3GL9A

The structure of a histidine kinase-response regulator complex sheds light into two-component signaling and reveals a novel cis autophosphorylation mechanism
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
120
structure length
119
Chain Sequence
SKKVLLVDDSAVLRKIVSFNLKKEGYEVIEAENGQIALEKLSEFTPDLIVLIMMPVMDGFTVLKKLQEKEEWKRIPVIVLTAKGGEEDESLALSLGARKVMRKPFSPSQFIEEVKHLLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Response regulator
publication title Structural Insight into Partner Specificity and Phosphoryl Transfer in Two-Component Signal Transduction
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Signaling protein
total genus 43
structure length 119
sequence length 120
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3gl9A00
1NXTA 2HQBA 3OO0A 1DCMA 3OQOA 1JLKA 2IPMA 3LMKA 3FGZA 3H5TA 2FTKE 2PE5A 1NY5A 1USIA 3N0XA 3O2JA 4LRQA 1PUXA 3HS3A 1RNLA 4NQRA 3RVPA 1LBIA 1LJUA 1QPZA 1VLZA 3LKBA 4Z4EA 1JL3A 1U2PA 3H5WA 3JPYA 1PNTA 4MS3A 1VKRA 3CRNA 4LX8A 1MB3A 5DKFA 4PYRA 1FFSA 1NXPA 2HQRA 3H1GA 3O2SB 3LUFA 4KV7A 5IUJC 3H6GA 2FEKA 3HUUA 2JRLA 1QNLA 1P6QA 2DRIA 5HQJA 2MYPA 1C4WA 4EUKA 4IF4A 4LDZA 3A10A 2IYNA 4KQ9A 3FFTA 3G85A 1YK1A 3RVJA 3R0JA 4LDAA 1AB5A 2OQRA 4Q6WA 2JVJA 4RK5A 3KTOA 5IUKC 4NCBA 1Z13A 3LUGA 4QYWA 1YIOA 1QKKA 5CNMA 5KQPA 5EWLA 3O1JC 5ABPA 1U04A 3EGCA 4IGAA 4ZMSA 4LZLA 3OQNA 3IP9A 2J48A 4UHKA 3N53A 4OBBA 4MLDA 3N0RA 3EQ2A 3QLUC 2N9UA 3IPAA 4MPTA 1S8NA 5IC5A 4EYOA 2ID7A 2JBAB 3CG4A 3KKEA 1MVOA 4Q7EA 2VUIB 4Z9AA 3JTEA 4FE7A 2LBPA 4G0OA 2YHBA 4KQCA 2FVYA 4H3KB 4TLMB 3IP6A 4RSMA 5KI6A 3RVRA 2CWDA 3SAJA 5KQGA 1NXVA 4O1IA 4KFCA 4EVQA 1Z15A 1QMPA 1R8JA 2QVCA 2FQWA 3CNBA 4P98A 3DZDA 4DQDA 3HCWA 4RY0A 2L2QA 2AYZA 3A0UA 1BVHA 4KZKA 3IP5A 5B3JA 5FWXB 1FFWA 1ZH4A 4N41A 3MYYA 3N0WA 1BA2A 5KC9A 3NNSA 4FB4A 4KMRA 2PMCA 4JA2A 5I4CA 4MR7B 3LUHA 1TM2A 4DN6A 3H5VA 4G0QA 1XHEA 4RV5A 2PUEA 1DJMA 5C5EA 2PUFA 2MSKA 4TLLB 3O75A 2FQXA 2RGYA 3T38A 3EULA 5IEJA 3CTPA 2IDMA 3C3MA 4WT7A 5EWJA 5DCLA 5B3JC 1YS6A 2LP4Y 5JNVA 4F8JA 5FBHA 5T7BA 1RXIA 3BRSA 2I6FA 2IKSA 4HNRA 2R4QA 2FSPA 1U2QA 1ZY2A 3H5LA 4MR9A 3ROTA 2A9PA 5IEBA 5T3YA 3FFXA 3VNAA 2HQOA 5KQMA 2V0NA 4KRFA 4O5AA 1NXXA 2L19A 4JB2A 3SG0A 4YRZA 4ZYLA 1PEAA 1TMYA 2QSJA 1SXIA 3HK2A 5TPZD 1KRXA 7ABPA 1APBA 1JDPA 4JAVC 3QELA 3SY8A 2NT4A 1OXBB 1LJLA 3URMA 2E4ZA 3H1EA 5IBQA 1TLFA 4RZSA 1J56A 1DCFA 1E2BA 3B2NA 2X7XA 2H3HA 2NT3A 3HDGA 4NCAA 3OQMA 1P8AA 4KNYA 4JASB 4RWEA 6CHYA 4LE0A 2Q5CA 2B1JA 3F73A 4G86A 3Q7RA 3OMWA 4RY9A 1D2AA 4PE5B 4RK4A 4N0QA 1JFSA 5BRAA 2FEWB 2QW1A 1EWTA 4ZPJA 2FKAA 4TN5A 2GWRA 1JBEA 1UDRA 4RDCA 5TPZA 4F3TA 5E3JA 1H9CA 3Q15C 5JS1A 2MYUA 4H3HB 1ISSA 4HNSA 3L49A 3F6PA 3IPCA 1YVUA 4RY8A 3W9SA 4ZJPA 1JFTA 1ZAYA 3RVMA 3KG2A 1SRRA 1M5UA 4MYRA 4WZZA 2QR3A 3JVIA 3FFWA 4G0MA 3DGFC 4MRMA 4QYMA 1JF8A 1PEYA 1RPJA 4OLAA 3LUCA 4PZ0A 3RVLA 5TQ0A 4RU1A 2XDYA 1BDHA 1KRWA 3OLWA 3UK0A 1MIHA 2PUGA 1DBPA 5HKOA 5HSGA 4MQEB 4MS4B 3RVQA 3SNKA 4RK1A 2W42A 2F8TA 3OMXA 5IULC 1ZGGA 2F8SA 4D6XA 5JNWA 3NHZA 5CNKA 2HSGA 2WWVD 3MF4A 3L6UA 4OG2A 8ABPA 1VRVA 4O1HA 4RKQA 3O1HB 5DLEA 1LK0A 5EWMB 4Z9BA 3QX8A 1YMUA 4E7PA 3SM9A 2WY2D 3EJWA 1U0SY 3HSYA 3KYIB 2QXYA 3QEMA 1JYEA 3OM1A 4W5TA 2HJ9A 1DG9A 1BDIA 3TX6A 4MRMB 1TJYA 5TPWA 5BR1A 3IDOA 2R25B 4YCSA 4MS1A 2GX6A 4MQFA 2B4AA 2ID9A 2FMFA 3KJXA 1SXHA 5JNRA 2A9OA 2LPMA 3M6MD 1GUDA 1Z17A 4MS3B 1PNRA 4D6YA 2PAFA 2IPNA 4WUTA 2MYNA 4MR8A 5TQ2A 2VYCA 2PUAA 3LUDA 1M5TA 4E7OA 2E4XA 2E4UA 2RJOA 3CZCA 1DZ3A 1DBQA 3K4HA 3C3WA 3Q7TA 2P4UA 5FBKA 3KS9A 1ZVVA 1E6LA 2FXIA 5EWLB 3VNBA 3E61A 3MMNA 2JVKA 1GUBA 1ZHHA 5TPWB 4RKRA 2AYXA 3MM4A 4Z99A 1EWKA 1Z16A 3CFYA 4QPJC 4IMJB 1Z25A 4G0XA 4KVFA 3H6HA 2PKXA 4P1ZA 1ZH2A 2FQYA 3JY6A 4FE4A 3CKMA 4RXTA 2MSLA 4PICA 4YLEA 2WRZA 1GCGA 4UHJA 4H60A 2R47A 5JS2A 1NATA 1DP4A 3KLOA 3HUTA 1Z18A 5KQLA 9ABPA 2RJNA 1DC7A 3A0RB 3GA5A 3JVDA 4MGEA 2A9RA 4XAQA 2QU7A 3RVSA 2L18A 4N0PA 3O21A 1KGSA 2P9HA 2GBPA 3N8IA 4M88A 2CHEA 3RVKA 1QP0A 4JB0A 1D1QA 3KYJB 3LUKA 3GT7A 3OLXA 4L4UA 4W5QA 1E6MA 3OLZA 1U8TA 2CHFA 2HPHA 2L17A 3E3MA 2JK1A 3LKVA 1A04A 1C0EA 3DBIA 4EY3A 4F06A 3DLHA 3HDVA 4KPYA 3HJFA 1B00A 3ILHA 4EVSA 4W5OA 1D5WA 4S04A 4KK3A 4RS3A 3A3KA 3KHTA 1CEYA 4XLTA 3UUGA 1A0OA 2O20A 4OATA 5EWJB 5F64A 3BBLA 3HM9A 1NXOA 3NHMA 4S05A 2FW0A 1VPWA 1JX6A 3LTEA 3O74A 2ZAYA 1CHNA 1E6KA 4MR9B 2JB9A 1ISRA 5C5CA 3K9CA 3RVNA 3GBPA 3C3KA 1USKA 1Z2DA 2YHAA 4W5RA 2GI4A 5KWSA 2ZWMA 3I42A 2IPAB 3GWGA 4KREA 1EHCA 2FMKA 3GV0A 3KSMA 4ZMRA 1YTUA 1KMIY 2E4WA 2KYRA 5BRJA 1EAYA 5CNIA 1BAPA 2QVGA 1P6UA 3GRCA 4LE1A 3CZ5A 1W25A 4WWHA 1M2FA 2PJUA 4QICA 3QELB 3KLNA 4NICA 1NXWA 3D8UA 4MAAA 1DCKA 3HXMA 3H1FA 5IX8A 1FSPA 1FFGA 1K66A 1CYEA 1GCAA 3QLTA 1AB6A 2FMHA 4WXEA 1XWWA 4W5NA 2PUBA 1ZGZA 4ML3A 4EVRA 1FQWA 1DRKA 2WB4A 1BDJA 3N6VA 3Q7SA 5JNTA 1K68A 3M9WA 1F4VA 4PEVA 2JCGA 5PNTA 2NZVG 4HNQA 3T6KA 2JBAA 1DC8A 3CHYA 3RVOA 1HEYA 3MA0A 3OLVA 4EYKA 3C6QA 4GPAA 1QQAA 2WMYA 5CHYA 4OTZA 3EAFA 3QLUA 3HVRA 5TQ0B 2GKGA 3NBMA 4ETMA 5HM6A 2CD7A 1RXEA 3KCNA 4B09A 3Q9SA 2FN8A 3I09A 1I3CA 3S99A 4RK7A 4LE2A 1JH9A 4Z4CA 2FMIA 