3GL9A

The structure of a histidine kinase-response regulator complex sheds light into two-component signaling and reveals a novel cis autophosphorylation mechanism
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
120
structure length
119
Chain Sequence
SKKVLLVDDSAVLRKIVSFNLKKEGYEVIEAENGQIALEKLSEFTPDLIVLIMMPVMDGFTVLKKLQEKEEWKRIPVIVLTAKGGEEDESLALSLGARKVMRKPFSPSQFIEEVKHLLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Response regulator
publication title Structural Insight into Partner Specificity and Phosphoryl Transfer in Two-Component Signal Transduction
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Signaling protein
total genus 43
structure length 119
sequence length 120
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3gl9A00
2JRLA 3H5TA 1JFSA 2KYRA 5IX8A 3JY6A 2F8SA 5EWMA 1SRRA 2FMFA 5CNIA 3ROFA 5KC9A 1Z2EA 5IUNC 3D02A 4YLEA 5ED4A 2QU7A 4G97A 3GL9A 4JB0A 1GLGA 3MQ4A 3H1FA 3BBLA 4MR7B 4O1HA 3RH0A 1BDHA 2TMYA 4S04A 3OO1A 1FQWA 4RY0A 4W5OA 2HQRA 4LDZA 2NT4A 1R8JA 3G1WA 5HQJA 4PYRA 5ABPA 2FLKA 2E4VA 4KREA 2RJNA 3DGFC 4RSMA 3C3WA 7ABPA 2LPMA 5GQSA 2V0NA 5HM6A 3N6VA 5JNVA 3KG2A 1E6LA 1KGSA 3JPWA 1Z25A 4NV3A 1ZESA 5C5CA 1D5WA 1RZRA 4N76A 2IYNA 3DBIA 3O1JC 2E4XA 2FMHA 3CS3A 3OLWA 4LX8A 2E4UA 4G0ZA 4OLBA 1USIA 3CKMA 3N0RA 3IP7A 3OM0A 1USKA 2P9HA 1TM2A 1F51E 4YR7A 4Z4EA 3RVNA 5EWLA 3HDVA 3OMWA 3O75A 2FN8A 3HZHA 1U2QA 3KKEA 4B09A 2HPHA 5IULC 1ZHHA 1P2FA 3N75A 2OQRA 1LBIA 4N0QA 3JTEA 1JDNA 1BAPA 3HSYA 3H5IA 4YCSA 1QNLA 1ISRA 1MB3A 5IC5A 1RZRD 2P4UA 1EWTA 4MRMB 1GUDA 3N8IA 5EWLB 4NCAA 4NICA 3H5WA 5IUKC 4P1ZA 3ROTA 2L18A 2QZJA 9ABPA 4HNQA 4ZJPA 4IILA 3H5OA 3HDGA 2E4YA 3QELB 4EUKA 5PNTA 2FN9A 3QX9A 1A2OA 1NXOA 3MMNA 1DG9A 