1M7XA 3QQ3A 3W5MA 3EYSL 3V4UH 5IROC 4NNPH 1L9MA 3IFOA 5FXCH 3TO4D 3CIQA 3IAPA 3RGHA 2AK4D 1LO5A 3RWGB 4OD2A 4C83A 3BE1H 2O26U 3KXFB 5AZ2H 3SKOB 1HCFX 2FGWH 3RL1A 1Z0MA 5C09E 2ESVB 3H7BA 3TIDB 4HW6A 1DBMH 4U05A 4ZDHB 3IKKA 1NCTA 1HINH 4K71C 2VB5A 4KI5F 2IBBA 2P5EA 4MYWB 2F53A 5DRWB 1C7SA 3TBSA 1QYGH 5TDNA 1IQWL 2Q8BH 3P0GB 5D6DA 3MNVB 1A6VL 5IEHA 1MHEA 4X99A 4HPOL 1BOYA 1R3KB 1S78D 4Z7VE 1TQBB 3PWJB 5CBAA 4KKCC 3ZT5A 4HKXA 2XXCB 5IVNA 2B2XH 4P5TC 4NC2B 3LV3A 1OCWL 1H8NA 4JZOA 4OQTL 3ZDYF 3DHJA 2EIZB 3W11D 3OJMB 1NFDA 3GNML 4OQTA 5D71L 5C0BB 3TZVA 2KH2B 4V1DE 3RPIA 1XF5A 2XKNB 3D18B 3EGSB 3WDIA 2NY5C 2XA8L 1HILB 3GB7A 5D2NE 5EG6C 4NPYB 3VWJD 2BNUA 3KGRA 3RKPA 4OZHB 5FOBB 1JYWA 5IW3A 3S4SB 2XG5A 1KB9J 4GH7B 5E6ID 2VQ1A 2WW8A 2BJML 2DQDH 3FZUD 1LO5B 3RWGA 3E2HC 3LIZH 4P4KA 2BHZA 3U4BH 1KEGH 4CN4A 4NRYA 1Y6NR 4ODHH 2VAAB 3O8XB 4Q2ZA 3UEZA 3PE9A 4KROD 4EQ2A 3T0WA 5SWQA 2W9LA 2ESVA 1HI6B 1DEDA 4ZS7L 4O02H 2Z4QA 3C09B 1KSRA 3JXAA 4HK3J 1IKNC 5INDA 1I4FA 5J06A 4NBXB 5AZEH 4P59L 4PJDF 4NFCA 1HYRC 1Q94A 4K9EL 1VFMA 3RA7L 2VUYA 4WHDA 3BN9D 5KBNC 1VDGA 1JPGB 3O8XC 3RTQC 3ULUF 3QIBC 4HULB 3WFEH 3DVGA 4TVPD 1N8ZB 3AAZB 2PN5A 1KCLA 4MX7B 3R4DA 5I30H 3WIFA 3WSQH 3FO0L 1R3LB 3O2VH 4S0TD 4PJHA 1KXTB 1VB9A 2JK5B 3PP4L 3VH8B 5I1GL 4ODBD 2D03L 1BOGA 2W60B 2Q6WA 4PRAA 5HHOD 3PWUA 4OGAD 4P9HL 3RPIB 1ZHNB 3EDEA 3G6JF 5J3HC 1FNSH 2R4RH 4UAOC 4QRRD 3O9WC 1RK0A 5DHVA 3MRLA 3WCYA 3QDGE 4XVSH 2VIRB 3MLWH 2YMXH 1IKFH 5DLML 5FGCE 4WFED 2X70A 1BM3H 5CBEB 3I6LE 2C3VB 1FLRH 5SWZE 4DN3H 3LH2L 1A6WH 5T3XE 1XIWD 2EC9T 4H1LH 1NGQH 5EWIL 3GUTA 4GRMB 1OSPL 2CO6B 4OSUL 4X6CA 3F12B 4TVPL 4H88H 2E7CA 1KACB 1JGDA 2IMMA 3SO5A 3F58H 3JWOL 1FG9C 4C4KO 1LNUA 1T7VA 4HS6A 4Q7DA 5CP3A 3VE0A 2R29L 5EU7C 4N0RA 5F71A 4Q0XH 2JIXB 4Y4KC 5DMKA 5JOFB 5DI8B 4W6XB 1CGYA 1NCWH 4PREA 3VW3H 2X1XR 4BUGA 4HAGA 4P2QD 4LGRB 3EYOA 1NC2B 2ZUQB 2DB8A 4PJ9A 1IM9B 3WFBL 4UT7L 4Z18A 1F45A 5FYJU 3LAFA 5FYKD 4J4PC 4MWFB 5CGYD 1FNGA 4M7ZB 3O45B 1T89A 3WHE1 4YHYB 4LHUD 3QCTH 1OARH 1BOGB 4BSWB 4X7TA 1RHFA 4HIIA 3FB8A 3ISWA 1VENA 3GZKA 1MFDH 5DQDH 5KW9L 4FNLH 2FATH 4MD0B 2VE6B 4JO3H 3ARFB 2QSVA 5DTFA 4YHLL 5DHVB 3BW9B 4XMPH 3S36L 1F58L 4WHTB 4EXPX 4QRUB 2PTUA 5ADOL 4OZIA 2ATKB 4LBEB 4E0RA 4HBCL 2XFXB 3OGCB 3MLXL 1EMTH 4X98A 