3GKZA

Crystal structures of a therapeutic single chain antibody in complex methamphetamine
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
242
structure length
233
Chain Sequence
EVQLQESGPSLVKPSQTLSLTCSVTGDSVTSGYWSWIRQFPGNKLDYMGYISYRGSTYYNPSLKSRISITRDTSKNQVYLQLKSVSSEDTATYYCSYFDSDDYAMEYWGQGTSVTVSSGGGGSQIVLTQSPAIMSASPGEKVTLTCSASSSVSSSHLYWYQQKPGSSPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAASYFCHQWSSFPFTFGSGTKLEIKRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords anti-methamphetamine single chain Fv
publication title Crystal structures of a therapeutic single chain antibody in complex with two drugs of abuse-Methamphetamine and 3,4-methylenedioxymethamphetamine.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 56
structure length 233
sequence length 242
ec nomenclature
pdb deposition date 2009-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gkzA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gkzA01
2DS4A 4JZNB 1FL5B 5ESVB 5JHLL 1BECA 3MLXH 4TTDD 1K8IA 5GGUB 2APTA 4HLZG 5IT2L 1QRKA 5KSBA 5FYKD 2BJML 3REWA 15C8H 1E4WL 5AYQA 4JY4B 4GXUN 3MBEA 5HVFB 3DARA 2J6EH 5DD1L 2HLAB 4KRPD 5DJ2A 1FYTA 1KXVC 3IB4A 4RWYH 1WIOA 4HV8B 4HX1B 3PWLA 3HB3C 3VWKD 3C09B 4FQ2H 3QHFL 4X8XA 5GS2D 2YXMA 1KJ2A 2VC2L 5KVGL 3BAEH 1DBKH 5I15L 1T3FA 1SMAA 3MROB 3O2DA 4IS6A 3QUXB 3VG9C 2VLMD 3MRJA 1BVKB 4MNQA 1LP9A 3ARXA 5DD6A 4CVZA 3HI6H 3QXDA 2D31A 3SDDB 5DQDL 4OZHF 4CW1A 4D0BB 4PFEA 3ULUE 1N8ZB 5LGHL 5E2WL 4Y5YB 3PNWA 1T1YA 1IGIL 4POYA 3VG0H 2Z8VC 1MJJA 1B6UA 3HMXL 3RI5F 2O5XL 1SJHB 1S7UA 5LQBH 1ZS8B 5DMGD 3H7LA 1FVDB 5L2KE 2JLLA 4LLUB 2KBGA 3JBG7 1EK3A 3UTPD 3LQAH 1R3IL 4XPGL 5DK0B 4UNTA 2F53D 3SE3A 5C09E 4YE4L 4X5WA 1VA9A 3U6RA 5CJBA 4RNRA 1RJZA 2CIIA 4PTTA 5D5ME 1X5XA 2Z8SA 1ITBB 5LG1A 3HC3H 4EI6B 2QJDA 4PJXF 4OV6F 1CFVL 3T1FA 4HEME 2XZCL 1XMWA 3CMOH 2P42B 4LQFL 1ZA3A 4Y2DD 3VH8A 1NAKL 5HI3C 2Z8WC 1N5AB 3SKUD 4XCEB 3WDJA 4OB5L 3PHOB 5K9OA 1AO7D 1N4XL 3FRPA 3GSUA 5I18L 5IEKB 4U6TA 5KN5A 4FHBD 1CGSL 3EHBC 4GG8A 3BSZH 1M7XA 2CKNA 1IGFL 5F7FA 3BEWB 1CVRA 4Y1AB 1MCCA 1GH7A 5F7YC 4BFIA 2P24B 1O5DT 3SKNB 2NW2A 1QLEH 2ZOKB 2FL5A 4OUUA 1T0MB 3OL2A 2I27N 3TWCH 2BY3A 4MD0A 2IAMD 4FQIL 5HY9A 3DVFA 5KVFL 2B5IB 4JPVL 1PW3A 4APQB 2Z91B 5T5NF 5GISL 1DVFB 4P4KD 5CSGA 4HUWB 2R4RL 4XPAL 3CFCH 4H8WH 3PGDA 3HA0A 4FP8L 3IFOA 4HIJA 4PJEF 1IM9D 4P23A 1PY4A 1T2QH 1UWEH 1UM6H 1YYLL 5KSBB 5T33L 1ACYL 2E6JA 3REWB 1KIQA 4OLUL 1CDHA 5L9DH 3TO2A 4WY7H 2MKWA 4TULH 3MBEB 3OAYK 1MFCH 3JTSA 5DVLA 5CJXC 5DJ2B 4XP9L 1NLDL 4OLWL 4DKDC 4YHPA 5ANME 1QFUH 1FE8L 5KVEH 2XTLA 2YA2A 4MD4A 4NNPH 1BLNA 1ZHBA 5FCUL 4ELMF 4WI3A 1KJ2B 1JI2A 1VGEL 3VMPA 3W0WE 1T3FB 1DLFH 4PIRF 4IS6B 3BH8A 1MFEH 1EMTL 3D69A 3MRJB 3QCUH 3H0TB 4A6YA 4MNQB 1LP9B 4KV5F 3CVHL 1PD6A 5DD6B 4B53A 5GSRA 4U1NA 5IMKA 3QXDB 4XVJH 4CVZB 4K71B 2D31B 5H94A 4CW1B 5C6TL 4HKZA 2WAHA 5JZ7D 3PNWB 4PJXE 4PV9A 4WI5A 3WNKA 4YXHH 4U3CA 1NCDH 2JK5A 2FO4A 1DJSA 1MJJB 3FQWB 4G43A 1S7UB 1TVDA 3T0EE 4RA0C 4WW1A 1IFHL 4ZYKA 2VWEE 4K07A 1OWWA 1AP2A 1L0YA 2EDKA 4OGYH 4GMSH 4AL8L 1FLRL 3GEWB 4X5WB 1CFNA 3U6RB 4RNRB 1RJZB 2CIIB 4PTTB 3RTQD 5HGGS 1VEOA 2XG4A 3MUGA 3SDAB 3CFDA 4ZUVA 3O6ML 1UB6A 4CMHB 2DLIA 3T1FB 4G9DA 3S35L 4YHZL 4D94A 2P47B 5C0DA 1NFDF 1ZA3B 5ICXA 3VH8B 1NAMH 2X89D 3MV8D 1IGYA 5DD0H 1ZANH 4X5XA 4Y4KC 4PJEE 4F8TA 5K9OB 5L8LB 3GSUB 2ZCLH 2AI0H 1CGTA 3IFLH 2UY7A 3LRHA 4GG8B 4P9HC 4JN1H 4HLJA 5F7LB 2IPUK 1A1OA 2UVEA 1WISA 4O02H 4BFIB 3RDTC 3WN5A 1QSEE 2NW2B 5C08B 3CXHJ 2FL5B 2OP4H 3C2AH 4OUUB 1FGVL 1G0YR 1IAIM 5TE7H 4NN7B 4HFUL 1BGXL 5BV7L 4MD0B 5HY9B 1OAXL 2ZNWA 2NR6C 5JLZB 3BSZL 3ULSA 4ELME 5DC4B 2W38A 3Q1SL 3JUZA 5I74B 1ZEAL 3PGDB 1IAOB 5JIKA 3IFOB 1Z9LA 4P23B 2VAAA 5F70A 1BZQK 5ACMA 1SM3L 4KV5E 3LEVL 1H3PL 5I30L 2AP2A 2WK2A 1KIQB 1PYWA 4JREC 4JHAH 3TO2B 5MEPA 1MRDH 2O5ZL 1KOAA 3JTSB 1A6ZA 4FQXD 4HS8H 4NZUH 3A6OA 1ITCA 4KJQD 4HUXB 4YHPB 1MFDH 4NIKB 3ETBF 5HHOE 3B83A 4MD4B 4HK3N 1BLNB 1ZHBB 4LOUC 1WWCA 4XTRC 3GGWA 1BQLL 4X9GA 1LDPL 1UJTA 3BH8B 2QR0A 2R69H 3D69B 2BSSA 4A6YB 2MQ0A 1NANH 2NTFA 3BHBA 5F88A 5T3ZH 2DD8H 2XQBH 4D8PB 1GGUA 2HMID 4R2GB 3MV11 5GSRB 4U1NB 5TE6L 2VLJA 5H94B 4YK4C 1XR9A 4MAUL 3P4MA 4YFEA 4HKZB 1NFKA 1DQQA 4QO1A 3U79A 4Q6YA 4TRPH 3LRGA 2I9TA 4PV9B 4EDXA 2NY2D 3NA9H 2K7QA 2A9NH 2FO4B 1NFDE 1TITA 3WHE0 1V7MH 5CUSL 5I1LA 1KG0B 1X6NA 4FZEH 2P5ED 2WIMA 4QRRE 4G43B 1YEKL 3VGFA 4QXGH 4FG6D 4FQHA 4WW1B 2BNQD 3U1SL 4ZYKB 1BOGB 4X7SH 5ILTH 3UJJH 2WBJC 4U1SA 2AJUH 4PTUA 1AP2B 4TN9A 4WGWB 4Z76A 5AD0A 1MVUA 2AJSH 3PV6A 1X5GA 3GRWA 3ZYOA 4ODVH 3ARUA 3OX8A 3MUGB 5HDOA 2XZZA 4R9HA 1Z6JT 3CFDB 4PJAF 4ZUVB 1UB6B 2MPAL 4N0RA 1YNLH 4PRBA 4G9DB 1VFOA 4XCCH 4AQOA 5C8JA 1S5HA 3QEQD 2FJGA 5C0DB 5ICXB 5C0JA 4LPTA 2OTWA 3TP4A 4LPCA 4QNPF 1IGYB 4CL7A 1A5FL 3INUL 4OT1L 1U8IA 4X5XB 3JV6A 3A0OA 1F13A 5JQ6H 4X7TA 2IAND 3D18A 1RIHL 5EBMA 3OAZH 3QUYD 3V6ZA 4JRYD 1NCBL 4YC2B 1FH5H 3WN5B 1DQDL 1C5DA 4UT6H 5DD3H 1A7QH 4K7PH 3AY4A 1MHPH 4YHYB 4IRJA 2HN7A 1HIMH 3EYQD 2G5BA 4JRXA 3U7WL 1YQVH 2ORBL 4FQPA 3RL1A 3ULSB 2ESVA 4EDWH 2ZJSL 1CTNA 3NPSB 3GFUA 4JFZH 4LCCC 4HIIA 1MH5A 