1DCFA 4RU1A 3FFTA 3B2NA 5DCLA 3JVIA 3A10A 3CG0A 2M1ZA 3KYJB 3LUFA 4KVFA 1QQBA 2BGGA 1SXIA 4HNSA 2PLNA 2RJOA 3FMVA 1JYEA 2FKAA 2GBPA 2A9PA 3QEKA 1JHZA 3O2QB 5HKOA 5T7BA 3DGEC 5BRJA 3MM4A 4ETNA 1LBHA 4RY9A 1RXEA 3RVSA 2GX6A 3O2JA 4ETIA 4Z4FA 3EJWA 1PNTA 3GV0A 4OG2A 3NNSA 4EVRA 3CZCA 4MR8A 4RKRA 2AYZA 3L49A 4DQDA 2CD7A 1YTUA 4RS3A 2MSWA 2CWDA 5DLEA 5TQ0A 4MQEA 3GA5A 1QP0A 2IPNA 1PUXA 5TQJA 1P6QA 3SAJA 3EULA 3SY8A 2B4AA 3O1HB 3CZ5A 1TVMA 3LUGA 2MYNA 1NXWA 4RK0A 1VKRA 4G0XA 4KMRA 2NZVG 1XHEA 4MR8B 2LP4Y 1EHCA 3IDOA 1KRXA 4RWEA 1JBEA 1P8AA 5FBKA 1M2FA 2LIVA 2PKXA 4MS1A 4ZPJA 3BREA 5TQ0B 1TLFA 1FSPA 4IGAA 4GNRA 3HV2A 2E4WA 3LKVA 3O21A 3P9YA 4RDCA 1K68A 1APBA 4EGSA 3W9SA 1FFGA 4YGXB 3CFYA 3OM1A 3RVKA 2HJ9A 3SG0A 2FQWA 3KJXA 3H75A 3LKBA 3MF4A 4F11A 3FDFA 2ID7A 4LE0A 4XLTA 3DLBA 1ZN2A 5BQ3A 4L4UA 4FB4A 5I4CA 3GBVA 4F3TA 2PJUA 3I09A 4Y9TA 2GKGA 1C0EA 5B3JC 4ETMA 4KK3A 2PUCA 1Z15A 3N53A 2CHFA 3SQNA 2O20A 4IF4A 2F8TA 2A9QA 4IMJB 3TX6A 5EWMB 3FFWA 3IP5A 5DGCA 5JS2A 3BRQA 2FMKA 2FQXA 3Q7TA 4H3HB 1ZDMA 3M9WA 2QW1A 1JFTA 1BA2A 4MQFA 4RK4A 2FEWB 3H5LA 4E7OA 1U04A 4MR9A 4LE1A 3RVMA 1XWWA 1CEYA 1D1PA 3H1GA 4RK1A 3LUAA 3NBMA 3T6KA 4P98A 2IPAB 4TLMB 3IPCA 4HNRA 1HEYA 3H6GA 3H5VA 3NHZA 4RK6A 4G0OA 2XDYA 1DRKA 4KQCA 3QLVA 3Q7SA 3N0WA 4MQFB 4RXUA 3QLUC 5B3JA 6CHYA 1VPWA 1DCMA 2JCGA 3CG4A 4G0QA 3IPAA 1ZGGA 2R4QA 3I45A 4DN6A 1OXBB 5TPZA 3HK2A 2FQYA 4QPJC 3IP9A 1URPA 2H3HA 4JAVC 3MIZA 5E3JA 3HVRA 2IPMA 1NXTA 3T38A 3NNNA 1JFVA 4EY3A 2QVGA 3LTEA 3OMXA 1DBWA 2A9OA 4D6YA 3HUTA 4Q6BA 4XFKA 1ZY2A 2X7XA 4ZMRA 3LUJA 4WUTA 1WETA 3OLYA 3JPYA 1LJUA 3L6UA 2WJAA 3T8YA 1QP4A 4KFCA 1SD5A 1JX6A 3C97A 1EFAA 2LUOA 3IP6A 4FE7A 4KK4A 3TMYA 1H9CA 1D2AA 2FW0A 3TO5A 4RXMA 3QLUA 