1A2OA 2TMYA 2MSWA 3O2QB 5FWYA 1ZDMA 4HYEA 1JDNA 5TQJA 3RH0A 1NXSA 1Z2EA 1QQBA 1TVMA 3BILA 1ZITA 4YGXB 1ZESA 4TMYA 5FWXA 5KC8A 3I45A 3QEMB 1MAVA 1GLGA 4F11A 2QZJA 1Z26A 3H75A 2FLWA 4MR7A 1JFVA 2E4YA 4Z4IA 2IOYA 4WXMA 4YR7A 3QLVA 2MYTA 4G97A 4XASA 3TMYA 4MS1B 4MQFB 3OO1A 4JP1A 1W9HA 3GYBA 1ABFA 3QK7A 2PUDA 4IILA 4RK6A 4F12A 3NNDA 1YMVA 3F6CA 6ABPA 3C97A 3EQZA 3QX9A 1MB0A 3D02A 3NNNA 4EYGA 4YWHA 4CBVA 4YS6A 4ETIA 3N75A 1ZN2A 1DBWA 5FWYB 4MLCA 4Z4HA 3CG0A 1WETA 4MR8B 5TQ2B 4DADA 4N76A 1RZRD 4GNRA 2NZUG 1YS7A 1XHFA 3O1IC 3CS3A 3QLVC 4EGSA 1OXKB 4JOQA 1URPA 3RQIA 2NUBA 2OENG 1D4ZA 1L5ZA 2R48A 3JPWA 3FDFA 2FEPA 4YV7A 1QP4A 2FN9A 5JNSA 2M98A 2A9QA 1M2EA 3TD9A 2PLNA 1EWVA 3DGEC 3GL9A 5DTEA 4Z4FA 1RZRA 1D1PA 1P2FA 1USGA 3P9YA 4RK0A 1JWLA 1EFAA 2BGGA 3T8YA 3H5IA 3EODA 3BREA 2FLKA 4XARA 2IPLA 4ETNA 3F7NA 4IMIB 3FMVA 1T34A 3CU5A 4L85A 3TO5A 3Q41A 3HZHA 1JHZA 5D2CA 3M9XA 3HEBA 4RXMA 4YP9A 4OLBA 3LUAA 1IIBA 1QO0D 1DRJA 4G0PA 5BQ3A 2E4VA 3LOPA 4EYQA 3BRQA 3G1WA 1SD5A 2VK2A 3IP7A 5ED4A 1SXGA 4Z0NA 3JS5A 3T95A 2VUHB 3MIZA 3EDCA 5GOTA 1F51E 1L5YA 4Y9TA 4KK4A 1JYFA 1LBHA 1YK0A 1Z12A 1QP7A 4Z4GA 4N03A 3ROFA 3LFTA 3SQNA 3HO1A 5GQSA 3DLBA 2PL9A 2WJWA 3CLKA 2JVIA 4N47A 3I5AA 2M1ZA 4MQEA 1QO0A 4MS4A 1ABEA 2H0AA 2RDMA 3GBVA 3HV2A 4G0ZA 2WJAA 4G0YA 4NV3A 5TE9A 3TB6A 2QV0A 5JNUA 5CNJA 2PL1A 4XXHA 4YO7A 2LIVA 5IUNC 3LUJA 3UKJA 3OLYA 3MQ4A 4D74A 3H5OA 4Q6BA 4XFKA 2LUOA 3QEKA 4RXUA 5EWMA 2PUCA 3OM0A 1Y1LA 1PHRA 5DGCA 1NTRA 3ILYA 4IRXA
chains in the Genus database with same CATH superfamily
2PCLA 4CM8B 1AO0A 1XQ1A 1RWXA 5K99A 1GGMA 3DTYA 3K0BA 1A8SA 3D4LA 4MKGA 4QIHA 3EGOA 3LCJA 1XELA 3E70C 4FEYA 3SIWA 2R2AA 4L7QA 1PUXA 4BNMA 3PZRA 4LSZA 3IBFA 3QU2A 3NOXA 3NEAA 3LKBA 4QSHA 2H4FA 4FIDA 1ESDA 2WD9A 1FE8A 5DKFA 4CR8A 1QCDA 2HQRA 3OCWA 4FDAA 4TOIA 4YAFA 1NMEA 3KKMA 5BQOA 2H6EA 4WD3A 3M70A 2P9JA 2RGDA 4BWFB 1BXRB 4H6VA 4QBGB 1U7XA 3W7AA 3OU7A 3HP4A 4IF4A 5ICEA 2X8WA 3G9TA 4L5AA 1DAEA 3BD9A 5AJUA 4RCYA 4Z8YA 3TQFA 2D2EA 3LWZA 3R0JA 2OQRA 4HYTA 4NZMA 4Q6WA 4WW0A 2BGUA 2X1VA 4XDZA 3UUFA 5MN5A 1KEKA 1FSSA 2VHJA 4Q66C 3IHWA 3WYAA 3TG8A 1D7AA 1V43A 2GT1A 3PWZA 3EGCA 3RASA 2ZATA 2P0YA 1O4VA 1O9GA 4IX1A 4BMSA 4E2WA 5FUVA 5J5CA 2VP9A 1DKOA 3N53A 1HSZA 5TMBA 4JC8A 4LSMA 1E2LA 4TV9F 2RB4A 1T6YA 2DKOA 4Q37A 1ZU4A 1GNVA 3KT0A 1PJQA 5DYTA 3FSGA 4LOKA 3ZHUA 4BV9A 3CKKA 4DLTA 4RTNA 2EWMA 4PIVA 4UAGA 3A27A 4CUJA 3UH1A 2XQKA 4DNOA 5LKAA 2ONCA 4UBLA 3AF5A 1WM1A 3HKCA 4U0KA 4ER6A 3OQVA 5E7QA 1VSQA 1L7VC 1E66A 5LQSA 4KGXA 2I6GA 1T36B 4OQDA 1JXQA 2DUWA 2ZROA 4QHTA 2PA3A 4KFCA 1NVWQ 2FQWA 1X8LA 3KQOA 4FM9A 1LTQA 2R65A 3NXSA 2V74B 3U4IA 3A4NA 2P9CA 5FWDA 4F1KA 1RCUA 4M1YA 4EPVA 2ASEA 3EK2A 1QH8B 4CG0A 1HA3A 4Z7JA 5JPCA 1AQNA 5FWXB 3PC4A 2Y1KA 3SJUA 4ZN6A 3QOFA 3TLXA 3LC7O 5ECGC 4UE3S 5JADA 4ZVMA 1Y98A 1NZJA 3NJ8A 3H5VA 4I5GA 2Z98A 4JDPA 4DN6A 1CP3A 4RV5A 1YVPA 4M86A 1R4MB 2JJ1D 3JZDA 3QEBZ 1DQRA 4D79A 3KL2A 2XWSA 4E4TA 3AKZA 3LBHA 3VKHA 3OZCA 1KY4A 2F48A 2RGYA 2WSMA 1HTTA 3PQ6A 3QFTA 2QGFA 4YBRA 4AU1A 1A3CA 5EUBA 3WOVA 5K6TA 1IAQA 1XCLA 4R9UC 3V8QA 3IL2A 3DVSX 3OZVA 2B9EA 1BWRA 3IAAA 2D5LA 4G5HA 4JKIA 1MB2A 4JJ7A 5DTMA 5FBRB 1R27A 3RS8A 4EA6A 3TSYA 3AZPA 5EE9A 1WX1A 2JA1A 4CR6A 1H5QA 4CLEA 4QOIA 5EJAA 4M53A 2P5UA 3D0OA 1Y9AA 2FU5C 1NUQA 4R7TA 1JDBC 1UR5A 1EQAA 3Q11A 2QSJA 2Y99A 1T9DA 3O9MA 2XB6A 4PN7A 7ABPA 1L4GA 4RZ2A 2FGJA 5IDXA 1GZ5A 3ZVLA 4TTTS 1C7JA 3WGMA 1LJLA 1UBTS 1QR6A 5BN5B 2NO0A 1J56A 3K0AA 3FPLA 3R0QA 4YDRA 4FC7A 3ULKA 4CG2A 3KBBA 2CLMB 2OKGA 1PR0A 3GDWA 2PR2A 4C7XA 2H5JA 1ZUD1 2BFFB 4CU2A 3QUTA 4LHVA 1OH6A 2FFQA 1HRDA 2G5GX 4MH0R 2VHTA 5HKKD 4N5NA 2Q2QA 3D3EA 1JEQA 4QC2A 3NDBB 1DRVA 4LJYA 1D6MA 3CLUD 1L8XA 3ZTTA 3IT3A 1W48A 3T9BA 1L5NA 1XTZA 1UKZA 3LP5A 1OHHD 3NTVA 4B4KA 4LHZA 2M6SA 3VNSA 4WCVA 3IR7A 1GSHA 4J91A 4AP5A 1U7PA 5H4GA 1TA4A 1D2NA 3GFPA 4J8PA 3LWDA 2EL7A 4JQYA 4MYRA 3JVIA 4R31A 5IKMA 5IJZA 4U7HA 3PUVA 2QD3A 3FOCA 1TUGA 4Y98A 1GN8A 1NFRA 3FLMA 3GEEA 3KZCA 2RC6A 3BFPA 3COZA 5IJ0B 5AKZA 1EXVA 1KO4A 4V24A 1XL1A 5DNEA 5ARCA 1QHHB 4E70A 5FH9A 3EPLA 1CY7A 4NENB 4F3RA 5KINB 1XTUA 2B78A 2PKYX 4WN9B 3WK6A 5HSGA 5IAKA 3R9XA 1TCUA 2F8TA 5TNXA 1WTAA 1CUDA 4HH0A 3MEQA 3MTIA 3SN6A 3ZR4B 3VBEA 3JD4A 4OXKA 3KEGA 5ADUS 3WQQA 1K5DA 3EXHC 1HLPA 1DOAA 4C2TA 1UKVY 5IT5A 3ZVNA 2IV7A 4ZC1A 4YXFA 3PICA 3DKKA 1IOLA 1QPBA 1JIIA 3UHJA 4HDMA 2AN1A 4Z8XA 1U0SY 1TFRA 3DG9A 3HSYA 1QKIA 4JFAA 4X6XA 1E9CA 3RSLA 1CUYA 4FWTA 3NATA 4DV5B 1GKIA 1SZPA 2XVZA 3CRMA 3GJ3A 3P2OA 3ESBA 3PVCA 1IAVA 2OVBA 3GXOA 1E5DA 4ND4A 1G20B 2N0SA 2VUUA 1J07A 1SXHA 5CVJA 3S68A 1CZLA 2JZNA 3IP8A 3U44B 5LZ7A 3I04A 3IALA 3UWPA 1HNXB 1AKYA 1X3SA 1UEXC 2H7CA 1ZN7A 1DBSA 2PGOA 4UDXX 4RE5A 1HFWA 5D1HA 5F12A 3TRFA 2OXCA 2F8MA 4IIUA 2IS1A 1SHJA 5EP3A 4NXNB 1Q0PA 3ZE9A 3ANSA 2QLBA 4PSVA 5TQ2A 4EKIA 2VYCA 5DN6D 5JCPA 4GZ3A 4EG7A 1LH0A 2FPGA 1LS6A 2NAPA 5JZMA 3U4QB 2ZS9A 1NW3A 1DQSA 2XAAA 3GOHA 1KEWA 1EP3B 3PU6A 5EMKA 1JIVA 3MHPA 4WK0B 2WIDA 2JCYA 3O82A 1T2UA 4GGPA 2H1SA 3ECCA 3SP1A 4K2HA 3FCEA 4JB3A 4JU8A 4MW5A 4NYIR 3IMFA 3LWBA 1O95A 2FVXA 5LQKA 1OT3A 3DL2A 