1N7MH 4G6FD 4TUKL 4GRMA 5KTEL 2OL3L 4XC3H 2Z8SA 3V52H 5C0CA 5ESAA 4HCRA 3QUYC 2MTPA 4XWOD 5H94A 3U36A 4P23B 2DM4A 3W9EB 2EKSA 3OF6A 4OZFA 5D5MA 4NC0B 3TBWA 5DI8A 1RK1A 2ATPB 5F8QC 1DZBA 3PG2A 1P1ZA 5GRXG 4G9DB 3OKMB 2DRUA 3MACH 3MXVH 4YHNA 2PO6C 1AO7D 1C5BH 2YSSA 4JO4L 4PJ9B 4X9FA 1NDGB 3RVTD 4R4NC 3ARDB 5IB1B 3WIHL 3E6FB 1QLFA 2FJHB 5GGUA 3Q6GL 2OTPA 3VFWB 1SEQL 4WDIB 3LEXB 5CJXC 4DKFL 3G6JA 3V5DA 3I3DA 5LGHL 4NC1C 5IWLC 1DDHB 1JFQL 2RFXA 2J6EL 3MJ6A 1CLZL 4HIIB 5JLZA 5J56B 1CFNB 1HHHA 5GISL 4R96B 3RVUC 1LP9A 2WUBH 1CD0A 1S5IL 5HYJA 1E28A 1N0XL 3QDGB 2VLJE 5JQHC 3VFRA 4HFUL 4ZTOL 3S37L 5E1AA 1I3UA 6FABL 5IM7A 3J7HA 4JPIB 3EFDH 5DRZA 5IHZA 4P9HC 2V5MA 3MRBA 3D1MC 1PLGH 3MRPB 3TJHD 2JB5L 1BQHG 5FOJA 1I7ZB 4NO2A 5ESAB 3U9UB 5D2LE 1YEDA 2JB6A 3BH9A 3H9SA 4PJ9C 4POUB 1EO8H 3MGOB 4P23A 5GS0H 1GCFA 1FHGA 3WJJC 2E7HA 3SDCD 1S7UA 3M17A 4KC3B 4KJQC 1L7IL 3UDWA 3PQYB 1YMMD 4DZBA 1VKXB 2DKSA 2G75B 5TF0A 4Y5XC 5C0AE 1KPUA 3H0TA 1ZS8A 3QWQB 3ARDA 5KANG 4KRMB 1A14L 2X5PA 2X4NA 2CKBA 3EOTH 4HWZB 1FZMB 5L9DH 2BRRH 2GTZB 3V5DB 2VL4A 3AGVA 1XFPA 4NCDA 3BWAA 4GQ9L 5I2IA 3C2AL 2BVPA 3QDMD 5JMOC 3L5JA 5BZDB 4HGKC 2XA3A 4XTRC 3MV7D 4Y19A 1H3WM 1MAJA 2FX8L 3P9LA 1BEYL 4HGWA 3BD3A 1MREH 4LPYA 4XCCH 5IMOA 5FV2A 2D31B 1F90L 3C6LB 4K94L 1UZ8B 2P8MB 4G6KL 1F3RB 1DCLA 3S97C 2CPCA 2VLJD 5GSVA 2F53B 3AUVA 4XH2A 4KJWD 5DJCA 5C2BL 4Y5VB 3BKCL 5TH2B 5HHXL 4KJYA 2C1OA 2QHRH 2PF6A 1QOKA 4YHKH 4OLYH 4K3JH 3U0WL 1A3RH 1YYMH 2NY2D 4NM8H 4M8QA 3NZ8B 2RQ8A 3IKCA 3P9WB 4AMKL 2IC2A 2VLRA 3F6LA 5GGTA 2NX5A 3B6SA 2OJEB 4L4VA 4DVRL 2C9AA 1BGXH 4NKMA 3T2NL 1SM3L 3DETC 1K5NA 3OGOE 2HRPL 3GHBH 1EO7A 4HUMB 4U1JA 3GIVA 3RL2A 4YXLH 2HJFB 2E27H 1XGUA 5MERB 2DLFH 3L3KB 2ZSWA 3HI6L 3WUWA 2VLJA 3FQUA 5J9PB 1R3IH 3MLUH 5IVOA 5I2IB 4O2EA 3QG7H 1NCAL 3WS3B 4UUJB 4P46C 3HG1E 2VXUL 5IB4A 4P4KB 5GRUL 5BZDA 5D7KE 1TZGH 1AQDA 4MB5A 2H1PL 1UT9A 3G6DL 3FB5B 3VXRB 5BXFB 2MCPL 2CD0A 1X4ZA 4LLQB 3RDTB 4IJ3C 3BKYH 1X7QA 1EBPA 4PJCB 4OT1H 1T2QL 1UZ8A 3QI9C 5F7DA 5F7UA 3ULUE 2EXYD 3FCTB 4XNQA 4PRNB 3REVA 1MCWM 5EUOF 4Y4HD 1AXTH 4I77H 4KXZI 1P4IL 1PKOA 3I84A 2XTJD 5IBTL 3FB7B 2CIKB 3TO2B 4AEFA 5DJ0B 5E94A 4HCRL 3JV6B 2ZUSA 4P46A 2VXSH 1HHJB 1KCRL 4MX7A 5BS0E 2B0SL 4WU7A 2RB8A 5ESQA 5F6IB 3QJFA 5EZIH 2A6KA 3C5ZA 2ITCA 