1YK1A 8ABPA 5TPZD 4PICA 2E4ZA 5JNUA 2IKSA 4O1IA 1K66A 2HQBA 1YIOA 3HEBA 5KQMA 1QMPA 3EAFA 3GRCA 2ID9A 4PE5B 2YHAA 5T3YA 3F6CA 4N47A 1ZVVA 4Z4IA 4RXTA 2FXIA 1E2BA 2PE5A 2FEKA 1ZGZA 3RQIA 4RV5A 4RKQA 3CNBA 3OLVA 2PUAA 3E3MA 1U8TA 3Q41A 1GCGA 4OTZA 4KQ9A 3RVPA 2L17A 4W5NA 6ABPA 1Z13A 1L5YA 4Z99A 3URMA 2PUBA 3O1IC 2MSLA 3Q15C 3RVJA 1BVHA 1A04A 4OATA 3UUGA 2WY2D 3A0UA 3CRNA 1DP4A 4OBBA 2IPLA 1NXVA 1MB0A 2JB9A 4EYOA 2JVKA 4TLLB 4EYKA 4PEVA 4ZMSA 1KRWA 4L85A 1Y1LA 3C3KA 1W9HA 2H0AA 1XHFA 1NATA 2FSPA 4G0PA 3LOPA 4HYEA 3CTPA 4S05A 2FMIA 1DCKA 1U2PA 5D2CA 3OQOA 4MS3A 1J56A 1YK0A 2JVJA 1S8NA 3CLKA 2QR3A 2JBAA 1SXGA 3F7NA 5CHYA 3GT7A 1EAYA 3ILHA 3I42A 1E6MA 3JS5A 2PUEA 2PMCA 2B1JA 3F73A 4EVSA 3RVRA 4MQEB 3DZDA 3F6PA 2ZWMA 1Z18A 2MSKA 3Q9SA 3NNDA 5TQ2A 4Q7EA 4D6XA 4MS3B 4NQRA 2WMYA 4E7PA 1JDPA 1MIHA 2JBAB 4G0MA 4UHKA 3HO1A 3HJFA 2VUIB 4CBVA 1CHNA 3LFTA 3MYYA 2WJWA 1CYEA 1GCAA 4F06A 4MLDA 3S99A 3ILYA 1F4VA 4KZKA 3OQMA 3HXMA 3JVDA 4MS1B 3BRSA 3MA0A 3UKJA 1NXPA 1YS6A 5TQ2B 2R48A 1ZH2A 1NTRA 5CNJA 3QLVC 4LZLA 5KC8A 4Q6WA 4UHJA 3M9XA 2YHBA 3KSMA 1W25A 1M5TA 4KNYA 2IOYA 1P6UA 1RPJA 2R47A 3A0RB 3VNBA 1JYFA 3HUUA 3N0XA 1M2EA 5KWSA 1AB6A 2QV0A 1Z2DA 1QP7A 4JP1A 4KPYA 2PL9A 2MYPA 5F64A 1LJLA 1NY5A 5FWYA 2QSJA 1DBQA 4FE4A 4EYGA 2FLWA 1PEAA 1USGA 3H1EA 3Q7RA 3QLTA 1D4ZA 3LUDA 4MAAA 4XARA 1RNLA 5C5EA 1JF8A 5JS1A 3SNKA 3KS9A 3KLNA 2NUBA 3QK7A 1MAVA 3EQZA 4MR9B 3CHYA 1DC7A 5CNMA 1B00A 4MS4A 4TMYA 3BILA 4WWHA 2A9RA 3RVQA 3OLZA 5BR1A 5JNWA 5FWYB 2I6FA 4PZ0A 4XAQA 2AYXA 1TJYA 2R25B 1BDJA 1RXIA 2PUDA 4D74A 5FBHA 2QXYA 3TB6A 1JLKA 1ISSA 1I3CA 4EVQA 4JOQA 4QICA 4RK5A 1ABFA 2GWRA 2PUFA 3FGZA 1FFSA 4MS4B 3OLXA 5CNKA 4ML3A 3T95A 2NZUG 3CU5A 5HSGA 2PUGA 5IEBA 4H3KB 2W42A 