5GIOE 4G1BA 1DTWB 1GQYA 5L7TA 2R97A 4QPJC 4G0XA 2QQGA 4QVKA 4BMNA 2H00A 1LBTA 2NYUA 3LPAA 4CLDA 1OZGA 4ZYWA 3H6HA 5IMBA 2JI7A 2NSJA 1O5TA 2WD7B 4L6AA 4WI1A 5HS4A 2JHAA 1ZR2A 1IK4A 4C1NA 1C5KA 3SOPA 4RXTA 3TEMA 4LKOA 2DH5A 4YLEA 4YFVA 4WV3A 1K7SN 4A36A 5F9FA 3E3LA 3I1JA 2NMVA 4QASA 3CO0S 3ELUA 3LYUA 4I50F 1LUAA 1EI9A 1GU7A 5DX8A 4MV1A 4GC9A 1ZGHA 4FDLA 4FOTA 1JR3E 1D3AA 2WM8A 2Z58A 3OCZA 1XDBA 4FSHA 2DU8A 3BMXA 4JLAA 1EFKA 3GO4A 3RVSA 2PBFA 1DAHA 2QG4A 3CVYA 1LDBA 2P5SA 5U1PA 3SC2A 3PUKA 1GCIA 5CX1B 3U39A 1RRGA 5JW6A 5CB8A 4NMLA 3E9YA 3PRHA 3BIXA 3GDHA 3BJIC 3BFJA 4FBMA 4W5QA 4FOLA 2C3PA 3H65A 4KV9A 1A9TA 4GG1A 1M1NB 1MVNA 2QRUA 1A04A 2FPLA 3ZZ1A 4I8DA 4B33A 1XF1A 1TAQA 3IE2A 2IEDA 1N36B 5DF1A 3I9NA 4N1AA 4JGIA 3PLRA 5IANA 5M2QA 1N2JA 3PDCA 3PJDA 2Z9BA 4EGJA 4EUFA 5FI5A 2GN2A 1L7BA 3B51X 1A0OA 4LYYA 1Y5LA 3S44A 4A8TA 3C1OA 5J3JA 3A06A 3V8MA 3NUGA 4P5EA 2YJNA 2JJMA 3QKTA 3IP3A 2WNIA 3DE4X 1V7QA 2VJNA 3H8WA 1EDZA 4JJ6A 3N8HA 2X22A 5ERYA 2PGNA 3DD1A 4J7AA 3VKUA 3VZQA 4DYDA 2YWCA 2OMEA 3H0CA 3KJGA 4RH1A 1T0BA 2Y67A 4M21A 2IPAB 1GWNA 3MSCA 1H94A 4P0PB 5BW6B 2XE6A 2FMKA 4I0WB 4KQWA 1KMIY 5D5QA 4DZTA 2Z5LA 2PUHA 2QZ9A 4FE3A 3THOA 5EFOA 3VTFA 2FHPA 1VIMA 1A71A 1VIDA 1MQAA 1NW9B 2C99A 2QQ0A 2WE7A 3L41A 3QELB 5GZ6A 2D74A 1CS0B 1ZMXA 1RKUA 4WACA 3HPQA 2VA9A 5KX5B 3FPFA 1I6MA 5AI8A 3DB2A 1BFUA 1LSSA 3WIVA 3EZLA 3QBJA 1XK7A 3MTEA 3NAMA 2EZTA 2SKDA 4AN0A 1R0YA 4R2MA 1CDZA 2XY4A 4TM8A 1U1GA 1GRVA 2JGIA 3AR5A 3MT7A 1UODA 4P9NA 1B15A 4Q0MA 4E4RA 5F2OA 3D8NA 4E94A 1A1SA 1DJNA 3KYCB 4MITA 1NE2A 3QVXA 4Q7JB 1S2LA 4ZT4A 1K68A 2VJOA 3MJTA 3MFYA 4PEVA 1VYHA 3RHSA 1QM5A 2JI9A 3LBIA 2H2GA 4FXOA 4E31A 4EY6A 1I7PA 2GFIA 4C87A 2QJRA 4FFBB 2FEOA 1RKQA 3T6KA 1U0RA 4MB0A 2BN4A 1KIMA 3KYBA 2FW9A 2WJ3A 2VG8A 5HCUA 5CVEA 4GPAA 1OWNA 2D4HA 4FBLA 4IJ6A 3LLVA 3O03A 1KYVA 3R7FA 4KR3A 5HMMA 4C7OB 1J25A 4YRIA 1XZAA 1LB1B 5KJFA 4A6DA 3QUCA 1F7VA 1FQJA 2JLCA 1ODTC 1LQ2A 1TMKA 2V7PA 2YIMA 3DBLB 4PLZA 3RRYA 2ZOSA 4EJFA 3F9IA 1GUZA 2HA4A 4FDUA 4FT2A 3K9FC 1UM9A 4NEQA 4R1PA 4I99A 1WXXA 2GK4A 1EBBA 2LZ0A 3A70A 2O2ZA 1AE1A 3OWOA 4EOGA 3H1PA 4HAUA 2GF2A 2DFDA 3KKNA 4PCLA 3UAYA 4UM8B 1GN9A 4PAQA 1T5OA 2G67A 2J46A 2CY0A 3QW4B 1V71A 4GECA 5H0IA 5A3RA 1E1QD 3AMVA 2KM1A 3HY4A 4WK2B 5L3RA 2FX3A 4MVYA 3SC4A 1HDXA 3OWXA 1Y4AE 2IDJA 4OMFG 5FL3A 5IBPA 1KMMA 2HIMA 4NBTA 3ZTYA 2QYHA 4E11A 3OZSA 4EW1A 3UK6A 1LC0A 4YC7A 1L6IA 1KR2A 4JH0A 4BNGA 3OICA 1U9JA 4WH0A 3UY4A 3Q9NA 1FYXA 1I33A 2O3JA 4OGLA 2EP5A 3B1ZA 4F8YA 4L5CA 5JFTA 4MB6A 4H31A 1J0AA 5IRCD 1M0EA 2B99A 3A4MA 3BYZA 2ZJFA 3X2FA 1ECCA 3WA6A 2IXFA 2G4CA 4ZCSA 4N0EA 2PIAA 1WG8A 1VSTA 3NETA 1C3OB 3KQNA 4PO1A 4CV1A 3DHWC 3HB1A 3KQQA 1QGDA 1E62A 3JD0A 3PF9A 4C6RA 1LVHA 3FB4A 2DHQA 3AEUA 3HJTA 2G3YA 3NEPX 4IDEA 3SBDA 3W6NA 5INTA 4OQNA 3BM5A 2D2FA 4JL5A 3DMDA 2BFNA 4JHLA 1NVVQ 3VOTA 5JEDA 3ZCRA 1S89A 2OENG 4PONA 1RWVA 4Y1FA 5FNVA 4KR7A 5JDCA 5DJ5A 4A6EA 1P1BA 2IYFA 1MXHA 4EG8A 5JNSA 3PNOA 1XMOB 1IJBA 2QAIA 3O8QA 2BZGA 1GLNA 4C4PA 5HNKA 3L0SA 1CQZA 2XUKA 3G2MA 3LRXA 4NS4A 5E0KB 3PGMA 4MA5A 1U7OA 4QUDA 5KB3A 2VJPA 3UT6A 5DASA 3BSYA 3G0GA 5FI1B 3LFHA 2IFTA 3FYUC 3BF8A 2D3TA 2FLKA 4EHBA 1E69A 1YC5A 1U2TA 1E9EA 1JMVA 1V6CA 5JISA 4F4IA 3MAAC 1UPXA 1S9HA 4TT8A 4I9HA 5DYWA 1SXQA 3BRWA 2EBWA 4FOPA 2P7HA 3PFNA 1ZJ6A 2HBZA 2VO1A 4ARZA 1SG9A 1TRHA 4JX9A 4M7RA 3I8OA 1DRJA 2JCVA 3P4XA 4LXYA 2XCRB 1L5KA 1EX9A 3AI7A 4ROTA 2Y1GA 1E2IA 3OF3A 1PYDA 1YR3A 2Q6VA 4M54A 3PNKA 5AKGA 1X39A 4ZQIA 2XT6A 3DOOA 2AHRA 5BR8B 4QOJA 5IABA 3VI4B 1UBFA 4LRUA 1PDWA 4BMXA 2WT9A 3CF0A 2V98A 3JS5A 4WZAA 3T95A 4B79A 2WYWA 1YRLA 5A9RA 1JH8A 1LPPA 1XEXA 2XEDA 1CVIA 4W9RA 2PWAA 3DCIA 3KPJA 2OKCA 5AIAA 2AG8A 4MCHA 3WK4A 5JH7A 4CI0B 4N5LA 3EZ9A 1LFAA 1D09A 4QTTB 3R5HA 3QVMA 1QGED 1LDYA 2CDCA 3IB3A 3Q85A 2ZSKA 4FNAA 2ZI9A 4KUGA 3GAMA 2EFCB 5H68A 4N9QA 4RKWA 2QV0A 2PL1A 1BN7A 1K98A 1KJYA 2BGRA 3UV6A 1P0CA 5FA6A 2DJ5A 3ZBUA 3HZZA 1ZI9A 2Y1FA 2X0DA 3WSWA 3ZJ4A 2FEAA 2IXAA 2QTLA 3A3YA 3LA8A 4E32A 3G2HA 1J9GA 5BYBA 2OQIA 4C0BA 1HNWB 1IE3A 3SZMA 3TZEA 5EXPA 1YS9A 3PGXA 4I3GA 1TIPA 3M3PA 4PFJA 2VZ9A 3M9LA 3IBTA 1E32A 1KA9H 1C9KA 4HHEA 3OHMA 1LJUA 2CVZA 2G70A 1VLZA 3LTNC 4LF9B 4TMVA 1N34B 3AVPA 2ZYRA 1RAHA 3ZJYA 5LMCA 1GG9A 1Y63A 3F4LA 3LXXA 3VU1A 4BKPA 1GGVA 3HU5A 2QUAA 4QXAA 3EBLA 3WWCA 3BL8A 2Y71A 2BF7A 2Y1CA 1N1MA 4NG5A 4RLQA 4B85A 2I6SA 1IUPA 1PK7A 2FZCA 4RWZA 4M1WA 4DR2B 3U19A 2B4RO 3T7JA 4ZOQI 1E1CA 3KEFA 3L92A 4IJKA 4MAMA 3CUEF 3IEPA 3BVPA 3JQ6A 4FI3F 2WKWA 2XQJA 3GZJA 3HJUA 5CM2Z 5HZKA 3RYFB 3V2HA 2Q1SA 5I9LA 1L4FA 4OO3A 1J00A 1Q7TA 1U04A 3PUJA 2E5LB 2G80A 2PRSA 2QU8A 2Q3DA 4RV4A 3IP9A 2YCBA 1J8YF 4KFRA 3ED5A 3L7IA 3V3TA 3PIDA 1ZO8A 3N86A 3ETNA 1BMDA 4NHEA 1KVRA 1KO8A 2F64A 2IXDA 2J1LA 2ID7A 3I2YX 1Z28A 3OPXA 1I7SB 2J31A 3BGIA 1CEXA 1JYSA 2ATVA 2G9UA 3KLPX 4J0QA 2CNOA 3RGWS 4Q7EA 5F52A 3JV7A 3L7CA 2XRZA 1HTWA 1UOPA 1K7FB 1H2YA 2YHBA 1MV5A 2Z4RA 2DFNA 3WLEA 3ISTA 1ORHA 3G88A 3M3HA 1N6NA 1M2WA 5DK4A 1RLOA 3K9GA 5D5PA 1QZZA 1KZGB 4D3SA 5KQGA 4LYDA 2Q49A 1E4VA 2ZIEA 1J24A 1R8JA 2EZ4A 4IEFB 4MJ3A 4S3MA 3N9IA 4EMTA 