3GKZA

Crystal structures of a therapeutic single chain antibody in complex methamphetamine
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
242
structure length
233
Chain Sequence
EVQLQESGPSLVKPSQTLSLTCSVTGDSVTSGYWSWIRQFPGNKLDYMGYISYRGSTYYNPSLKSRISITRDTSKNQVYLQLKSVSSEDTATYYCSYFDSDDYAMEYWGQGTSVTVSSGGGGSQIVLTQSPAIMSASPGEKVTLTCSASSSVSSSHLYWYQQKPGSSPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAASYFCHQWSSFPFTFGSGTKLEIKRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of a therapeutic single chain antibody in complex with two drugs of abuse-Methamphetamine and 3,4-methylenedioxymethamphetamine.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords anti-methamphetamine single chain Fv
total genus 56
structure length 233
sequence length 242
ec nomenclature
pdb deposition date 2009-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gkzA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gkzA01
5D8JH 3JWDC 2IPKA 5B21A 1HE7A 2R15A 3DJ9A 2B4CC 1P4IL 1PG7H 1IM9A 3O6KH 4GW4B 1HNGA 1W72L 4GMTH 5KSUB 3OBAA 4ZNCD 4XP5H 1HH6A 1WWAX 2F53D 3L3KA 5T1MB 4O58L 3GIZL 3ARGD 4X8JA 5M7QA 3ZDXE 4HZLA 4UOW1 3ILQC 3I2CL 3C6LC 3QWRD 5F1NB 3FT3B 3ULSA 3GMOB 2EYRB 5EPMB 5EWIL 1ONQB 3KHQA 1K85A 4MWFA 4RCAA 2P8PB 2VISA 3QI9B 4PLKC 4BZYA 2Y25A 3HE7B 1AXTH 3VWJC 3AU1A 2Y5TB 4R90H 3A6BL 2KDGA 5IB4A 5AEAA 2R4SL 4W6WB 2X7LA 2HMIC 5JPMB 1KLFA 1EV2E 2RCSL 5I1AB 4L4TB 2NNAB 4DFHA 1A22B 4JRXE 5KSVA 3NAAL 4PRDB 1JGLL 4EI6B 1CYGA 5F7WC 3CPLB 1NJ9B 5IROA 2BOBA 2OQJB 5IHUH 4KUCD 3BZ4B 5HDOA 3D3VA 3VWJD 1FQ9C 2Z91A 4OCYL 3PWPB 4GS7B 5IMOB 2ESVB 3SEPA 2NY3D 4CAGA 1TFHA 3UTPD 2L7JA 2AK4E 1QBAA 5CIPB 2FSEB 4OFPA 1JJUA 4P9MH 5ADPH 2ZUVA 3AB0B 4TNWK 4GQPH 5F7YC 1F5WA 3WNKA 2GK0B 5E8OA 4G8IA 3X14B 3PJSB 1DEDA 3MJGX 1FH5L 4NNPL 1R3LA 5C0EA 5GGRA 4PJEB 1W8NA 4YR6B 1OP3K 3SDAA 5DD1H 3TA3A 3SQOL 3CU1A 4MNGE 2NW3B 4QRUA 3VG9B 3G5YA 3U0PB 2V7NA 2B1AL 4P49A 3QUXC 5DD5H 1ED3B 1JZ3A 4MD0B 5CINL 4JQVC 5CHNB 3MREB 1I9RL 3L3HA 1MJ8H 3L3JB 4JZJA 4KGJA 5DDHA 2VITB 5AD0A 1UWEL 4FZ8H 3QXUA 1XGQB 3PHSA 3OGCA 4Y2DB 3TIDA 2HH0H 1YDPB 2FBJH 4M1DH 2W0KA 5GHWH 4JFYB 1MF2H 4GKZB 3C08L 2WSKA 1ZWIB 3VXOB 5KS9A 4QCIA 1HYSD 4JFOB 4NFBA 1HILB 4FXLA 4X4ZA 1WCBA 1I1AC 3IETB 4OGAD 1BEYL 5E94B 2X4UA 4GQ9H 1CGXA 4PJ7B 2Q6WB 4F33B 3ZTNL 5IHZB 2EIZA 4TYUA 3ZHLA 3QXVA 3S96B 4PJEE 1F3JA 3U7YH 5DRZB 1TJGH 4LPUA 1AJ7H 2ZUSA 1RUMH 1QFWM 2EH8H 4Y5XA 3PDOB 3QIWC 3BPCA 5BO1L 4LOUC 4I18C 1TCRA 4OTXL 4PP1C 4WUUB 2YD8A 5C9JA 4JEGB 4F7EA 5FUZL 3VXTA 4Q0XL 4HJGB 3W2DH 5T5NG 1T7YA 4WTZA 3CFKA 3BGAA 1I7TA 2E7HA 1J1OL 3H7BA 5GS0H 2AJVH 4HG4K 1FGVH 3LPGA 5T1KA 2ERJC 1RZ8A 4LHJB 3ZE2E 1A4KB 3O2VH 1P7QD 5A3IC 1YEJH 1GGTA 4MNGB 3H9SD 5IROC 4OF5A 3TYFA 1U8PB 4G8FA 2V2WB 1MVUB 5IW6A 2NTFA 4H1LH 5CWSA 3U46B 1FSKC 3GIVB 3E6HB 5MEPB 4AL8L 1H3VA 4QGYA 4J1UB 1OD9A 4MAYA 1JWUA 5E1HB 1OWWA 1BZ7A 3MNVA 3MRRB 3VD4A 3UDWC 3QWOB 3PWUA 2WP3T 4JO2L 3D1MC 4BQCA 3VXSE 1SYVA 4N8PA 1RIHL 4OUUB 2BNQD 4KTEH 3G9VA 5J8OA 4R4FL 3KLHD 3CLFH 4KY1H 3F58H 3FQXA 3H9SE 4M6AA 4U1MB 3DO7A 1FGNH 2R1XB 2VXQH 5T3XH 1ES0B 3FAXA 1K4CB 3O8XD 4KFZC 3FMGH 4GBXD 1JTPA 4OFIA 4M02A 1HIMH 3P4LA 3VJ6A 3KAAA 3W9EA 2IQ9H 3G6JA 5EOQL 2D4DA 5D7KE 2Y4SA 2C4XA 4U2YA 4Z77B 3BT2L 4RWYH 3EOYG 3LAFA 5A1AA 5FO8B 2VLLA 3LH2L 1U93B 5D6CA 2BNQE 2ED9A 4D3CL 1MUJB 1EFXA 2GAZB 5D72H 5I76A 3REWB 5D2NE 1H3GA 4CADA 1CQKA 5T1DL 1YN6B 3AM8C 2P5WD 1N4XH 4KTDH 4BH8A 1Q0YL 3P0VL 2Y9RT 1M6OA 2FEEI 3TLRA 1N0XL 2JJVA 2AJ3B 2VOTA 3BD5A 4QXTA 3A0OA 1LO4L 1FNLA 5HTSA 3FB6A 5J13C 3V0AC 1YMMA 3GMPB 4P2RB 2YZ8A 1QRND 3Q6FA 3PV7A 3ZYOA 5FM5M 1BOGA 1I3UA 1E28A 4YHYC 3ZKND 1IAMA 3CVHB 1OM3H 3SKNB 4HQQL 5ICYB 1L6XA 3LSOB 2R2CA 3NN8B 2GSGB 3LIZL 4Q74A 2JCCA 3UJTL 2P7TB 3BVNB 3CSPA 1YYML 3VFOB 1QHPA 4PJIE 1LWRA 3AGVA 5EOTA 1J1XL 4GKSA 5JXED 3FFDB 5IHLB 1RFDH 3X3GH 2LABA 5HDQL 1VFMA 1MCOL 5D5ME 5L88H 1M7IA 2LVEA 1QRNE 3WFEH 4CN1A 4YE4H 1S5HB 3O2DA 4OIBA 1GGCH 3VDCA 4F15B 4KROC 1JYVA 3VE0B 2FBOJ 5L2KB 2O61A 5E1AA 1CZ8L 4Z7UF 4IS6B 2FX7L 4YX2H 1A3LH 5C6TL 4PRDA 2O5YH 2Z92A 5EU5B 2ZSWA 4PTUB 3OSKA 2E6JA 4S0TD 5JPNA 3RWIB 3SKJH 4BFBD 1DBBL 4JFDB 3W81A 2AK1L 5DK0B 1KPVA 4JHBA 1JHLL 2RAMA 3IDIB 1S7UB 1DLFL 4PRAA 2H9GB 4PGCB 5IMOA 3U30C 4OM0H 3QXDA 1UB5B 2FGWL 5DMGC 4MWFB 1FIGL 2ZCKH 2W0LA 3GZKA 4TPRL 3GDBA 5I15H 3QI9A 4LP4A 3KPLB 1CICA 4OCLC 3ZHKA 4G8IB 5SX4I 3UTSD 4DEPB 3S3PA 4Z7UB 4RFOH 5MERB 1K2DB 3B9KB 4NKDB 2UUDK 4NC1E 3BPNB 3LEXA 3UO1L 1MHCA 1IILE 4QHNA 5FF6A 4XPAL 3UEZA 3QO0A 1G9NL 2ZOLB 4WI4A 1YN7A 4C56B 1A47A 3MR9A 3IDXL 1MHHA 4OKDA 4X6BA 1B0RA 3QWRA 3VFUA 4NM8H 3UTSE 3B3IA 5JDSB 4XP5L 4QRSA 2QHLA 4H1LB 2C1OA 4UT9H 3FRUB 3V6FB 2I9TA 5F7KC 4JFYA 1G7MB 1H3WM 2D7NA 3V5DB 4FG6D 3B2UD 1JVKA 1K4DB 3SDAB 4MXQD 1A64A 2APXA 5CFHA 4P57A 3VH8B 2ORBH 4KJWC 1RULL 3KG5A 2BVUA 4EI5D 1INDL 2OS7A 2FYYA 1P84J 1EZVY 1KUMA 5DC0A 4M9OA 3PGCB 1ZOXA 3C60A 2DBLH 3S35H 1SJEA 1ZHKA 1FO0L 1Q0XL 1Q9WB 3TFKC 3U0WL 4NO2A 3L3HB 3L3JA 4YHML 3VGFA 2FX8L 1RV6X 2W9EH 1OARL 4JANA 4KHTL 3VFMA 5CGYC 3ZL4L 3T0EC 3QEUB 4ZS6C 5C0DB 4Y2DA 4LVEA 4W6YB 2HTKC 1L0XA 1J87A 5EO9A 5H35A 