1BDIA 1PEYA 1PNRA 3HM9A 5BRAA 1YMUA 4YRZA 4Z9AA 1U0SY 1ABEA 5JNRA 4MRMA 1DRJA 4N03A 4WXMA 2FTKE 2L19A 3GYBA 1JL3A 3O2SB 2NT3A 4WT7A 1ZITA 2HQOA 1QPZA 4IMIB 1ZAYA 1D1QA 4YO7A 3QELA 4TN5A 1UDRA 3E61A 3KHTA 3M6MD 1A0OA 1JWLA 1DJMA 3A3KA 4H60A 1VLZA 1VRVA 3EODA 3VNAA 1QO0A 1Z17A 2DRIA 4MLCA 2MYTA 4LRQA 2M98A 4KRFA 3LUKA 4QYMA 3KCNA 4ZYLA 1QKKA 4XASA 1ZH4A 3GWGA 1LK0A 1OXKB 1FFWA 3QEMA 3SM9A 2GI4A 3G85A 4W5TA 2QVCA 4YV7A 3K9CA 3RVLA 1EWVA 4W5RA 3QX8A 3KLOA 4RY8A 5FWXA 4YS6A 2WWVD 1DC8A 5KQLA 4MGEA 4JB2A 4RZSA 1KMIY 2FVYA 4F12A 3OQNA 1QO0D 4Z4CA 3DLHA 1NXSA 1YS7A 1TMYA 5IUJC 4MYRA 1Z12A 3EQ2A 1Z26A 1YMVA 3O74A 3K4HA 3QEMB 2WB4A 4G86A 5KI6A 2N9UA 1Z16A 4Z9BA 4M88A 2OENG 1C4WA 3OO0A 5TE9A 2L2QA 3NHMA 2Q5CA 4Z4GA 4EYQA 5FWXB 3H6HA 4Z0NA 2JVIA 3RVOA 1JH9A 2WRZA 3HS3A 1QQAA 2RDMA 1M5UA 4MPTA 1DZ3A 1SXHA 3C6QA 4IRXA 3R0JA 3EDCA 3LMKA 1DBPA 2J48A 2HSGA 4G0YA 2VYCA 3EGCA 5JNTA 4OLAA 4F8JA 4XXHA 3D8UA 5DKFA 5GOTA 4DADA 2PAFA 2RGYA 4KV7A 2PL1A 5IEJA 2IDMA 4NCBA 2JK1A 5TPWA 3KTOA 2FEPA 1E6KA 3HCWA 5EWJA 1MVOA 4QYWA 3KYIB 3LUHA 2VUHB 1IIBA 4LE2A 4N0PA 4N41A 4WZZA 3GBPA 4YP9A 1PHRA 3C3MA 4LDAA 4RK7A 3LUCA 3TD9A 1T34A 3UK0A 5JNSA 4JA2A 1NXXA 5IBQA 4W5QA 2VK2A 1AB5A 2MYUA 5TPWB 4JASB 5KQGA 5EWJB 3I5AA 4GPAA 4O5AA 2ZAYA 1GUBA 2LBPA 3FFXA 1L5ZA 1EWKA 4WXEA 4YWHA 5KQPA 1YVUA 4Z4HA 5DTEA 4MR7A 2CHEA
chains in the Genus database with same CATH superfamily
4WZBE 3OOHA 3GR6A 2HPVA 2KYRA 3FUVA 1UKAA 4J2HA 4M21A 4Z3OA 2Z83A 2FMFA 2W9XA 3LX6A 1RC1A 2JF0A 5HILA 3X43A 2C9BA 5F5LA 4ZI3A 2LRHA 3ZDRA 2PSFA 1USWA 3NTLA 1V16A 4JB3A 4V03A 2JHFA 4BL5A 2FRDA 1W85A 2QN6A 3MJCA 1J20A 6ADHA 3KQUA 3PQ4A 3OAAA 3THWA 3M3HA 4O1HA 3LXXA 4OIMA 1TNDA 4NZ9A 3PDJA 4IIGA 1UBUS 5IN4A 