3BRGC 2ZPKL 3PL6D 1IRAY 1B3JA 1ERNA 2VAAB 3HUJA 4OIIL 4QEGA 2XACC 1QNZL 4TUOA 2B1HH 2NPLX 2NTSP 2DOCA 3DIFA 5MEPB 1F4XL 1OW0A 4Q9BA 1A6ZB 4A2MA 4HF5L 4F2MA 1I3RA 4YHOH 1JP5A 4DN3H 4ODBD 4JFEB 4S1QL 4M61A 2FJHA 3V95A 3KYAA 1I8KA 3TN0C 3UTSE 4Z8FL 4KH2A 5C07D 3GGWB 4FQ1H 3OKKA 4I2XA 1MLBA 4PG2A 4Z7VF 4OGAC 3U30C 1EVUA 2QR0B 3RWIA 1P5UA 1FNAA 4N1HB 4C58B 2BSSB 3HZMA 2NTFB 5F88B 3BHBB 4RFOL 5D1QD 1XCTA 2NY1C 5DQ9A 1YEFH 3MACH 2VLJB 2D7MA 2JB5H 1KGCE 1XR9B 3SE8H 3B3IA 1DN2A 1DQQB 5DEZA 2I9TB 4OGXH 4OQTH 2I24N 3MRHA 4EDXB 2IG2H 1LVEA 3D3VE 1KB5A 5C0ND 2BOBA 5I1LB 2ARJA 4QNPE 3WXWH 4LSTL 3SE4A 4BELD 2E9WA 4FQHB 2YD9A 1X5AA 1I4FA 3RWCA 4TUJA 3JTTA 2IGFH 5TDPA 3FT2B 4U1SB 2DQJL 3I3EA 4MLSA 4PTUB 3ILQD 5CCKL 1RZ8B 4Z76B 5AD0B 1AGDA 4QRPA 1E6JH 5CILH 1MVUB 2EDHA 4R4FH 4XP5H 3V6OC 3WFEH 4LEOA 4PJIF 3PV6B 5FAAA 1NGYA 2CKBL 2W59A 3OX8B 1ZK9A 1DQJA 2PXYC 2CR6A 4RIRA 1LHZA 1NCAH 4PRBB 5BQ7A 1GHFL 4WTZG 3GSRA 4NCC1 4EIZC 5C8JB 5E7FA 1S5HB 2Q7NA 2FJGB 3G6JE 2GY5A 5C0JB 2OTWB 4KQ3L 4NWUH 5E4EC 3WSQH 1U8IB 3KJ6L 3PP3H 3JV6B 3OBAA 1YC7A 2VUOA 4XPHL 1JJUA 4J1UB 4LCYA 2QQNL 3L3OA 4DKEL 4X7TB 5E70A 5KSAC 4TTGA 3D18B 1UKSA 5AEAA 2AK4A 5EBMB 2Q6WA 4DVRH 4KDTA 4R4ND 3V6ZB 4OFPA 5T1MA 4AYFA 1C5DB 5TDOA 2HRPH 4UTBL 5HDBF 4EI5C 1HXYA 4ZAKA 2EH8H 2ATKA 4IRJB 2HN7B 3HCVA 5T5FL 2G5BB 4JRXB 1XGTA 1UACH 5EORH 4KFZC 2OMNA 5TGBA 3MSPA 4PRID 3P77A 4N9OB 2QLVB 1E0OB 3RL1B 1FQ9C 2ESVB 3ARQA 2QSQA 3QRGH 3TIEA 2UWEE 3DGCR 1CDGA 2CD0A 1OP9A 3HLAA 1FFRA 3KYMA 3WE6A 5IB3A 1D5BA 4HIIB 1QEWB 4DGYH 1MH5B 4O9HL 1UEYA 3HUJB 2WWKO 4TUOB 3PG2A 4K3HA 3CZFA 1TTGA 3K2UH 3DIFB 4HG4J 4Q9QL 3GNMH 5FHAL 4V1DE 3LZFL 4F2MB 1I3RB 3CH8A 5A2JH 1WK0A 1U3HD 1BFTA 3IDMA 4M61B 2FJHB 4N0UA 1LO4L 4DQOL 3UYRL 1I8KB 2MOVA 2D7TL 3JV5A 4H88L 4POUB 2FATL 4JFFA 2RIKA 4OSUL 3DRTA 3OKKB 4I2XB 1MLBB 3KPMA 2AEWA 1BJMA 4P2QD 3V7AE 1EVTC 3RWIB 2F5BH 3KJ4B 1ZVHA 7CGTA 3EYUL 4PJIE 1U91A 4LAQH 25C8H 5I6XC 1XCTB 5DQ9B 3OKOA 2IQAA 3FB7A 3B3IB 4FXKA 4P2OD 5F71A 3S36L 5GGVH 1QZ1A 3MRHB 1FIGH 1FLTX 3MQIA 1CTOA 1S7WA 4LHUG 1KB5B 1HYRC 1Z0MA 2BOBB 2IADB 4KMQA 5DMIH 1UXSA 4NSKA 2Q3AA 4CRPA 4QRTA 2KL6A 4LEXL 3A6CH 3MRMB 1I4FB 4ZTOH 3R8BB 1DEDA 4TUJB 1EHLL 3JTTB 5TDPB 3PWUA 4JY5L 2J5LC 3RZWA 3ULUC 5CBEA 5A2LH 5J7CC 4X6DE 4UUJA 1B4RA 3MUHL 1AGDB 5ITBH 1MCBA 4QRPB 1B0WA 1G9ML 3LKRA 4LEOB 1NGYB 2OS7A 5HDBE 1DQJB 3B2UD 5HI4C 4XP4L 1CFSA 4HQQL 3TBWA 5BQ7B 3GSRB 2WIIA 4IRSC 2VUYA 2NQCA 3CXDL 1EBPA 4F8QA 4KHXH 4LCYB 3L3OB 5IW3A 5JW4R 3DV6A 4FTVE 2AK4B 2XOTA 4OTXL 3N0PB 2OZ4H 1F90H 2Q6WB 2FX8H 1V7NL 4R7DB 5D7LD 2ZG3A 2EEBA 5T1MB 1UCBL 5TDOB 4NJ9L 3I3DA 1HXYB 4ZAKB 3RVUC 4WI4A 2ATKB 3HCVB 1D9KD 1XGTB 1WITA 2B0SL 4J6RH 5TGBB 3BP4A 3H3KA 1TZIB 3P77B 1YJDH 5C0CA 4G6MH 2XY2A 4JKPL 3HG1D 3TIEB 3O3DA 5HDLA 5I1CH 3HLAB 3KYMB 3QNXA 3WE6B 5IB3B 4Z7OF 5D72L 4XXDA 3FAXA 2IWGA 4JM4L 4U2YA 4J3TA 35C8L 4DOHE 4WGVB 3FO2A 5SWQA 3CZFB 1UEMA 2VDNH 2H1PL 4D3CH 2GK2A 1EX0A 4KK5D 3ZKXC 5B21A 3V5KA 4OCYL 3BKJH 3KPSA 5D1ZC 3I50L 5HYJD 2YPLE 4JFYA 3IDMB 4C56D 4N0UB 3HC4H 2FX7L 1MAJA 1FSKB 4BSJA 3C5ZD 4I3RL 2NXYD 4N90D 4JFFB 2Z31D 3DRTB 1MIML 1I8LC 3KPMB 1WEJL 4P5TD 3M17B 3UZQA 4P46C 1LO0H 4OZIA 5CBAA 1U91B 3L3GA 1LO3H 3OKOB 5CEZH 1FGNL 5CP7A 2IQAB 3FB7B 2P4AB 2BVYA 1TTUA 3VW3H 4FXKB 4GAGL 3S97C 2XPGA 1DFBL 4ZPTA 5T1LD 4RAVA 3DYPA 3LPFA 1T2XA 3X13A 4Z7UA 3NH7L 5SWZD 1UXSB 4NSKB 3GBNL 4QRTB 5EULV 1YEDA 4EN3C 5C7XH 5ICYA 4Y19A 5EZOH 5A43C 5E08H 3PWUB 1JNLL 5CBEB 4XB8A 2JJTA 2XQYG 4UUJB 5CJ8A 1MJ7L 1XF2A 1JGEA 3LKRB 4OFYD 3NN8A 4EEEA 2J4WL 2LU4A 4W4NA 1AD9B 2H26A 4G5ZL 3T0EC 1CFSB 3TBWB 5I76A 2VWEC 3R8QA 4GMTL 1FFOB 2ERJC 2WIIB 4MHHI 3TYFA 1NGPH 1UG9A 2VXUL 2Z93B 3S37L 4U3XA 2AK1L 3D2UA 1A3LH 4DN4H 4XVTL 3HE7B 2M1KA 4Z7OE 1IGJB 1QSFB 1CFQA 2IH1A 4M1CD 4X6CA 3DV6B 3NCMA 4G6FB 4NOBA 2AABH 3SGDI 4L3EA 3K8KA 5JPMA 2GQHA 4JPWL 1YEJL 3PHSA 1BFSA 3CX5K 2M26A 4QHNA 3V6FA 1KIPB 4J4PD 3WFCH 1A7OH 4ZUUA 2O5YH 2H3NA 1IQWL 4XP6H 4RGNE 3B2VL 4OD3L 3BP4B 3QEGL 3SJVD 4X98A 3F58H 3QAZC 5C0CB 2WWKT 5E99H 4IIQA 1B0RA 3MNVA 2EDRA 3O3DB 1Z2KA 1MFBH 3QNXB 3NCFB 5CJXA 1GPOL 2OL3A 4XXDB 3KS0J 1KBGL 2HJKA 4CBPA 1NEZG 2PW2A 1ZKAA 4C4KO 3P0YH 3ULVL 3FO2B 4JQIH 5SWQB 2CRMA 4K7PY 4ONGL 2FB4L 1DQML 1MCKA 3FMGL 4J23A 4ERSH 4Z77A 3V5KB 5J06A 3KPSB 4N0YH 4GRWH 1AJ7H 4FQQA 4J12A 4EVNA 1JRHI 3RZCA 2J7LA 4JFYB 4AMKH 3JV4A 4WHTA 5DK3A 3VXUA 1NKOA 2R2CA 3DUHA 5FM4A 4LU5H 5EWIH 3P4NB 2VDOL 2LV4A 1MAMH 3UTTE 3RUGF 4OBSA 2OJZL 1LO2H 4HPOL 4NZDA 1YY9D 5ACLA 5CBAB 3L3GB 4LIQH 4I9WD 1NMAL 1M7IA 5CP7B 2EDTA 3R0NA 3DJ9A 4XNXL 1QLRA 4NWTH 2WP3O 1JWUA 5C0BE 1FBIL 3O81A 2XPGB 4W70A 4ZPTB 4RAVB 1E4JA 3X13B 4Z7UB 2EDYA 4NRZA 3VXRD 3WEXA 3KPPA 1PAMA 1YEDB 4RFEA 3A6BH 1OD9A 5ICYB 4Y19B 2ATPA 2ZNXA 1DDHB 5DYOB 3U4AA 1MFAL 4J3OC 4WFGD 1K2DB 5AZEH 1HILA 3TYGH 1JGEB 1XF2B 3SE9H 2HG5A 3AS3A 4TNVK 1P7QD 4M9OA 1EFXA 1NKRA 4Y4KA 1JPFA 1DLHA 4E41E 1IT9L 1AGEA 6CGTA 5I76B 4K3JH 2Y36L 3TYFB 1OAKL 5L6YH 1J1PL 4P3CL 5DVKA 5D8JH 1DQLH 2XFXA 1VACA 1A6TA 3F6IA 3RDTA 3D2UB 3ALWA 5JPNA 4Y7MA 5GRXG 3MV7A 3OJVC 3UMTA 2IH1B 3D39A 4X6CB 5EC1A 2R29L 5FEBA 4GQ9L 1OP5H 4M5ZL 4WTXA 