4NO0A 5J4MA 4Z7VE 2CH8A 3K3QA 1UT9A 1AP2A 2AEPH 1DE4B 3GRWL 1F6LL 2LQRA 1UWXK 1B6UA 1A4KA 4H0IA 1C1EH 1NC4D 1LNUB 5T1LA 3I9GH 4FQ2L 1I7UA 4ZS6D 2A2QT 5D5MF 1MVUA 2H1PH 3SOBH 1WGOA 4JO1H 5ISZB 1U36A 3DROB 4G6FD 4KZDL 1KCKA 5D5MA 2CO6B 5T3ZL 1BFVH 1FCGA 1CXEA 1NCCH 4CRPA 4GRWE 1JGVL 5DJDB 4O4YH 1A0QH 2OTWB 3GMQA 3T4AA 2QADB 3D85D 3F5WA 4O2EA 5D1QA 2QQKL 1EBAA 4I48B 3ZYZA 1T0MB 1YPZB 2BSTA 4ONHB 1OAKL 4PJIB 1QFWL 1WT5A 3OXRA 5MHSD 5HVHC 1N3NB 1R0AH 4G9DA 5CMAA 4EI5B 5C0CA 3PF2A 4LFHD 3CZFA 3LQZA 3S4SA 1V05A 4PJDB 4HWEH 1FZMA 1M71B 5EB9A 4Y2OA 4LHQB 3EJYC 2VKXA 3QDJE 1OVZA 1FG2B 1DVFA 2A1WL 3U0TB 3MBEA 4E41A 1L9NA 1IC7H 1T4KA 4L8BB 1UVQB 2G9HA 1D7FA 1IRAY 4GRLA 1ZXQA 4OGXH 1BZ7B 2D03H 3IRPX 3MNVB 4E5XB 3S9DB 3QDJA 4BSJA 5I1LA 4KKCD 5I2IA 3PXHA 5A2FA 2OZ4L 1DBML 3EDKA 5KVGH 1MLBA 5MP6L 1K8DB 1U91A 1RI8A 2R0ZH 3CFJA 3DX8A 3NA9H 5JXEC 1H8OA 3WFHB 1R24B 3TCLB 4OUUA 4APQA 4X6CE 3K80A 1B2WL 1LHZA 2P44B 5CJ8A 5D1ZD 1KIPB 3FCTA 43CAA 1ZTXL 1IQDB 2MQ3A 1HH9A 5HHOD 1XCQB 4BH8B 3DBXB 4JPVH 4NT6B 4TUKH 3CCHA 4U1IA 3TH2T 2H8PB 1AQDA 3V7AE 4RMQA 3FB6B 2CKNA 4X7EC 3EOAA 3VD9A 3LEYL 3MJ9H 3EFFA 5GJSH 3ULVH 3FQTA 1TXKA 4F7PA 4O5LL 4N0FA 4ETQA 1LDSA 3KLAA 4P4KB 5DHVA 4JFDD 3MTRA 2VDLL 5E6ZA 2DQTH 1IC4L 4JZNB 2JJWA 3HUJB 2BXZA 2OXGA 1KEMH 4YHKL 3WD5L 2VKWA 1JYNA 2VLRA 2M8XA 1PZUB 4DZ8B 5D7IF 3I50H 5E9DD 1UH4A 3BPNC 25C8H 1BM3H 2XQYG 3T0WA 1T80A 2AJ3A 3ILQD 1F97A 4YFLI 4M7KH 1NLBL 2A74A 1T0NB 3KWWA 1BD2B 4N5UA 3I85A 4UU9B 2BOCB 2QQQA 4ZPTA 1J0KA 2Y7QB 3DIFB 4RRPA 4WI2A 4YGVA 4F37K 4PY7A 3QIBB 1CLCA 2GCYB 3SKNA 3JV4A 4XPTL 1FGNL 3BPOC 1U58A 3SDAD 2GT9A 3QEQD 3KYMA 1A5FL 1TZHA 1J9CT 4O51A 1IL1A 4M5YH 4P46D 3JBG7 3VFOA 1CN4A 4F8TA 4XNYH 3VI4E 5F70A 1REIA 4FFWD 3QXAB 5I1CL 5EOQH 5CJQH 3D69A 1U6AH 1WZKA 1IEHA 4Z7WE 1DDHA 3BT2H 4XCNA 4ZFFB 5IM7A 2CLZB 1NGPL 2DMCA 3OF6D 1F02I 3Q0HA 2XTLA 5IVXF 5DVKA 2F74A 4OCXH 3MXWL 1QBMH 4Y4FA 4XP9H 4YH6A 1KENH 3BD3A 1GGUA 4UIKL 1A7QL 3I2CH 4NO0D 1GHFH 5J3HD 1FORL 1NUGA 5EU5A 1UA6L 4PJ8A 1XR9B 1MCPH 2DQUL 5JPNB 1AD9B 5CJOL 4M1CC 4FXKA 1KPVB 5C0AE 2VQ1A 1JTOA 4DKFH 4X6BB 4HKXB 1MH5A 2AV1A 5C0AD 4L4TD 4ENEC 4CL7A 3UXFA 1OAUL 3MCKB 3V4PL 4N0CD 3RVTD 2AABH 3A6BH 5F6HJ 4LCWB 1G84A 2IMNA 3QR2A 4G80B 4G9FA 1C7TA 2DM3A 1F3DJ 5FO7B 2QBWA 5J06A 1MRCL 1G7MA 4P2QB 4WI3A 5GQBA 3A67H 3GJFA 3BZDA 3KR3L 5JW4N 3WFZA 4LEXH 2P49B 3LEXB 5E8NA 3NFPA 1JN6B 3IU3A 1K5NB 1QR1A 2DLFH 1D5IL 2AEQH 4XNMA 3QRGL 4X5WB 3MR9B 4C57C 5I1JH 3C5ZD 2J3SA 1HYSC 1SVCP 1EBPA 5LXGH 2O5XL 2XWJB 4U2ZA 3BEVB 2ID5A 3WMSA 3QHZL 1FH5H 4GKOA 4C58B 5C0FA 5IKCA 5GGUA 2O5YL 5F7DB 3WXWL 2MKLC 4HV8A 1Q72H 4LDOB 1RZ7H 5IT2L 5EPMA 1U8JB 2R9HC 4XPGL 4LOUD 3DSNA 3HI6L 2JCCE 2NYYC 4L9LB 4DJMA 5KSAB 2DN7A 3FL7A 3FQUB 4ODTH 4UB0H 1RZKC 3MQIA 1U3JA 1DANT 4HT1H 3KYKH 1RD6A 2FGWH 5F3HA 1G7JA 1I9RH 4OFYA 2QV2A 2WK2A 4JY5H 1XEDA 5K9JH 1A7PH 2EYSB 5I9QC 4KQ4L 2FIKB 4MQTB 2QSVA 4QOKD 4MA3B 5GGQH 4I3SL 3O9WA 2HT2D 2Q7NA 3SJVD 1U8LA 1H5BC 3RGVA 1XGYL 5DJCA 5DYOA 1IGYB 5JXAH 2V17L 3CPLA 4Q9CA 1DJSA 2PW2A 4NN5B 1E4XI 5IESH 4P2OB 4WUKH 1S3KL 5IWLC 2XRAL 4MS8D 1CGYA 3CXDH 3PWPA 1IEBA 4O2CA 3MLWH 1FG9C 4PLOB 1MI5B 2ZKHH 3VWKB 3D3VE 1UM5L 4EBQL 2FSEA 3SGEH 1KCRL 2FECI 2EYTB 2YBRB 4E0RA 4Q2ZA 5FEBA 4OD1H 3SGDH 3SCMC 1OTUD 3E2HB 5LQBH 3LQAH 4U0RB 3MBEB 5D6DA 5GGRB 4W6XB 4OQTA 5GS1C 1UXWA 3HAEH 3UDWA 3ULUL 1I8KA 1KTDB 2BCKA 1E4KC 1MPAH 3PP3H 1YEDA 4M6NL 5SWSB 2GYSA 1KFAH 2WMPA 5DJ2B 1U2CA 2R2HA 4G8GB 5E95B 4YFLF 5CHNA 1ZVYA 4I48A 3L5XL 4JHAH 3CSYA 1OB1B 1LDPL 1FGVL 4PJIA 5KVFL 5JR1L 2PCPA 1TMCB 3MJ7A 1P9MA 5F7NC 4ZDHB 1A1OA 5CMAB 4X98A 4OI8A 5SWZB 4Z76B 3MODH 5EO1A 1NGYB 1XCQA 5GRVL 4A6YL 1DTUA 3CCHB 5DXWA 4U1GC 3U6RA 1PSKH 1RK0A 4QOKB 4DOHB 1AQDB 4KXZI 1BQUA 4P5TC 5CJXA 4ZUVA 1HILA 5HVHB 2I60L 5DHYA 2X4UB 3T65A 1CE1H 2YD5A 4GAGL 3EFDL 3HI5H 4NJ9L 1E4KA 2Z93A 1HHIA 1HQRB 3QDJB 2HG5B 1S7TA 2YHGA 5TQ2L 1RUKH 3O4LB 4OM1H 4R4ND 3RAJL 4Z7NE 1NQBA 3PE9A 4KVNH 4QRQA 3RWFB 3BQUB 3CFJB 1AGFB 4WJ5B 5EFIA 4Z0XA 3E6FB 4MA1C 3AM8A 3FRPG 3HAEB 4AEHL 5LGHH 1MFCL 3X3FH 2DL2A 1NCCL 4K9EL 2NY7L 1UH3A 3SY0A 1GZPB 5I8OL 2IALB 1SM3L 4PGEA 2K1MA 5TF0A 4BFGA 5AZ2L 3FN3A 3SE8H 4KZEL 3TO4D 1KN2L 3RWDB 5CEYA 3UTTA 2IH3A 1FFNB 1OAKH 4ONOA 5T1KB 5J3HC 1RZ8B 2XNAB 3OKYA 2BOCA 4MMXC 3QDGE 1R0AL 1ZA6A 1KULA 2D31B 2EDRA 5F89B 4DGVH 1KXVC 5DSCB 4LGRB 3CIQA 1CIDA 5DD0H 5HYEA 3BRFA 1INQA 4KMTH 1M7DB 4QTIL 1TZHB 3BH9B 3RGVD 1DBJH 4HIIB 4KTDL 3VXSA 5FCSH 1N0XH 4YDJA 1U8NB 1OP5H 1UGNA 1XZ0B 4PGBB 2HVJA 4XCCH 3M17B 3ZKNC 4FZEH 5KVGL 4Y1AA 1ZS8A 4DVRH 1EMTH 2A74B 2FATH 3OKEB 1GGBL 3MGOA 2EDDA 4M1GH 2Z4QB 3VGBA 3N1GC 3WDIA 4JFQA 5HVFB 1FV1A 1FAIH 4FQPA 5IVOA 4YXHL 4JM2A 4O02H 3WS6C 4Y4FB 4WWKD 1WSST 1BZQK 2XXMB 3C09C 3V6ZA 4P2OD 2A73B 4Z7OF 3SKUD 1NSNL 2XTJB 2J8UF 3JV4B 4PJIF 2CGRH 2HJFA 2YRPA 4CU7A 2GT9B 1A7NL 1TTUA 1QG3A 5K59F 4K7PH 1MHEB 4V1DB 1ZLSL 4ONGL 3QULA 5JA8B 3X3GL 1J86A 4X80H 1MCOH 2B0SL 5FO8A 3K8LA 4U31A 5FO9A 4Y4FD 3B8YA 5KSAD 8FABB 4JREB 5KAQG 3B2VH 4RIRB 5FHAH 3JUYA 1T1ZB 4XWGL 1M6OB 3GM0A 3BQUC 1LGVA 3CX5J 3T2NH 1Q8MA 2X4RB 5JOFA 4WTXA 3D85B 2BSSA 4CVWA 2O5ZH 5GGTL 