1E98A 2EJVA 2KM1A 5ULLA 5L40A 3ND8A 1HT1E 1U5BA 3DAGA 4BEWA 4CG3A 4A0FA 4DXDA 3EXG2 2ZRAA 1YRQA 2QPOA 3KZOA 3ZCUA 3WL8A 4LNAA 3C3WA 1FUEA 2Y66A 4B7UA 2VHWA 3P52A 4NATA 4KIGA 2O4UX 5AUPB 5EJEA 2LR0A 4JLDA 1JVSA 2AE2A 1MF7A 2RC6A 2CXRA 5JQGA 2H4YA 5DEIA 4B9EA 5HIJA 4OM8A 3OPNA 4EFDA 2W2VA 2YOHA 4CF5A 1UZMA 3DDWA 1DTWB 1LI7A 2DX7A 2PS1A 4L27A 4LOLA 4E3ZA 2QF7A 1Z0FA 5CLJA 3WLMA 1UFQA 2IYNA 1S7GA 3HRHA 5IU6A 4KIWA 2OUIA 5BSTA 4UU1A 3P26A 1NL3A 4LYDA 1NC1A 3MG9A 4YLGA 4LGVA 2Q1WA 1PEDA 3FLMA 3W2GA 2A58A 1XTUA 2XBLA 3RVNA 4QU9A 1Q7BA 4OBWA 3DMTC 2VBCA 4MSUA 4TXLA 3GDHA 4B3JA 1HURA 5EJIA 2DPXA 1ZXBA 1UR5A 8OHMA 2CMFA 2ODTX 3B82A 4C0LA 1LBIA 2XZOA 4Q15A 3CW8X 4YWJA 3T54A 1CP2A 2PJDA 4MV1A 5DHAA 1NBME 4A2CA 1OZAA 2QTMA 3FYUC 3DB2A 3J7TA 1KAHA 5EC8A 5AUQA 4BJ5A 4CCSA 5AJZA 5JD6A 4URXR 2RD2A 1XCOA 2P0EA 2JA2A 1ZZEA 4HLUC 4JA0A 4EBFA 3VI4B 5LNK6 2BEVA 4AC9A 3AF0A 4ND2A 5HKLA 3L4JA 5EZYB 4IMRA 4PLGA 1YS1X 2XB4A 3AEKA 3ORRA 3L05A 4JFAA 4TRJA 5AHXA 5KYVA 3SJBA 4UOZA 3KZVA 4YJ2F 5IT0A 3ICQB 1VKHA 5A4FS 1KR5A 3K20A 4DMCA 3H9EO 4EQ6A 4RU1A 2IHNA 3FFTA 2C1ZA 5D01A 5KVAA 2NYAA 5I8ZA 3CY6A 3O6VA 5CURA 1F0NA 5K0TA 4Z53A 3UCFA 4E3WA 4MVJM 1RWOA 1QGUB 1V0JA 1V41E 5JROA 1O87A 1PV4A 1V7CA 1W4ZA 2KHZA 1Y89A 3JQRA 4GI7A 3DTVB 3BTVA 3MBIA 4YXWA 3KTDA 4TSFD 1D4OA 4TL6A 1WPRA 2J3DA 2R79A 3NEPX 5CVUA 3NR2A 4DT1A 4MVWA 5JPCA 4G1FA 3DBHB 5G41A 2NAFA 1FFCA 2WWHA 1CJKC 1ZOIA 3JYNA 1H6DA 2D2VA 3DTVD 3V3TA 4TS3A 2VNJA 3N7TA 4C4ZA 3A70A 5LUBA 4CKBB 4EDFA 2W2KB 1U2GC 1PE0A 2X1LA 4K0RA 3JASA 3WBBA 5F3RA 4A8JB 5K7SA 2R4UA 5DGIA 3TL3A 4TRRA 5IKXA 2J41A 1UEIA 2II6A 4A91A 4WHMA 1O54A 1UT5A 3K6RA 3LK6A 1R4ZA 3PUJA 3PFNA 4M98A 4ZVNA 1XOIA 4BYGA 5HYVA 2XQJA 1L4LA 2R751 2EP7A 