2O5ZH 5CD5C 1E4JA 1ED3B 3C8DA 3QQNA 1K5NB 4OGXL 5JNYB 1P7KA 1CDUA 3W0WD 1U8PB 3GIVB 1AXSA 4Q9QH 5JIIA 3HC0A 4XHJC 1SY6H 1MRCH 2GEEA 3P11L 5GZOD 3BD4A 4L4TB 1FYHB 1CFSA 1X5LA 4Y4HA 4O2EB 4M7KH 4HFWA 1ZVYA 1WWBX 3JWDH 3BP7A 1A4KA 5LGKA 4P3CH 1I1FB 5HHPA 5D72H 2OS7A 3BWUC 1AGFA 2CH8A 4NQDE 4QT5A 3R8QA 4ELME 1H5BB 4DGVH 1MUJB 1TETL 1X7QB 2V2XB 4JFFB 2XQBL 4HS6B 5KVGL 5CJQL 2B1AL 4F8QA 3O4OC 3DETD 3QRGH 5JOFA 3B9VA 2NXYD 3DX9B 4HXBH 1W0VA 3A6CH 3QG6B 4RFOH 2A6JB 4PG2C 2RBLA 4Z7OE 1OQOA 4ISVB 4XPGL 3K1DA 4EXKA 3PWPA 4PRID 3SOBH 4AQOA 5TE4H 4QRRB 2APTA 3FFCA 1RMFH 2FX9H 5F3HA 5F93C 3MFFA 4F7TB 3NCJL 2YS4A 3JV6A 1FGVL 1G6VK 4ZFOL 4PJIF 4K7FA 5IMMA 4FXGB 4TN9A 3DO7B 4OB5L 1FNGB 3T2OA 4XNZB 2FHFA 3P77B 1U3JA 4LSTL 4X5WA 4PUBH 4JPWL 2DQHL 4K94C 5GJSH 1P7KB 2DQEL 3AFLA 3HS0A 2ARJA 2GJ6D 3KG5A 1AD9A 2FRGP 3U4EA 3T3PE 5ICYB 4IM8A 3FT4B 4MXQC 4HF5L 2W07A 4XTRD 3TNNB 1NL0H 3W0WE 4AT6B 4PJIA 3IF1B 2BSSA 4Q9RL 4ZO7A 4MCZA 5A1AA 1GZQB 3UTTB 2LVCA 2V2WA 5CUSH 5IB2A 1F4XL 1R5IA 3D39D 2AV1B 4P2CG 1DN2A 3L95B 4U31A 5C07A 1OF2A 5DMGC 1JHTB 3MRMB 2KKQA 3DURB 4KAQH 3LKQB 2R0ZL 3A67H 5GGVH 4CMHC 1H5BA 1KJVA 3VXTB 4ENEC 4CUCA 3UBXA 4KY1H 5ITBL 4CKVX 2A1WH 5EB9A 4A6YH 1KJ2A 2ED7A 2G5BB 3NOIA 3C5JA 3HE7B 5GJTL 3NH7L 3SO3C 5HHMB 4YHZL 3MBEC 3WFCL 4LSUL 4MXQD 1FH5H 4LARL 3FN3A 3N1QC 3ZHKA 1Q9KA 2D0FA 1DP0A 2QQNL 4XWGL 3NAAH 1LEKA 1MWAB 2CLRB 1U8JB 5EC2B 1CQKA 4GW1A 3U1SH 1QR1B 3DGCR 1YNTA 4MQ7A 3NTCL 3KYNA 3W82A 2HTKD 3HZKB 5CHNA 4M43L 4NZUH 5GGRA 4MNGA 1CFNA 2R0LH 4F57L 1A0QH 1R0AL 3IFPB 4PP2B 3LKOA 3SKNB 4XAWH 1MFEL 2XN9B 1A6AB 1QSFA 3FT4A 3MV8E 2DL9A 3O6ML 3DGGA 5KOVC 3HPJB 4BQ9A 1MCRA 3EO0A 4YR6A 5I6XB 2WWKO 3WXVL 1CE1H 1ZSDB 2Z35A 5FYJE 5HDQL 2N1KA 1F4HA 4LKCB 3O9WB 4WU5B 3OR6A 4NP4L 2APWA 1IAIM 2AJVL 3FFDB 4Y2OA 5IIEB 1S9YA 2HYMA 4R4ND 5BJTB 1UA6L 1RZ7L 2F19L 4TNWK 4XPAL 1GGCH 2EO9A 3FO9A 4D0BA 3UJJL 2ZG2A 1A6PA 5AYQA 3KLAA 2VZVA 3FQXA 1QRNE 5CLTA 1YDPA 4Y7MA 1BLNA 3HE7A 3HZYA 4M00A 1HNGA 2X4TA 4HPYH 4PJDE 4U1MA 1NCCH 1S9WA 2DLHA 3MLTB 1ZS8B 4OFPA 2YBRB 3QPXL 1TCMA 4LSVL 4E41A 5J4MA 1C8PA 2HFFA 2AS5M 1CGWA 1ZXQA 2BOBA 5I1CL 1NLBL 5DRXB 2QV2A 1J5OH 5CD5D 3RP1A 1H3XA 3Q1SH 2KUTA 4IS6A 4NQDD 3W9DA 1Z2KA 1OOAA 4FQ1L 1KLGA 4MNGB 3HZMB 1MI5D 5KN5B 2WV3A 4FFWD 4MSWB 3AB0C 3OKYA 