3V4UL 1YMMB 3GMPA 5IEKA 1DQDL 3PHOA 5BRZE 5I15L 2NZ9C 1BOGB 4G8EB 5DRWA 3QA3A 4JDTL 4OBRA 3MRPA 4FABH 5KVMC 4HKBB 4QEGA 3ZT7A 4HX1A 4XRCB 3MGTA 3L7EB 4X9HA 5CCKH 4PPTA 2WIIB 4Q58C 1T89C 4HKJB 3D5OF 3UO1H 1MCNA 3V9FA 4M6OH 5BZDA 4IOFC 1OAYH 1LMKA 4Z5RB 1A4JA 2NCMA 5T1KD 3N1QC 2G5BA 2MQCA 4XPBH 1EERB 1KTKE 4PJCA 4OZ4B 2VWEC 4XTRD 5EZIL 5F3HB 4XBPA 1JRHH 4KK9D 3QUXA 1MRFL 2APBA 5C92A 3OKDA 2FIKA 4PG2A 1S7RA 2Y23A 3VDAA 5HI4D 2A77L 3BWAA 1CCZA 3DI3B 2YEZA 5H2BB 4L3EB 2F54E 4LHUA 3RL1B 2AEWA 1AFVL 2W59A 4DK3A 5E5MB 5E4EB 4U1LB 4K8RD 4U3CA 3MXWH 4I0PD 1UCTA 3MCLH 4XP9L 5GGUB 4YIQA 1A7QH 2BNQA 5F7DA 5F72S 5T33L 1YNLH 5I30L 5ENWB 5B8CA 3HB3C 2JB5L 3MV8D 3VWKA 4JM2F 1WIUA 2XN9A 1QFHA 4NQXB 4L9LA 3UPAA 5KSAA 4P9HH 3UYOD 4G6JH 4YJZL 1Q9KB 3ISWA 3ARGA 1CFTA 3MRJA 4X83A 5TF1H 2J8UA 3IKKA 1G7JB 4DVBA 4V1DD 2F5AH 3T8XB 1N5YL 3LS4L 2F8VA 4HUMB 1OPGL 1VKXB 4JRXA 4Z7UA 4YDLC 4LFHG 1K2DA 5FUOL 2UY7A 3B9VA 5I8CA 2JJTA 1KTLB 1HWGB 2VH5H 3O9WB 2NY1B 3A67L 4WFFE 5DK2B 4HC1H 4NM4H 2EIDA 5E6IB 3TVMD 3GSOA 3SO3C 1UADC 1MI5E 2X4TA 5DJ2A 5C0CE 1TZIB 1B88A 2IG2H 4P2OA 4PJDE 1TQBB 5GGRY 1YNKH 3RY6C 1YEFL 1N59A 1E27A 4F7CA 2D4FA 1U8KB 4ORGB 1RJYB 1SY6A 3KPSE 3VFUB 4CDHA 1DQMH 3BSZH 5D1QD 5JDSA 4OZIE 2DIBA 2VDQH 5EO1B 1Z6JT 3DX9A 5DD3L 4Q2ZB 5EOCJ 1JNLH 1HHKA 1GOFA 3CJJA 4FQLL 5GISL 2I07B 3O3AB 4X7CC 4G43A 3SDCD 1T66D 1S9KC 1K4DA 4P57B 3VH8A 1MI5D 4QF1A 2YA1A 1N5AB 3STZB 3G6DH 2CO7B 4XPHL 3E3QC 1RUAH 1PD6A 4K2UL 3QUZD 4HT1L 1NCAL 1MEXL 2BVOB 5ALBL 4XWOC 4AENB 2PO6A 2P43B 1VFBB 3RZWA 4NOBA 3RWFA 2Z8SA 3QFDB 3MLYH 2EE9A 4LCWE 3D9AL 3MJ7B 1EEUA 3EBAA 2CLRB 1TJHL 4WW1B 4OLWH 5E9DE 3WNPA 1GZPA 5EO9B 5KTEL 5EBWA 4PGEB 2WQ8A 5E70A 3V8OA 3BI9X 2OR9H 3C09B 4EOWH 4M6ML 5FYJD 2XRAH 3T0EB 3JWOL 3AS0A 2OZ4H 1UM6L 2DM7A 5D7SL 1YEKL 3QJFA 4GO6B 1RJCA 1S7TB 3ZDYE 4C83B 1IGFH 3O4LA 1ZSDB 5F71A 1P5UA 2HFGH 2GTWB 4PRIE 2HN7A 5GSRA 5KSUA 3ZSTA 3OKMA 1CG9B 3TN0B 4FQIL 4W68A 5HGBA 3LZFH 1KNOA 4CW1B 2OXHA 1X5KA 4LKXA 5HI5D 3WXVL 1MFEH 2NY5L 4JREC 4NC1C 2R8SH 5I66A 2NX5D 1QSVA 1ZS8B 4YC2B 3ULVL 3UTTB 3RL2B 1U8MA 5TFSH 5E00B 3CZFB 1R3HB 4QRRE 4TSAH 4XMLL 1M71A 1FV1B 1WZ1L 4NUJA 4NYLA 1G7IB 4U7SA 1XIWA 5DEZA 2VDLH 3NPZB 1IC4H 3QUKA 3ZO0A 4N8VA 5I73C 5CZVL 3HRPA 5B3JE 5DC4B 2BY2A 3I50L 3P40A 2G9HB 1PSKL 5EUOE 4NJAL 3RTQB 5C8JA 3UMTA 1MHEA 1X6NA 5L8LB 3WV0A 4HIIA 1IVLA 1DQJA 4DFIA 2QLVB 3R8QA 3LDBB 2X42A 4LF3A 4AEIH 4HK3J 4R2GB 4ZODA 5INCB 3O3EA 1OAXH 1H0DA 3KYNB 4EIZC 4MD5B 4LLYA 1RUKL 1R24A 1NBZA 4P4RA 5EU4A 5FHBL 1T7WA 3FQWA 1SQ2N 3P4MA 4MDJB 3V4VH 3HRZB 3VCLA 3VFSA 3UCRA 3SDDA 3DSFL 1U95B 2I26N 5KVEH 5DUML 5EN2B 4GXUN 1WAAA 4NNXB 3V6ZB 3R1GH 2A73A 1FHGA 4WEMB 5KVDL 3DVIA 1SM3H 3B9DA 2ADGA 2GFBA 3SPVA 5E24E 5IEKB 4RDQG 4YK4C 3EFFB 1X3DA 3FQTB 4HUXB 1P4IH 5DQDH 5I1CH 1PG7L 4G8EA 1MFAL 3OR7A 3DO3A 3MRPB 3MRIA 1I8MB 4HKBA 1UZ6E 4POYA 3MNWB 3L7FA 4ETYA 1NGPH 1AHWC 3ARPA 2N7BA 1IBGH 4ZAKD 1XMWA 5F7EL 4ZD3L 4TRPL 3H9ZA 2VLRB 4JKKA 1X9QA 1QEWA 1WISA 2YKLH 3SDYL 1S78C 4P23C 2HRPH 4GRWF 2VQUA 2YA2A 3IXTB 4Z7OE 2F5BH 3VRIB 3QPXL 4N0CC 3RVTC 2ZCHH 4HHAA 1RJLB 1AXTL 2X40A 4YBQC 5JOPE 2OCFD 2VXTL 1WCQA 4JQXC 4R90L 5LKNA 2PYED 4QRTB 4ZPTB 2UWEB 4APQD 2DQCH 3RU8H 2B1HL 4U7KA 4LHUB 3DIFA 1CL7L 2A83A 5JW5B 5JW4M 3QIBA 4OQTL 2R56L 4U1LA 1UWGH 3BZFA 1FAIL 4L4VE 1DN0B 2GJ6D 4BZ2L 1KTRL 3BGFB 1IM3A 3LKRB 1PVHA 1WBZA 4YNYB 1YNTA 3L95B 5D7IA 3KYMB 2ESVE 4YBQD 5DFVD 3THML 4JKMA 3C5ZC 4WUUA 3VGAC 5ACLA 3S8WA 4LARL 3REVA 2DLFL 1C7SA 4R2GD 5ALCH 5D1XD 5GHWL 3SDCC 1JHKL 3KPOA 5EOCH 4NWUH 2BFVL 1TPXC 5T3XD 3H6JA 3LKNB 3KPQA 1L6ZA 5M94B 5IB1B 2D3VA 5HHNB 2CLZA 5F7MC 4Y89A 1ZHNA 4L8SC 4U1HA 1DN2A 3IDGA 3T77A 5I1AA 1P69B 5GSVA 1MLCB 3HN3A 3RL1A 1XR8A 4U1SA 4ZYKB 2OR7A 3BE1H 3PV6A 4Y16C 1U42A 3B2VL 5JHLL 5FHAL 4CNIA 1Q72L 2X4TB 5CWSB 2A6KB 5BO1H 3MPCA 2OQJA 5I1KH 3BP5A 5HVGB 2ZP0T 1T03H 4JN1H 1VADB 1J8HB 1S8DB 3HR5A 4S11A 5T3XE 35C8L 5IFJA 1UWEH 3QWOA 5CIPA 3STBA 5DRXB 1JNNL 4ODSL 1RZIA 5A2KH 3S4SG 5GRVK 4ZXBA 4YK4B 1A14L 2VB5A 4PRHB 5FO7A 3QXWA 4I3SH 1LO0L 1YJDH 1IAIM 1ADQL 2YSSA 3C08H 4JFXB 3KJ6H 4QF1B 3FQXB 4QRUB 3U7WH 2UVFA 1CICC 1EPFA 5E6IA 2IQAA 4POUB 4RISH 2OL3A 5EUOF 1AXSA 1BD2D 2VQTA 4X4XB 4P5KA 2DIJA 2PO6B 2VITA 4L3ED 4OZHF 2KZWA 4Q6IA 1X44A 1SBSL 4CN6A 1IFHH 2NXZD 1QFUL 5AYUH 3LQAL 3B6SA 2E6PA 4NN7C 5F1KC 3HPLB 1OD7A 1DLHA 5DJXA 4U4BA 5HYJA 3GMRB 1DUYB 4X6CB 1UJTA 2JB6B 4Q0XH 4KGLA 3D2UD 4JM4H 4QY8B 3QUYB 4X6DE 2VXQL 3RWHB 4TULL 4F37F 5I71B 2W65A 2NY2D 3O2VL 3IDMB 5KG9A 5A16B 1VACA 1E4JA 5FUCE 5FYJU 1ZSDA 4Z0BL 4LLQA 4OZGF 3SDCB 3W39B 4P2RA 3S34H 3TNNB 3NZHH 1QQDA 1B6DA 3MXVH 2QHRH 1FVDB 3OAYK 2CIIB 3QUMH 2PW2B 4HCRH 4M5ZL 3E2HC 4LU5L 1F6AA 3CFCH 4N8CH 4RAHA 4FRWA 2P7TA 1A3RH 3ARDD 3BVNA 1XF2A 2X89D 1KB9J 4JRYE 4QHUB 3UTOA 3WJJC 4NKIL 1D3CA 2VLJA 4I18A 4NUJB 3QZWG 4NYLB 5DJ0A 5TQ2H 5CBAA 1RPQA 1AC0A 3ZE1E 2VDNH 5FCUH 1U8PA 4G8FB 4N0YL 3ET9F 2F54B 2FO4A 2NY0B 5HGAB 3SKOB 3KHOA 3VMOA 4HS8H 4LRNL 3B5GA 1JZ5A 5C8JB 5L9DL 1J8HD 3QP3A 1CG9A 2E9BA 2R0WL 3TN0A 4EXPX 1EJ6A 3KPTA 3H42L 3KXFB 5HGBB 2AK4A 1KNOB 1G1CA 5ICZA 5FUCC 1NDMA 2IQ9L 5FB8A 1WJ3A 5FECB 3MV9B 