2ZI3A 2DPYA 2FSUA 3OTHA 1XZCA 3GNLA 3ZNPA 4BB6A 4CIDA 1FTYA 4G0NA 1UODA 4PGAA 3TD2A 4EHAA 2IZ1A 4JBGA 3KELA 3ZLVA 2MHCA 1ZM4A 621PA 4N6GA 1XAHA 3TW8A 1NVXQ 5E7MA 3MOGA 3TVTA 1QG2A 2QIOA 3EGOA 4WERA 1SULA 1EJBA 1JBEA 1UBRS 1YNSA 2R60A 4R98A 4AMYA 2RAUA 4WUVA 2OA0A 2AD5A 4BFVA 4YRAA 1TLLA 2VJMB 2Q5OA 5T64A 5AVZA 1XXHB 2I78A 4WFKA 2E4WA 5EKUA 2FF7A 1AA9A 4HAOA 2QTNA 2ZYTX 5CCBA 2IW3A 1JB9A 3RIXA 5HF6A 2JD0A 2OC4A 2D13A 1P4HA 4LGMA 2VYQA 1NWHA 4PLWA 1FLDA 1SCAA 5F4ZA 4ZTUB 3CX4A 3PNVA 4OMDA 1KI1A 5JJKA 1CUDA 1DAEA 2XOEA 4G9BA 3IESA 3MB8A 3K5PA 4IYJA 5BSUA 2RI6A 1EFVA 4TVBA 4YT2A 3I09A 4Y9TA 3R8FA 2H29A 3KJGA 1LDBA 2XXBA 1IEWA 4U0JA 2HCJB 1SU6A 1CIPA 1E9FA 2CHFA 2CXQA 3QOFA 4ZOEA 5KX5F 3FGOA 2OM2A 4F1WA 4Q0MA 2PKEA 5A2QA 4K1XA 4PAWA 4H7PA 4PAMA 1MMFB 4KUGA 1YL7A 4ZVOA 3WTCA 1AY0A 3CVOA 2FMKA 1FRVA 2OP0A 2BVNA 3PIRA 2FX3A 2OKGA 3QKWA 3QVKA 4A8TA 5FX2A 2HV9A 3FMGA 4MQFA 2O0KA 1IBKB 5JCOA 5C7IO 2X1MA 1G66A 4AU1A 2VA8A 4JYMA 1K0FA 1XWWA 1JPNA 2QORA 3AY0A 4KQGA 1RCTE 4H3SA 1ILWA 2EZ9A 2I1VB 1XTBA 2QIPA 2CF5A 4P98A 3BL6A 3M3DA 1QRSA 1SBZA 2NZWA 4JEMA 1K88A 3JQ8B 4LYAA 3WG9A 1G6Q1 2V6MA 1R0WA 1VA5A 3E5NA 3ECCA 4QGFA 3TLGB 4MO9A 1L7PA 1SCBA 1VPEA 1RJ9B 1WS6A 3WWDA 2A2ZA 1UXKA 5AJTA 1A72A 1H93A 1USVA 1ZGGA 2EHJA 2G72A 4UXIA 1S02A 2OQVA 5M34A 2J5QA 5EIOA 4M8IA 4NX2A 3SZOA 3V7UA 2JG3A 1FNNA 2A59A 3G7UA 3DYIA 3IOBA 2YJZA 1GNVA 4B6SA 4QM7A 4L78A 1X9IA 2HPZA 2JI8A 4MW5A 4ZAXA 4UTZA 4RX1A 1RPNA 1BQEA 3EZ6A 2A9OA 4E5PA 4Q6BA 5FT9A 1SUFA 1EJ0A 3T5MA 2BHLA 1JHYA 3OZIA 5CLGA 1LRLA 1CBUA 1PL6A 1VPVA 3OPYA 2OGWA 4QSHA 5DXAA 4PM4A 5I7HA 3L07A 1VDZA 2CD9A 3TMYA 1D6NA 1F2VA 1UFVA 2LKCA 3N2YA 4QQNA 1KTVA 1ZW1A 4KMMA 2OCLA 1EUDB 1R9JA 1TD1A 1AKVA 1YKGA 3KDAA 7MDHA 