1HYHA 3W90A 3RS0A 2Q3HA 4G0WA 4CCWA 3IODA 2ZSIA 4RULA 1ZRMA 2BCGY 3QM1A 4W5WA 1A2BA 4MHSA 4ZT7A 1ODKA 2OE2A 1BA2A 3DZIA 4TKUB 4DC0A 1JHYA 4OHMA 3OU2A 4KTTE 1OLUB 1UJMA 2C2GA 1TM2A 4Q24A 4XX1A 3WRXC 4ZMBA 4P7FA 4O0MA 1XHEA 3DV9A 1BYIA 4UXJA 5C5EA 1F6DA 2PBZA 2MSKA 1NJGA 3FDIA 1A9RA 3ONWA 3QOXA 1QX4A 2GB4A 2PUFA 1WEKA 2PKRA 2QE7D 4C5BA 3EULA 3WNBA 1D1TA 5HW0A 1PBNA 4KYUA 1X87A 3HB5X 2V9CA 2IY8A 4OK6A 4IQ0A 2EATA 4PO8A 4DVJA 5DXFA 5FBHA 5DHQA 2P6OA 5L9AA 5A04A 1OLOA 4U4AA 1YUMA 4PQYA 2FSPA 4YRRA 3RWMB 2ODWA 4JEMA 3IV6A 3PPVA 5IEBA 3MWDA 4AKTA 4DUZB 4RVFA 4QGHA 2X0FA 3UHAA 1N2CE 4NNOA 1XBTA 2XTZA 2UVQA 3B38A 3CUYA 5DNVA 4B3FX 4BWYA 4JZKA 4YXWD 4LFBB 5JNRA 1A5AB 1IBKB 3C6XA 5AM1A 1B2LA 1SXIA 4MARA 5H3CA 2WKSA 4I81A 3ZWNA 3HK2A 3L7BA 4LC9A 5KNBA 1OXBB 4RSRA 1ZK3A 2JGKA 4PZEA 1GA1A 4KLAA 3M4YA 1X9GA 4C4OA 4P36A 4LFCB 5HQTA 1KERA 5GJCA 3IVAA 4JJAA 1TYEB 2OC4A 3LK6A 2EX0A 3K92A 1PVDA 2O06A 5K3AA 4AK9A 4YCLA 2A33A 3VR4D 3TR5A 1UK7A 1VP9A 2MOKA 5DBGA 1M75A 4OJKA 4YMLA 1M1YE 2YYYA 3H17A 3KVYA 4Y9DA 3WE7A 4PM4A 3HA2A 1BE8A 3KE8A 3AEQB 4BP3A 1JFSA 2A5JA 5EJ2A 1QGYA 4L6CA 2WJYA 2WSBA 4RJTA 1P1FA 5EAIA 1UXHA 4BCDA 3EC1A 3KPUA 5J4VA 2Z2ZA 1NRXA 2MYUA 3CE9A 4F6RA 5LJLA 1CQIB 2J5BA 3FHOA 4PHFA 4GMKA 4R7GA 4V0LA 1J5PA 5H7XA 3TD2A 4YCCA 2PSFA 3DM5A 1FRVA 1G55A 1QYXA 5JJ5A 4A1OA 1ODIA 2LD4A 1BH2A 1H2HA 1VBNA 1JU3A 1SVLA 4M7PA 3A9TA 3WLFA 2GRAA 2JFVA 3LIPA 1Y8AA 3RR2A 2D54A 2G1JA 3ZI4A 2OM6A 3A26A 3HJNA 3U81A 4XJTA 4B7ZA 2VK4A 3Q87B 1BKSB 1EBUA 4ZRNA 4EB6B 4QFCA 3B13B 3EGIA 3OT5A 5KYWB 2VK8A 2YDXA 1PU2A 3DPSA 2HK7A 3ONDA 4LY6A 3NAQA 4UBOA 5B12A 3L0IB 1LFDB 1ZKDA 1BFDA 1HZZA 2HLPA 3N2KA 4J2OA 1KP3A 3KWMA 2VP0A 3MF4A 4PZYA 4QPCA 4U2KA 1ND6A 13PKA 1KH3A 1KYQA 1N3YA 1SC1A 1IQPA 2W8ZA 3BDAA 2H11A 3EISA 5TJ9A 3QX8A 4MWOA 2CJXA 2AQHA 2FP4B 4KP7A 4ZCQA 1VBFA 1QP8A 3CPJB 3L46A 5L4LA 2W90A 1CU1A 1V26A 1QSGA 3BXFA 4RX1A 4Y7CA 2EEZA 2BZSA 3LQQA 4D4GA 3I9JA 1Q0QA 1DG9A 3TX6A 4BXOB 4LF8B 3SR3A 3OTGA 3F74A 5I9TA 3KCQA 4QU5A 3IEUA 1Z7EA 4K9NA 4XUGB 3EBOA 2DHEA 4JVOA 1K5HA 5D01A 4AZ3A 3GLHA 2CK3A 1SVWA 5DTRA 4X44A 3GEDA 1RRKA 1Z2OX 4WUTA 5I8ZA 2YQ4A 5BXYA 2Y76A 3BN3A 4MR8A 1S4QA 3I76A 4EG4A 1NT4A 3WNVA 1FRZA 5K1ZA 1NNUA 2HF7A 4M9SA 5LP6C 2E4UA 3VJRA 2YTZA 3IKMB 1B42A 3O9ZA 4DMMA 2Q0QA 5IARA 5LXTF 3C6YA 3KS9A 3IJ5A 2H1FA 4MXDA 4YP6A 4GYJA 4N5IX 4R8SA 1A7AA 2QD1A 2Q8PA 5JECA 1P33A 4ABYA 2QDXA 1OTYA 5ITVA 3VGJA 2AJLI 1JA0A 2W6OA 4R6WA 3EWIA 4WVFA 2F1RA 1W6RA 2CHUA 2NZ8A 3B7GA 1O96A 1ZX1A 5IAJA 3BTUA 4LYHA 4KE9A 3FTPA 2XA1A 4YCBA 3RO7A 3UAOA 2MCFA 2AI3A 4I1IA 4CKWB 2OAEA 4BNZA 2XIJA 4JIMA 3OTOB 4AY6A 4D97A 2Q5LA 5CDHA 3E9CA 3ADDA 4AJ2A 1VXOA 5BSHA 4MPPA 2EKPA 3LC0A 1NW7A 1YNOA 2V54A 4X24A 4M1OA 4NH4A 1MAUA 1QIEA 3HNPA 1AC5A 1MTZA 5K0GA 2CSXA 1RCTE 1LRKA 4QOEA 3A0RB 2ESRA 4G37A 4KYIB 4RHUA 5A6VA 4D0GA 4ZODA 5LQCA 3LD9A 1G5QA 4N0PA 2NPIA 3JRNA 2HX1A 1N57A 1WPQA 2AC7A 2AN9A 2ENUA 4TTJA 2CJPA 4M88A 4EA9A 2CHEA 3UPUA 3KOUA 2LKDA 1CSEE 3PKJA 3E03A 5KPDA 1E3TA 1SXJC 1HQDA 1QOZA 3ER6A 1CIJA 4FGWA 2BGJA 1Z5PA 3NGMA 4MI9A 4PCVA 1IN8A 3D8RA 2W0SA 2HRRA 1JZSA 3UB4A 1MO4A 5DBFA 1H1TA 4R9SA 4PXYA 2P4QA 1L5HB 2TRSB 3GRFA 4OYYA 5NLLA 2O8DB 5H83A 5LOVB 2YIJA 4OUDB 1ZXLA 4KOAA 3JYNA 4QDJA 2DWUA 4NZYA 3TD6A 4B75A 1JB9A 3BKXA 5A7GA 2A35A 4OA5A 1XCJA 5B1IA 4TYWA 1SH7A 5HIKA 3H97A 4C6TA 1SU8A 1HDIA 5ICMA 4LNAA 4I4LA 4S05A 4GAEA 3I6YA 3QTLA 1XRRA 4LMAA 4ZI7A 1FLDA 4DLRA 2GYUA 2ZVQX 1U63A 5C5CA 4ZXFA 3RJ5A 1P4SA 3E2PA 3RFCA 1DKUA 3KJNA 3S4YA 1I9GA 1FJXA 2H5EA 2IPXA 5TV2A 4HWGA 1RQ7A 4K6MA 4FYHA 1SCIA 5KWSA 2JFZA 1D9XA 3MUFA 5BT9A 4PLHA 1XDUA 5BRNA 4KREA 4E33A 1RJ9A 1A5ZA 4I19A 4MI1A 4MIYA 2I6XA 5BSEA 4IHJA 4MA4A 3V9AA 2G1UA 2WPDD 1RWMA 3AEKB 3FWNA 1UP6A 4IGKA 1VG8A 4L7VA 5DPMA 4CCYB 5EHXA 1EUYA 3K9QO 3D6JA 2Q6OA 2RH8A 4R3NA 5F1OA 3TXAA 1Z0AA 3HXMA 1GNRA 2BONA 3T7IA 4IL5A 5CG1A 1T5HX 4D4KA 2QJWA 4BNYA 2WT4A 3FGPA 4TWBA 3MWGA 1K66A 1Z73A 1DJLA 1TYDE 1XU9A 2QGZA 2PSJA 2B1GA 2GTHA 2PUBA 4G5GA 2QT1A 2XYVA 3SC3A 3VO1A 4RTLA 1SA0B 3MRXA 3WL4A 1QWOA 5F9MA 4G0UA 4CFYA 2WIJA 2PRYA 3NHPA 1Q1QA 5CEFA 1QRSA 2NAFA 1BJTA 2GZ2A 1YQ9A 3PDIB 3TJRA 1KK3A 1I80A 4ASUA 3A6LA 1SUIA 2QK4A 3HKBA 4G0NA 1J2TA 1CT9A 2VRCA 5IHXA 2SKEA 5HZMA 2OO7A 3F3YA 3GT0A 1H93A 2FSHA 1QFSA 4IH4A 2CCKA 1HE3A 3OHPA 1P1CA 2AC2A 2GKGA 3JR7A 2UUCB 2VAPA 2HQ1A 2O52A 3WL6A 2P0EA 1X86B 3AYXB 3FWYA 2V6JA 1BTOA 4RDHA 4W99A 4BZQA 1JHUA 4V1CA 5MFPA 3ADCA 3RUFA 2KX7A 3DZ8A 4N8DA 5CA1B 1OX4B 1Q1NA 4DCGA 2GNOA 4RPJA 4GOKA 3NC0C 1Y6RA 2GZ3A 4YGXB 2NTJA 3DCJA 3V7NA 1MX9A 1RLIA 2AL7A 5A02A 2JLUA 4HG2A 1FX1A 4B7AA 4AJ9A 2HAEA 2IZZA 2HLHA 1U9IA 5TX7A 4IFTA 3SNHA 1S01A 2NZ2A 3EFEA 3GVHA 4K86A 3OURA 3WMRA 4FMPA 3BGDA 5BSWA 1KI1A 4GSLA 1CY6A 4R83A 4G97A 4XUEA 3L7JA 2HPVA 1E3IA 3ANXA 1I9CA 3VSDA 2WVAA 3O3CA 4CF3A 2BRUC 3P2YA 4KH0A 2O8CB 3BG5A 4GX2A 4U7TB 3OSZA 3WLMA 2WG1A 4RK6A 3G0IA 5SV2A 4BQPA 5JUWA 4RH3A 3LAWA 1OX6A 3DTNA 3R23A 2HIHA 3M6UA 5G1PA 3NNNA 4FYVA 3T1NA 5JCJD 1UXJA 3X3HA 5FDFA 4DUPA 1ZONA 2JHPA 3L1UA 3WYNA 1XU4A 4XD7A 3B6KA 2CNLA 3HXLA 4YJFB 1YS7A 1PVOA 3C3PA 3GMIA 1TECE 3HJHA 