2KBGA 5DJ6A 5DK0A 4CKVX 4W4OC 2Y6SD 1PKQE 4G5ZH 4L1DA 1IMHC 3KYNA 4LLYB 4UNVA 1K3ZA 5FV2A 4I0PB 1GAFH 5ADOH 4Z76A 5HDQH 4FQQA 2YR3A 4KK5D 4HUVA 5C7XL 1DSFL 5EUOA 4OFVA 4KJQD 1TJHH 4P59H 1N4XL 1KGCD 3P0VH 2Y36H 1CZ8H 4Z95L 4U6VH 3EYOB 3TWCL 4M7ZC 1I3RA 5B38B 4NN6B 5INDA 3T65B 5C6TH 3T0BA 4WGVB 1W0VB 5K33A 3KLDA 1EVTC 1F42A 3BFOA 4KJQC 1H5BB 1AGFA 4W4OA 3E6FA 2NX5B 1G6RA 3UJTH 2SEBB 5I76B 3B3IB 5L2KD 3VXMA 3FO1B 4G7VL 5D71L 2IALA 2CGRL 2JJSA 1A6ZB 4X7SL 1I75A 5IEHB 3VRIA 4QXTB 5DA4A 2Z9TA 4ONGH 3WFEL 4RGNC 2EDNA 5F88B 1C5CL 3G5XA 1N6VA 3UAJC 1FE8H 4AK1A 2XT1B 4NHCH 2G60L 2D31A 5TFSL 1C16B 1QP1A 4WY7L 1I8MA 5SX4H 2MCPL 1P4LB 4OI7A 4BYHA 4C59B 2HVKA 4Z18A 4M48H 3EJZD 4WDIA 5HI4C 3BH9A 2XA8H 4NQEE 4JDVA 2GTZB 3ILPA 3V52H 2D7QA 1JHLH 2D7MA 3AVEA 2CXKA 3FFDA 2ICWJ 5AWNH 3DXAD 2VERN 4DKEH 4HWBH 2APTA 4EVNB 3M45A 2BC4A 4XXDA 2FEDC 5L0QC 2NLJA 1RULH 2P5WB 4UT7H 1RJLA 3EJZC 3VE0A 3DVGB 1O7VA 1UKSA 1PX3A 1F2QA 3VXPB 1OQOA 1TNMA 4PRNA 4XP4L 4GLRH 1D5ZA 4EI5C 3V6OE 1F4YH 4HBQA 3RY4A 2YUVA 3DSFH 4JFDA 1IZJA 1V3JA 5EC2B 3VFWA 4YNYA 3L95A 5D7IB 5TE6L 3ZL4H 1S7UA 3QB7C 4UNUA 3S5LA 4PJ5B 1J8HA 3QULB 4X6DF 4NP4L 5K9KB 4Z7WB 4HS3B 4QNPE 5HYJE 1UEMA 2X70A 3IDUA 3HMWL 3INUL 1CXKA 4FQHB 3KPLA 1A21A 3GRWH 4HGWA 4PRIB 5JLZA 4HLZG 3MA7A 5HHPA 4M03A 3S4SB 3B9KA 1Y0LB 1F4WH 5GSVB 2YKLL 4NHUA 5DK3A 3TVMB 1O7SA 3MOQA 2EO1A 4YXLL 4QXGH 3NCYP 2XICA 1TIUA 3BMWA 2PYEA 3O9WD 1TPXB 5BS0A 2BNRA 1AXSB 1FBIL 4LASH 4ERSH 4JO4H 3S35L 3B5HA 2J6EA 3NIDF 4G6KH 4L8DB 5D6DC 1C8PA 4JJHA 4GMTL 3GSNH 1JRHI 3TBSB 1MFBL 3HS0B 4WUUE 2DQCL 3B6SB 5E2TH 4OZGE 3L5IA 2VZ3A 5HD8C 3HPLA 5DJXB 5GZOC 4H1LA 2I9TB 3FRUA 1MCQA 2X9YA 4OQTH 2PO6C 4PRHA 4IM8A 3QG7L 4OI9A 5BZDB 3BD4A 1VGEH 3KNBB 1EHNA 4L3CA 1S7VB 2G5BB 4NCC1 1ACZA 4H5SA 2ICWB 2QKIB 1IGJB 2D2OA 2A1WH 2JK5B 5EA0H 1FC1A 2FYYB 1T20A 3NPSC 3EJJX 3UJJH 1I4FA 5DQ9B 4L8SA 4QTHB 4ZUSA 2KQMA 5C1MB 1AKJD 1B4JL 2R69H 6FABH 4OGXL 5JDJA 3EOAB 4KI5D 5GGTA 1KT2B 4D8PA 3VG9C 3JV6A 4YBLB 2OZ4A 3BEWA 3KPRB 1MJJB 3OKLA 5TDPB 4LSSH 5GZND 1JGLH 1NPUA 4YIQB 5H35B 2BZDA 3QDMA 4KK5C 1A6VL 4IRJA 2Y72A 1T04B 2HLFD 4RMTA 2AJUH 3C5JA 4NQXA 4PLNC 1T03L 4I18B 4R4BB 4PD4K 5D96B 1LNUA 4RMVA 3TH4T 3IDMA 4XGZA 5KG9B 5A16A 1FYTA 2R2BB 3MOAL 1LEGB 4S0SD 5HGAA 1QR4A 3RIFK 1BD2A 1FL6B 1A1MB 3X13B 1S7QB 1U8QA 1N64L 4XH2B 4AJ0A 2NY6B 3RNQA 1EGJA 3H9YA 4WCYL 3RFZC 1ADQH 5FM8A 2R1WB 4HS6B 3IFOB 2EXYD 5JW3L 4NQCE 3O6FD 2BVEA 1NEZA 4ZTOL 1N3NA 2G5RA 4QXWA 3IT8D 25C8L 5ETUB 3UZEA 4ZPVB 2HP4A 4X99B 3ALWA 4S1DD 1OLZA 2VDOL 4U3XA 4XHQA 5D7JB 1B9ZA 1FRGH 3D69B 4QGTA 3K81A 3N06B 2P8MA 4LIQH 3NCMA 1DVFB 4JPVL 1CFVL 2QSQA 2OJEB 5GS3A 1KLUA 4JCMA 4FQIH 4LCUA 1I3RB 1C12A 3WS3B 1A7BA 5IIEA 1W0VA 5EU6A 5D93C 4WWKB 4YAQA 1NFDF 3LEYH 3MJ9L 5GJSL 5I1LB 4KKNA 3DGGB 2ZNXA 1A6UH 2H45A 5ICZB 5J56B 1ZA3A 2AKRB 4PY8I 1UJ3B 1VCAA 3HC4L 3PWNA 1VFBA 5E8PB 5GGSY 2DQJH 4R7DA 4PD4J 3TCLA 5E99H 3SDXB 1HSBA 4ENED 43CAB 4YPGB 4KK9C 2YRLA 2GK0A 4G9FB 1A6ZA 5MI0B 5IEHA 4PJ9A 3GJFB 4MX7A 4NFDA 4JHWL 3BW9A 1QBML 2AQ3A 2V9QA 2IBZY 5B38A 1J1OH 5GS0L 5IR1A 3G5YB 4I0PC 1D5XB 5E2JA 1OAXL 3TBYB 1C16A 1OTTC 5TGBB 3FFCD 1NGQH 3QIWB 3GSWA 4JY6B 5HBBA 4LSDA 2FB4H 4U3HA 2AK4D 2D9QB 4N1EA 4RMWA 4P2QD 4JZJB 4Y19A 3WIHA 5AD0B 4YUEL 4I8DA 2GTZA 1MFDL 3WSQL 2SEBA 5FKPB 2F53E 4Y2DD 1GVIA 1PQZA 3FO1A 4PLJC 5TE4L 5BS0D 1YDPA 4B0MM 2COQA 2WANA 2AJYH 5I66B 1F3DH 5ACZB 4NGHL 1BWMA 1AE6H 5KSBE 4B5EA 4L4VB 1F11A 2F8OA 3MJ6A 2CD0A 5DJAA 1JCKA 3QEHB 3G6JF 2V5RA 1KYOJ 1I1AD 1YC7A 4HIXL 4OGAC 2DJSA 4XPFH 1MCRA 3LDBC 2DAVA 1NC4A 4R3SB 3QUKB 2CJUH 5IP4A 3M8OL 1FL3B 3UP1A 1R3IL 5IJKC 3VWKC 4IRSD 3NGBC 4TRPH 4MSWA 3ZDYF 1FNAA 1YQVL 1U58B 1DSFH 4LNRA 4O9HH 1JI2A 3I84A 4ISVB 4PJ9D 4Y5XB 4WDIB 2V2XA 3WKMH 5HYQA 4I1NB 4Z7WA 3GBNL 2Q8BL 1U3HC 2F5BL 3E8UL 2DWDA 1BBJA 4I9WE 3BIKA 2CSPA 4NRZA 1NMAL 4HJ0C 3RTQC 3WCYA 4Y4KC 4O2CB 3Q6GL 1YEHH 4GOSA 4F7MA 4N0RA 1MI5A 3RQ3A 4DK6A 4MDIA 5C0ND 1S7WB 1Y0LA 2HT3C 1XGRB 3WUWA 5T1DH 4WU7B 1RZGB 2RHEA 1Q0YH 2DICA 1WWBX 3IJHA 1AO7D 5BS0B 4WI5A 1MRDH 4TSBL 1LO4H 2VQ1B 4R6UA 3Q1SL 3CSGA 5HHQA 1JWUB 4PJ5D 3CXHJ 5EOCL 3VXRD 2Z31C 3OR7B 1HKFA 3RY5A 4GKNB 3HS0A 3IF1B 4EJ1C 2X41A 4NN5C 3MV8A 3ETBF 3QJHB 4JG0L 4W4NA 4Z7VB 4RSVA 4Y16D 1SYVB 3AAZA 4IOIB 1QFWI 4YEFA 1S7VA 2IADB 3S36X 3NZ8A 2IFFL 1JHTA 2RBLA 5CGMA 3VI4F 3IU3B 1A6AA 4NRYB 2PYEB 2C3VA 1KIQB 4QTHA 4ZUSB 1ES0A 1YY9D 3PIQA 4EUPG 1KJ3H 3DETC 3Q3GA 1OT2A 5HSFA 1EAPB 1JGEB 3AREC 4ODVL 1FSKB 2ZPKL 1G7LB 2IEPA 4QWWD 3W9EB 3S37H 5IBLD 3BEVA 1MAKA 5JW5A 1N2RA 1J1PH 1CIUA 3OKLB 3BZFB 2OL3H 4Y4HB 4RNRB 4XZUA 5TDPA 4Z8FL 5JXAL 5E0QA 5T5NF 1QPXA 4QRQB 1EO8L 4NQTA 4ZAKB 4HV8B 4S1SL 1F4YL 3GSRB 1MUJA 4KRMB 1I9JH 4HZAA 1IQWH 3PDGA 1UZ8B 3IFLH 4CMMB 4NFCA 2AXGA 2X4OA 3U2SB 2IJ0C 2GITA 2XKNB 3NCFB 4OF0A 4GW1A 3S36H 5IBLC 5FA4A 3C9NA 2EXWD 4B53A 3I3EA 5DURB 3I02B 3T0AA 4ZG1A 2P4AB 1U9KA 3C5ZB 1JGDB 2BNRD 1MY7A 4DW2H 3DYPA 2XNAA 3DYOA 3HFML 4JRWA 3CFDB 3ULUH 3WFCL 4LRIC 3RZCC 4S2SA 3CVHA 1CI5A 4OGZA 4JRYA 3G9AB 2A6KA 4PB9L 1JPST 1CDCA 1M7DA 2IMMA 4IIQC 4JLRA 3V95A 4X9IA 4DCQA 2DS4A 5HHMD 1MFCH 5JA9A 3CVHL 4HDIA 1TENA 