2SEBA 4L3EB 4R90H 3MYJA 5JPMB 1H3UA 1Z5LA 2EECA 4QHNB 4UV7L 3RVVD 2JJWA 3O2WH 3V6FB 3ULVF 5BMFL 4NQCD 1MJ8H 2EKJA 2NY5C 1CBVH 3WXVH 5E9DE 2C3GA 2H3NB 2NY3C 4N1CA 4QOKD 1T7ZA 3BGMA 4WWKC 5DGRA 3W5NA 3ZL4L 4S11A 4Z18A 5F1SA 4X98B 4IIQB 1UA6L 5D7JA 1B0RB 3QIWD 3MNVB 4G8GE 1KELL 4HDIB 5EU6D 4LSQH 2OL3B 5TF1H 1A6VH 4BJLA 5JXAH 4WEMB 2HJKB 3RUGE 3LMJL 5D93C 1PY9A 2PW2B 2EH7L 2YOCA 5IB5A 1HKLL 4G8EA 5DR5H 5HPMA 1MI5E 4IJ3C 4O00A 3FB8A 3RA7H 4Z77B 4G8FA 3RX5A 3LHPH 3OXSA 4FQQB 4HC1A 5F7KC 4OCSH 3RZCB 4JZJC 4L8BA 1CE1L 2Z8RA 3U9UB 3JV4B 4TVPL 4WHTB 3VXUB 1YPZF 2YZ1A 4AENA 3DETD 5ID1A 3QRFM 1NJ9A 1G7HA 2EO9A 3JWDH 2WUBH 2W0LA 4BZ1H 2XRAL 4YHIA 4OKVA 4WVRA 4AEHH 5J3HD 5H2BA 1CDBA 2VLRA 4OCLC 4LHUD 2VE6A 1KXQE 3TBYA 1CLCA 1QFWM 3ARWA 3U36A 5K9QG 2Y06H 1M7IB 5FUZH 5TPWL 4TOYH 4GSDL 3O2VL 4M3KB 1QLRB 4IDJH 2Q8AL 1J1OH 1JWUB 1WV7T 2WBJA 1V3JA 1OTTD 3S3JA 3PGCA 3V0WL 4ALAH 3AS0A 2GSIB 4C59B 2IAMC 4URTB 5TQ0H 1J5OH 3WEXB 2I9LA 4GBXD 4N8VG 3KPPB 3RBSA 1WZ1L 2LTQC 3C5SA 3VXNB 4RFEB 4JM2F 2VDLH 2ATPB 4YQXL 5B8CA 1D5ZA 5MEND 2AJYH 1QYGH 1JHTA 1U2HA 3LEYH 1HILB 1VESA 4YEFA 2J3SA 2NY7H 2HG5B 4NZJA 5CJOH 3RAJH 3ULVE 1EFXB 5GGVY 3T08A 4PGBA 4MS8C 4LAJH 3TCXA 4Y4KB 1JPFB 1DLHB 1AGEB 1FRGL 1KJ2H 2XZQL 3MNZA 3MRLA 4B0MM 2WM0A 1ZTXH 2QADB 2XFXB 4PRPE 1VACB 1A6TB 3RDTB 5T1KB 3O9WA 5JPNB 3R1GH 2IPTH 3MV7B 1KFAL 1SHMA 3D39B 2JELL 5EC1B 5DD5H 5GGTL 1ZV5A 1LEGA 3MYJB 1S9KC 4UBDC 1Z5LB 3ARTA 3ZKSD 4P2YA 3C6LD 2VKXA 2LQRA 3L3KA 1MRCH 1KEGL 5C0AB 1CR9L 4R0LA 4PJ5D 3RHWF 3M07A 1MQ8A 2VRAA 1QACA 3BGMB 1CLZL 1CXEA 1A3QA 1YPZE 4KROD 5T1DH 3LKNA 2YWYA 3K4DA 2W0PA 5D7JB 3O6KH 3TBVA 2QTEA 1INEL 4TPRL 1M05A 4MAYA 3BOVA 4JKMA 3B9KC 3B4NA 1MJ8L 2R1WA 3VFVA 4LSVL 2AEQH 2JCCF 3TN0A 4G8EB 5HPMB 1GL4B 4AIXA 3FB8B 3OF6A 2E9BA 4HG4K 4KC3B 3OXSB 1A4KB 4R8WH 4WUKL 2HLFD 4Y16C 4L8BB 2ICWJ 4WFED 1H5BC 1UZ8A 2BVQB 4YUEH 3C60A 3V4VH 3U7YH 4DGIH 3QQ9C 4AENB 5ID1B 1NJ9B 2NXZD 3H9HA 1G7HB 1PKQE 5IHUH 1RULH 4YK4B 1F97A 2WNGA 4YHIB 3QFJE 2OBGA 3QUMH 4OKVB 3RNQA 2QL1A 2VLRB 4U6YA 2VE6B 4BQ6A 3O6LH 1I7TB 4UZGA 3O6FA 3I2CH 2W9EH 4DEPC 2KH2B 3QP3A 2HFGL 1FAIL 1CWVA 2RBLA 2X9WA 2D7QA 3ARED 3PGCB 4ZUWA 1CXHA 4J3XA 5SX4H 1CZ8L 4CADA 5LGKA 4CVUA 3U4EA 3MR9A 3V6OA 4LPVA 2V5SA 2I9LB 3BESR 5JHDE 5EFIA 4XH2A 3HFML 3G9AB 2C1OA 2XN9D 3C5SB 4Z9KB 4P2CG 2PXYA 1OARL 2F8OA 3X3FL 5B8CB 1D5ZB 5FUZL 5IM7A 2E8ZA 1JHTB 1SJEA 3O4OC 1CIUA 4XWGH 3N1GC 3WO4B 5DZNA 4LRIC 1BFVL 1AHWC 4RDQF 3FN0L 1IEHA 1XGYH 4PGBB 4JQVA 5KSAA 3HE6D 2EDBA 4PJGF 3MNZB 3BE1L 3MRLB 5IB1A 2DIAA 3LPWA 1CE6A 4TVPE 3O9WB 1A7NH 1UH4A 3OGCB 3QDJA 1WWBX 1U8NA 4I3SH 3V2AR 3QULA 3JXAA 1JMXA 2CUHA 4UNUA 5FUCE 2JCCE 2VZUA 3T65A 3TPKA 5CWSA 1MCPL 4WV1C 3T8XA 2Y6SC 3O2DL 1DQTA 2HMIC 5A3ID 4IHOA 1JRHL 3L3KB 2IALB 4R0LB 1BZ9A 5J6GB 2LU7A 5KAQG 3LKNB 1D5IL 1KB9K 3TBVB 2DQCL 1M05B 2XYCA 3KXFE 1GC1H 4MAYB 3S88H 4N8PA 1W0WA 4AG4H 2R1WB 4XPTH 5HHME 5T3XH 3VFVB 2EXYD 3ALPA 2VXSH 1AIFA 1JL8A 3TN0B 3PWPD 1RZFL 5AAMA 1ZSDA 1F6AA 2YZ8A 3OPZL 1EIBA 3ISWA 4OZFH 3TO4A 1U8JA 1AQDA 4XC3H 1UZ8B 3QIUD 3C60B 2RCSH 5DLMH 2DQGH 3HAEB 2JKXA 3H9HB 4HWEL 3EOBA 4HXBH 2D03H 5SWSD 5EUOA 4NFCA 5GJSH 3RNQB 4U6VH 2E27L 3WBDA 1JZ8A 3JSSA 4U6YB 3Q0HA 1U92B 4GKNB 1ZT4A 3T3MF 3O6FB 3GMPA 2ADJA 3VXSE 1ADQA 5J13C 2DL2A 4PLKC 4TYUA 4NKQB 4DUWA 1YEIH 1ES0A 4O2FA 3S4SG 3VD7A 4PJGE 1KTLA 3NOIA 3BVNA 4EOWH 3TPUA 4CADB 5KSBF 3WS3A 5GS0L 3MR9B 4LGPB 5MP6H 5EFIB 4XH2B 5HHVH 2FHFA 2C1OB 3K46A 4I1NB 5EU5A 4WTWA 2PXYB 3T0AA 5HVHB 4NNYA 4UQ2A 4ZOBA 3FO9B 1WTLA 4P5MA 5IM7B 4OAWA 3VA2C 1SJEB 3PL6C 4IRSA 5ABDE 7FABL 5LCVL 2B7DT 4HJ0D 1Q0XL 2GIYA 4KTEL 5DC9B 5GGQH 5C09A 3TJHD 4PS4L 1OT2A 2FLRT 2EZ0C 5A16A 3UPRA 4R7NA 1C16A 3LRSA 4G6AD 1LMKA 5IB1B 1LP9F 1YEEH 5JO5A 3V79C 1CE6B 3UROR 1IBGL 2XG5A 4NJAL 5CKAA 3DSFH 3OMZA 4MDIA 3N9GH 3MJGX 2EO1A 4MWFA 4H20H 1I9IH 2ZWLT 3QDJB 1U8NB 5CZVH 3FB5A 3QULB 4CU7A 1CK0H 3T65B 5C86A 1NSNH 5CWSB 1GGYA 2HT3D 5JQHC 1CLOH 2J8UF 3L7FA 3QBTB 5D1QC 1XGQA 2YPKA 3U0WL 4ZOEA 4IHOB 1Q1JH 4M7JH 2ZCKL 4A6YL 3BJ91 2BK8A 1XIWC 2VXTH 1BZ9B 4NO0A 2CLRA 3NZHH 5CP3H 2YPVH 4Y1AE 3OG4B 1Q0YH 1OGAD 3QHZL 1A0QH 1I7ZB 3TH4T 1J1XH 4DGVH 1HHIA 3JWOL 2X4PA 2W60B 2VDKL 1P2CA 4KAQH 4UT9H 5FKPB 3T3ME 3VXOA 1AIFB 5F8QC 4X4ME 1W0VA 4XCNA 1F6AB 4M02A 4Y2OA 1Q9LA 1I8LA 5DSCB 2R0WL 2AJXH 2EIEA 3TO4B 4NZRH 1A6AA 1U8JB 1AQDB 3NFPA 1G6RA 4WEUD 5KSBE 2X1PA 5CEYA 1KCSH 1KC5H 5T3ZD 3P4LA 1BIIA 2GY7B 4Q9CA 1LQSR 4YDVA 1KJMA 5EUOB 1G9MC 3ZDZF 3ARPA 2BC4A 1NMCC 2WLYA 5DJ6A 2B4CL 3W0WA 3KPOA 3WS6C 5DQJA 1ZT4B 5FA4A 5D4QA 3RY6A 4P2RA 5FYJL 5I1HL 5DI8B 5IKCA 5HYSG 1PSKH 4S1RL 1MCIA 3THMH 2LVCA 4O2FB 4XXCC 5FGCB 2PR4L 5I1JL 1KTLB 4H1LH 4PUBL 3BVNB 5GHWL 4KHTH 1LP9E 3TPUB 3UPAA 2W0KA 5GS1C 5EOCH 4PJXA 3WS3B 2H32H 2X1XR 4HGWA 1A6WL 1TQBC 4XCYA 4ZOAA 4M9PA 2HKFH 5EU5B 4LSDA 1FNLA 1YA5A 4NNYB 4UQ2B 4WFEE 4P5MB 1MCLA 4NHCH 1KPRA 2D4FA 4JFHE 2DDQH 3B9DA 2E7MA 4IRSB 2FBJL 2J8UE 4M43L 5I1AA 2BX5A 1L7TH 1AKJA 3WKMH 5JIPA 4YXKL 1JNJA 4ETYA 3FAWA 1RZJL 3NIDF 3KR3H 1EAPA 3MLPA 3IAQA 5AWNH 5A16B 4JHWH 4R7NB 1C16B 1Y6NR 3LRSB 1MSPA 5JXED 2OR9H 4P3DA 4RX4D 3H3PH 4I0KA 3WFDH 