5FYQA 2IKSA 4E5VA 2F4NA 1DX9A 1JAXA 1FDVA 4LPKA 2A3NA 4LY0A 4BRWA 3T1HB 3WLAA 1FW8A 1TLTA 2J07A 4NU5A 5JEDA 4MUAA 2UZ1A 4Z4IA 2X58A 4QLAA 1U7ZA 4RPCA 2HNBA 1GPAA 2P35A 4KCGA 4YRDA 2ZUCA 4EHIA 5BQFA 3WA6A 2ADFA 1QHFA 2WWTA 3VKGA 1AQNA 4H6VA 5DCWA 5BQPA 2JASA 4IJUA 1L5LA 5JSQA 2DT8A 2JIRA 4NIMA 2OGZA 2UUPA 3CKKA 3FJYA 1L7QA 4JEIA 2Z9BA 4BGEA 1WG8A 3B3AA 2QU8A 4MHSA 4BTVA 2PUBA 1QVRA 3O1IC 5DOVA 2ZYDA 4PBRA 3GLFE 4KI0A 1EX6A 4IY1A 4P35A 4LOIA 4NBWA 3X1JA 2GJAA 5CRIA 2PFKA 1EBUA 2XOXA 3E7WA 1H2EA 4NYJQ 1X1AA 1E59A 2O0JA 5CVJA 3L7LA 1TZ2A 3QNMA 4EAAA 4ERXA 3C70A 5AM0A 3DOUA 4DB2A 3V8MA 5GJBA 5CJPA 3HV0A 2PSJA 4RIHA 5JYDA 4G1EB 3WLIA 3UGKA 4M0DA 4BGVA 1JDTA 1MTZA 4MWZA 4DIBA 1RWNA 1PDWA 1N5MA 3HVKA 5A5DA 2ENUA 1ABBA 4QPZA 4W4TA 1J56A 1YK0A 1JSLA 5KKAA 2HHHB 2NSYA 3BXFA 3OT4A 4I7EA 2FW1A 3CVYA 3MJTA 1EA5A 1MIOB 3SEFA 1H6CA 1OXXK 3BK7A 3WLRA 2JZNA 1RR6A 4X94A 5ER9A 2ZWMA 3W1VA 2MSKA 2NYUA 1GR0A 4PYKA 1NZJA 4HS9A 4CIXA 4Z7JA 2HJRA 1U8ZA 4LFCB 4AO7A 2Y27A 2YJ4A 2OFXA 1B16A 4E7PA 4CMKA 4UASA 2AJTA 4EG1A 1FOEB 5EPEA 4HDKA 1RWWA 3H9CA 1TCAA 2C4KA 4NJEB 3REOA 1TYAE 3MYYA 5JRJA 1QYWA 1CERA 1A5BB 4HJRA 3ZWVA 1IJEA 4OI1A 5CFRA 3P19A 4MS1B 1J0XO 1N25A 1L4MA 3R7BA 2CF6A 1E2DA 5TQ2B 2J08A 4E03A 3GEMA 4M36A 1ULZA 3MHTA 1G2IA 2ZE8A 3G1TA 3PC4A 1T6NA 2VLBA 2J45A 2BGIA 5EZSA 1CIJA 2RAPA 1EGMB 2JI7A 4FHCA 3UOAB 2OAQ1 2QLNA 3W3AH 5KHLB 4FNAA 4PO9A 1XQXA 1G291 1UCFA 5B7QA 1JYFA 2ZKIA 3BRWD 1RP7A 3OFKA 4BMSA 2F9LA 1H1LB 3NWPA 5JBNA 1QK4A 1I13A 3C6XA 1IFXA 3UGQA 1FIUA 4QUEA 3X2FA 2WWXA 1XCGB 2NN3C 3K8YA 3HJGA 3TQCA 1GQRA 3NANA 3VYWA 3DMGA 3KZ1E 5F7XA 1A9PA 5JAZA 4FMDF 4UTXA 3JQPA 3SBEA 4CKCA 1JTVA 2GPBA 4DANA 1OLUB 3Q7RA 3HI6A 2MMCA 2CDBA 4IV0A 3ZQ4A 4E6PA 