4P4SB 4PAGA 3BC1A 3ZWDA 4YYZA 1PDVA 3C87A 4AP6A 4YX9A 3S0JA 5T3UA 2F1KA 2B7LA 3KZ1E 4CQMD 5AVTA 2H4HA 2IV3A 1ZN8A 4C6HA 1N0UA 3A9CA 3O5AA 4UTZA 2WW8A 1IBRA 4IVNA 3PQ8A 3EVAA 4L76A 1PT8A 3BWYA 3OJLA 1OZFA 4Y6PA 5TMDA 3O92A 3PNBA 2IKQA 3I32A 3KEQA 3WWOA 2PS3A 3TD9A 1RYHA 4UU7A 3NAZA 5EXSA 1YQTA 3DGEC 3NP9A 1PI3A 4B6EA 4J7UA 4BAZA 1I3KA 2NNWB 1I01A 3NJRA 3SKVA 5I7SA 1QHGA 3QKRB 4N82A 1PFYA 2HJGA 2VCYA 4BNJA 2XAUA 1H6BA 1TCBA 1D2HA 4J0KA 3EODA 5KSOA 3BREA 1TT5A 1E99A 4RMJA 4G2TA 2XUQA 1UEIA 3FOEC 2PXXA 1Q14A 2V8OA 3FDJA 4HDKA 1Q17A 1SJ9A 2HCTA 2JFYA 4N3AA 4CN8A 5CBKA 4CEJA 2X3UA 1CJMA 1XA4A 3HM2A 3PE6A 4TRNA 2AR9A 2P2YA 3Q2KA 3L0DA 3CF4A 4ZVSA 3WL8A 4F7DA 4YRPA 1ZXBA 3AX6A 1KL7A 3M1YA 1H2AS 4TMZA 4IJWA 2NV6A 2AUNA 3G1WA 5B64A 5JQWA 1NC3A 2H7VA 1SD5A 3WWPA 2EX1A 3O8BA 4D9MA 3EDCA 1O7JA 3SXPA 1DX9A 3OTHA 2OLKA 4TLEA 1KMNA 2BHNA 2ZRGA 3EZ6A 5AP9A 1R6XA 3FPBA 2V3WA 4NMMA 1QP7A 4YY3B 1BXGA 1FK8A 3RYHA 2RK3A 1YD7A 2VZLA 2WJPA 3AILA 3EY9A 5DP1A 2UZ1A 1GGNA 2VT2A 3K9HA 4MQMA 5T57A 1XT6A 1ZZGA 1K97A 2P1RA 2WSLA 4ZRMA 5I9SA 2HUPA 4L28A 3ZBTA 3OQOA 1QFXA 4X3PA 3VSBA 4BWGA 1TKRA 2NSYA 2EJBA 4P4GA 4ZA2A 3UKJA 2CXTA 4XQEA 4YV2A 1JMKC 1YCHA 2CDAA 2WNSA 4NP6A 4AWBA 2EJUA 4Q6BA 4DWVA 2CLFB 3HVIA 4RFSB 5TY0A 5K05A 2IDZA 3LKZA 3R9IA 2CUKA 3E84A 3QBDA 1PHRA 1D0SA 2IYZA 4F93B 5FWNA 3QUAA 2YOFA 4OKNA 4C2UA 4G23A 5EHQA 4U8HA 3WLAA 1K06A 5CFNA 3S2IA 1GCOA 1OJ7A 4KR9A 2V7GA 2W2XA 2QZZA 3IOCA 4HZUB 4YUWA 3RTDA 3OIYA 2XCTB 2B30A 2YZ7A 2IP4A 3RK1A 1ILEA 2VUTA 1E7QA 3PQ2A 3W2TA 1XLTC 3CA8A 4MS3A 1N6IA 3ZHCA 1A5BB 4BQFA 1EUCA 2B8WA 1XQXA 1TU0A 2PGAA 3G82C 4MRAA 1A82A 3GRKA 4KMOA 5A62A 4S0XA 5EJ6A 3CVVA 3ICWA 2C1ZA 5HIJA 2V7WA 4AKIA 2JRLA 9GPBA 3O4FA 1P6QA 5HQJA 2OOSA 2NP6A 1SQ6A 2VDVE 3A3OA 4KN6A 2EWWA 2AA3A 3K2EA 2D00A 4S1WA 2VT7A 3SJ7A 1II8A 1ODCA 1WD5A 2F6RA 2R87A 1WR8A 4W8GA 1QHSA 3ZDZB 2P62A 4NYMR 4D3DA 1C9YA 5KU7A 5CJPA 4AY5A 2QTZA 3DWIA 3C3XA 4U5XA 2QBYA 3BCUA 3LHSA 1GUFA 4Q4AB 2WILA 1ZGAA 1S96A 5I7UA 2M6KA 4KW7A 3QLUC 1ICEA 5DSZA 4EARA 2X7JA 4CMGA 2GAJA 3MRSA 1V8PA 3PT9A 3G89A 1AK2A 3FROA 2WIBA 1FVOA 3KDAA 1TT7A 4WBNB 2LKCA 3MAGA 4P54A 4XLZA 4G0OA 3R5JA 3UCXA 1GAJA 4D46A 4HT3B 3R40A 4JI2B 4TXMA 1JXMA 1LF0A 3IJPA 1H85A 2ZETA 3PD1A 4UTOA 3WRXA 4I2NA 3C8HA 3A1SA 5EYPA 1SXJD 2WOOA 4MK4A 4YCNA 3S1AA 3FZEA 4EVQA 4TSFD 3DYBA 2A9JA 2E37A 4J07A 3T99A 1JG2A 4AY3A 3MNFA 4LZJA 1C7EA 2O1WA 3NONA 5HRCA 5C52B 5ALLA 4XI9A 3ZDRA 3OY7A 4YMVA 1NOKA 2FF5A 5TDHA 1DC3A 3MJDA 1W88B 3U5TA 1QC5A 1CW2B 2JFHA 3QLJA 4D26A 2CMFA 2IUTA 4KQHA 3TOZA 3GIWA 1KZ7B 1T3HA 3LUHA 5CM9C 2WHPA 1EQUA 4GPTA 1U8FO 4Y9UA 5A0FA 1H3FA 2CD9A 4FHZA 5FADA 3QIAA 5C37A 3UENA 2X6QA 2H4JA 3K5WA 2WLSA 1TM4E 1K7XB 3MWEB 3OZIA 3I92A 4NYMQ 3W5IA 4BVFA 2HFKA 3ZWCA 2JFOA 3WB9A 3K32A 1ORVA 4H7EA 3ZWMA 3T38A 4B3DA 2W98A 2DUUA 4MQUA 2A9VA 3R9WA 4WDQA 1TGVA 1J7JA 1AQUA 4N8SA 4FEAA 2ADOA 5B3JC 2HRQA 1ZL0A 2LP4Y 4KWHA 1U5BB 3OBIA 3LG2A 4G4GA 4YAUA 5HZHA 1VPWA 2J30A 3ZKWA 2OCPA 2BV3A 3G79A 3GH1A 4N4AA 4HNRA 3H84A 4PFQA 1JG3A 3VC7A 3KSAC 4IUCS 5GPBA 3EG5A 1JVNA 3GX1A 4TT3A 5AVZA 2W2OA 1GUAA 2GCNA 1GRNA 3W8EA 3ZHVA 3EEOA 1ZYUA 4PV7A 5F3WB 4JB2A 3SKYA 2H65A 2VJCA 2Z3VA 5EP4A 2G36A 2O23A 4J94A 4EPYA 1MW9X 5AVVA 3MJVA 4NXMB 3GLFA 5BWMA 4ZVPA 2VTEA 3WLPA 1MJFA 4IRMA 2JIMA 2C3OA 5IASA 1FDOA 4OX9B 3A6ZA 4N7JA 3RVDA 4JP5A 2NT4A 5EMNA 1JXOA 4LXHA 4DT1B 4PLGA 4EHJA 1Y48E 2YHIA 1KETA 3H7AA 5G1NA 1IB0A 2BGTA 4G5YA 3D3WB 3ID6C 2PS0A 1OD6A 1UWCA 1NYTA 4KJXA 4P84A 1WMAA 1CY4A 5HUHA 3VTKA 1VHQA 3PR2B 4K6FA 4TXHA 1E60A 1XZIA 1CEEA 3Q7RA 1UMBB 1NJ1A 1J8DA 1EFUA 5B30A 1GTRA 3GUCA 3DEHA 5EJMA 5BRAA 4Q3AA 1GSOA 3UAGA 1IY8A 2QLTA 1IMJA 3T5TA 2I87A 4F3TA 1H9CA 2ZJ2A 1L7EA 1JE1A 3OT1B 3OLCX 4YMTA 2JLXA 4F9TA 4FWIB 3W06A 3LIIA 3FWPA 5CA0B 1SHZA 4XKJA 1G2PA 1BHQ1 5K03A 1JNXX 3RS4A 3AHHA 1YKFA 5I9NA 2HDNB 4G5SA 1YZHA 5J2TF 2FDXA 3LUCA 2IWHA 1KTIA 1JFFA 1UZAA 5TQ0A 1Z4JA 2W2KA 3VKFA 3EEFA 1LVUA 1M33A 5B1HA 4QYIB 3UK0A 5BUSA 4ZCTA 1U11A 4CMKA 1DMRA 1OXTA 3ND7A 1WBDA 2E82A 2QX8A 3TLGB 3RVQA 3QUQA 2IH5A 4DCCA 2OD2A 4Z1MA 1Z88A 4R8RA 1Y80A 1YE5A 3AUXA 2OHFA 2F1JA 5K8JB 5KKNB 3UW3A 1Y6QA 4FFMA 3TL3A 2RCNA 1U6JA 4BNLA 2J59A 3ROPA 4KXQA 5J4YA 5AI6A 3HCBA 4NK4A 3UYLA 3HFJA 3RNLA 1JQ5A 4JUCA 3AEXA 1JYEA 2UUPA 3FPKA 3P94A 2PKQO 4MUGA 4EMSA 4YR9A 1DAPA 4OBXA 3VHXB 1XGKA 3L9XA 1LRLA 3DYIA 5DW3A 3ZCQA 2W4IA 3JAMA 3V1MA 3EIEA 5LP6A 4HI0E 4MS1A 2Y1EA 1YULA 3KKZA 4RMIA 1QYDA 3IO3A 4K26A 3DBRB 4PYLA 4HQ6A 3GP8A 5T5QA 2HSEA 3K0KA 3LO5A 5LA6B 3WTBA 1UBUS 1NPTO 1P8JA 3R1IA 3VBCA 4NARA 5F3RA 5L8VA 3TG2A 3AM1A 1SK8A 3C6KA 1UH5A 1XG5A 2FFAA 4GLFA 5IC4A 4DB4A 4DR3B 2W6MA 2E4XA 4L3VA 2I34A 1Q50A 2JJQA 4GL4A 4LQDA 3C3YA 3EDQA 4KGZA 1Q20A 1ZK4A 1ZK0A 5C1BA 4UQPA 4GVXA 1TD1A 1P3Y1 2OCKA 4YAGA 1FYDA 2QNBA 4YRNA 4DWWA 1KE1A 4RS4A 2VIIA 5K3BA 5K0NA 4JUIA 1TIKA 3WNZA 3E81A 2O6LA 2JAUA 4OHCA 3FUCA 2VQDA 3UA3A 3F73A 2Y68A 1BG6A 3HJRA 2D5IA 2WM3A 2AYXA 2P6MA 2YX1A 5JAZA 2GMWA 4C30A 2OC9A 3SIXA 3L7KA 3NXKA 3ASUA 4GRIA 4R2JA 4DCVA 4F2GA 1CDEA 2PKXA 5DI3A 3ST7A 4AF7A 5TMEA 4C5AA 4FHFA 3OPVA 5E8JA 3NOQA 3QI7A 