4PLNC 3NA4A 5JOPD 3E6FA 4KZDL 2YA0A 3O45A 4TSBL 4MDIB 5KJRH 4MWFB 4XPBL 4OI7A 5INCA 3FB5B 5IK3A 1OCWH 1QHOA 2Q86B 1WZMA 3ZDYF 1JZ2A 1U8PB 1F4HA 4U33A 3L7FB 4LP5A 1XGQB 2YPKB 4K3DL 4AEIL 2H8PA 3AAZA 1QSEA 2YMXH 3P4OA 5IB4A 4PREA 4NN5C 1ND0A 1MREH 2CLRB 1IKFL 2XI9A 1XFPA 4RFNB 1I9RH 1BAFL 5C08E 1EO5A 3RIAK 1KTRL 1HHIB 3OAUL 3V52L 3ZDZE 1CLYH 2X4PB 4ZO6A 5DUBA 2IH3A 3MA9L 4NGHH 2JE8A 2KKQA 5EOQL 3K1KC 4UV4H 2HT4D 4WWID 3BI9X 2VLLA 4PBVC 1W0VB 1DR9A 4PLJC 2X9XA 4DZ8A 2XA3A 4XGZA 1Q9LB 3NTCL 4FXLA 3B2UC 3NFPB 3JZ7A 1G6RB 3S34L 1DZBA 3EYOA 5CEYB 3IGAA 2PW1A 2VDMH 3DXAE 3GRWL 5E8EA 1KPVA 5I75B 4UOW0 1K3IA 4BZ2L 3FQRA 4R4BA 1KJMB 4NBZB 5FB8A 2OR7A 3MBXL 2BC4B 5DJ6B 3RGHA 3MA7A 1VDGA 5JMRA 3KPOB 5DQJB 2ZCHL 5FA4B 5I9QC 2ZKHH 4R97B 2ICWA 4P2RB 1RUKH 1UH3A 1CGUA 3NIDE 5IKCB 1K6QH 3AB0C 3QR2A 3L5WA 3FQTA 5FECA 2OI9B 4QXWA 5I8EA 3OB0K 3TZVC 4JPKL 4PJXB 5F1IA 1CYGA 3W2DL 2W07A 4HGWB 1NFDA 4XCYB 3UYPA 1HHKA 2VDRH 1XH3B 1GSMA 4F7MA 1RVFL 4OLVL 5GIRA 3WO3B 2WLZA 4BUGA 3U0TA 3ELAT 1KPRB 1OLZA 1WIPA 3ZDYE 3OV6A 1OAZH 2CUIA 4PBWD 1IGCL 4KJWC 5I1AB 3P0VH 1NCNA 1EPFA 4YDIH 1AKJB 2OXGA 3MOAL 3GMQA 1R5IA 1SJVA 4K55A 3KWWA 2VZTA 1ZLSL 2GFBA 4RDQG 3WFBL 4P3DB 4K9EL 3N06B 4LLAA 4C55A 4S0TD 3O45B 1UM4H 1A7BA 4I77H 2J8HA 3ULVC 5INCB 2AJVL 5EU7E 1BBDL 5TF0A 4DVBA 1RJLA 4JVUA 5IK3B 4BKLA 1ZLVH 4WWKA 1WFOA 3ZSTA 1FORH 3MRKA 3CFJA 2CMRH 4G8IA 5E5MA 5LXGL 4JPIA 4KKLD 4PP2A 4PV8B 3TBSA 4MSWB 1KEML 4KU1A 1YMMD 1TIUA 2H8PB 5FYJE 3AAZB 2VZ1A 1QSEB 3CVHA 3EDFA 3P4OB 1QPXA 2VXQL 5IB4B 4PREB 4JFPB 5L0QC 2G60H 4ODHH 3GI8L 3NFSH 3WLBA 2F5AH 1J0YA 4KKNA 5DJZA 4I48A 2F53A 3O0RH 1DBBL 3NZ8A 5MI0C 1KB5L 5ACZA 2OTPA 5DUBB 3SDCC 2AXJA 4P48A 2IH3B 1B0GA 3GO1L 5JW5A 3K2MC 2VLLB 1J8HD 3UAJD 4DZ8B 4XWOC 4Y2DA 4XGZB 3SEPA 2YK1H 3F5WA 4S1DC 5DHVB 1UT9A 1HH6A 4YXLL 4O58H 3T0WA 1AO7A 3IJSA 3EYOB 1YEGL 1DCLA 3KPLA 2PW1B 3GHBH 4G3YL 5B38A 4X80L 2DTSA 5ECJE 5E8EB 1KPVB 4Q74A 1QLFA 2ED8A 3FQRB 4MHHG 4KUZL 1QR4A 5D70L 2OTUA 4QTIH 1SBSH 5FB8B 4JFEE 4X0KA 4XBEH 2GJ6D 3WNNA 5HVWA 2ZSWA 3MA7B 3M8OH 1A14H 4E5XA 3GM8A 4Z0BL 1JGLL 2IAMA 4Q7DA 4X99A 1T1XA 2ICWB 5DMKA 5ALBH 5DJCA 2IPKA 1UYWH 3UO1H 1S3KH 4WO4D 3L5WB 2YHGA 3FQTB 4JM2C 3S98A 4UAOC 5FECB 2A1WL 2AJZA 1WCQA 4CGTA 3HUJF 4MX7A 4X7CC 3ZE0F 5I8EB 3RGVD 1IM9A 5E8DH 4ONFL 3LD8C 5F1IB 1V3LA 1NCWH 2AGJH 2VLJE 1LEKA 1KN2H 4NO2A 1HHKB 3T2NL 5KW9L 3LKQA 4F7MB 5GIRB 2N56A 3OJDA 3VGEA 3MXWL 4GXVL 2P7TA 4K3EL 3V4UL 1C1EL 2A9ML 1X9QA 5T3ZE 2P49B 1EH9A 2AV7A 3ARGC 1RMFL 3B9EA 4JO2L 4PRDA 3P9MA 3R4DA 2KDGA 4QF1A 3GMQB 1R5IB 2DWEA 3QA3A 4ZSOE 3KWWB 3QFDB 2CDFA 2GFBB 5LBSH 2B1AL 3BIAX 1F42A 1NL0L 1IKNC 1H3TA 3FFCD 4OJFL 1TZGL 4G6JL 1INDH 1P4BL 4D9RE 1WBXA 3NAAL 3RJQB 3MV9D 4Q9RH 3G6JA 4LSSL 4N8CL 2MCPL 4OLXH 3NFNA 1H8SA 1BQSA 2CLVA 3D0LA 4FZ8L 5J11C 2A83A 2X41A 4DVBB 1RJLB 4BKLB 3CFJB 4LLWA 5E5MB 3TV3H 4HHAA 4PJFF 1JPSH 4JPIB 3TBSB 3NVQA 5HDQL 4KPHH 4EJ1C 1GGTA 2CRIA 1Q38A 5E6IC 2P5WD 4HT1H 5FUCC 4OCRH 4ODTH 3KLHC 3QXAB 5DJZB 4I48B 4NOFA 2F53B 3SQBA 2XKUA 5C0EA 3CSGA 3GJFH 1NGQL 2FECL 5ACZB 3RTQA 2UWEA 3GKWL 2VABA 4JRXE 4Y16A 2UZIH 3PDOA 1B0GB 1H5BA 1P6AB 3RY5A 5JW5B 5C3TA 3DURA 2ESVE 3KVQA 1OTSD 1QVOA 4Y2DB 3RVWD 2X89A 3MV8A 1TTFA 3VH8G 1T22B 3F5WB 3X12A 5DWUH 1HH6B 3HUJE 3MLWH 3ZE0E 2NY0D 5I17A 1QQDA 1AO7B 3IJSB 3KPLB 1MCRA 1IGMH 1TLKA 5B38B 1DEEA 3MXVH 5KVMC 4WFHE 1NQBA 3QDMD 4RMWA 1RFDL 5CEZD 5D1XC 5IFHH 4UDTA 1QLFB 2GHWB 4H0HB 3QDHA 2OTUB 5F7MC 1T7WA 3HI1A 2EC9T 4UINL 4XC1L 2ZSWB 1CF8L 1DUYB 1JHLL 3EIFA 5I8CA 4E5XB 2DBLL 2IAMB 4X99B 1J18A 1OQXA 1T1XB 2AAVA 3BP5B 3I3BA 5DMKB 5DJCB 2IPKB 4ZS7H 4I2XE 1DSFL 5ADPL 3GSQA 3BRFA 4P59L 3BMWA 3RKPA 5IFAL 1SEQL 2AJZB 4MX7B 3IDUA 3LS5L 1IM9B 4F9LC 5LKNA 3U0PA 2PO6D 1PVHA 4LRIA 1LEKB 4NO2B 3HC0A 3U48A 1MELA 2K1MA 3LB6C 1IC5H 3LKQB 5HHXH 4M5YH 4DAGL 3OJDB 1PEZA 4G42A 4FQXA 5GRVL 1OSPL 1IAII 2P7TB 1UWGL 5BZWA 3QUXC 5KTEH 2AV7B 4JG1H 4PJFE 3VE0B 4WJ5A 4PRDB 3MLVH 3P9MB 4U2ZA 3SBWC 4X6DA 4PB0H 4QF1B 5LGJB 3U9PH 2DWEB 2Z35A 3QA3B 5CIPH 4ENEC 1GOFA 4Y0GA 3SDDC 3V6BR 4D9LH 5EIIA 1HNGA 2CDFB 3DX9A 1KACB 5IHBA 5IIEA 1R5VA 4Y5YC 3CFKA 2X42A 5HI5D 1N7ML 4QRPE 1A6PA 1ZHLA 1WBXB 3MLTA 4MVBC 5TJWK 1G9EA 1U2CA 2VXVH 3P30L 3G6JB 4ZD3H 3NFNB 3D0LB 3DHJA 4K8RL 2A83B 1OAUL 5J3HC 2WUCH 3VFUA 2Q87A 4HHAB 2YRZA 3EFDL 1F2XK 2CDEB 5CZXC 5DUPL 5IF0A 4ODSH 4YHLH 4OF6A 4ZQKA 1QG3A 3UBXA 3ZT6A 2BNQA 2AK4E 2R56L 1S78C 5GRJL 4AM0B 2XWBA 1U3YA 4JKKA 4MCYA 1P5VA 3QCTH 2L4OA 2XA8H 2CLZA 4XX1G 5C0EB 4GBXC 3KYNB 3NCJH 1F02I 2FEEL 3RTQB 2UWEB 4E42A 2VABB 1VPOH 4Y16B 3ARFD 3N1PC 4MB5A 3X3GL 5FV2A 1H5BB 2V2WA 3DV4A 5AG9A 1HEZA 3TVMD 4P9HH 4JO3L 1IC4L 3QEQA 1A7RH 1QVOB 3MV8B 1XAUA 3X12B 1FN4B 1EGJA 4OZFG 1HQ4A 4H0GA 5I17B 3O3EA 3GK8H 1MWAA 1DEEB 2OX5A 3CIQA 1XCQA 3QUYA 1X4XA 2B5IC 4JRYA 4IRZL 4APQC 4DEPB 4UDTB 2X4OB 3G6DL 3UP1A 3UDWC 1DVFC 3HI1B 5EU3A 2V5RA 3D6GA 3ZE2E 1L9NA 4FQLH 3H3BC 4CDGC 5I8CB 1KENH 3GBMH 3SDYL 1ZOXA 1RU9L 4UB0L 3GSQB 2VDQH 3MBEC 5B22A 3NABL 3BQUC 1BIHA 1N3NA 4JR9L 1UXWB 2PYED 4XMPH 2DQEL 3PL6A 3K74B 2R8SL 3U0PB 1RUPH 2CPCA 3SOBH 5IVXA 1U8KB 2C4FU 3RKDC 1HYSD 4G42B 4FQXB 2EXWD 