3BISA 3HE6D 3LSOB 5CJ5A 2IPUK 5HYSG 4UNUA 4JFQA 4LAJH 3LPGA 3DGGB 2BHUA 4YO0A 2OL3B 5HHQB 3IDMB 4RGND 5EBGA 2HT4D 4OLZL 2BOCA 5HYEA 1RJZA 2Z9TA 3SE9H 4XBEL 5GSVB 1HXYB 1CQYA 5KAQF 2WWMD 4TYUA 5IW1B 1KV3A 3ULUC 1T6VN 2E8YA 4N0YH 1I1AD 2VXQL 3LZFH 3CFIC 3QZWB 1A2YB 2BSTA 2W9EH 1AIFB 5GRZA 1MJ7L 3KLAB 4FTVB 5DUBB 3WNPA 4M8QB 1WGOA 1R5VB 4UB0H 32C2B 1U42A 4HJ0D 2HMID 4L4VB 4JN2B 2WBJC 2X4TB 4R4FL 4TSCL 1AP2B 2YBRA 1BECA 2XY1A 3CGTA 3U7YH 4HUVA 4NQCA 1UJ3B 3BXNA 1GOGA 5IVXA 3P30L 5DRXA 2WBJD 2GQHA 2IG2L 2MSPA 5C0AD 3WUWB 5MEOB 1KLGB 1RIHL 4HJ0C 5FECB 1DVFA 2EDFA 4M3KB 2ID5A 3QXDB 4K23L 1Q1JL 4I0CC 3MO1A 4JO2L 3H42L 2P47B 5D8JH 5EPMB 4ETQB 4KVCL 2D0HA 3WUZA 4YXHH 1XF2B 3ZKQD 2BY3A 1PG7X 3O6LH 5F7DB 4WRLA 3SGDH 4U0QB 4KRLB 5T1DH 3WIIL 4BFIB 2OXHA 1KJ2L 4PJEB 4MAUH 3NVQA 1TCRB 3ABZA 4R0LB 3QA3B 1G7HB 1P7QB 1JP5A 1S8DA 4LLWA 4QOKB 3SGKC 4AL8H 4X4YA 1XR8B 4XI5C 5IKCA 2FBJH 3O8XD 4JGUA 3BHBA 1L4IA 2Q7YA 5HI4C 1I9RL 5K9KA 3QIWB 4GLRH 3RWFB 3QWOB 3QQ9D 1CLYH 3V6BR 4OCWL 3AS2A 4MS8C 3TJEL 1ED3A 4HXAL 2P49B 1NC2D 1LK3H 3CFEB 3UTOA 4IIQA 1AP2A 2ICEA 4K3HA 2V17L 5ESVA 5TQ2L 2O5YL 4G7VH 1AO7E 4MJ6A 4XXCA 1CXLA 4K3EL 4KROC 3S6CA 1I7TA 2OR7A 3DX8A 1J0ZA 2EIDA 1O0VA 1UM4L 2P46B 1CFBA 4M5ZH 4N9OB 1KYOK 5DUPL 5C08B 2DD8L 5MEOA 4RX4D 2Q87A 5FHBL 4APQD 1P7HL 3D3VB 5HYQA 3DO3A 3UO1L 3SDCC 1SEBB 3KPQA 3QWRA 4OD2B 3QFJE 3O81A 1R5WA 1WAAF 4LNRA 5ICZB 3HR5A 3SDDB 4ZFGH 3OR7B 5D6DC 1E4XL 1VFBB 1RUAL 3KPNB 3CH1B 1RZFH 3FB6A 1IGMH 1PG7W 3OPZH 1YMHA 1ND0B 3HZVB 4ONFL 4P57B 4NZRL 5DWUL 1MSPA 5DRWA 4EDWL 4RGNE 1V7NH 5H37H 4DKEH 4JR9H 3VRLF 2HVJB 4JFED 4X80H 1BJMA 1PGRB 5MEQB 3RVWD 1E6JL 2B1HL 4C56D 2P5WA 1YEJL 1ES0A 2ADIA 4KJPC 3QEHB 1Q9WB 3QXAB 1XR8A 3ULSA 4L4TE 3TESA 3IU3B 3HC4L 1OB1B 2Z31C 2VITB 4WEBH 4RWYL 1U8MB 5IKCB 1FFOB 2I5YH 4GUPB 2KDGA 4J6RL 5I1JH 2BMKB 3B3IB 5FCUL 1NCNA 1NAML 4NQTA 5MENA 3QUXC 4X8JA 2IQ9L 2ICEB 2ARJB 1SJEA 2Q8AH 2DQJH 4CBPA 3D18A 1OPGL 5LQBH 1AI1H 4ELMF 2ZUWA 3DTXB 3QQ4B 3O6KL 1NQBA 4D0CB 2MPAL 5BS0B 4NNPL 2PO6D 3DX7B 3GFUA 1XGPA 3LRSB 4KH2A 4LF3B 4IRSB 4OAWB 2AJYH 1DBAL 4XGZB 3LY6A 1OT1A 5EU5A 2Z31A 2Y07H 1R5IB 1CFTA 1LO4L 2DMCA 3BJ91 4Z7OF 4JFPA 1E4WL 3CZFA 1HSAA 2W9DH 4LGSB 3SDDA 1HWHB 1FL6A 3P9MA 4HWEL 3IXAA 2D9CA 4Z95H 3CFCL 1T7YA 2Y25A 2FJGB 