1QO3A 2GEEA 3BGFC 4TULH 5TH2A 5C0RH 3ROOB 5IFHH 4AIZB 1T5XB 1DUZA 1UM4H 3ARYA 4G6KL 4ZPVA 3O41A 1IARB 5DRXA 3ES6A 3N9GL 5DLML 2HVJB 4YXKL 1KN2H 4H0GA 4ZXBB 1QSFB 2AJXH 2DMKA 3KVQA 4GMSH 1FYTB 4X4YB 4G6FB 5L2KA 4JFXA 4LCUB 2O61B 4XBGA 1RVFH 5CKGA 5D7LD 4HIJA 1L0YA 2DI7A 1JZ7A 4JZJC 4M5ZH 4YAQB 5DD0L 1UXSA 1INDH 1FLRH 5D96C 2ZSWB 4PTUA 1UWXH 1A3RL 2OL3B 1NL0L 2HJFB 4X4XA 3OWEA 1FNGA 4OM1L 4R7DB 3U0WH 3CSBA 2C3HA 4YHMH 3QQNA 1A1OB 3HMXH 4PRHE 1T2QH 1U0QA 3DPBA 1XGUA 4X99A 1P6FA 1G9EA 2NY0D 2XN9D 1KB9K 4KK8C 4YPGA 2E7BA 4K9EH 2K7QA 4PB0L 1RAMA 1JYXA 2PF6A 2AGJH 1RK0B 4OFKA 3QEQB 1KLUB 4ZFGL 3UPRA 2OX5A 3R8BB 4YBHA 1P1ZA 1NCTA 3HE7C 3RIFF 3QIBD 1B0GA 3ARDA 2K7PA 4JKLA 1HQRA 2MPAH 5IGXL 4OB5H 2JJUA 5F21B 3BP7B 1A7NH 1YN7B 3P30L 4C56A 2XOTA 2P24A 4RGMB 4LLQB 1MHHB 1MAML 2AKRA 3VFNA 2H1PL 3AY4C 2H2SC 3TNNA 5ILTH 1SMAA 1HH6B 4GFTB 2IPUG 1DCLA 2E6QA 1ZLVH 2QADC 4QTIH 3MUHL 2IPTH 4P2YA 3CUPB 1DQQA 5DZNA 1A0QL 4BSVB 5JQ6L 1F6AB 3P4NB 2AQ2A 4HKJA 1CD9B 1FAKT 3ULSB 4AMKH 2DRUA 4GRWH 1QTYT 2A9NH 3RWDA 1A9EB 4FQJH 4MX7B 5B38G 1A6PA 4PP1D 2NXYB 2X1QA 4LSUL 4G42B 1WTGT 5D70L 1ITBB 2OI9C 4Y4FC 3VFPA 4M1GL 4OZ4A 4R0LB 2VDOH 4LCWD 4LMQI 4XVJL 1QFOA 4HFWB 4ZUWA 3O6MH 3BXNB 1PY9A 4LPVA 3TF7C 4L4TA 4JG1H 3MGAA 4KJPD 1QSFD 5KSVB 3MLVL 5KOVC 3MUGA 4IMKC 2L4OA 1U8NA 4P4KC 5A2LH 1IGTA 3DRQB 4K8RC 2Q8AL 5FYJE 2NZ9D 3E3QE 3U4EB 4X80L 5DJ6B 1DBMH 5HGGS 4ODWB 2B0SH 5EZOH 4NZUL 3BX7C 3VXUD 4F7MB 4XPBL 4L4VA 4X9BA 2C3WA 5I1EL 5DJAB 1S7WA 4LQ1A 5D2LA 4KJPC 1B2WH 3FZUD 1BQHA 1CFNA 1XGPB 5IMKA 4EZMA 5T1LB 3ARED 5KW9L 1R3LB 4TOYL 4JRXB 3IJHB 3CFIC 3O6KL 1NBVL 1UYWH 3CD4A 3MRQB 4YR6A 1RZJC 4NO5B 3DROA 5BZWA 1MELA 2OJZL 3FB8A 3V0WH 4ISVA 4O58H 3DXAE 1T2XA 1ZEAL 2BNUB 3L3IA 4LVHB 2IANA 5T3ZE 4NQCD 5EUKB 3TVMC 4N0UA 2DWDB 5E4EC 1KBGL 1XGTA 1AGDB 3OZ9L 4TUOA 3LN4B 4BZ1L 2ZUWA 3JV5A 4OF8A 2BSTB 4ONHA 5JUEH 5GRYA 4LRIA 2NX5A 4D9RE 3GJEB 4M7LT 3WD5H 1FP5A 4FFZH 2HKHH 1OAYL 1CD1A 3DX9B 3QAZC 3MRNB 1D9KB 3HB3D 3WUWB 3WSQH 1OPGH 2XYCA 1EX0A 2QSCH 3QCUL 4GKZA 5IOPA 1M1SA 4K23H 4G43B 2P47B 3ZT5A 3EYFB 1AHWA 4R26L 5DJZB 3Q3GB 1TITA 4GXVH 1J0YA 1WCBB 3IETA 4RGOH 1NLBH 1UVQA 4NGHH 4IIQB 3HMWH 5BVJB 4E5XA 2EIZB 3HA0A 4HGKC 5IHUL 4D2NA 4RNRA 4XZUB 3MGTB 4NQVB 5I8EB 5FYKU 2CJUL 2DD8H 5H94A 3LEVH 3RWGB 3MCLL 1R3IH 5IWLA 2YK1L 4JDVB 3MOBH 4OCNC 2FEEL 1FYHB 2AW2A 1OY3B 4YXLH 1FFOA 3T2QA 2X4OB 1T21A 3U2SA 2F15A 4LPYA 4G8GE 2YXMA 4F7EB 3IB4A 3DHJA 2VZSA 1FN4A 4LASL 4P9HL 4ERSL 5C0GB 4D0BA 2HWZH 4MJIA 4XNUH 3E8UH 3OKKB 5CJQL 2A0LD 1JK8A 1KCUL 3ZKXC 2MSPA 4L29A 4YDVB 5JNYB 1I3GH 3QO1B 2VUYA 3EYUL 4S1RL 1JF6A 5H2BA 5FUOH 3FFCE 1NCBL 5EBMA 5F96L 4YC2C 5E2VH 4JR9H 4OJFH 5F3BB 1MSPA 4OCXL 1D5ZB 3FJTA 3QT2A 4HC1L 2L0DA 3E6HA 5MEPA 5H8DA 2HN7B 5GSRB 3VFWB 2BNQB 3DURA 4J1UA 1TQCC 3KXFD 2DQUH 3LKQB 5GGSA 4WU5A 3GSRA 3HC0B 15C8H 1MRDL 4JPIB 4PRBA 1YEFH 3WJJA 1UZ8A 4CMMA 2NY6C 2X70B 4TN9A 7FABL 3CNKA 2CR3A 3MRLA 4JPKL 5FYKL 3VFTB 1OAUH 1B4JH 1FFRA 2R69L 4WFGE 3V4PH 3MO1A 1AY1H 4Y8DC 1MCBA 2ITDA 2DLIA 2CDGA 1HWHB 3PP4H 3W0WE 3OL2A 5GISH 4WNQA 5D7SH 3RPIB 4EN3A 2P5EA 4JPWL 4HIJB 1G7IA 4U1MA 4LEXL 3CFDA 4OIAA 3U7YL 4YGVB 1PAMA 1NCNA 2IFFH 2GCYA 5T5FH 5IQ7H 3NIDE 3ARGC 1KJ2B 4K94L 4F3FB 3ARWA 1HXYA 1NMBH 5BV7L 4L5FH 3QRGH 3ULUD 1N59B 4F7CB 1K9TA 1I85C 3VJ6B 4J6RL 1G0YR 3TPUB 3GKWL 3ROOA 4JFZL 1LVEA 2DJ4A 4EDXB 3MLYL 4UOW0 2O5XH 3JVGA 3L3OA 3TBSA 2XWBB 3BYYA 1JMXA 4DGYL 1Z2KA 4M3JA 3LKOA 1U93A 1J1PL 4P3CL 2CDFA 4WTZG 4YFEA 4ZFFA 4X4YA 3DV6B 2OR9L 4BJLA 1JZ6A 4PG2C 2ICWA 1G7HA 4H5SB 3CXHK 4KRLB 2ICES 1N5AA 4GRMA 1U95A 3SDDB 1U8IA 2BVPA 3KS0H 5J1AA 1UM6H 3TM6A 3EGSA 3MV7B 4PJ8B 4ZFOL 1F2XK 4IOFD 1AD9A 1FYTE 3D0LA 4OT1H 3LVEA 2XKUA 2GFBB 3SPVB 3KPPB 4YHNB 3JSSA 3Q6FB 2DMBA 4HUXA 1KOAA 1T1YA 1NKRA 4TTDD 4X6EB 1FRGL 4JO2H 1DZBA 2FEDD 3MCKA 4WV1B 3S3SA 3ZE2F 3KPSA 2V9TA 4URTB 4I3RL 3QUMA 5FHBH 4UT6L 4XNZB 4ZQKA 5C0IB 4YZFE 4BQ6A 1QEWB 5B4MC 5JXEA 3UPRB 4UDTA 4OZHA 3T0ED 1P1ZB 2VAAA 5JW4R 4BH7B 3FOMA 4U1NB 1JN6A 1LE5B 4R4BA 1JWSA 1E6OH 3VXRE 5FA3A 5KVDH 1G6VK 1U8OB 1GRWA 1EEZB 3FQRB 1LE9A 4R0LA 4Y5VC 2IH1B 1DFBH 4OZFB 3QUXD 5EU7C 3OKOA 4BUHA 2VUOA 1QACA 3DGCR 1DVFD 1MFAH 4R8WH 2FDBP 1YJDC 1CK0H 4YHZL 1V7ML 2A83B 2NQCA 3IFOA 1WFNA 4N5EC 2DTMH 3LH2H 4XMKH 3RWJA 3CUPA 3JTTA 1OHQA 1KFAL 1KLGA 4B7LA 1OTTD 4LMQE 4NKMA 3P4NA 5BOPA 2E9IA 4F58L 5C70A 1W72B 2H9GA 3VGDA 3L6FA 2QJDA 5DVOA 3L5XH 43C9B 5EULV 3CH8A 5E00A 3REVB 1R3HA 2LE9A 4G42A 2VJXA 4ZUUB 3FQUA 3FOLA 3EYQD 4CBPA 1BQHB 1CFNB 2BSRA 4UIMB 4HFUH 4ZXBD 3WFDL 2BNRE 5MERA 4YUEH 1LEIB 3QIUB 4U1HB 3QWQB 3KYOB 3RU8L 4HEME 5DMYA 1OSPL 1N0LA 2ATKB 5JO5B 5DJCB 4Z9KB 4U1SB 4MD4A 5EU6B 1Q1JH 3D0VB 4DTGH 3QO0B 4PJDF 4K3EL 2IANB 3PV6B 2C1PA 2CRYA 4CNIB 4LF3B 4APQC 1OGAD 3C60C 3VW3H 1AE6L 1W8OA 3IFNL 3LN5B 4LAQL 4TQEH 2NW2B 2ZSVB 1I9EA 4YFDB 4UUJB 4LHUD 1BBDL 4KVNL 2H26B 1BAFH 5I8KL 4TVPH 3FQWB 5IFJB 3GNMH 4JFFD 3SGDI 4LLMB 3QZWB 5IB5B 3VGAB 4ZD3H 2EYTA 2YBRA 1FPTH 4V2CB 4RAUA 4GRLC 4OFYD 3K74B 1XGPA 3GI8H 3SJVE 3EYFA 3GM8A 3CMGA 4U05A 2YSSB 3EHBC 1E4XH 2ADGB 4NN7B 2ZCHL 3TZVD 1F4AA 4BK4A 3EO1A 4FQJL 4XMPL 1ZE3C 12E8H 1YEDB 