5DVNA 3UJIH 5BZWB 4LSRL 1B2WH 4Q0XH 4K2UL 4PJCA 4WJ5B 2MTPA 2OL3L 2DIBA 3BDYL 4X6DB 3CU7A 4EZMA 3HZVA 5C07A 2Z35B 4K71C 2APFA 2C3VA 5EIIB 4X8JA 5IIEB 1M4KA 1R5VB 4E0RB 2VH5H 3CFKB 2XICA 5TDNA 4MJID 3ZHKA 4HH9A 1ZHLB 3MLTB 5D1QA 1JNNL 3BMVA 3EJJX 5JR1H 4YDKL 2DMBA 3PIQA 2MFNA 3WJLA 4CU8A 1FC1A 1DBML 4Z7UF 2NY2B 4I5BA 3VFUB 1TNNA 1PG7H 4Z6AT 1U95A 2JB6A 4HSQA 1B6DA 5AZ2H 1CIDA 3KYKH 4XBPB 1G7QA 1QSFE 4ZQKB 4U6HA 3PQYD 2BNQB 3SDAC 3D9AL 2XWBB 5DHYA 4KI5D 4CMHC 1BEYH 4NQTA 4MCYB 1R6VA 4L4TD 3M1BA 4HW6A 2CLZB 1W72H 2FBOJ 3IFNL 1C5BL 5FA3A 4X9BA 4E42B 4F7TA 3FFCE 4V2CB 5CMAB 2V2WB 3QEHA 5C0CE 3IKKA 3DV4B 4MA8H 1HEZB 2APWA 3CPLA 2VR9A 3REVA 3QEQB 2NMSA 4JFOB 4TNWF 3MGTA 1ZGLA 1MCQA 1TETL 3NIFF 1HOCB 5GS0C 3V8CA 5K9JH 4YHNA 1HQ4B 3QXUA 3DX7A 3O3EB 3BZ4B 4NN7C 5C0RL 1MWAB 4KJPD 1Q94A 2HFTA 3WS6A 1T80A 1XCQB 3QUYB 1Z9OA 4AK1A 4JRYB 5J13B 1VFAA 3IDGA 1FVCA 4QRQA 5IW1A 4KK8C 1F58L 1PJ9A 3EOYG 2YXFA 5EU3B 2JF1A 4PB9L 1ULVA 3UTTA 5EB9A 2HYMA 4OFKA 2J88H 3D0VA 2EE9A 5I66A 2XKNA 3IVKA 2V2XA 4RRPG 1XZ0A 4XNUH 3NCEB 1TZHA 5A3IC 4LLYA 1N3NB 1Y18A 4H8WC 3ZTNH 5I8OL 2H2PD 3D1MC 4H1LG 3VD5A 2CIKA 3PL6B 1Z3GH 2DQDL 5C0BA 1FYTD 1I8IA 2RB8A 3NCYS 4OF8A 4RQQA 5ALCL 5FCSH 2Y23A 5IVXB 1ORQB 4Y4FD 5D96B 2YUVA 4KQ4L 1BVZA 5E2UL 3EOTH 5KS9A 3K8MA 4QTHA 3LDBC 2BOCA 1S9YA 2Q20A 2MKLC 4YWGL 1IEAA 4Z7UE 4PP1C 2ICES 4YBQD 1WWAX 1I9JH 2EIDA 4N0CD 4PJCB 1B4JL 1EEYA 3NACH 4MA7L 1CL7I 3HZVB 4MNQD 4R2GC 5C07B 2QHRH 3QYCA 2ZUYA 4Y19E 4G9FD 3BPNC 1DANT 2C3VB 3IXTA 1BD2D 4X8JB 1AI1H 1PLGH 4D9QE 4P2QA 1EZVY 3ZT5A 3RVXD 1NMBH 4HH9B 3JWOC 3QIUC 4F37F 5GGRA 5ADOL 5D1QB 4HC1L 3HZYA 3H6JA 4JDVA 5E95B 1IE5A 1JN6A 1MCOL 1V3KA 1JMZA 3PIQB 4TVSa 4MXQC 2YSSA 4I5BB 3BKCL 1U95B 3ARDD 3AC0A 1DBJH 2WZPD 4XNMA 2MWCA 1G7QB 3NIFE 2QQKL 4U6HB 4M1GL 2HTKC 1U36A 2GK0A 4JG0L 5DHYB 5EU7C 3TJEL 5F9AC 1RIUL 4O5LL 3KGRA 4JEGB 1AXTH 2R2BA 2YD1A 4XPFL 4IOFD 3M1BB 5E8PA 2B4CC 3DVIA 4QHKJ 3MLZL 3AMKA 5F9OH 3VWJD 4F7TB 3TESA 2DKMA 4JCLA 3AM8A 1RURL 1S7SB 3QEHB 3RUGA 4KY1L 1EBAA 3VFPA 3REVB 4KKCD 5LWYH 4YC2C 4HJ0C 5F6IB 1YNKL 3MGTB 3WN5C 1ZGLB 5I1IL 2APXA 1JCKA 1HHJA 3RRQA 4YHNB 3DX7B 2NZ9C 2VB5A 1RQ5A 4ELKA 3S8WA 2RAMA 1T66D 2FHBA 3GSNA 1CXLA 3QIBC 5D7LA 5TQ2L 1VFAB 3O8XD 3IDGB 5LAXA 1FVCB 4QRQB 1JZ4A 5IW1B 2HVJA 1CICD 1IAIL 3NPSC 3MLYH 4ZTPL 5F7DA 4XP1H 4GS7C 5GZOD 1AQKH 4GXUM 3HNVH 3VXUE 3UTTB 5KVDH 1MCDA 1D9KA 1RZJC 4BH8A 3D0VB 3MRNA 4P23D 1BHGA 5TE4H 5HYEA 5I66B 4PRIB 4JGJA 5BVJA 1XZ0B 2DQUL 3BD5A 3DLQR 1TZHB 3HG1A 4XVUC 3S7GA 4LLYB 4JJ5A 5FYLH 1Y18B 4YDJA 1XF1A 1YECL 1UB5B 5DGQA 4RAUA 2CIKB 4DKFL 2J12B 2EEAA 3QPXH 1I8IB 4QXUH 4RQQB 1KJ3H 3I9GL 3L95B 4M7KH 1GAFH 4L9DA 5KS9B 5HYJA 4QTHB 3EO1A 4KXZI 2BOCB 1S9YB 1IEAB 1D5XA 3OSKA 3RU8H 1IC7L 4R96A 1ZLWK 3VFTA 1EEYB 1F4YH 4M62L 5BZDA 3KS0H 3C5ZA 4FFYH 3KPRD 4NM8L 3IXTB 3VRJA 1RZKL 3VXMD 2Z31A 1J05A 4P2QB 4G7YL 1EEUA 2AS5M 1BOYA 1RIVH 2PTVA 5GGRB 3HZYB 3KDMA 2R9HC 1V8HA 5F1KC 2EDXA 2BCKA 4JDVB 5DEGA 5GSVA 2E7HA 5CINH 1JN6B 5IVOA 3W39A 4BSWB 3ZHLA 4S2SB 1S5IH 3W82A 2YSSB 5T1LA 1MCWW 3ULUH 3KAAA 3C8DA 1U9KA 4PJ9D 5SWZA 4XNMB 4NFBA 2XZAH 1UH2A 2XTJD 3D39E 4UDUA 5C2BH 1DL7H 3SDCA 3KNBA 2GK0B 4X7DC 5T3XD 3GI9H 4CN6A 2VERN 3BJLA 3WIHA 4IOIA 2R2BB 3OTTA 5HYFA 5IQ7H 2JIXA 1YPZA 2PUQT 4OFYA 5C0AE 2YA1A 4PJDA 2BY0A 3I6GA 4S1SL 1UQSA 2Y5EA 3PHQB 1FO0B 3DTXA 4KJYA 2BP3A 3VFPB 4KGJA 5CLWA 4EBQL 4LKCA 3N50A 2A2QT 3L1OH 3L5XH 5JW3H 1JYXA 4UILL 4KVCL 1HHJB 1KCRL 1CL7H 3F7QA 3AY4C 4WHDA 5FOBB 4X4ZA 4IRJC 4ELKB 2ICWI 5I9QB 3GSNB 4L3CA 1P53A 4DW2L 5DA4A 5D7LB 1ZMYA 1YYMH 5LAXB 1BQHG 4OF0A 2HVJB 1TQCB 4DTGH 5J0BA 1MEXL 2IMMA 4J4PA 3AB0B 1PKQA 1CG9A 5F7DB 4JM2A 3RIFK 3QFJA 1D9KB 3A67H 3P11H 3PGFL 4BH8B 3MRNB 1JGDB 5BVJB 2BDNH 3BX7C 1OAYL 1QBML 3JV0A 2FGWL 3HG1B 3X14A 3QUZD 4K9EC 1NLBH 2DQIL 4JJ5B 1KCVL 2VLRE 3L5IA 4RAUB 5TFSL 4O4YL 2WANA 5HGBA 1S7TA 1BFOA 2YBRA 1IILE 3QB7C 2I60L 5JTWA 2X1WL 3S3SA 3B8SA 5HYJB 1KCUL 4ZFGL 3EO1B 3QG7L 1D5XB 3V4PH 4TUKL 2I26N 4R96B 1G6RH 1S9XB 3KJ4C 3VFTB 2YD8A 4AJ0A 5BZDB 3C5ZB 1Q9WA 2FGZA 4HCRA 1OP3K 3VRJB 3HKFA 2Z31B 4X4XA 1NCCL 1J05B 4WEBH 2ADGA 4TSAH 5DO2D 4P5TB 3V0AC 4MXWH 2EYSA 3FN9A 1A7PH 3RVTC 1LD9A 2FD6L 1KULA 3KDMB 1UM5H 3SE4C 5CJQH 2BCKB 3LS4L 5MHSD 3RWFA 5DEGB 3ILPA 2FX9H 4Z78B 5D71L 5GSVB 3W39B 4I0PD 5I19H 1FP5A 3VGBA 3GMLA 3T77A 4R26L 5EIQA 3PP4L 5T1LB 3LH2H 4PGDB 1E4XL 3BH9A 4OM0H 4UIKH 5SWZB 4NCC2 3VXRA 4AT6B 4M1DH 5JW4N 2QQLH 2QSCL 4F9PC 1TJHH 3SDCB 3KNBB 4IMLA 4HXAH 1ADQL 2E9JA 4ZXBC 2UUDH 4WTZA 3U4BL 3E8UH 4IOIB 4KMTL 4HK0A 4XRCB 1AXIB 1MVFA 2JIXB 3FZUD 2IJ0C 3ZKMD 3PXJA 1P7QA 4PJDB 5JHLH 3I6GB 3FJTA 4L4VE 4RMRA 3KPTA 5HYQB 1UQSB 5IT2H 2OCFD 1OAQL 3LEXA 3KXFA 1KLUA 2BJMH 1AR1C 3Q6GL 4M7LL 3DTXB 4KJYB 1E4WH 3Q6FA 4KDTC 4JJHA 5DD1H 5JA9A 2HWZL 5JDSA 4ONHA 5IEHA 4ZAKC 2QHLA 2X4SA 1BM3L 3VRIA 2XIDA 1T1WA 3QHFH 4L3CB 2W9DL 2VC2H 3QCVL 3RNKA 5I15H 4JY4A 4P99A 1WCBB 5CGMA 3KLSA 1CG9B 4OIAA 4JM2B 3QSKB 5DJ8A 4QOKA 3GZKA 5DS8A 4LLQA 1CXKA 3KG5A 5DQDH 3BUYA 2A6KA 3F6LA 1C8PA 5LGHH 3IF1A 5E2WH 3QDGE 1CN4A 2GI7A 2IQ9L 3VXSA 1M7DA 1I75A 2NNAA 4ODUA 3ZKNC 1IGIH 1IQDA 3B9VA 3HMXH 2O5XH 