4MHHI 2Z4QB 4R8WH 3UBXB 1P84J 3FRPA 1S5HA 5DMGD 1JUFB 1DQDL 5MEND 5FM8A 3SDXE 1EIBA 2N7BA 1D5ZB 1KJ2B 1FPTH 2R2HA 3B9DA 2DBLH 2Q8BL 2OTUA 3KR3L 4FQHB 4I1NB 4PPTA 5KVFL 2GJJA 4XI5D 1FL5A 2CDEB 2X4UA 5C0EB 1MFBL 1JZ8A 1D9KB 1OAKL 1GXEA 2IH3B 2CJUH 3CJJA 1OCWH 3TYGL 1OB1A 3HMWH 1IEAA 5T1MB 2AXGA 4XHQA 4FQLL 4MQXC 5DDHA 3WJLA 2VDRL 1HIMH 4JCMA 2FSEB 3QI9A 5D7LA 4HG4K 4PP1D 4M93B 4U3HA 3DX6B 3S36X 1VFOA 4XPHH 5C3TA 2AP2A 5GGRB 2Y7QA 3WKMH 4ZS6C 3R1GL 1ZHLB 1UEMA 1WIOA 2XWBA 4HX1A 4ORGA 4GRWF 5LBSH 5DFVC 2GYSA 5CAYB 4NQXA 1FYTB 3SE3A 4DK3A 3IU4L 3VXSD 2DTSA 2X09A 5FA3A 4PJ7F 4JRYD 3L3IB 1A7PL 1GIGH 2IANE 3FMGL 4LKCA 1MFCL 2ADGA 3AY4A 2DJSA 5C2UB 5GZNC 4MNGE 4PGEA 2AJ3A 4OV6F 3HI1B 3GDBA 3S35L 5C0BE 3ESUF 4Z8FL 5FYJH 4O02L 3DVNA 4OLWL 3QAZB 2DLIA 3D39E 1JPFB 1M7IB 2NY6D 1KENL 2Q1EA 2XRAH 4PJAF 3I6LD 4NM4L 1ZT7A 4BUHA 1PZUB 1EEQA 5KVDH 1RURH 3V7MA 5IFJB 2DLGA 5E6ZA 4CGTA 4JM2B 3SGJC 2Q3AA 3ZTJG 4PJ8D 1UCTA 5CJXA 5C0IA 4LP5A 1KUMA 1FG2B 2DMKA 2XZAH 4X6DB 1ZV5A 2WWMC 4W6WB 1EEYA 3VGHA 4HZLB 2J8UA 2BY0A 4G6ML 4XP5L 2P43B 5DDHB 1DQQA 3VXSE 2Q86B 1OAXH 5I1GH 4EVNA 4HT1L 2X2YA 3GSUB 3QO0A 3FRPG 4UIKL 4M6ML 1FNSL 2R4RL 4MA1B 2XQYG 2CKBL 3TBTA 3MYZA 1CGXA 3HRZA 4Z6AT 2CSPA 1X5JA 3CPLB 1C5DB 4DW2H 3QJHB 2YMXL 1NFDF 5DLMH 1FYTA 3U9PL 1QSEA 3H9HA 1JPSL 3BPOC 4QRUA 2J4WL 4J23A 1NGQL 4X98B 3L3HB 1V8HA 4PGCA 4GG6F 1QFPA 2EXYC 2YD3A 3QI9D 1RUPL 4OKVB 4X9HA 2XOTA 2AJ3B 4LNVA 2D7TL 3GMOB 2OP4L 3WLBB 5L8JB 1G7MA 1DUYA 1G9MH 3FJTA 3IFLH 4JRYE 2PNDA 1UWGL 5ISZB 5KSUA 2RGSA 2EKSB 4JY6A 4X6BA 5J6GB 3EYUL 1A2YA 3VW3L 4OLUL 5ILTH 1A1OA 4WFHD 4MXWH 4NGHL 1TQCC 5BV7C 1WZ1H 4NBYB 5J57B 1OAUL 3GKWH 4RGMC 5DRNB 4MMZC 3QEQD 1CL7L 3NPSB 3WFBH 5E8DL 5IW6A 5E2WL 5C0IB 3TH4T 3L7EB 1MCKA 4HUVB 1LE9A 1JWMA 2NQCA 4JKWA 1OARL 5LWYH 4KHTH 1UWEL 2A77H 5EFIB 1UVQB 3QO1A 2EE9A 2NW3A 5EORL 4P5TD 1J0JA 1DVFB 4JO3L 4HSQA 4R96A 1MCOL 5ID0A 4MAYA 3HRZB 3FQRA 3CX2A 3CK0L 3RWCA 4H1LB 3L5XL 4WY7L 4PJAE 1A7NL 3QBTB 1B88A 2BHYA 4XX1G 4XPFH 3K81A 4LPCA 4MB4A 1ZLVK 4DOHB 1INQA 4TUKH 4HWBH 1P6AB 1A5FH 2R23B 3QUKA 4OKVA 1BX2B 4YDVB 4TULL 2ZUTA 3GMOA 3RNQA 3WLBA 3D6GA 1LE5B 1I8KB 4M6OH 1W72A 3HMXH 3OBAA 4P5KB 1NGXA 1DQJB 3HNTH 4P4KD 4IRSD 1MHPH 4N0CC 3IDJA 1GPOH 1Z5LA 2XQYK 4UTAL 1QFUH 3TP4A 4X7FC 4DCQB 1OVZA 