2IQAB 3A6CH 3MNWA 2HT4C 3IDYC 1Q9WA 4TUOB 4HLJA 4JN1L 4NQVA 3IKCB 4X0KB 4YHOH 1UWGL 3DETD 4P5KB 5ERWA 4KMTL 5TPWL 4Y5YA 4JFED 3BRGC 3QEUA 5DI8A 5KBNC 4WFFD 2PR4H 2DYPD 2NMSA 4XBEL 2HT4D 5GJTH 2XXCB 2BFVH 5C0BD 3KJ6L 2EDHA 5I16B 3HMXA 1BVKA 4QY8A 2JJTC 1ORSB 4MAUL 1EMTL 1G9NH 4QRTA 5GS1B 3RWHA 2UWEA 4IIQA 4BQ9A 2I25N 3MA9H 4XHJD 3QAZB 3DX7A 4UV4H 4O02L 1FL3A 1FZKA 4Z7QE 5IB2A 3UC0L 5KZCB 2B4CH 1J05A 3LKRA 1HOCB 1CTOA 5D5MB 1MCFA 1EFXD 3JWDH 4WFHD 3MRBB 3BQUA 2DM2A 5LJYH 2RR3A 4ZTPL 4PJBF 2E7LA 1YY9C 1QFUH 2BMKA 4POZD 4OLXL 1M05A 1PLGH 5ESQA 3U1SH 2OJZH 2VR9A 3V0WL 2X9XA 4J3VA 1ZLSH 2PKDA 3ALXA 5IG7B 5D1QB 1AO7B 3QSKB 2NZIA 1JNHB 1U92B 3KJ4B 4PREA 5DT1H 4K55A 3TT1H 5L7XH 1F4XL 3LKNA 3NFSH 2P45B 3MX0A 1EFQA 2F19H 2VL5A 2WWMD 4MJIB 5C0GA 3UJIH 3WEXB 4JZOA 2ICEB 3ECBA 4MXWH 2ZPKH 3FB7B 1ZLWK 2FR4A 2ORBL 4FTVD 1IAIL 4OCRL 2VABA 3K2MC 5DO2C 3MLUH 1RZJH 3GHEL 1NGZB 4PJDA 2F8XC 3ESUF 5D7LE 1XR8B 4H8WL 4MHHG 1TVBB 1E4WH 5I1IL 3D2UA 1T4KB 3BDYH 1YA5A 3GSUB 2WV3A 2QHRL 1EXUB 2C5DC 4K23L 4GRLB 5K59E 4A2LA 3HE6B 3HC0A 4DUVA 2LU7A 2V7HB 3S36L 3VXSB 2J8UE 4NUGH 3R0MA 3IAQA 1NDMB 5FB8B 1CGSH 3IF1A 4N8CL 1BOYA 1LO5A 5KN5A 4X6FB 4FABL 3MV8B 3LKOB 2EKJA 3DX8B 1U91B 4DW2L 3MO1B 1RZFL 4RWHA 2A9ML 1AD0B 4FN0A 2KL6A 4M6OL 3OTTA 2IADA 3VG0L 4Z7NF 2VDNL 4FQQB 1C1EL 4RQQA 4U6YA 2DQHL 3MOBL 4N0YH 1DBAH 1ZLWH 1WICA 3BH8A 4PB9H 4ELMB 1U8IB 3SOBL 4LRNH 4KZDH 4Z7VF 1WITA 1NBYA 1AR2A 2OTUB 1TCMA 4YDLB 1NCWL 5HYFA 1BMGA 3MRFB 4Q9BA 2AJZB 4WI9A 3IVKA 4F7PB 3ARFA 1HXMA 4HUUA 3FRPA 4UQ3B 1BQSA 3SN6N 3DRTA 3QDGD 4PJ8D 1NCBH 5LGKA 4HMDA 5F96H 4OZIA 1FVEA 4WO4B 1H5BA 3OAZK 1DQTA 4NCDA 4ZAKA 4LK4A 2HKFH 1GAFL 1BZ9B 1G6RB 1ZV5A 4UV7L 2AXFB 4NQDB 3TBVB 4HXAL 3D25A 5FA3B 5FA4B 3WLBB 1H9VA 3U36B 1LE9B 4GJTB 5JOFB 1VACB 2NY0C 4QHMA 5DMJB 3VXQA 5CLWA 5IVNA 1JGDA 1RURH 3D0LB 2XA3A 4UU9A 1T2QL 4HS8L 4U1JA 4NRXB 4UTBH 5TQ0H 3ZLQC 2Q76A 4X6EA 2VH5L 1NFIB 2GW5A 4HJ0D 4ELME 2CIIA 2DTSA 2R0WH 1RQ5A 3RHWF 4L3AA 4U6HB 4DN4L 5B39A 3P9WB 4XRCA 3L7EA 2Y06H 5CJBA 3T08A 2QTEA 1KIRA 3QISA 4JGJA 1J8KA 1N7ML 4G5ZL 1YNKL 2NY1D 1DR9A 4L5FL 4Z5RA 4LPWA 4OB5L 3TV3H 4WFGD 2VAJA 4F9PA 4EVNA 4BK5A 4L4TE 4NNYA 1RK1A 1DDHB 4MS8C 4UIMA 3QCVH 2WBJC 1VHPA 3QHFL 3OKNA 5F7FA 1KB5B 2NLJB 2P5WA 2XQYK 3QUXB 4YHLH 4BQBA 3MLPA 3OKOB 4JFFA 3NCBB 2X5PA 4NHCL 4XB7A 5FYLD 1BQLH 2IPTL 4RGNB 2DKUA 2QEJA 3BWAB 1UZ6F 2F74B 4L3EA 2DKSA 3VXPA 4D9LH 2VZUA 1Q9LB 1UB6B 2B2XL 4FXGA 3H8NA 1UXSB 1XF5A 4M48L 4G8GD 3UAJD 1IGCH 2B8OT 3JTTB 3DARA 3T1WA 1C08A 4K2UH 4QRRA 2APWA 1KSRA 4LSQL 4LVNB 4PRPD 2X2YA 2H26A 5K9KA 4HS3A 4HWBL 5I1DB 5KAQF 4HLZH 1JF1A 4FQXB 1A7OL 3QFJD 3CK0H 4HWBA 2LU3A 4ZUUA 1Q9KA 3FQNB 3JV0A 3PQYB 5E56A 4OLWL 4UT7L 3MUJA 5CZKA 3BISA 1QBBA 4G7VH 5BCAA 4IJ3C 3UROR 5JLZB 2HA1A 3MLXL 3QIUA 1JMZA 1J0IA 3EYOA 4TTGA 4NQDD 5FGCB 3MBXL 4AIOA 5SV3A 1B0WA 4HMCA 2GI7A 2BHYA 1B0GB 1V3MA 3JWOH 5JO5A 4NC2B 5ACMA 3B5TA 1FE8L 3HUJF 4XNMB 3BP7A 2HAZA 2QQNH 1YEKH 3QUYD 4ODHH 3P0GB 2VYRE 3GHBH 3MREA 3RHWK 2XKSA 4JDZA 4NP4H 3U83A 5ANMA 3S97C 3UTTE 4NC0B 3FTGB 2AJSH 2RQ8A 4ZO7A 5J11C 4EKXA 3CC5B 1KELH 2ITCB 4HBCL 3MNZA 1CK0L 1BJ1H 3QFJB 3TIDB 3GIZH 5AWNL 1FVCB 5C0AA 1ZHLA 3O3AA 3HR6A 1J8HE 1CDUA 2PO6D 1A9EA 4EQ2A 1KC5L 5F9DC 2JCCF 1CLOL 4L3CB 4KKLC 2YWYA 1KENL 4HH9B 3G5XB 1F13A 5EWIH 5C86A 2VIRB 1MCPL 2DWEA 1ZANL 4LHUG 4K07A 3UBXI 1SMOA 5KS9E 4HFWA 5AUMB 5HGDB 3IKCA 5CZVH 5F44A 2LFGA 3AS1A 4WW2A 3WFDH 3T3PE 4WFED 5ERWB 1I8IA 2HKHL 3AREA 3QFDA 1CE6A 1TCRB 1Z5LB 3EOTL 4ZUTA 4Q6IC 3BEWB 3O2WL 5D7JD 1MJJA 5CILH 3FO0L 4I0KA 3GGWB 4JRXD 3GMNA 3BYTA 4XC3L 1RUPH 4XNQA 4WTWA 4GXVL 3P9MA 5E08H 2LAAA 4LSRH 3ZDZF 5I9QB 3RGVC 4KDTA 2HRLA 2VLJD 3L3DB 5FKAA 1B90A 4NKOA 2ICWI 2EDOA 3B8SA 1H3XA 3I6LD 4MNGA 3R4DA 3ULVD 1X4ZA 4JJ5B 1OF2B 4OZFG 2ED8A 5KANG 5L6YH 2BX5A 3GI8L 1UXWB 1A1MA 3X13A 4KK6D 4Q97A 3MRBA 4XH2A 3C5SB 2N7AA 3S5LB 5CZXD 4Y19D 1IGML 4PJXF 2FRGP 1E4XL 2WWKO 1F58L 1LO3H 4ACPA 4N0UB 3OG4B 3MRDB 2ERJB 5EORL 4G8GA 4X6FA 2XY2A 4HUWB 1JIBA 3F8UB 5GXBB 3W0WD 3SKMA 2EDTA 1RY7B 2ICEA 3ECBB 4KUZH 5DMIH 3MLTA 3MA7B 1FZJB 1X5FA 4X98B 2L7UA 2VDPH 2GJ6B 2O26U 3NBNA 1ETZB 4GSDL 3I6LE 4Z7WF 3AS3A 2NY4C 1N8ZB 1QYGL 1TZGH 1A7PL 2H32B 3F7VA 1TVBA 4UMGA 2BHUA 5DZOA 3WNNA 1NH6A 3SQBA 2EH7L 4J23A 2AJZA 5DHYB 4Z78B 1C12B 3WS3A 2VXTH 4R7NA 5DUBB 4P46B 2YN3A 3ARFB 1GCFA 2X9WA 4AT6A 4LQFL 4JPKH 3BQUD 4HULB 2R23A 4PJCE 1I1CA 3DRTB 1ORQB 1QBLH 4JN2B 3U4BH 1G9MC 3GSQB 1FFPB 4OZIB 3PWNB 4WO4A 5HI3C 3CFEA 1L7TH 2VXVL 3MSPA 3PL6B 2Q86A 1H8SA 3GK8L 3HRZA 3VCLB 3HG1D 1CXLA 4N0UE 5HDBE 1FN4B 5AG8A 5ALCL 4WVRA 5CP3H 3NFNA 4L8SB 1X5HA 5E4IA 5I73B 1YMHB 4OAWA 3FONB 3QO1A 1H8NA 2JIXA 4OV6F 2FWOB 4PR5B 4PJGB 5F89A 2OSLB 1N64H 4HCRA 4UQ3A 3ZKMC 4EUPH 3I6KA 1JE6A 1INQB 1HEZB 3DURB 3VXUB 2JE8A 3PP3K 3LKQA 1EK3A 5HYSA 3OJDA 1TJIH 1WBXA 2D0GA 5EOTB 3B9KD 4GKSB 5EBLB 3W82A 1HZHH 4N9OB 35C8H 4PGBA 1X5AA 3MRLB 3VFTA 2HTKD 2VDRH 1KB5L 4M7JH 5H37H 2R29L 2EO9A 2X09A 2YWZA 3OKNB 3RRQA 1KJMA 1EJOH 4HHAB 4OV5A 1U3HB 1FL6A 1CFVH 1QLRA 4EN3B 1YJDL 2BVQA 1VEOA 3QUYC 4JAMA 1R5WB 4KTEL 2X4SB 1UB6A 2CKBL 4FXGB 3RVXC 4Y4KB 2BRRL 1WUNT 