5HGBB 5FHBL 4PJGA 3QUKA 4LGRB 1FSKC 4GH7B 3FQXA 1S7TB 3ESVF 3Q5YA 2YBRB 4Y5XA 5I0DA 3OGOE 5D2LA 5F7WC 3CU1A 1N8ZA 1R3IH 4XPGH 4WCYL 3CNKA 4YE4H 3OJ2C 2X09A 1PBYA 1LE9A 4X6BA 1I1RA 2ED9A 1Q9WB 1U8HA 5EUOF 4X4XB 1CFVH 4LP4A 4PJ8D 2XZCH 4LQFH 1QRND 2ADGB 4ONOA 1D6EB 3DMMD 1ZGLP 1NAKH 2EYSB 4LHUA 4K23L 2E3VA 5F7EL 1JF1A 1LD9B 1JGUL 4OB5H 3DO7B 1N4XH 3RWFB 3ILPB 5I18H 1CGSH 1IGFH 3GIZL 5FDYA 3GMLB 3T77B 4HMEA 2F54D 2BFVL 1QOKA 3MUZ1 4BFBD 3BH9B 5KOVC 3VXRB 3SGJA 4GBXA 3QDJE 3DX8B 4FQIH 4KKAC 2ITDB 4Z95L 4IMLB 4JPVH 5MENA 2FX9L 2P48B 1JE6A 5GISH 4HK0B 5IBTL 1I1AD 4FMFA 1E4KA 2R4RH 4XPAH 1G84A 4JO4L 4GLRI 2WWMD 2P24A 1P7QB 4WI8A 1JYNA 3HE7C 1T2JA 4FP8H 4WFFE 1S7XA 1YYLH 3LEXB 3KXFB 3LKPA 5T33H 3BZEA 1D6VL 4B7IA 1ACYH 3VGDA 3G08A 2IEPA 4OLUH 3Q6FB 3L5JA 4NQSA 2ZUXA 1MHEA 2YRPA 4X4MA 3QWOA 4XP9H 5GRUL 1NLDH 4OLWH 4JO1L 3UDWA 4LFHG 4BQCA 4NKOA 3GHEL 4ONHB 3VMOA 5IEHB 4TSCL 3IFPA 3WJJC 2X4SB 4EXKA 1FE8H 3VRIB 1X5LA 1H0DA 2HT2C 1T1WB 1LE5A 5FCUH 3EO9L 2FEDD 4CN4A 2ZZUT 1MJUL 1VGEH 3RNKB 3HNTL 2R0LL 3C6LA 3BQUA 1EMTH 3TEUA 3CVHH 5DJ8B 1NDGB 3G5XA 4QOKB 5DS8B 4OLYL 4ZS6C 2NX5D 4LLQB 1OPGL 3OR7A 3BUYB 4XAKE 5C6TH 2A6KB 3LQZA 3IF1B 3MRBA 5FGSA 3ZMRA 3EYSL 1G6VK 5EUOE 3VXSB 1M7DB 2VJXA 2NNAB 4ODUB 4PY8J 5FK9A 4KZEL 1IQDB 4PGCA 4HEPG 3WYRA 1OGTA 4PJGB 5BOZG 3H0TA 5CSBA 3QUKB 4OIBA 1HHGA 1U93A 4K8RC 2JTDA 3FQXB 1IFHH 4QXTA 4Y5XB 3T0DA 2MQ3A 2OK0L 5D2LB 5FGCE 1L6XA 3RIAF 4JFFD 2O26U 3HPJA 4JKWA 1ZHKA 4AL8H 1FLRH 4WI7A 4PY7A 4MJ6A 3O4LD 1OTSC 2J8UA 3FQWA 4X6BB 1LE9B 4NQED 3EJZD 3H9SD 2FRGP 1TXKA 1U8HB 3O6MH 1R3HA 4LSUL 3ARZA 3S35H 4YHZH 4M48L 3RWGA 3W11D 5K33A 2NY0C 4LHUB 1JF1B 3QJFA 3CLFL 1WTGT 4KKBC 3UBXI 4RGOL 2FH8A 2NY4D 1NBQA 3SDAA 3VDAA 2ZUQB 4KVNH 1NBZA 3AREA 2HP4A 2JJTC 2D0FA 5I73B 5F7NC 3RP1A 2R0KL 4WU5A 1YEHL 4IDLA 1FGVH 1GZQA 4GBXB 12E8L 4JB9H 4HFUH 1BGXH 5BV7H 2DQHL 2V5MA 1OAXH 4P0DA 5L8JB 5MENB 4J3SA 3WHXB 3CJJA 4EQ2A 5CD5D 5J8OA 1QBBA 3Q1SH 3EO0A 1ZEAH 4X6FA 5ESQA 1RSFA 5C08A 1S7XB 2HTLD 5FYKL 1SM3H 3LKPB 3LEVH 3BZEB 2H2SD 1H3PH 5I30H 5DFTA 4HBCL 3G08B 4YFLI 1P4IL 1IEBA 1XGUA 1QUNA 5JLZA 4NQSB 4HIXL 2O5ZH 3ZYZA 2FWOA 1MHEB 3QWOB 4LASL 2ADFL 4OFDA 4NKOB 3F7PC 3QI9D 3IFPB 1FCCA 2HA1A 1IAOA 2VIRA 3HMWL 4K7PX 1H0DB 4XNYL 1AGCB 4L29B 1LE5B 1BQLH 3DXAA 1LDPH 4IIQC 5HVGB 3DGGA 4JDTL 4X9FA 3C6LB 3BQUB 3NIGF 4L5FL 5HD8C 4PJ5B 1LK3L 3G5XB 4HUXA 5DMJB 5TE6H 2HH0L 2NY5L 3OR7B 4KROB 2CDGA 1OQOA 4MAUH 3LQZB 3WFHA 3HB3D 3MRBB 1F8TL 4KK9C 1HI6A 5FK9B 3ET9F 3KPSD 3RZCC 5CUSH 4PGCB 3LCYA 1Q9KA 5BS0E 1OGTB 1YEKH 5AYUL 2C3HA 4P2RE 3CK0H 1HHGB 1U93B 4D8PA 3ARVA 3PWPA 4QXTB 3U1SH 5I1KL 3SGKA 1G1YA 1MNUL 2PN5A 3EKCA 1GYAA 3HPJB 3ARFC 3IDXL 3I6LD 4F58H 1ZHKB 5L7XL 3RFZC 4JRWA 1YMHA 2W0FA 3QIUA 3EYVA 5KZCD 3V8OA 4M00A 1KG0A 4PY7B 4MJ6B 2J8UB 2P46B 4H25A 2NXZB 2MPAH 1R3HB 4P57A 5JDJA 1BOGA 2DRUA 2XQYK 3EJYC 3RWGB 2A74B 3MTRA 3WNLA 3VD3A 1A5FH 3INUH 4PBXA 1FL6A 3QJFB 1E28A 4OT1H 4KUCD 5HTSA 1ZVYA 4ZUTA 4CVXB 5DRWB 1RIHH 2OLDA 9CGTA 4AH2A 2R2HB 3WFZA 2LAAA 1EV2E 1JPTL 1NBZB 1NCBH 3AREB 2VR5A 1DQDH 4OZGA 4WU5B 3VXQB 1OY3B 1RUAL 1VSCA 3MUY1 1GZQB 2V17L 5HI3D 4UTAL 5BVPL 3U7WH 4GRMA 5GZNC 2ORBH 2ZJSH 1OTUC 3EHBD 4KVNL 1W8NA 4MQXD 2FIKA 3CX5J 2QADC 1NAMA 2DN7A 3EGSB 3EO0B 4X6FB 5ID0A 5ESQB 5ISZE 4OD1L 1VFMA 2ZPKH 3NIGE 4UNVA 2DYPD 4HK3J 4OIIH 1UADC 1QNZH 1N2RA 2EXWC 4JB9L 3BP7A 1IEBB 1XGUB 4PJHF 1F4XH 3QIBA 4L3ED 2FWOB 4LPYA 1FCGA 1FJ1A 4HF5H 2YD6A 4S1QH 4YX2L 5DFVC 5IBLC 2VIRB 4Z8FH 2F74A 2BHYA 1IGTA 5A2IH 1T7XA 3R06A 2CRYA 5DK2A 3DXAB 4NN6B 5D7JC 4LARL 1FNGA 2VL4A 3DGGB 1HSBB 4WI2A 4JFQA 4RFOH 3HPLA 4JFEA 3BO8A 2CGRL 3CVIL 2IBZY 4YGAB 2CDGB 2R0ZL 1H9VA 3CSYA 3WFHB 3QXWA 2FIRT 1MFNA 1X7QA 4NBXB 1HI6B 3MLSL 1J88A 1N6UA 1QPPA 3LDBB 4FQJL 4NZTL 1Q9KB 4LSTH 4OCWL 3CH1A 3H8NA 3PWPB 1E6OL 4BUHA 1N5YL 2DLEA 5IMMA 3F7RA 3BPNB 2DQJH 5I1GL 1QKZL 5CCKH 2DIJA 2BSTA 1QBLL 5FYKE 4LVEA 1YMHB 2W0FB 3QIUB 4N1EA 1MWAH 2CKBH 3EYVB 2LABA 3BIKA 3SKMA 3TA3C 5DZOA 3U7AA 4H25B 2DTML 1X4ZA 3CK0L 3SQOL 5C6WH 4P57B 1GHFH 4ZSOA 5SWSB 3FT2A 3PWJA 2XWTA 3SGEI 1QFWL 4BQ9A 4KQ3H 1RZ8A 2AXHA 1FL6B 1E28B 4F58L 3KJ6H 3TF7C 4N8VA 4Q6IA 4XPHH 2QQNH 5ESAB 4QLRA 4ZUTB 4DKEH 1NBVL 4AH2B 4OF7A 5B8CC 4PR5A 4F57L 2VLME 5DHXB 4X5LA 4OZGB 4PJHE 3Q5OA 5E2TL 3WO4C 4UTBH 4M6NL 1C7TA 3OKYA 2MQCA 5T5FH 1NGXA 4GRMB 4J1UA 4Y4KD 5H35A 5FUOL 3SN6N 4NKIL 43C9A 4F7PA 2FIKB 2VN7A 1L0XA 2FH6A 1NAMB 1HCFX 3F8UB 5ID0B 4LFHD 4O9HH 3O9WC 5E4IA 4P3WA 2D2OA 4U7KA 2VN4A 3DBXA 4XMLL 3UTPE 1N2RB 5FDWA 3BP7B 1I3UA 5JXEA 4FFWC 4Q9QH 2F53E 2A0LC 1K9TA 4RX4A 5FHAH 1FPTL 3LZFH 2NR6D 3QIBB 1FJ1B 3G6JF 5L88L 3H2WA 2A77L 2R4SL 5HGHA 3CLEL 4R0LC 1LO4H 1QEWA 4DQOH 4GS7B 3UYRH 3RJDA 2F58L 2F74B 1IGTB 1B9ZA 2D7TH 1J8KA 2Y72A 4H88H 2FATH 3R06B 2NY6C 5DK2B 2VTFA 4HGKC 4OSUH 4FFVC 2X5PA 1AFVL 1FNGB 5GJTL 4E9LA 4MAYC 5HXMA 1AO7E 2YRLA 2PNDA 4OM1L 5F1OB 3RWEA 4JFQB 3EYUH 4P9ML 4ZPVA 3HPLB 3BO8B 3ES6A 1RZKC 5E8OA 4U1JB 1TCMA 2B2XL 3CSYB 5HHQA 3ARDC 4HUNB 1X7QB 3S36H 1T04A 2UWEF 4XTRD 4YHML 4C57C 4GKOA 1F6FB 1N0XL 5D2NA 1JVKA 4FMKA 1KV3A 3IAGC 3ZSSA 5I1EL 4LEXH 1Y6MR 3TFKC 3CH1B 1LDSA 3R0MA 3C60C 