1HOCB 4RZCA 4JO4H 4KUCF 2M8XA 4H0HB 4TOYL 3ILPA 1MRDH 5BRZB 1LEGA 2Z93A 2DDQL 2FEEI 3V0VA 2P24A 1KTRL 3T77B 4ALAH 4LASL 4X7EC 1J1XH 2VXVL 2LTQC 2YZ8A 3SKJH 3VXRE 1UVQA 2BC4A 1I7RA 3ZDZE 1SJHB 1YEHH 3ZE1F 1YN6A 1RZJH 4LVNB 5IEKA 1N0XH 1R5WB 4LNRB 1BPVA 1B4JL 4EI5B 3LKNB 1F02I 3KXFD 4PJ9D 5FDWA 2OSLA 3V7AE 1T1YB 1OQXA 3V8OA 2I07A 3TJHC 1T7XA 5E7BA 3TPKA 4F7PB 1W0WB 4HQQH 4X83A 1UADC 1PLGL 4Z0BL 2Y6SC 2NR6D 3RKDD 4RQQA 1C12B 5IT2H 5C6WH 1JPTH 1WBYA 3TVMD 4N90D 1RJLA 5HGHA 4UDUA 5LG1A 4Y19D 4QXTA 4JHWL 1A6TB 3N0PB 4GBXB 4GOSA 4LAQH 5DUMH 5C08D 4XBGA 3NZ8A 1BREA 1CFQB 1YQVL 4D3CH 2M1KA 3K2UL 3AC0A 1BFVL 5DD0H 5IK3A 4K7PL 3N06B 4HDIA 3SQOH 5TE7L 3VGDA 5FYLE 5DJAA 2FBOJ 4L5FH 3T77A 4TQEH 1B0RA 3V4VL 1QBAA 3DX7A 5I17B 2VH5L 4GQ9H 4FP8L 4OM0L 1RFDL 4LLYA 4OAWA 4X6FA 1LO2L 4PG9A 4X7SL 5GZOC 1U93B 4P2QE 4UUJA 3VRLE 4ZOAA 4BSVA 3X13B 4DFHA 4OV5B 1AH1A 1FL6B 5I1IL 1MREL 3SDXF 3X12B 5E8EA 3SE4A 5FDWB 5HVHB 1T1YA 2K3TA 3CVHB 2FJGA 4K94H 3GSNB 3F7QA 3MREA 4P23D 2BFVL 5EU3B 4U1GB 5I16A 5CCKH 2GT9A 4WCYL 3TPUB 4CL7A 3PUCA 1W0YT 1HHGB 5E08L 1C16B 3FRUA 5LJYH 1NGPL 4LLAA 4UDUB 1WQVT 5E99L 5FKPA 3WXWH 1R3KA 4K3JL 4QXTB 4JY5L 3U82B 3VA6A 4RX4A 1D6VH 1TVHB 4L1DA 3DIFB 4XP1H 3HC3L 2HLAB 3PL6A 4WU7B 4UINH 3H3PH 3G04A 4HEME 4NN6C 5I19L 3PJSB 4JQIL 4OF3A 2R1WB 3ZKNC 4MJ5B 3DSNA 1JGLL 5CGYC 3S9DB 5SWSA 4B53A 1EHAA 3DBXA 4GXVL 2EICA 2DLFL 5DJAB 5HTSA 1A02N 3VRIA 2XKNA 4L4VD 5ISZD 4BQCA 2BVQB 1Z9SA 4GBXC 3HI6H 2C7UB 3ZLQC 4Z5RA 2P1YA 4RGOL 5GGSY 3P4MA 2P44B 2VABA 5MP6L 2BNQA 4C56A 3QUMH 3EYFA 4QXUH 1KCVL 3HHRB 1YNKH 4OZIF 3BKYL 3LRGA 5L2JB 1CLOH 1MUJA 3D48R 4PRDB 3GSNA 1T2QH 1JRHH 1DANU 3QFJD 4ETYA 5AYUL 2YN3A 2OXGA 9CGTA 1XCQB 4ODTL 3KXFE 5E8PB 4GXUM 4FQCL 2APFA 4HIEB 1I1AB 4BK5A 1ODAA 4D2NA 4PLJC 4DEPB 3MFFB 5J12B 4OTXH 4HZAA 3VXRD 5T33L 2WINB 3DXAD 5AZ2L 1PD6A 1T0MA 3FL7A 2FGWL 4OLEA 2YKLH 1OT2A 4KZEH 2Q86A 2YXMA 1T80A 3C5ZC 5C6TL 3KDMA 1NFDE 4FHBD 2HG5B 1Z9OA 4Z7UF 3DBXB 5E5MA 3TBVA 3WMSA 1QYGL 5K9QI 4M1GH 5JHLL 3P11H 1D5MB 2EH7L 5ENWA 2FIRT 3DRTA 1A6VH 5CGMA 2R56L 1T03H 3W0WA 4EUPB 2BCKA 3MUHL 1T7WA 2V7HA 4M7KL 4RFEA 5SV3A 4MCZB 5DJZB 3C6LD 4XCEB 5E9DB 1J1OL 1CICA 3ME0A 2PO6A 1AE6H 1XCTA 3F12A 5I1HL 2ZOLA 4DGVL 5KSAA 3TNMB 2XQBH 4Y1AE 5DGRA 4JO1H 3LKRB 4DUWA 1INDH 4O00A 