2DQHH 3KPMA 5KSBA 4U6HA 2I5YL 1HXYB 3WIHL 1WBZB 4IRSC 4YDKH 3IDJB 3MACH 3S98A 3MFFA 1YECL 5KSBF 3QDMD 6CGTA 3ESVF 2JIXD 2X4NA 3QXDB 5ETUA 4FQXA 1JF1B 3DWTA 2IAMA 1BJ1J 4DAGH 3IS1X 1ZLVK 2R39A 2CDFB 4KI5E 1J88A 5FO9B 4HJJL 3D3VD 1QA9B 1XF3B 2C7UB 5IMLA 4LVOC 1CT8B 4FOMA 4MJ2A 4G6MH 1BJ8A 1WZMA 2XTJE 3NIFE 4OLYH 4QHNB 4GRMB 1ERNA 2HLAA 2MKWA 3TT3L 1WIPA 1RZGA 1MCIA 1HCVA 2B7DT 1HHHB 3LOWA 2P5WE 3D39E 3D85A 1ZA3B 5E6YA 3HTLX 1NGQL 3MLSH 1C08B 3BP5B 4DZBA 1B0RB 2J5LB 3PHOB 4LSPH 4KRNA 1HK6A 3O45B 5F7UA 3HC3L 5DRWB 2XN9E 2Z31D 2H41A 1RZIB 3FQNA 3Q6GH 1G9ML 4P5TB 5J6HB 3SCMD 1GGBH 1NFKA 5D2LF 1JPFA 3CFCL 1ULVA 4IOIA 3EYVB 3LIZH 1HI6B 3TPKA 1OP5K 2BVYA 3ARZA 1Q9OA 1OAZL 5FGSA 3NZ8B 4KKAC 3IJYA 3PG2A 3HNVL 2B39A 4Y4KD 3OX8A 4FQXC 1D5XA 2EICA 4NOFA 5FK9B 1WEJH 1NSNH 1PYWA 4K94C 1U8OA 4TQEL 3TV3L 3PIQB 4CJ0A 4DEPC 4A2MA 1LP9F 5AUMA 2HLFC 4PUBH 3UYRH 3GNML 3OB8A 4DKDC 4JDZB 4RBPH 5DD6B 3MLZH 1BREA 4Y19B 3BAEL 3HLAA 1NC2A 2IGFH 3DX6B 3PGFH 3MV01 2HFEA 1BQLL 3TZVC 3O8XB 4FQXD 2ZUQC 3QFJA 1K6QH 5DVMA 5A2JH 1DLHB 5HYJB 1A3LL 1UFUA 3WIFA 4DQOL 3KLHC 4LSTL 4NO0B 1EUTA 3GMRA 1W72A 2FJFA 1DUYA 4X6CA 1QHOA 4MVBD 2AXGB 4RAVA 5LCVH 4NKOB 5E6ID 3NTCH 1UKTA 4MA8L 3AMLA 1SVZA 1T3FA 2YD2A 4R3SA 2BSRB 1KJ3L 2W65B 3LD8B 4PRHD 3CU7A 4PJAB 2XTJC 2EXWC 5D9SA 4Z7UE 1MJ7H 4F57H 2VC2H 3AREB 1J5OL 1CE6B 1QQDB 2V2XB 4ZUTB 4YQXL 3QRFM 3RZCD 4XBEH 1ZLUK 1T7VA 1TZIA 3MRDA 1TETH 2VDKH 3G6AA 4XNQB 4WWID 3FAWA 4JLRB 2Q1EA 4MNQB 3VWJB 5E7BA 1XF2B 3KPNA 2BJMH 2YXFA 3SE9H 1T5XA 1CBVL 4LLMA 4JVWA 3ES6B 3OAYH 5DGQA 1R6VA 2DJUA 3UC0H 4WU7A 1KELL 4HBCH 5DQJA 2FJGA 1EH9A 1AC6A 1VEPA 1FJ1B 4CVZB 4QXUL 4ALAH 1QPPA 1A2YB 4FQCL 4LEOB 4PTTB 4LSVL 2WWMC 4FP8H 3LB6C 4XBGB 4FNLL 3WFCH 4QHKJ 3ZKMD 5HHQB 4P46A 4R96A 1CLOH 4ODVH 2ZZUT 2E5EA 5F93C 3GI9H 3KXFA 5GIRB 4KV5E 2Z35A 3GMMA 3PNWA 1HCFX 3WJLC 4F80A 3DYMA 2WLZA 3HNSH 3EDDA 2BVOA 3S6CA 4NZJA 4I0CC 1Q94A 3ZTJH 3MLUL 1FO0H 3AAZB 2CLVA 3MLTB 4ZO8A 4APQB 1IKNC 3TCXA 1QSZA 1MWAB 1CWVA 3VFGL 2X4PA 4GMSL 5F9WC 2F53B 4AL8H 4WGWB 4NRYA 4QHLB 2HJKA 5GRJH 5IB3A 4U1IB 2Y1VA 1I1RA 3O4LE 4LNVA 4XC3H 1T89A 4NQSA 5I16A 3PL6C 4LL9A 4MXVE 4OAWB 5DEFA 3TBTA 5E08L 3QIUC 1G7LA 1FLRL 1CGSL 3H9SA 2XZAL 1F45A 3QNYA 4GUPB 1N2RB 4XP1L 4Y4HA 3AS2A 3NH7H 2MTPA 3HAEG 4DOHE 3HPJA 3L1OL 1ORQA 4JB9L 1OAQL 1J05B 4WENB 2WWKT 1R5IB 1V3LA 4O2FA 4GXUM 3H3PH 1F3RB 5LWYH 3OKMB 3F58L 4UAOC 3B83A 3PL6A 1N6UA 3MRMA 5CJXC 2VTFA 1SYSB 2WAHA 2V2TB 1IE5A 2HFFA 1UM4L 4BSVA 3QDHA 4F8QA 1F90L 2AGJL 4PGZA 4KHXL 3P9LB 2RJMA 5F8RC 4DUXA 3FMGL 4K8RL 5IBTL 3UTSA 3X11B 5I0ZA 5DR5L 1HIML 4ZFOB 5AAWA 2EZ0C 3C5ZA 4J7RA 2VABB 1I1YB 4LAJH 3GSNB 3GUTB 1X4YA 4OCWL 4X8XA 3BGMB 3PWPD 5IV2B 5CGTA 3SE3C 2VDPL 1BFOA 1UQSA 3GO1H 4N8VB 4S2SB 4GSDH 5D7LB 1YEEL 2UWEE 2HVKB 3I3BA 3GSUA 4NNPH 1AGCB 2AV7B 2G2RB 4TSCL 1SJHA 2WBJA 3MUGB 3GSXB 1DUZB 3AUVA 2W60A 4K3DH 1WFOA 1G7PA 1H0DB 2DQEL 1H3TA 4Q9QH 1XF1A 3NCEB 3BKYL 5IM7B 5TE7L 4PB0H 4UTBL 4HD9A 5MHSE 3DVGA 5IK3B 3MRGB 4LVNC 1T1XB 3L5HA 4WEBH 1MNUL 1QSEE 1TNNA 4JAMB 4PJEF 3BH8B 5DA0B 1G6RL 1IGFL 3VMNA 3BO8B 4CJ1A 4P99A 4P5TD 5EA0L 1HHHA 2MPAL 3BMVA 4YPJA 1HINL 5EC2A 1RSFA 3OAUL 3LRGA 3RBSA 2DYPB 2BERA 2X4NB 1BEYH 4BFIA 1KN4H 3QCVL 4PJBA 4NBXB 1ZLUH 4FQHA 5B39G 4MCZB 2FZ3A 5SWZE 2CR6A 1D6VH 5E6IC 1S5IH 3LKPB 3GJEA 1AJ7L 2NXYC 2VR4A 1WZ1H 1RUML 4YX2L 1CT8A 2B2XH 3O4LD 3DUSB 4P5MB 5C07E 4V2BA 1FFQA 2Q87A 3RUGF 2PYFB 5FK9A 1HKLL 3WLBA 1HZHL 4NSKB 2KKQA 1ZVHA 5FUZH 1IM9D 1HQ4A 4CMHB 4U7MA 2H2PD 4OM0L 2OK0L 2BY0A 2OYPA 3AFLA 1RHFA 5MEQB 2MWCA 2ZG2A 1NC2B 4AEIL 1QSEB 4MAYD 2Q76B 4C4KT 3MJ8A 4J3OC 2UZIH 4PJAF 4P5TA 5GZOD 4ODUA 2Q8AH 4FFZL 4X9GA 1N6QL 1QUNA 1GYAA 2ADIA 4YDKL 2EE3A 2WLYA 4OD2A 5KVEL 4LGPB 2VZTA 3R1GL 4FFVC 4H88L 4NNYB 5H37G 2BRQA 5DQ9A 3BKJL 1BWWA 3ARBB 3KPSD 3FB5B 2GKIA 5F1IB 1FCCA 4L29B 1WWWX 4H8WC 5JNYA 5KW9H 3BRDA 4EXKA 3VA2C 1CVSC 1U8LB 1P2CA 2GSIA 3RGVB 4ZYKA 1BFSA 1MCDA 4C55A 1BVLB 5I18L 3ZE1F 1IGTB 5J9PB 1A9BA 1A6UL 4ODWA 3MUZ1 3SDYH 1KBGH 5GRWA 5FAAA 4IRJB 3HC4H 1NBQA 3MRKB 5I1DA 4Y5XC 4N8VG 4P2CG 5D2LB 3GKZA 2BHZA 5CBEB 3HC3H 5EDXA 1QSED 1OTSC 5JW4Q 4HSQA 3WO4C 4WFEE 1FNEA 2EDLA 5DJYA 5BRZA 1TVHA 3ZKXB 2B1HH 4PTTA 4HPYL 3RPIA 4KAQL 1KTDA 3OGOE 5E2VL 3RNQB 3U9UB 2BNUA 3L3IB 4BZ2H 3KR3H 2R1WA 4HS6A 3RI5K 3T0VA 5K9QI 2X44D 2FJHA 3LN4A 3RNKB 3RWEB 2E7LC 5TJWK 3T4YA 3DVFA 2PCPB 2R4RH 1VFAB 4TUJA 1WFUA 3FN0L 3LEVL 1I7ZB 2XWTA 2DQIL 1MWAA 2ITCA 1RJZB 3PQYE 3MNZB 2XWBA 4M61B 4JVUA 3BAEH 3O0RH 2YD7A 3MRNA 3PGFL 4W81A 4S1DC 4RMRA 5C07D 5J57B 1AGEA 4YO0A 4GG6F 2F53A 4KJYA 4ZS7L 3DMMC 5IOPB 3VFRA 2WINA 2HWZL 4XNUL 4PFEA 3CH1B 2F9BT 4OKVA 1KCUH 1LO3L 1J10A 4MLIA 5FYLH 3SGJA 3RVUC 4IRZH 5BVJA 1V3KA 5C2BL 3DGGA 3P73B 2VLKD 3U48A 4ODTL 4QO1A 3ZDXF 5BV7H 5I1KL 1G0XA 3VA6A 4QRPD 3BP6B 3M8OH 1S9WA 4P48A 1R5IA 4PRID 4YHNA 4WW2B 4HWEL 2MFNA 3FKUS 5LGJA 3PQYD 4DGYH 3SDXA 3STLB 1FFOB 4Y5VB 5J7CC 3HZKB 5ID0B 1S7SA 5ELIA 3GGWA 3MBED 4EUPB 2E27L 2AS5M 4ZQKB 5C0IA 4JFPA 1NDGA 3BP4A 4JGUA 3CFBA 1CDBA 4YDVA 1XIWC 3PWLB 1FFNA 2PXYB 2VLJB 5FKAB 2VAAB 3PP4L 3UYPA 3MLWL 5DJ0B 5CBAB 1LE5A 1ND0B 1UKQA 5F3BA 1MJ8L 1EEZA 