1JIBA 4WU7A 4M93B 5IMMB 1T03L 1EHLH 4JY5H 1OM3L 3SCMC 5F9WB 2BSTB 1G9MH 2IADA 3BIKB 3SKMB 3O6FC 4PJFA 4CNIA 1NCUA 4XP4H 3MRMA 4HQQH 3WIFA 2R39A 3MX0A 4ZSOB 1QHPA 4MMZC 4M8QA 2O93L 4OQTA 2ICEA 3PWJB 2XWTB 3U2SA 2WBJD 3CXDH 3MO1A 3BZFB 2M8XA 4NQDD 5E2VL 1EGJL 2AQ1A 4JFDD 4N8VB 4Q6IB 5JOFA 1MWAL 1GOGA 3I84A 4F9PA 1HZHL 4OTXH 2M2DA 2VAJA 3LIZL 5HVHC 4YBHA 3EOAA 3TBTA 4PR5B 1V7NH 4ZXBA 5DXWA 3T1WA 2FDBP 4HMDA 2EE2A 1UCBH 5C0FA 2F15A 4NJ9H 4NDMA 5M94B 5MEOA 5BJTA 4L8DA 5GGSA 4L1DA 4HZLA 4LNRA 2OSLA 1JTPA 1NGXB 4JQVC 4TQEL 2B0SH 3OAZK 1YQ2A 5H35B 2AQ2A 4HWUA 4WRLA 3FO1A 4JKPH 43C9B 3K7UA 3WDIA 4F7PB 4X6DF 2K3TA 1HNFA 4R7DA 1C12A 4QYOA 2Q7YA 4OLZL 5D72H 4JM4H 1GGBL 3IXAA 5FYJU 3DBXB 35C8H 2VLKD 3MRPB 4HMCA 2D7NA 5FDWB 3GBLA 4CUCA 2H1PH 2PYFB 3ZYJA 5IVNA 1TZIA 3MZTA 4MZ3A 4QKXB 4MGXA 1OVZA 1SVCP 4OCYH 3PDDA 3I50H 1YN6A 3WUWG 2X1OA 4RBPH 1CS6A 2EDDA 5HGHB 2YKLL 4LLDA 4M6OL 3P3YA 5T5NG 2W65A 1IL1A 2FX7H 1A3RL 4CVWA 4I3RH 4K94L 3K0WA 4XZUA 3T3PF 3L9RA 1MIMH 3BZDA 3MV8E 1WEJH 1FFQA 3MCLL 1UJ3C 5HHPA 2G75A 3KHOA 3RWEB 3H7BA 4ZPVB 4BK4A 1C5CL 3ES6B 1FGNH 1IM3A 5E8OB 1FG2A 3VI3F 3ZKQD 3DI3B 4ZMAT 2CUMA 2YC1A 5HHQB 4PJ9C 4GAGH 4FNLL 5IESL 1T04B 3BN9C 1DFBH 4S10A 2CXGA 3TO4C 1R0AL 3NH7H 1X3DA 4HD9A 5D2NB 3M17A 3GBNH 4OGAD 4RZCA 4WU7B 2N7BA 5A40E 5KG9A 1KCKA 1J8HA 2NY1D 2D9CA 1JNLH 1QFPA 1RZGA 1NC2D 3BPOC 1MJ7H 3IRPX 1BX2A 5ITFA 2IFFL 3MPCA 3PWVA 4YFLF 2J4WH 4DWHA 4BSVA 4PJFB 4CNIB 4G5ZH 1A21A 4RISL 1TJIL 2VZSA 3DVGA 3WIFB 4GMTH 3WLWC 6FABL 4WUUD 5EZIL 3KPQA 2CK2A 3S4SA 1MIEL 4M8QB 4X7EC 2ICEB 2A38A 2GJ6A 2VXUH 1WAAF 3S37H 3U2SB 2AK1H 3MO1B 4XVTH 4NNXA 3HRPA 3D25A 4HZAA 2B20A 2DF3A 5JOFB 1TPXB 4F15B 2BNRD 2F8VA 1XF4B 1AD9A 1L9MA 3OQ3B 3EOAB 3TBTB 3BT2L 4ZXBB 4JPWH 1YEJH 2VSCA 3LY6A 4XAWL 1FFOA 3RGVA 4EUPH 3S5LA 5C0FB 1YNTA 1WIUA 5IVXF 2Z93A 4NDMB 5MEOB 5BJTB 1N6QL 3PP3K 1LEIA 4L8DB 5GGSB 4HZLB 3HE7A 4LNRB 5KBNC 2OSLB 5D7SL 1IQWH 1IGJA 1QSFA 1EUUA 3B2VH 4OD3H 3QEGH 5E8NA 1WWWX 5F96L 3FO0L 3T3PE 5CGYD 3FO1B 4PJCF 5KSAD 2P5EE 3W5MA 1C12B 4QYOB 1GPOH 4XMKL 2Q7YB 1KBGH 3H9YA 1KT2A 1KIPA 1RHHA 2BNQE 3IXAB 3IDIA 3WJJA 4EI5D 3ULVH 1JFQL 3HI5L 2DMCA 4ONGH 2FB4H 5D7KD 3MYZA 1DQMH 3FFCA 3FMGH 4LLVA 3VI3E 1LILA 2C7UA 2OZ4A 2BVPA 3JUYA 1KB9J 1CT8A 1LNUA 1YN6B 3MV9A 4LLDB 1J86A 2W65B 1IL1B 4L8SA 4PGJA 4NC2B 4C83A 1JK8A 4XZUB 3QEQE 4RFNC 1I1FA 2ICCA 1T4KA 4F33A 2VDOH 3L9RB 3FN3A 3FB6A 2Q8BL 4XHJC 5HHPB 2G75B 2GUOA 5FYLD 5MEQA 2OJZH 2IANE 4HPOH 5DDHA 1O7SA 3H7BB 2P5WA 1A4JB 5DJDA 1NMAH 4JRYE 1X5YA 1IM3B 1FG2B 1ZLUH 3SKJL 1VFUA 2YC1B 1Z9SA 4XNXH 2NYYC 3H42L 3ARBD 3LV3A 5J1TC 1VFBA 1FBIH 4IMKC 3P4NA 2P44B 4JFXA 3O3AA 1EO8L 1WAAE 2XXCB 4DCQA 4RZCB 5JIHA 3AGVA 2BXYA 5KG9B 5I75C 3FZUC 1J8HB 2X4RA 4R6UA 1RZGB 1MFAH 3IU4L 2IF7A 3BXNA 1F3DH 5FV1L 3EFFB 1BX2B 5ITFB 4L9LC 1CI5A 3PWVB 3JVGC 3GKZA 5IVXE 4PRNA 3LN9A 4BSVB 4R97C 3OKMA 3RY6C 3OR6A 3QDMA 5D7IA 1IT9H 1FO0L 1FNSL 3DVGB 2Y36H 3KPQB 4BFGA 1OAKH 3S4SB 2L7UA 1J1PH 1DDHA 4P3CH 2RGSA 2OI9C 2GJ6B 4PJCE 5DYOA 4Z7WA 3MJ9L 3ULUD 1K2DA 5C07E 4NKDB 4NNXB 3D25B 1V5JA 5EO9A 3E1F1 4IM8A 4W4OC 2L0DA 4LMQI 2R29H 4LSPL 1U6AL 4GQ9H 3GSNL 4POZC 4M5ZH 5F9DC 4FN0A 5HI4D 5K9KA 1WF5A 3T2QA 2DM2A 4UV7H 5L2KD 3RGVB 3S5LB 3PWNA 1YNTB 5BMFH 4IRSD 4G6KL 1ZT1A 2P8MA 4DK3A 1QR1B 5FM5O 1LEIB 1VKXA 5BRZD 2KPNA 4NPYA 5KS9F 1P84K 5C09D 2C26A 4NUGL 5E8NB 3ZL4H 4Y4HC 3BPLC 1UA6H 2I5YL 3B5GA 1KELH 1X5JA 4IBLT 4LVOC 5E03A 3VFMB 3BD4A 5FOJA 3CGTA 1FDLL 1KT2B 1RHHB 3LMJH 3QPQC 2EH7H 3IDIB 4QHKI 4HCRH 3RVUD 1HKLH 1MQKL 3FFCB 4LLVB 2KUTA 1KCLA 2C7UB 4UU9A 2BVPB 5HGDA 4KTDL 4BK5A 3HNSL 1CT8B 1LNUB 4LVHB 4KK6C 4HDIA 3MV9B 4CMMA 1CE1H 4TVPH 1KF9B 3MLRL 4L8SB 4HWBL 4C83B 1DUZA 1JK8B 3DMMC 4NO0D 1I1FB 3EDJA 4HKBB 1T4KB 4F33B 1DTUA 1WQVT 2FSEA 2UYLB 2XRAH 3FB6B 1JHKL 4N5EC 3N85L 2GUOB 2V5TA 5MEQB 4DJMA 5I71B 5D1ZD 5DDHB 1ZE3C 2AJ3A 2P5WB 1ZLUK 5DJDB 4FFZL 4QWWC 3U9UA 1RV6X 3CCHA 4GG6A 1FIEA 5TPWH 1YN7A 2YN5A 4GSDH 2ED7A 3O2VH 3LSOA 1JWMA 2Q8AH 3LV3B 4HWZA 1N0LA 1VFBB 5F44A 4LL9A 3V0WH 1UENA 2ITCA 4JFXB 5J1AA 1RZIA 3O3AB 4OCNC 1GGIL 3ARFA 4DCQB 4PRIE 3WD5L 4HKJA 1WZ1H 1ROWA 2BVEA 4P46D 4YJZL 3TVMA 4WNQA 1I1AC 3BKYL 4HUMB 2X4RB 4YQXH 1O7VA 2Z9TA 3WIHL 3EDKA 3BXNB 1L7IL 4XT1C 3TNMA 4U0RB 4OCXL 3MODL 1EA9C 2NY0B 2GSIA 5GRZA 3P9LA 4PRNB 3W0WD 4LPXA 3OKMB 2FCBA 3BKML 3OR6B 3QDMB 5D7IB 3SHSA 2X7LB 5KS9E 1FRGH 3TT3L 3VXNA 1MF2L 2XZQH 1H15B 4EN3D 4XCFL 5BW7C 1RPQA 4RSVA 3LN5A 4TTDC 4Z7WB 3G5VA 4OD2A 2EYTA 3OHXA 3V7AG 5EO9B 1KFAH 1A8JH 2JELH 1MRFL 2NZIA 2V6HA 5GGTH 1I3GL 4P2QE 3CD4A 4KRPC 3T0ED 3TT1H 3PABA 3RIFF 5K9KB 3WDHA 3PWNB 1BWWA 2DLTA 2GTWA 5CFHA 1KEGH 1ZT1B 2P8MB 1CR9H 3I6KA 3ZYIA 3UJTL 1VKXB 3VWKC 5T1KA 4RMQA 1WJ3A 4NPYB 1D7FA 1CLZH 4GKZA 5B39G 3P9WB 2OQJB 4UT7L 5EA0L 1INEH 2F19L 4TPRH 5DJ0A 5JA8B 3T4YA 3VFWA 4FABL 5C0AA 2E7LA 5IVZA 4LSVH 1PGRB 1X5KA 5DUML 4NP4L 1K5NB 4MJIA 4UU9B 4CKVX 5HGDB 1G7JA 4WUKH 1II4E 1U3ZA 1AD0A 5DMGC 4CMMB 1WT5C 1QSED 1T89A 2GTZA 1DUZB 4X4YA 4HCRL 2JJSC 2OM5A 1KN4L 1KTDA 2FSEB 1HDMA 1A4KA 1GGCL 1HH9A 3MOBL 5BO1L 3PQYA 2AJ3B 3UBXG 2X05A 3VFRA 3RWDA 2BVQA 1CU4L 3CCHB 5D7LE 4GG6B 1YN7B 