1A7RL 3G9VA 3Q5OA 3QEQB 3L5WA 2NY4C 2YOCA 2LU4A 3LHPL 1XGQA 2FR4B 2X1WL 4NHUA 3VFVA 3NBNA 1OLLA 2LE9A 3KPSD 4HWUA 2WAHA 1ZA3A 3S34H 1EFQA 35C8H 4ZFOA 1MFNA 2WWKT 5F70A 5I66B 4KFZC 1RJYB 5EO9B 1JYNA 4U1HA 1YEFL 1JPST 3ESVF 1U8JA 4N68A 5FF6B 4M7LL 2R0KH 1H15A 2OLDA 4KGJA 2SEBB 5EFIA 5JMRA 1U3HD 1IM3A 5I1EH 3T0EA 4LLMB 1BBJB 3TCLA 4I3SL 3RA7H 2HWZL 2XN9A 3QHZH 43C9A 5ENWB 4OIIH 4AG4L 4BZ2L 4WGWB 3LQAC 4YFEA 3G5YA 3KJ6L 5IHLB 4E5XB 4MMXC 3V6OA 2FEEL 3WE6B 3LD8B 5CUSL 1SYSA 4OF8A 4ZSOB 3VCLB 3IRZA 3O2DA 3VGFA 4OIBA 3QIUB 2E6JA 5EU6D 4Z78A 1N6QH 3RZCA 5MI0C 1GGBH 3PNWA 5C8JB 2P48B 1NGYA 3FFDA 2VMFA 3TNMA 3RVTC 2VXTH 3EYSH 1FDLH 3U46A 3V4UL 3VFTB 2PYEB 2DQFA 1MJJB 1P5VA 4IDJH 3NZHH 4ZUSA 3Q48A 5GJTH 3BDYH 5EOQH 1XZ0A 4H8WL 3BE1L 1J0YA 3SKMB 5IFHH 4RCAA 3OAYH 4GAGL 3UBXG 2CGRH 5T5NF 1JNJA 4OCNC 2YSSB 3KHQA 3OXSA 4FQJH 4G9FD 4PBXA 4I5BA 1NJ9A 4WWKA 4FG6D 3U1SL 3V0VB 4S0SD 1YN7A 3TA3B 1T83C 1CD9B 1HINL 1TVDA 3GRWH 3PXHA 4FQXA 1LP9F 2R29H 5F9WB 4LLUA 2XNAA 3NACH 1XGRB 3QDJE 2C3XA 1YQ2A 1NCWL 3U7WL 4XAWL 4ZG1A 1NMCC 1MCPH 3P0YL 5CEZH 3O6MH 5FGSA 2X4RA 5I15H 4WNQA 1E6OL 1QBLL 2B2XL 5D1XC 5C0FB 3JVGA 2GK2A 3NN8A 2IADB 2CXKA 4OD1L 5HDQH 2VDMH 4K8RH 4JANB 4OI8A 1W0WA 1T21A 1CL7I 5DRZB 5IHZB 4W70A 4J4PD 2VZOA 4TPRH 4N8VA 5ICXA 4Z7WB 4U1KB 1N6UA 4PJ7E 2P5ED 1RZGA 3DV6A 5IW1A 4YHIB 3MJ7A 4P48A 3UX9B 1RJLB 1QKZL 3MGOA 5EZLB 5EDXA 2WP3O 3VFTA 3FKUS 3BVNB 3ETBF 4EQ3A 3FOMB 2JTDA 3AMKA 1KB9K 1HSBB 2JCCA 4XBGB 4YHLH 4N5ED 1RHHB 3LIZL 1DR9A 5E7FA 2NY1B 2XXMB 4XCNA 4WFGD 4NO0B 4NQEE 5D7SL 1ZWIA 3OL2A 1KPUB 3H0TB 3OXSB 5C07D 3L3JB 4LCWE 4XVUD 5D7KD 5JOEA 4NQCB 1DBKH 4GRLA 2OL3H 4XC3L 4CNIB 5JW5A 1J5OL 2F8XC 4GSDL 5C09B 4L8DB 3SDAD 1F3DJ 4P59H 4FQ1H 1OLZA 3T65B 3V95A 4PJ5A 3J8F7 1RU9H 1S7SA 3HAEA 3TC9A 1OSZB 4LVHC 3F5WA 1JK8B 1OTTC 2AEQL 2M2DA 4Y19B 3T08A 1BBDH 1LILA 2GUOA 4N1HB 4NN6B 3L3OA 3RL1B 3JWDC 4MA3B 3PGFH 1CIDA 1HDMB 3SE9L 1H3TA 2D31A 5GRWA 2EE2A 2GT9B 3KS0J 1I9JH 3TPUA 1MIEH 4FRWA 1HHGA 1BZ7B 4N8VB 4R4BA 4Z7WA 2X05A 4N0YL 4XH2B 4QWWC 3RIAF 4K07A 5B3NA 1PZ5B 1NCDL 3VXPB 4WI7A 5C0RL 4RWHA 4U2YA 1IQDA 5GISH 3QIBD 3B5GA 4O51B 2WUBL 2HFGH 3PWJA 3KPRB 2V7NA 1TVHA 4UB0L 2JCCB 3LH2H 3L6FB 5CD3A 1EHNA 3S88L 3S37H 1OSPH 3PJSA 4XCNB 2EIZA 3FT2A 3CFEA 1ZWIB 3L3JA 5SWSB 3VMPA 