3FQRA 4JFFE 4C54A 2X6MA 5DSCA 3ULVF 4GAYB 4HIHB 3RI5F 3WHE1 1ACYH 2CUIA 2APFA 5JZ7C 3RVWC 1NAMA 5C0BA 3P0YH 4S1QH 1KGCE 5GGSB 4TSBH 5ID1B 5T1MA 2FBJL 2G75A 1XH3A 1ZT4A 3H9HA 3EO0B 4FP8L 4I3RH 1AQKL 2UYLB 1J0ZA 4YDJB 3U82B 4GBXC 1L0QA 4XPAH 3LKSB 2E8YA 1UG9A 4HUWA 3X17A 3I3DA 5CP7A 2E9JA 4KPHL 3SKMB 2ITDB 4ZFOA 2CDGB 43C9A 2J6EH 3OKEA 3MGOB 4JHAL 4WI6A 3ROLA 1ETZA 3NCYS 4JFQB 4MNHB 5KVFH 3GUTA 2ATPA 5IVZB 5EUOB 1DFBL 3BO8A 1NEUA 3AU1B 1VFOA 3V2AR 1FZOA 1KJ2A 3C2AL 4ZXBC 3L9RA 4QOKE 4M62L 3RKDC 1BIIA 5GS0C 1G0DA 1MWAH 4Z78A 4HK3N 4R7NB 1P84K 4MD4B 3D0VA 4AT6B 5F7HA 3GSXA 4UZGA 2I60H 3QI9D 4EDXA 3L3OB 1WWCA 3S37L 4NJ9H 5FV1L 5JIKA 4UDUA 1EHLL 1BBJB 3GSQA 4OLEA 2DF3A 3C60D 1BGXH 3BZ4A 2FZ3B 2ZSVA 2AJVL 2GQHA 4ZFZA 1Q0XH 3LKPA 4PJCF 3RAJH 4XXCA 4MDIB 2YD1A 3QZWA 1JZ4A 5GS2H 1OARH 3MRGA 4HEPG 4ONFL 4RIRA 1G7HB 1XGRA 1NUFA 1FNSH 4KQ3H 2W38A 2I5YH 2VMFA 4G9FD 1HQ4B 5F6IB 4M5YL 2HTLC 4MCYA 3TA3B 3KPPA 5D7KD 2BDNL 1S9XA 1ZVSA 4P23A 2VDML 4R8WL 3T1FA 1T22A 3HFMH 3TNMA 4GBXA 1P4LA 4KROD 2NR6D 3LMJH 1IKFH 4NPYA 4WV1A 1BLNB 1CGUA 1YUHB 2DTML 4PJXA 2MHAA 2NPLX 3GO1L 3QJHA 3VXUA 4Z7VA 1BAFL 5I8KH 5HYSB 2HFTA 4I5BA 3TEUA 2ADIB 1A7RL 2ENSA 1PFCA 3TT3H 5FM5O 2YD9A 5BJTB 3FO9A 4BH7A 1UA6H 3V0VA 5BV7C 4O4YL 1JWSB 3F7YA 4BKLB 5GZNC 2D0HA 3BKML 4YXKH 4K7FA 2IH1A 5CZXC 3VXMD 3OKDB 5DRNA 4IDLA 4TNVF 4UNTA 3T0XA 3BKYH 5B3JF 3EDEA 5CUSH 2AABL 1IC5L 1QSEA 4UILL 3DMMA 2PYEE 5IHZA 4AIXA 1OSPH 3UZVB 4PRNB 3W5MA 4RRPG 3VRJA 1UACH 1MRCH 5SX5H 3D6GA 2R1YA 1X5XA 1KLGB 1Y18A 3MC0A 3SGJC 5I71C 3PDOA 1EVUA 1NL0H 1YZZA 4XI5C 3VW3L 3QCTH 1IC7L 3F6IA 4D0CA 3BDXA 4KRPB 3JWNC 1EO7A 2PR4L 4XCEB 2AEQL 3HMXL 2XKNA 1AO7A 1VPOL 2ZUXA 3C9NB 4HGWB 4PRIA 1L7IL 1RMFL 1QA9A 2NY2C 2C7UA 4MAUH 4HF5H 4WW2F 1TVHB 4QRPB 2OR8A 4J12A 3C2SA 3KYOA 4OIIH 3NA9L 3QNXB 1IAOB 3MA9L 4P2RE 2C26A 4JKPL 1P7KA 4E42B 3QHZH 4JFHE 4HQQH 5DK2A 1JL8A 5FOBB 2E7CA 3W9DB 5L2KE 2V2WA 4LSTH 1S9VB 4XWGH 4MXQC 12E8L 3W5NA 4J3SA 2EDXA 4P9HC 3D2UB 4XPGH 3ZE0E 1FO0B 1JUFA 5JMRA 3V52L 1PLGL 1KV3A 1U8KA 4MAYB 3FN9A 1CS6A 4HDIB 3WN5C 2DLTA 3AXLB 3NTCL 1RFDL 3SJVB 3MRKA 2EDJA 4AIZA 2XWTB 2OK0H 5BRZD 2AP2A 3UJIL 3BZEA 5CBEA 5GRUL 2FD6L 4DKAA 1AGEB 4YO0B 2CUMA 2D0FA 5FYLE 5LAXB 5CCKL 4TTDC 3EYVA 1HI6A 3CZJA 3HUJE 4PLJD 5EU7E 5F6HI 4RQQB 3TIEA 1AGBB 4U6YB 4WO4C 4TNVK 3ALPA 2VDKL 3QDJD 2IPUK 4MNQD 1ITCA 4J3TA 4MB5A 1BM3L 4NZTL 3RZCB 1S9WB 3ZHDA 2ZKHL 5DHXB 3ME0A 5JHDA 4TUJB 2FH8A 2HFEB 2M2DA 2X10A 4Z77A 1RJZA 5LQBL 1XGUB 3HZKA 2FL5A 5AZEL 4ZNEA 4RFOL 4L8CA 3WIFB 1FVEB 3QDMB 4QHKI 4IRJD 3T0DA 5DT1L 5FYKE 3TT1L 3VFRB 4KDWA 3JVGC 2A6DA 3CGTA 3L5JA 3T0EA 2ZWLT 3F12B 1VERA 4RAVB 3MYJB 5DVNA 5EU6E 3WYRA 3IDXH 1RZJL 3GHEH 3QEGL 3DX7B 2DM4A 5K9QG 4G6JL 4PJ7E 5C09A 4UINL 2HT3D 3K4AA 4NM8L 2Q7YB 3VFNB 3MRHB 1S7QA 1U8QB 4MHHI 5I74C 5CSZB 1T1WB 5I1IH 2W0PA 5ID1A 2YUWA 1E28B 2BMKB 4A6YH 1M05B 4Z6AT 2MMXA 3STLA 4PBWD 1JPGA 2DBJA 1K3IA 4MQSB 3WLWD 4H1LG 5ID0A 1KG0A 3BHBA 5ABDE 4XP6L 3G6AB 3VWKD 1CFBA 1XCTB 2J5LC 4NQED 1GHFL 1P7HL 2FO1A 4D0DB 5JOEA 3MV8E 1PY4A 4R9HA 2IF7A 4PBVC 4GAGH 3EFDH 3FB7A 2XQBL 5JTWA 1U8MB 3MV9D 5D7IE 2A6JB 1OCWL 2OBGA 2PTTA 1WBYA 2VLME 4V1DE 3GBLA 5D7JA 2ATPB 4JB9H 1Z9OA 3M07A 1RK1B 3MMEA 1ND0A 2VDQL 4I2XE 3VD3A 3S5LG 4M93B 4GAYA 4HIHA 4BQ8A 4LLDA 4ZUWB 1J7VR 4KUCF 1I8LA 3FT4A 2P42B 5CEZL 5DJ8B 3HE6A 1Q9LA 2YMXL 1CFSA 2HJLA 4WWKA 4DN4H 2G75B 3OQ3B 4JM2D 5A40E 5IW1A 1SEQH 2Y06L 1GJIA 2UYLA 5AZ2H 1SBBA 5D2NC 5INCA 5FYLL 3DRQA 2J1KA 5J13B 1LO5B 5KN5B 3P11L 2AEPL 1N7MH 1Q94B 3NACL 2YPVL 1FDLH 2AJUL 1D9KC 4XTRC 1NKOA 2DD8L 3OJMB 3TZVB 1E0OB 5I0DA 3I9GL 4FQ2H 4X6CF 4UV7H 4NQCA 4HIEB 2FH6A 4JO1L 5HJ3B 4YHLL 2H32H 2HJKB 4OGYH 1NBYB 4TSCH 3MRQA 1JGVH 4NKDA 3AY4A 3RPKA 3MRFA 4D9LL 4MA1B 5BZWB 4EOWL 4M6MH 1I3GL 4FHBD 1WV7T 1ROWA 5TGBA 2QQKH 1WAAE 4XCCL 1HXMB 5TQ0L 1QFWH 5SV4A 5I1GH 1AH1A 1I8LC 4UDUB 2GK2A 1D5BB 3KYKL 5TE7H 4MVBC 1NEZG 5MI0C 3W0WB 2GJJA 3H0TB 4PJFE 1I1AA 4OZGB 3B43A 1XFPA 3RUGB 3TBVA 4S1QL 3PWJB 3N0PB 2EEDA 3A6OA 1D9KA 3TYGL 5HHOE 2PUQT 4Y19E 2YPKA 3ZT6A 1CTNA 2B20A 1FVCA 1AQKH 5C0AB 1MJUL 3UTSB 5DZLA 2Z0BA 2FX9L 3E0GA 4K7FB 1W2KT 4WUKL 3PABB 1OGAE 2D03L 1MCKA 1KN4L 3JUZA 3I75A 3MLRL 4GG6E 2FECL 1UM5H 4EBQH 2P5EE 3G5VA 4JPWH 5CEXA 2F58H 5D7LA 4NPYB 1IM3B 2DQJL 1YUHA 4PJXB 4WHDA 2MHAB 5T5FL 5IQ7L 2IBGA 5H94B 3RWGA 1GIGL 2P46B 3QEQE 3VXNB 2DLHA 2OI9B 2VXUL 1GC1H 4NZRH 4D0CB 4LBEB 3HZYA 3IAPA 4J6RH 1Y6MR 2W60B 1HKLH 4M93C 3V6OC 5BJTA 4XCEA 4JFZH 1OSZB 2EC9T 4PJBE 5E5RB 3V0VB 3GSVB 4M6NH 4DGIL 5A43C 3O6LH 3KPQB 3FT2B 3OKKA 1BQHG 2DB8A 1FL5A 4OZFH 2B5IB 2QR0A 3ZSSA 5MEOA 4OLUL 3IDGB 1J0HA 5DF0A 3QNXA 5HHVL 3T77B 1ADQA 4X4ME 3QQ9D 5JIIA 4UI2A 5IFAH 3MODL 1I7UB 3EUUA 1KEML 4YHKH 1V5JA 2R1YB 1EO5A 2WW8A 4XVTL 2PNDA 3MZTA 4XC1L 4WU5B 5CILL 5EIIB 3GFUA 4G3YH 4LDLB 1WC7B 2GUOB 5DMGD 5F9AC 4BFIB 1I9IH 1QVOA 1YY8A 4MB3A 5D1XB 3HI5L 4PBXA 4UAOB 5E9DB 3QQ9C 3MV7D 1Z0NA 4MYWB 3EDFA 3OAZH 3OXRB 1T6VN 5DMKA 4JQXA 3VRLF 4HWZA 2GJ6A 1WAAF 3DUSA 1KC5H 1JHTB 1I7RB 5I18H 3FFCB 4AEHH 3C8DA 3V6OA 2H3NA 1MVFA 4KK8D 2NY4D 1TLKA 4NSKA 1UJ3C 4X5LA 5IBUG 1A5FH 1S9VA 5HI5C 2YPLE<