3G49A 5H81A 1JR2A 4PICA 3UGJA 2P8SA 1CR4A 3BD7A 4YRDA 5JS8A 4RSHA 4REQB 1LXCA 3D5TA 3HYNA 3JZAA 4RPIA 5CDFE 5A4KA 4CM9A 2OUKA 2FGKA 4MX8A 2CVFA 3B36A 4HWOA 3UG6A 2GCIA 4N6NA 1KO7A 4OI4A 3K0CC 2HHJA 2C4HA 1RWQA 2Y4NA 4PQEA 4EH1A 4BTEA 4F4HA 2PVCA 5KTOA 3IE1A 4X91A 3M49A 2K87A 3RTCA 4IY1A 2JZCA 1PZNA 1VBMA 4MYUA 4DCPA 1F4PA 4KVAA 3RUEA 1UOQA 2FPUA 4IEEA 4CLRB 1KSFX 1W0JA 3KD3A 1W85A 3T7DA 2AUTA 2IOFK 4HS9A 2O5CA 4RV9A 1Y3CE 2D0PB 4YMSA 1V16A 2AD5A 1IM2A 1C0EA 3VPCA 4MROA 3BX1A 4YFYA 4M1KA 3QVGA 3S70A 1S8FA 1D5WA 3SR0A 3GNTA 2O3UA 3HJAA 3TOXA 4AKSA 1WUKS 1T5DX 2O0LA 2O20A 2XSZD 2GLTA 3MTJA 2A7QA 2BGWA 1Y8QA 1IEVA 1CETA 1CVLA 3CSSA 4IIJA 5JD4A 3I58A 2RHMA 4HN2A 4MUHA 4EJMA 1MMFB 4L22A 3IEXA 3GLIB 4MR9B 2VPYA 3DNPA 4X0EA 5A06A 1VJTA 3CB4A 2QW0X 4W7SA 2ACKA 4CM8A 2ZG6A 1HG1A 5JJBA 3JYOA 4BQOA 2GI4A 3Q8WA 4KO2S 3FVRA 3P9KA 4KQ2A 4P08A 3UJHA 3VR2A 4JLOA 3VJKA 2IOQA 2YJ4A 1WBJB 2ZWOA 3EGXA 1WA5A 1PR9A 2CYCA 2JLAA 1EAYA 2IBSA 4RIEA 4RVCA 1GV1A 4LCBA 4PQGA 5I9MA 2IYEA 1CBUA 4CM4B 1P3DA 1PR5A 2G9RA 1E3WB 3PENA 4QICA 1XL0A 3DV0B 4G1MB 1NQXA 3HDTA 3G9XA 1JZTA 1P9RA 1RJDA 4JEIA 3SS9X 3PXEA 1BXRA 3GQBB 4P32A 4TS4A 3JVUA 4XB1A 2X6RA 5EP1A 3OQ1A 3FNGA 1IHXA 1XQ9A 3WLSA 5EZQA 5AHXA 5KEIA 2C96A 5TEWA 1W46A 1W2GA 3OE1A 4EJSB 2XUPA 4BS9A 4ML3A 1QFJA 1PZEA 1D6NA 3BHJA 4G8DA 2PO7A 2YWRA 4HRVA 2JIZD 3KQTA 4NU8X 4QQ8A 4RKYA 4TWZA 3TAHA 3RARA 4WSOA 1W2WB 4CHGA 3L7OA 4DEYA 4ZDKA 4HZGA 5EOVA 1YB2A 4KITB 4MYTA 1NQOA 1SM4A 2OCLA 4HUQB 5K2MA 5CA1F 3EVCA 4P4LA 4YK7A 4C20A 1E4YA 4H35A 5DSXA 3EG9B 4A0HA 4E5YA 2VBIA 3FHJA 3JQFC 2RI1A 4K87A 3EF3A 5C7YA 3JQRA 5LR6A 1EZ1A 1W4RA 2FG7C 2VJMB 4R3WA 4E5DA 4AS3A 2BTQB 4H1VA 2OXTA 1PL8A 3W3ZB 5A1TA 3U3ZA 3NYIA 2IELA 1IVYA 1XMXA 4LJ9A 3TF5A 1T36A 3VU0A 1JQDA 2Y0CA 4GO1A 3UJAA 3ZWBA 4D8XA 1YH3A 1I3CA 3HN7A 3WB1A 5AW8A 3C7TA 2BRUA 2FMIA 3IA7A 4BMVA 1SUDA 2TMYA 4V0QA 3F71A 2KI5A 1MU0A 1I4DD 5DM0A 1OYOA 4X8HA 4ZK6A 4C0JA 2Q7OE 5AVQA 4MP6A 2VF8A 3NHLA 5FWXA 1CE8B 1Y5MA 1DHRA 1O5OA 3I45A 3PLNA 4TWAA 3ZCXA 2F1OA 4FT4A 4TN1A 1Z0ZA 4R1QA 3NIFB 2ZB2A 3H75A 4GLOA 4C3VA 4HKTA 1N33B 2C0PA 2PTHA 2B4TO 3Q3CA 3ZY6A 3TJMA 4YR7A 2GPTA 4AMGA 1R4MA 3R76A 2GLXA 2JFQA 1WPGA 3HWRA 1WCYA 1LPMA 3KZVA 3GU3A 3LX6A 4Z3DA 7ADHA 4N6OA 2GKOA 1EUZA 3VC3A 3E82A 4XWYA 3QXHA 3C97A 1GQSA 4LISA 1E5QA 2H9YA 3F8SA 4GC5A 4HQ0A 2CZCA 2ZDGA 1Q77A 1V2HE 3EIWA 3IPXA 3N75A 3BBPA 2B2XA 4WK4B 2IWRA 1R6AA 4WZ6A 2AXNA 4GBMA 3VR6H 2VYNA 2Z5VA 3MOSA 2Y6UA 5FFNA 4HXEB 3FF4A 3O1IC 2H92A 2JHGA 5A03A 1WSBA 2C88A 2RCYA 3BTVA 1E3QA 3CEJA 5JCXA 2PWYA 4EF5A 2X0JA 3EIFA 3HCCA 2XB8A 4ZOLB 3QSYA 1XDWA 3GCWA 3UA4A 1NLYA 1URPA 2GM4A 3V8EA 3G2QA 1DPFA 3ZE8A 1RRVA 2B2CA 2R0QC 1Y7TA 3KL4A 2IGTA 2OOKA 4FFLA 4TYYA 1C8BA 1Z0KA 3VOBA 4X6YA 5IDQA 3W5AA 1R0ZA 1YB4A 2BFDB 2E18A 3CCBA 5ALDA 4AIRA 3HP1A 1WW3A 4ZDJA 4EZIA 3CH5A 3GL9A 5BN5A 3Q3IA 3WB2A 1USGA 4NR0A 4FCWA 3Q7QA 5HJ7A 1X80B 3JRWA 4ECEA 2IY7A 3ABQB 3BICA 1LLFA 3EVEA 1ESMA 1MQ9A 3R3SA 4X5OA 2HK9A 1G6KA 2G9NA 2A0FA 4J7XA 1PJZA 1Z0FA 3QX3A 4IMIB 3MLEA 3JD3A 1C3XA 2IXTA 3TTSA 4WX2B 2R1TB 3JQBC 4L57A 3W5UA 1WMDA 1OB5A 3UV3A 1U2GC 4IMRA 2GBFA 3I2FA 3S29A 3HRKA 4G0PA 4C6SA 1UPUA 5EJ9A 1BSVA 3QKSB 2IC5A 5F2NA 1GKYA 2Q6TA 2ZJ4A 4GRAA 4MWTA 1VRCA 3U7EB 3E8SA 1HQYE 5JBNA 4FP9A 4I9FA 2C7GA 2V7EA 2OHJA 4MVJE 3RTEA 3HE3A 4LI0A 2MMCA 4X41A 3IT0A 3QNMA 3KZOA 4GI7A 4HAOA 5MF6A 4MDEA 2I4RA 5L53A 3WLHA 5IJ0A 1H4TA 3CNEA 5MGNA 2LWIA 4BAGA 4DJEC 1QHHA 1O9BA 1ZOLA 2B34A 5KMGB 3C1AA 4PZAA 1SUCA 1Z4NA 3MJHA 4ESHA 4HDRA 1SUAA 2RDMA 2WHYA 4D44A 5JNUA 4DUGD 5F7XA 1XNGA 5CNJA 2BJHA 3BMOA 4BNWA 4O4HB 3CLRC 4UATA 1XLTA 5ALKA 5ESWA 4DM4A 3JSXA 3TRIA 5M34A 3TVYA 4XYBA 3T5BA 1IXRC 1RAAA 3DZCA 5DHAA 2P75A 1MENA 3ROXA 3GIDA 3V7FA 4D9GA 5F73A 5BT8A 4N40A 1NXTA 2MSDB 3DXYA 3EIHA 3KAQA 4RIHA 4AJPA 4B71A 4ZYZA 1O57A 3E4DA 3JQ9A 4XIYA 1XTIA 1EFHA 1FVXA 1UAGA 3BH6A 2A57A 3VVLA 2HPAA 2NYAA 3U44A 2DPMA 2ZZMA 1XK6A 1ISHA 1QHEA 1MB3A 3QX7A 1C9NA 4QUEA 3GGOA 4CEHB 3EOZA 4D8UA 2J8ZA 4E88A 4Y18A 1NP7A 3TZCA 3BA6A 2DRIA 1YDMA 1FP2A 4EUKA 4DBLC 5BWLA 1DS6A 3GFOA 4CKXA 1AA6A 3U4QA 2HHLA 1DELA 1L4UA 2QTBA 3CEHA 3P8ZA 1FFHA 4LDAA 5E9JA 2IP1A 4O2BF 2CFRA 1TYBE 4YRBA 3NHYA 3L7NA 4X3OA 1WDMA 1YL7A 2ZITA 1DB3A 4IIVA 1U0JA 3DBOB 5TVGA 1KDYA 4ZMSA 6REQB 4RJJA 1Y4SA 1FP1D 1AK1A 1LGYA 2P3SA 4O2LA 3SQXA 3LH5A 1DTWA 3U31A 4F72A 3D6UA 3EQ2A 1DIGA 3NVMB 3RJMA 3RRFA 4M49A 4E2FA 3JWEA 1KO5A 2GQ0A 3D54D 3ENNA 5E9QA 4II7A 4CNBA 1UOEA 4QTYA 2R44A 4ZCRA 2YQZA 2NTNA 1V95A 4XLLA 2WD7A 1ZMRA 2GD2A 4FIZA 3RG8A 1WXIA 2MTBA 3G6WA 2QDKA 3D4IA 3PC2A 5BN4B 5TT0A 3LT1A 4ZAVA 5EJ7A 2YZNA 3GOQA 3QKWA 1W5TA 3CNHA 1D8TA 1OIXA 5DB4A 2BC9A 5SYNA 4RMHA 2NU7B 2CWDA 4NOJA 1HE1C 1IB6A 3IVCA 3CZPA 2FWPA 5JAIA 1RXUA 1XUOA 3G2KA 5J9FA 3WP0A 4JXZA 3VQTA 3VO9A 3A0UA 2CW5A 3HWWA 3H3JA 2VTBA 1ISPA 4QOGA 4RIFA 2DB3A 1VMAA 5B3JA 3I3OA 3HCEA 4YAWA 4Q03A 4MJXA 1PLJA 1U2SA 4DY4A 4DLSA 3X1XA 2XKAA 1FXUA 1ZCJA 3WGQA 2VN8A 3FMOB 5H80A 1WHSA 2HLDD 1FMTA 1M1NA 2OG1A 2VLIA 1E63A 1PTJC 2VDJA 1EJ2A 3GLVA 3ONNA 4YP5A 1K0FA 1JJFA 3ZU2A 4ND2A 4CXMA 3NB0A 4X92A 4XYGA 2B7CA 4MGIR 