1E4KC 2Z8RA 3MNWB 3UTPD 4WV1C 1VGEH 3OKDB 1JCKA 3F7VA 1NEZB 1YJDH 4LRIA 5IMLA 1F4WH 2YD2A 2HLFD 5IOPB 2N56A 1MF2H 5E6IC 1Y6MR 1ZLUH 4LHJB 4Q6IA 2R39A 1CT8B 3F65A 1Q1JH 4OCXL 5ALBL 3SHSA 4NRYB 2J2ZA 3FB5A 5BXFA 3SDYH 3VD3A 4PJEE 1CR9H 4LPWA 1JJUA 1JIBA 1DVFD 4F7MB 3UYPA 1HYSC 3B83A 4OCRH 2X89A 2YWYA 5SWQB 3QCTL 1QACA 5CZVL 1G7JB 1HWGB 3MBEB 5HVFB 1REIA 3UC0L 1A6UH 3O41B 1GGYA 1RVFH 2YR3A 2FATL 1CLCA 3TN0B 3QZWG 3HKFA 5HHME 5HJ3A 3FB7A 1IGCH 4MA7L 5JHDD 4K7PY 2NY3C 5D1QC 1M6OA 4YDIH 4Y4FA 5ABDE 3AAZA 5ADOH 3OKEB 5KG9B 1FFOA 5CD3B 1CLYL 4OCWH 1KFAL 3QJFB 3WIFB 3H9ZA 3PV6B 4QHLB 1JWSB 5FO9A 3TT1L 1CBVL 4HGMA 3N85L 2R1XB 5T3ZD 2QLVB 1T5WA 2ORBL 1NMAH 2V5YA 4JPKH 3ET9F 4H5SB 5E5MB 4JFZH 3VXUA 1D5MA 4UBDC 4PIRF 1QQDB 1NEZA 5EUKA 1ZMYA 4L8CB 5SX5K 3V8CA 1H3PH 1IGTB 1UENA 2DM2A 3ULVH 4XVTH 3VD9A 4JG0L 5CBEA 5EU5B 4WI5A 5F44A 2CR6A 4F9PC 2VDOL 3PHSA 4XAKE 5SWSE 5DFVD 4DVRH 1XCTB 1I1FA 3MRNB 5HHPB 4X6CB 2YPKA 5EOTA 1RZFL 3Q6GH 2EDNA 5KSAB 2X4OB 3CCHB 2D7NA 4YXLL 5F7NC 3MRHA 3HE6A 4ONFH 2E27L 3KPMA 4DEPC 3DI2B 3X3FL 2V6HA 3LKPB 4PP1C 2FR4A 1EFXA 4XMKH 4JR9L 2F5BH 1ZVSB 3DX9A 5CFHA 1JNNH 3MLVL 1RUQL 2W59A 1IC7L 3OKNB 1KN2H 4MJIE 1DN0A 1YEJH 2DI9A 1KGCD 3EYOB 1OGAD 5EBLB 1Y18B 2QADD 5F3HB 4F7TA 1E0OB 1TZGL 4Y4FB 1G7PA 4XPTH 3NIDE 4QRPE 3DMMB 1WIUA 4PJCE 5L6YL 5C0JA 3ALWA 1DQLL 4I18C 5E2UH 2CDGA 3I75A 3DX6A 1IAII 1FFNB 4OT1L 4ELMB 4K3DH 4PRPE 4AEIH 2X1OA 3K8LA 3U83A 3FB8B 4I0KA 1CYGA 4GRWH 3O6KH 5GS0L 5E2VL 3O0RL 4HD9A 4YAQB 4ZQKA 5DTFB 1AJ7L 4ODUA 1AGEA 5T1LA 1IGTA 5EU7E 1BF8A 2Y07L 3V6FA 1KCRH 4JY4B 4GG8B 3B2UC 1QD0A 4LEXH 4NWTH 4Z78B 5CSBA 1FSKC 1MLBB 4LGPB 1YUHB 4BA8A 4ORZC 1A14H 4OGXH 4AEHH 5FB8A 4BH7A 5JW4Q 3HI5L 4U2ZA 4UQ3A 2RIKA 1FPTL 4NUJB 2UZIH 1SY6L 3DHMA 3EOBB 2UUDK 1JI2A 1W2KT 2BSRA 2ICES 1U92B 4HJGB 5C7XH 5B4MD 8CGTA 3OKNA 5F1SA 1A64A 2CJUL 4AQ1B 1HEZA 1IGFH 1KNOA 2HAZA 3TYGH 3MGAA 3JWDL 1BEYH 2EXWD 1NLDL 2V9TA 5JQ6H 1B3JA 2EEAA 5D72L 4R6UA 2VDRH 5FYKE 1YN7B 1U3HC 4GW4A 2Q3ZA 2APVA 2FH6A 2QQLH 2B1AH 4QXWA 5FGBC 5FIEA 5CHNB 4YPGB 3DVIA 3MV11 1D5IH 4HIJB 4HXBL 3QRFM 4IRJB 1MCBA 4MCYB 4YHKL 3LQZA 1QFOA 5L0QC 1A3RL 1QSFB 1YYML 3BEWB 4YFLI 1ITBB 2YXFA 4U6VL 3V0WH 4U1LA 2FX9L 3EO0B 1INEL 1NMCB 4TRPH 4YR6B 3VFRB 3JTSA 3A6OA 5T1LB 1BD2A 3RUGA 1F4YH 1ROWA<