1FAIH 2HFGH 5DZLA 2K7PA 3LSOB 4L4TA 1DBAL 1F4WL 1JWMB 4Y2DC 1FZOA 4PJDF 4HWZB 1RUQL 1PQZA 4DUVA 1CZ8H 2VZOA 4YAQA 2ITCB 5J1AB 4GRWB 1RZIB 5EC2B 3ARFB 5E56A 2C4XA 1HINL 3MCG1 1T1ZA 4HKJB 3HFMH 1JZ6A 3QO0A 5EDXA 1I7TA 3TA3A 3TVMB 4WNQB 3HG1E 1OARH 3X3FH 5CD5C 3SGDH 1G9NL 5HHOD 1UGNA 4QCIA 1VGKA 4HKXA 5EOCJ 1NUGA 3TNMB 2HTLC 5E0QA 1RI8A 3F62A 1BFVH 3P9LB 3FN0H 3CAFA 3BPCA 1M71A 4FQCL 5GRYA 5HYJE 1A6UL 3BE1H 4P4KC 4P5KA 4D0CA 3CSPA 4C56E 3LN5B 5BOPA 2ZUUA 3G5VB 4OD2B 2VOTA 1Q72L 2EDQA 2EYTB 4RGMC 3OHXB 4N90E 2VDPL 1OWRM 5I8KL 3E0GA 4QRRD 1EJ6A 2PYEB 3PABB 1H3XA 1MCPH 2CK0L 3O2DH 3OAYH 4OBRA 1GZPA 1JRHH 2GTWB 3I6KB 4Y4FA 3GIVB 3OGCA 3ZHDA 5DJYA 4GKZB 3SO3B 3UTOA 1Y6KR 1OP5K 3U83A 1D5IH 4NM4L 4M03A 4LVNC 3I02A 5SWZE 3V5HA 3SDXA 1KUMA 5DJ0B 3TT1L 2DQCH 3T4YB 3VFWB 1JF5A 4YHKL 4NO3A 2IALA 2CQVA 4G9FA 5IVZB 1BD2A 2ZG1A 2ZSVA 4L4VA 2A6DA 2G9HA 1RZFH 5JZ7C 2NY3D 4YLQT 5J6GA 4MJIB 4WWKD 5D6CA 3OPZH 1G7JB 1PZUB 1A47A 4PJDE 4C4KT 2FR4A 5F72S 1OT1A 1AD0B 1RUML 2P8PA 4MQTB 4XVSL 4W6WB 2GTZB 2BXZA 4X4YB 2N4IA 3KYOA 4HWEH 2AEPL 3LOWA 1KTDB 2V7HA 3AU1A 3ARDA 4GOSA 5BRZE 4S0SD 1KIUA 4H0IA 2E27H 1HDMB 4AQ1B 3RTQC 1HH9B 3HS0A 3PQYB 5HGAA 3CX2A 1FZMA 3VFRB 3RWDB 1FHGA 4LCWD 4RWHA 5DT1L 5EZJA 2Z4QA 2CJUL 1BBJA 1RZ7L 4L4TB 4M7ZC 3Q3GA 1FZOB 3C08L 3HAEA 4G7VL 3MRIA 1PQZB 3WIIL 3SCMA 4YAQB 3F7YA 3QDGA 3VFGL 3VWJA 5GS0H 1RY7B 2C3XA 3JWNC 1NANI 3SJVE 2WP3T 3D5OF 4HJJL 1U92A 4GKNA 1T1ZB 5K9QI 3QO0B 3TA3B 4PYHA 2BHZA 2DI7A 3FCTA 4MQXC 3OZ9L 1A64A 3UTSD 4QCIB 3FQUA 1VGKB 5EG6C 4HKXB 3QUMA 7FABH 5LCVH 5JORB 4GAJH 1Q0XH 4KTEH 5J6HA 3LQMA 2Y07H 1I1YA 1MPAL 3BPCB 4PS4H 1M71B 2DQTL 3GJEA 1P1ZA 3O8XA 4LCIL 1MCEA 1TJGL 1X4YA 2EDWA 3UC0L 2FZ3B 4JCMA 3MGOA 1CICA 4P5KB 3FO9A 4D0CB 1NPUA 2E5EA 1KGCD 1IBGH 4NJAH 2DLHA 8CGTA 4KDWA 3RQ3A 2BZDA 1K8IB 1LO5A 4HULB 3AROA 4XNZC 4DZBA 3D3VD 3MLUL 4OZHE 4MS8D 4FQXC 3FT3A 3MNWA 3WMSA 4KJQC 3U0WH 1FYTB 1GZPB 3AXLA 2ZCKH 3DYOA 4I9WE 2IC2A 4A6YH 4MD5A 2EKSA 4NQXA 4Y4FB 5D2LF 3PWLB 3MRGA 3MLXL 5AUMA 2VR4A 5C2UB 5C0GA 5IOPA 5DJYB 3ARRA 1NDMA 2LAGB 4LPUA 15C8L 2VITA 2RFXA 4LQ1A 1REIA 2V9TA 3I02B 3I75A 3QHZH 4PYGA 5TH2A 3V5HB 3VXRE 5E6ZA 3SDXB 2J6EL 3JWOH 3ZDXF 4HUVA 3WV0A 4UBDD 1N26A 2ENSA 5F21B 3NGBB 2VDKH 3KPRA 4NO3B 3MGAA 4G9FB 1V3MA 1DE4A 4RWYL 1BD2B 2ZSVB 4BFEA 3VXMA 3HN3A 4L4VB 2A6DB 2AQ3A 3C5JA 2G9HB 1I85A 4FQ2L 4NQVA 4WFGE 2NY2C 2YUZA 5D6CB 1ZWIA 2NY6B 2NW3A 1BF2A 1G7IA 1T1YB 2PTTA 4GW1A 4ACPA 2R0WH 3BAEL 1DBKL 2FR4B 1I7ZA 1UJ3A 1A2YA 4FG6C 2P8PB 1CD9B 2W60A 3B9KD 1HXMA 2EC8A 3HI6L 5FKPA 3TH3T 3KYOB 2V7HB 3AU1B 3ARDB 4PJ9A 4MA1C 5DSCA 2B4CH 1JYVA 3VG0L 3HS0B 3L7EA 5HGAB 1I1CA 1FZMB 2FO1A 4Y16D 5LQBL 5FYJH 4HUUA 2E8YA 5I1HH 5EZJB 2Z4QB 1M6OA 1K4CA 1BBJB 4S1RH 2N7AA 3MRFA 4FOMA 3Q3GB 3QQ9D 4NQCE 4Y89A 2PR4H 5I1JH 3MRIB 4PUBH 3DRQA 3SCMB 3LQAL 5GHWH 2ARJQ 3F7YB 3QDGB 1XEDA 3VWJB 4OZFA 4QOKE 1J0HA 3K3QA 4PY8I 1EUTA 4V1DD 1A6WH 4HS3A 5KN5B 3QUYC 3FCTB 4GRLD 5EU6E 2F9BT 3HC3L 5DI8A 3FQUB 4MNGA 4ZODA 3CMOL 3QUMB 2FBJH 4M43H 2HAZA 5J6HB 1JZ3A 3EYQC 4YXKH 1I1YB 1BP3B 1RZJH 5D2LE 3GJEB 5CJ5A 1P1ZB 3O8XB 1T5WA 4LHQB 3MGOB 3CMGA 5CSZA 5C92A 2DBJA 1CICB 2WBWB 4ZFOA 4KZDH 2H9GA 4HIJB 1QLEL 4TSBH 3ZDXE 4GAJL 1LO5B 2BSRA 4XPBH 1T5XA 4DZBB 2Y07L 5D96C 3TWCL 3QUZA 4H26A 1X5HA 2DKUA 3FT3B 3QH3A 2DKSA 5EU4A 3MNWB 4K3DH 2ZUVA 4EUPG 4AEIH 3AXLB 4LDEB 3CFCL 4H8WL 4MD5B 2EKSB 4NQXB 2I07A 3D85D 3MRGB 5AUMB 4K94C 2E6PA 5C0GB 1T2QL 1IKFH 1UWEL 1UM6L 5IOPB 1NDMB 2VITB 2RFXB 4PRAA 1BAFH 5DMYA 5IROC 2Q86A 5L9DL 1KXTB 4BM7A 4WY7L 3I75B 1U8PA 4TULL 5TH2B 1MFCL 5FM8A 3OAUH 4HUVB 3V52H 3VGAB 3B43A 4LF3A 1IZKA 2Y6SD 3KPRB 4LMQE 3MA9H 4MJ4A 1DE4B 5EOQH 5IMKB 5MENE 3VXMB 1QFUL 2EEDA 5KVEL 3C5JB 3WJLC 5IWLA 4NQVB 4ORZC 4NNPL 3BEVA 4FS0A 1ZWIB 2NW3B 1G7IB 2PTTB 4GW1B 4FTVD 5C0NC 2JK5B 2PTUA 3NTCH 4UOJA 1DLFL 3MRDA 4HWNA 1UJ3B 3VXTA 1MFEL 3S34H 1A2YB 3QCUL 2WV3A 3GRWH 3X11A 1FZJA 4I0PA 1HXMB 1MCNA 1WFNA 4XVJL 5CP3A 3RWHA 3ILQC 3U82B 4BZ2H 4U7MA 1JNHA 4PJ9B 1A1NA 3MBXH 4IMKA 2XTJB 4YXHL 1NCDL 1NUFA 1CFNB 1HKFA 3L7EB 2ZCHH 1PG7W 1SMOA 4XNQA 1CDYA 4N68A 4HUUB 1M6OB 1K4CB 5IW6A 3MRFB 5J12B 5F6IC 5IB2A 4HIEA 2VQUA 3DRQB 3BPOB 4JPKH 4OGYL 4GMSL 4OZFB 1TFHA 4PJ5E 2FECI 3W2DH 4L9LA 1SEBA 3JVGA 4HS3B 5BS0A 1RVFH 2YPLD 4OLVH 4R4NC 1EFQA 1A1OB 2COQA 4PLKD 2ZUWA 4MNGB 1IGCH 1NAML 2V9RA 5FO8A 3MOAH 5DD0L 4LCUA 3G5ZA 3BRDA 1ZANL 4JGUA 2IFGA 4RRPA 1ZLSH 3P2TA 1XH3A 2ZCLL 1T5WB 2AI0L 2QV2A 3IFLL 3MFFA 4W4OA 3WFBH 4U6XA 4JN1L 5CSZB 1AH1A 4ZFOB 4K9EH 4LCWE 4O02L 4H1LA 1CXIA 2H9GB 2LVEA 2OP4L 2H32A 3NCCB 3C2AL 2BSRB 1T5XB 2AJVH 5TE7L 1BBDH 1EZVX 1PYWB 1KYOK 3QUZB 4Y5VA 4H26B 3KLAA 3ZLQC 2EZ0D 4Y4HA 1S7QA 3QH3B 5LXGH 3CUPA 5EU4B 5J1SC 5DTFA 1U3HC 1KEMH 1A22B 1OB1A 4IEFB 2QSTA 2VXQH 3Q48A 2I07B 4LK4A 4ZNEA 1OF2A 5CGTA 5DURB 2AW2A 3GI8H 4LKXA 2QKIA 4PRAB 4NO5A 1PKOA 1RD6A 4JHAL 4ZFZA 3CFBA 1DBBH 1MRDL 3DNKA 4HS8L 4PV8A 1KB5H 4MSWA 2XN9E 4LF3B 3H9ZA 4NZUL 2ID5A 3GO1H 5ISZA 1MFDL 1V05A 4JFPA 5B4MD 1SY6A 4PJ8A 1T20A 3ZTJH 3P4MB 4P2OC 4PJAE 1QRNA 1XIWD 3T4AA 1QSVA 2VO5A 3DMMA 3BEVB 4WENB 3RPIA 5F7UA 1ZAGA 1U0QA 1IJ9A 4UMGA 3GM0A 3MRDB 4YXLH