4U2DA 2WPNA 2W70A 2W71A 2GJ8A 3C3MA 2HMYB 2YV2A 4Q5IA 2VXBA 4WT7A 3ZDYB 3ZK9A 4AC9A 1T9AA 2WFAA 1ODJA 2GPJA 3GLUA 1E5VA 2HF2A 3KR1A 5AVYA 4KBFA 3EDOA 4G5FA 2VZ8A 2ODBA 1NBME 1PUIA 3OE7D 4M0DA 1P0QA 2ECQA 5TEVA 4V3CA 1NVAA 3FFXA 3IUBA 3N2YA 2I8AA 3ZOZA 3ELWA 3ETHA 5L7WA 1RXWA 4B47A 1V9SA 1PJAA 1YQEA 2DLDA 1J39A 1CUSA 3HNOA 4QXPA 3BCSA 5GONF 1DBVO 5DV9A 3CNLA 2QMZA 1CJVC 4EFNA 1LY1A 1RYMA 1CR2A 2BP7A 3ABIA 3FPCA 2L42A 3OEEA 3QQ5A 3ITKA 3QELA 3DMTC 4A5OA 4ACAA 3S28A 1CS0A 4MPRA 2ZYIA 2V58A 4L3WA 2DBZA 4P4UA 5KX5A 3STVA 1JVBA 1ULUA 2RGEA 2PU5A 3WSTA 2BE9A 2JFUA 4XH9B 2COEA 4W1RA 4EAAA 5HR5A 5D85A 5FBWB 2Z30A 3GGPA 3EIUA 4ARCA 2AFIE 4L51A 4EGCB 2PMKA 2PVSA 3UB2A 4GI1A 3E3AA 1OF1A 3QIVA 1TVKB 2I66A 4ZPJA 1T2EA 3RC1A 3TTWA 3ZWOA 5IZ4A 2P2SA 4OX9Y 1EFLA 1TLLA 3THRA 2G63A 3HR8A 1EFDN 3OE4A 3LXUX 3AOEA 3GAAA 3L49A 4FKMA 4RY8A 3I73A 2ILTA 4FFBA 4KO1S 1AXEA 1RZ3A 3HDJA 4QYMA 2BTOA 4JJKA 4DV1B 1D0IA 2ZYGA 1MEOA 3M7IA 2KHZA 4C7OA 1Z8HA 3P19A 3AIIA 1BDHA 4K3VA 4KO3S 1Z5NA 2XT0A 1K63A 3L93A 3GLGA 3DBLA 1S2MA 3F1KA 3IULA 2IVFA 2Z1DA 4UMDA 3FTNA 3PJFA 5BO5A 1SR8A 1D6SA 1YE3A 3S1SA 1E64A 3ZGXA 1Z6YA 3BHNA 1W1UA 1P7ZA 3AHJA 3FWKA 4QUBA 2Y0DA 3T0GA 5HX7A 1PJ2A 5EUMA 4JSTA 4TV8B 5C0OE 2GVZC 3LCCA 5KNCA 3QG1A 1U2EA 4BFSA 4KQJA 1IZ9A 1CJUC 1MO2A 4NONA 1U7UA 4A23A 4GIBA 3F0TA 1JG6A 4WADA 3OOYA 2ORYA 5ICFA 4QU9A 4QZVA 1GAXA 4GI2A 2A9OA 2WZCA 1V35A 3M1IA 3PXDA 3JVEA 5F4BA 2DT5A 2VNIA 1IRIA 2ZI7A 3KDSE 1CFZA 1GP2A 1MXFA 4OYHA 3PCRB 1IWPB 1LV8A 3KKKA 4YMIA 2MYNA 2G04A 1YVDA 4E12A 3TECE 4H59A 2P1ZA 4ZPXA 4Y1EA 1OAKA 2YW2A 4UZFA 1MO5A 2XNDD 5TSDA 4AF6A 4BN4A 2IU3A 4IXDA 3ZLVA 5KYYA 4N0MA 3NGLA 3LECA 2QUJA 4AO7A 3FDZB 4COOA 3ESRA 3K4HA 1MCZA 1NR7A 5JY1A 3AJAA 3IESA 1KOGA 3NM6B 1Z62A 3QE3A 2FSIA 3LK7A 3MGAA 5D1NA 4RTJA 4RZUA 5JPIA 4ESVA 1U4OA 5GINE 1TQ4A 3B5IA 4FFWA 5MN4A 4R0MA 5A0TA 2JLWA 2XRFA 4R5MA 4Y2HA 1RC1A 3U4CA 4HGRA 3MPUA 1EWKA 1ZN9A 1UXIA 1AM4D 1ZBDA 3K0CA 1DMSA 3OTQA 1GG8A 2VP3A 5DGDA 2ARKA 1T43A 2BHRA 1XMIA 1FUUA 2Q4DA 2UDPA 3DUFA 4HYQA 1Y81A 4DRXB 3ADBA 1LZLA 2QROA 4GLJA 3ZHTA 5FNZA 1IG3A 4UUAA 4ICIA 4P82A 4UULA 2UXDB 1I5RA 3EEIA 2B1IA 2XKBA 1J33A 2AMFA 2RHBA 2OK7A 2ZSDA 1GQRA 5DWQA 2X0NA 4DL9A 1ORDA 1ZC4A 3JCZA 1S8AA 4WFKA 3L7MA 4DY6A 1SN7A 1G2OA 1DOHA 1OAOC 2C9MA 3MT9A 4K1LA 1NGSA 2H8GA 4HN4B 3ICPA 3DD5A 3NHUA 4LBVA 4PYQA 4ZTBA 2CL0X 3FWHA 5BV8A 5AW2A 1TKAA 5DOVA 3ACDA 3JATB 1CD5A 4NNPA 3TRHA 2ZKIA 1OFGA 5AM4A 3WJ2A 1G42A 5ALMA 2RBEA 3CEAA 3Q5GA 2JBHA 1WQ4A 1KJQA 2CYAA 3MGCA 2H3EA 1UKCA 3PNVA 4R81A 5JYEA 4NFSA 2A5GA 1RAIA 1S1MA 3GLSA 2GGSA 1K2VN 4JGBA 4FYWA 4WXYB 3E3MA 3OM9A 3OWHA 4YONB 2JGDB 4ZCLA 3HJFA 1MDBA 3A9SA 1UJ5A 3A6KA 1B0PA 2AN4A 3C7CB 3ZY4A 5KTNA 4RS3A 2G76A 4FOOA 3UK1A 3DTVD 4HNTA 3B1XA 3ESQA 2R96A 1E9DA 2OV8A 3KXDA 3VSCA 1BHSA 4MYHA 1MEEA 1HYEA 2Q6LA 4FYPA 3UPTA 1XFDA 2PCJA 4MWSA 5GADl 5SY6A 5K0LA 1XEWX 4UXHA 3E9RA 5E4TA 3RSOA 1Y9DA 2Q62A 1CY8A 3P5SA 3M1AA 1W7AA 5TGTA 2MMGA 3FMGA 3EEBA 4FD3A 4Y2UA 5JJIA 1UZMA 3F6EX 3A3NA 4EKGA 3KZKA 1BYUA 1JR3A 2PBRA 1ZMOA 2RGGA 4LFAB 3SE0A 1FFXB 4ZYXA 4YJDA 1NI4B 3I42A 1OBOA 2GJ9A 1R5OA 4AD8A 3QA3E 2BFBB 1L4MA 3ZQKA 3P9ZA 5KWEA 1E1NA 1NLFA 2GCOA 2QV7A 3IXMA 4S2EA 5IN5A 3P27A 4DMFA 2ZIWB 3S2FA 1HT2E 2RAUA 4Q9HA 3LOUA 1XN1A 1IJKA 4N5HX 2AOWA 3D8UA 3UK7A 3IEMA 2Y1LA 1PAUA 4QEKA 1GARA 1WS6A 4FR5A 3JQFA 5AJVB 2GKSA 2D8AA 2QMOA 2YN2A 3FJYA 4WXEA 4P81A 1SUEA 2QIOA 3RYFA 3VPDA 1EZ4A 2A3NA 1GTG1 3PHBE 4NI5A 5FUBA 3WK7A 4B9AA 3SDSA 3EPPA 1F14A 1DUVG 1H5NA 1TMGE 2A0YA 2ZU0C 4FKBA 1Q3KA 2VDLB 4GBGA 4CT0A 5KNDD 2Z8ZA 4OI1A 2VK1A 2VKQA 3N0TA 5JZ9A 1EX1A 2BEJA 4O4LF 5B2ZA 3M9WA 1FZQA 5UKDA 3CINA 3DP7A 1U31A 3KWFA 1CY0A 4U8GA 5PNTA 2JD0A 2NZVG 4MW2A 4AJLA 4BKRA 1ZPDA 1SKMA 4G9GA 1OT5A 1SUSA 3IBSA 3INNA 4HNQA 1AUQA 4H2DA 4AMVA 5A4FS 1Z6AA 3O1LA 3KQLA 1ZUHA 4NJEB 4QYXA 2XOKD 1N8TA 2OP1A 3R9KA 1K6MA 4H16A 3CF4G 4P3XA 5C51B 3UCEA 1X1CA 3BXOA 3QWAA 2O8EB 4IR7A 4NPCA 3G1TA 3JU3A 1NSFA 5C4IA 2Q3MA 5HM6A 5JYBA 2Y0BA 1GZ7A 2DKNA 3DE6X 3HMKA 4E5UA 5JFGA 1FQKA 2AJ8A 1CRWG 3KCNA 2YY6A 5C1OA 1TZCA 1ZIYA 1BA3A 4HFNA 2EW8A 1XKTA 2WJHA 1T6NA 3L2OB 2KE5A 4UCWA 3EPJA 4I08A 2FNAA 2PVPA 1Z2EA 2ZVPX 2A9FA 3BILA 2W11A 2Z9CA 1ODLA 3E2IA 4NOKA 1RZUA 2X5OA 1W30A 2BGKA 1IVSA 1P4AA 4KVGA 2AE2A 3K15A 5B1SA 1SOUA 1WULS 2Q9BA 4TKUA 2IYLD 1RQNA 5P21A 1TCVA 2AFIB 2I1LA 2QZJA 3TZKA 2FFHA 3ND6A 5I4IA 4OL0A 1JFVA 1I1HA 1OLUA 2E4YA 4D4JA 1N77A 2DERA 5COAA 2EF1A 2F1IA 3OUZA 2OMKA 4UU1A 2MYTA 5JXJA 2ZB4A 4X71A 5CPFA 3NDJA 4NH0A 2IV2X 5LNK6 3D2CA 1UAAA 3QYAA 2OBBA 1LJ8A 1SD2A 1XP5A 2Z95A 3W77A 4A3SA 3FCCA 4HXFB 2G08A 1E3EA 3CWQA 3SBOA 2EYUA 1XCPA 2HQSA 4LK2A 1L5VA 1FS5A 1NQAO 2VYQA 3OPYI 4LF4B 4XB6B 3HXPA 1XDGA 1XKXA 2XMCA 3JQDA 2W2LA 4ETIA 4NCXA 5LNK1 4FZ5A 4KB5A 4L75A 5FWYB 3AHEA 1JTEA 3DF7A 4HNAB 3ZY3A 3UJDA 2W93A 4IQGA 4YQFA 2G07A 2GZ1A 3VM6A 1NVDA 1AF4A 2QRVB 5DCWA 4BKQA 1YFKA 3TLAA 1XP8A 4ZQCB 4EI7A 4P92A 4C0HA 2VXCA 4C88A 1O08A 1X14A 3ND9A 2I1QA 2QTAA 1P0FA 1COWA 1R0KA 2BI4A 2RHHA 2ZZKA 3JQBA 5LWHA 5LMNB 2QB5A 4BUCA 3DDUA 4LZNA 1EJBA 1MJGA 2JFPA 2X2EA 1UEJA 2POCA 4IS3A 3OA0A 4AXBA 3S40A 4ENWA 1SG0A 4DDMA 1QDLB 1G6Q1 1RZRA 4NV1A 3GRVA 4E3WA 1JWLA 1XRQA 3GPLA 5DDIP 2P68A 3CZ4A 2QJFA 2GNAA 4GZ5A 5LYJB 1RLUA 1XTQA 2OXRA 2Q2NA 4P3KA 4MULA 4BFTA 1NLUA 1KS9A 2Q28A 4P53A 3VVCA 4U1RA 1OC4A 5HYVA 1Q74A 1VIYA 1SC9A 3HR7A 2BI8A 4RPKA 2V6FA 4RHCA 1NI5A 2XUFA 4YP9A 1JILA 2C0CA 4ZFNA 1Y1SA 4I5FA 4PVDA 5CYPA 3OPYB 4UHCA 1AZSC 1BVUA 3VPHA 2R7LA 1CQIA 5KYKA 1USWA 5JWRA 4U39A 1F8XA 1HFKA 2WMOB 1O6FA 4MMZB 4PX9A 3ZPXA 2HHHB 1GTVA 5EEHA 4F9EA 5FA5A 1SU7A 1G4HA 4IDGA 4AMUA 3T4PA 1O97C 2EW1A 3C3AA 4ZVQA 1F0KA 4FR2A 2E55A 3W78A 1GQQA 2FSSA 1EDBA 1U8ZA 1R50A 3AL3A 3ESAA 3OESA 1A9XB 4LPSA 3GJ6A 2WWGA 4ZQHA 5IAOA 3K94A 1NX6A 1VI2A 2N42A 2HXGA 2OHIA 3ROFA 5DRYA 2YCLA 3TUJC 5M3BA 3Q9LA 4IF6A 2NNLD 5LD2B 1R0SA 1WDLA 4MJLA 5KYWA 2H1HA 2YY5A 1QTRA 1DQPA 4IWYA 3QVOA 4P2BA 3AESA 4XXHA 4YO7A 4YROA 5EIWA 4AG5A 4EYSA 1Y9ZA 1TZJA 1WZCA 2PUTA 2G06A 3WGZA 2BR3A 4L5JA 2X8BA 1QU2A 2FP4A 4Q82A 3BTSA 1N2HA 5CDSA 3UMYA 1HX7A 1WVMA 3K0EA 4YJ2A 2FF7A 2JKYA 4Z7QB 3LC1O 1YA4A 2FDRA 2C9CA 1OUMA 4P22A 1TTPB 2W83A 5BWBA 1NI3A 3SEZA 5BN1A 2FPOA 1T4DA 2DWPA 2PX3A 3PGKA 5DTQA 2PE5A 3OIVA 1EUQA 2GM3A 4BXOA 5DGTA 2E1PA 2YXPX 3PI6A 3ZZUA 4BFWA 3EVNA 1RNLA 1UPCA 5A6SB 2C4TA 4XCQA 4ZQFA 1AN9A 1QDUA 3D1JA 4KWTA 3H5WA 4TYQA 1TQ8A 4KXNA 1ZHOA 3KM0A 4OBWA 3QPWA 3PNMA 5LXTA 2NTVA 3LUFA 2CBXA 4NEHB 3N39C 1EFPB 2OGSA 2P90A 2Q1TA 3ISVA 3FPAA 1JKFA 2VHXA 2XB4A 3NTUA 5AK5A 1HETA 2XE7A 3FUXA 3I9OA 4Q34A 4I1OA 3W04A 2VNHA 5A5VA 1UF9A 4KXXA 2BSAA 3C8DA 3MTGA 4KQ9A 1YK1A 4RH0A 5E1MA 1U6KA 4M2LA 3GC6A 4LK3A 4EF6A 4NV0A 5K0EA 4FS3A 4BVKA 1JHDA 3GLRA 4WNIA 1Z5GA 1I51A 3NI2A 4JJIA 4Q02A 2ZTVA 4X97A 1FUIA 3CZQA 4CWAA 3MWFA 1O77A 2IE0A 2VRWA 2M9MA 3BOSA 3EOBI 3KOXA 4PYIA 4WESB 5DX0A 3HV0A 5J5VA 3AO0B 3A2KA 1A95A 4QUIA 3MJEA 5C53B 4P35A 3BWXA 3BD8A 3EW9A 4WKCA 2RKWA 4OOEA 1O5IA 1S9DA 3HQ4O 1AKUA 2QMEA 3BJRA 1W2HA 3VHLB 3SMQA 4G07A 2Q6IA 2FW8A 4KTVE 3TRJA 3RAGA 3JYQA 3FI0A 1ECJA 4MWZA 3V97A 1P91A 2JRCA 5AH0A 1DXHA 1GSIA 1Z4OA 2NOAA 1P62B 1OZ0A 2FJ0A 4G26A 1VKJA 3RC2A 3W8RA 5E9AA 4HQKA 3WK5A 5FOWA 4OQFA 3RFVA 3PC8A 3SYKA 3HCWA 5ELXA 4NWIA 1WZEA 2EQBA 1ONOA 2QZ4A 2XCSB 4DIOA 4WXPA 4YRLA 4R8KA 1Y0BA 1Z83A 3KELA 1KR5A 1E96A 1FFWA 1RHMA 2NUPB 4NX2A 3N0WA 4ESOA 3GELA 3D3QA 1QB7A 2GBLC 5K7SA 1ICIA 5DT9A 1L7RA 3DNFA 3R3XA 1VE6A 1Y3HA 2AG1A 2LIPA 1U3DA 1U80A 3JWJA 3QEOA 5D3ZA 1L5HA 1NBAA 1HDZA 1P1IA 1AG9A 2JJ8A 5LOVA 2O8DA 3HXTA 4OUDA 4YPVA 3O8OA 4GW3A 4PZCA 4ID3A 3D1VA 4UZSA 3N87A 1ZM2A 4W6ZA 2Y93A 5J4HA 3J7AC 3HCFA 5JHGB 4E5KA 3ZW8A 3ZE6A 4MTCA 1JDTA 3C16C 2CN1A 1KPGA 1YDWA 1WKVA 3DLPX 2HT1A 3K9BA 4P3NA 4KHPB 3UATA 1CJTC 1ZIXA 2BJWA 5JNVA 4MIOA 4OB8A 1R1DA 4RAOA 4RTKA 5CJ2A 2I6FA 1S0UA 2ZRHA 2WUEA 4IXMA 3VR4H 3IS3A 1SVNA 4F4CA 3ROTA 5CEEA 2R86A 3FGNA 5K8CA 4NJMB 2FWIA 3OPMA 2V4UA 5I01A 2YWHA 4K7JA 4KRFA 5J47A 2G0AA 2QE6A 1RXYA 3EIQA 2ACVA 4IAOA 1GRRA 3MWLA 4XGKA 3AB7A 3UHOA 2CSUA 3AHGA 3V8RA 4DPKA 1APBA 3SS8A 2EW2A 4KIJA 3TMKA 3AEKA 3CE6A 4EHFA 1W36C 3PGJA 4CCYA 4DBVO 1NBOA 1TLFA 2ERYA 3CTMA 1H6DA 4RZSA 3R7LA 2NYVA 3GEMA 2J3JA 4GL2A 2JEYA 4RQAA 4XDGA 2G09A 5B55A 2YIDA 4B7XA 1V4BA 1P8AA 1AGXA 1PDOA 1PKEA 3PVZA 4C0XA 1ESZA 4B35A 1RFGE 4MPDA 1SU6A 1Z75A 1ENYA 3GMTA 4W7HA 1YFJA 4I55B 3OCVA 4RK4A 1SA0A 3DOIA 3B3JA 2ZE7A 2FB9A 2GAFA 2GWRA 4YLYA 5C8YB 4ZANA 3D6MA 4KI7A 4CIBA 1X13A 3NBAA 5E3JA 3U1VA 4ALKA 3ZLUA 3JW8A 4IJQA 4CQNA 4V0SA 1C7RA 2R8YA 4EEKA 4HNSA 4FBGA 3PDIA 2OFFA 4G4SO 2Z56A 2VWQA 1JFTA 4C0WA 4YP0A 5LM3A 5H16A 1UINA 2Q4EA 3MCUA 3T5PA 1XMQB 3RADC 1ISJA 1WTCA 4MRMA 1HR0B 2QMQA 3VA7A 3U7IA 3AUUA 3PWTA 1AOXA 1HL7A 4HNUA 1MV8A 1KK1A 2VBGA 1XJ0A 5DM1A 4BRSA 4F7WA 2V4ZA 1YFLA 1ZCBA 3IGFA 1SVMA 1NUTA 3HNRA 2H18A 1KBQA 2AWOA 1UBKS 2ZR0A 3HMQA 4OFXA 3H2ZA 3RBXA 4UOEA 4Q3OA 3AB3A 2ZB7A 4L2IB 1VLJA 1JEQB 1GGJA 4JENA 2BFMA 3MC1A 1OX4A 2BUBA 5FPQA 1PR1A 3VR3D 5T8KC 4DQLA 4U9UA 2R1UA 4TZTA 5EZYB 4UEKA 3KOOA 3TIIA 5JAQA 3QV1A 4BKMA 4AT1A 4MVJF 4CMAA 2HBRA 3AUAA 1AD2A 4JT9A 4RF4A 2J3EA 3LGAA 2ODQA 3U4GA 4YJKA 3CW8X 3FCYA 2XB9A 2V55B 1XRJA 1QAOA 3AI3A 4J1TA 2MU1A 1J09A 1GPDG 3S7ZA 3TLCA 2O8FB 4BC1A 4KAJA 3CWCA 7YASA 1RI3A 4U2GA 2HT6A 1QH1B 3A2LA 1I0IA 2ZIGA 2O8CA 3GR6A 4K5QA 4ZI5A 4YDSA 3RI3A 5KWIA 3GNQA 3FSRA 3DKPA 2FJUA 3TCKA 1FJGB 1DIBA 2CCJA 3FMPB 4P33A 5D51S 1G8JA 4ZAZA 5IMSA 3SJBA 3J81k 5SZKB 2AS0A 2YINC 4P58A 2IOFA 4DDWA 2ERXA 3K7EA 2X1LA 7MHTA 5C1DA 1WSAA 2P9BA 3CZRA 1RRPA 3FLEA 4PPQA 2PUAA 2UUBB 1F9EA 2R7AA 1HBJA 3HB0A 3OFVA 3U4DA 4DDKA 1A8HA 1E2MA 1M7BA 4P4SA 2GOYA 4ER3A 2QLLA 1RVV1 3JQ7A 2L69A 2I67A 2IZ1A 2P4UA 3Q7TA 1KOJA 4YREA 1GOTA 2ZM5A 3QRWA 3ZGOA 2F43B 1T1IA 3V8NA 4QHYA 4M37A 4YN3A 3V55A 4QAJA 5CFQA 1OAOA 5EIBC 1I4EB 1VG0B 3FTEA 2XVMA 4NE7A 3WLRA 4RCZA 1E9SA 3WQBA 5C7IO 4TKMA 4LDQA 5HE9A 3RUCA 3E5HA 4YPOA 1L3IA 1OFUX 1NVKA 1QXSA 4O2BB 2FW7A 1N7JA 3HB9A 4QO8A 4R51A 4UREA 5EIHA 1FEZA 1X7DA 3T7TA 3GMSA 1SZDA 3QKRA 3VU3A 4CLHA 5A1JA 4HQLA 5J2UF 1DJQA 4ZI3A 2VSYA 1XROA 4PU0A 4LGVA 4L74A 2YC4C 1OV4A 3DXZA 1IU9A 3HYCA 3SEAA 5CVTA 1U3CA 2FPGB 1SUFA 4X60A 5CGQB 3VC1A 3B3GA 3N7AA 1NR1A 4QVGA 4Z49A 1QTQA 3GA5A 2D2IA