2BP7A 4JJAA 1B00A 4LOJA 1R0CA 3EXFA 4L9WA 1KEEA 4FT2A 4ZI5A 3MT9A 3HN2A 2XOKD 3WGIA 4GS5A 5FLXA 2HHAA 3AL3A 1WQ1R 3K8ZA 3C7AA 5NLLA 2O7SA 3RPEA 3U61B 3CSSA 5BN3A 1F3LA 4D4HA 3PQ5A 4J75A 1IYZA 5EXPA 4MKRA 2PVPA 3B9QA 1NQUA 1I3CA 5E4JA 4Q02A 4E32A 4RFLA 2P4EA 4MV3A 1OX4A 2GJ4A 2FSFA 4Y2HA 4ZK6A 6YASA 1F5NA 3PEYA 1DUIA 2G08A 2B69A 3MOSA 2NZUG 4I9HA 3D4IA 1QE3A 4AJKA 4BNMA 1RT9A 4BS9A 1YA6A 5CB6A 3U1BA 3IV6A 4AJ1A 3ONDA 1XF1A 4A26A 1G7SA 2C54A 4AYXA 3R40A 2JLRA 2AJBA 2BAGA 1XQYA 1ABEA 2QN7A 4LYFA 2DCUA 3I9JA 4CF3A 1Z4NA 3VYVA 3ILXA 5LXTF 4ER3A 1YZQA 3QI7A 2VYND 3CEHA 4NFYA 4TQ9A 4N5DA 1W8IA 3PGKA 1BZYA 3DOFA 4FDUA 1E3WB 4OP1A 5KJ6A 3OE1A 3AKZA 4QOJA 3QWFA 2ZU6A 2AHRA 4XVCA 2C3YA 5DRTA 1SBHA 4UAUA 2XVAA 3A3KA 4TYPA 3T9BA 4R81A 3VNAA 3ZWKA 4D9EA 4YAIA 1TJNA 1WL8A 4FXPA 4G4JA 1SKYB 4R51A 3KR0A 4G5HA 2ZUTA 3CLVA 3DOCA 2HR1A 4D25A 1NRIA 1XPUA 1N2JA 3LRPA 4KQHA 1VJDA 3FPKA 4ND3A 1JR3A 4UUOA 5ALEA 4HB0A 1UWCA 3W8DA 5BW5A 4CN9A 1G7TA 3D4PA 1W5BA 4OQEA 3AEUB 4G01B 4XPZA 4YASA 1XUOA 4HYTA 2GD6A 3DD1A 4XJSA 3VX3A 2B61A 2EKLA 5HCNA 3BD8A 1KI6A 4FMPA 1HZJA 5KSWB 4W5RA 1ZVKA 2WI8A 1E4OA 1TKCA 3I9OA 5FOXA 3VUFA 1DAOA 1ENYA 1NLYA 2F7SA 5AYVA 3RJ9A 4WPGA 3RTDA 4RZSA 5AOBA 3V6MA 2I4TA 1NZFA 5B3LA 4R3UC 3E82A 3SR4A 2FV8A 2GZ1A 4BNDA 1MOQA 2O14A 1QH1B 2ZG6A 4RGYA 4MV9A 3RS8A 1PL7A 3AVYA 5KI6A 2GM3A 1O4WA 3IXQA 2OENG 3GXOA 3I4CA 3IQIX 3K35A 2FPMA 1LK7A 3RSOA 4LBWA 4YAKA 3PQCA 1QOZA 3QF4A 1XD2A 2AOTA 3S28A 3VTKA 4YHBA 3H6HA 2GM9A 4QHYA 1SVKA 3HS3A 4XQGA 4CM5A 3PC7A 3H6KA 4Q9DA 4QUIA 2C97A 1CUYA 3S1AB 1RQXA 4QDZA 3VDRA 1NG1A 1SPBS 3K6KA 1P1KA 2YR0A 3U16A 1Y5RA 3TPZA 5IFKA 5JCXA 5EQJB 1CNEA 5BQXA 2IDKA 4AROA 3R41A 4JHLA 4QECA 5DB4A 3RUIA 3ADKA 1MVOA 1GZ4A 4QYWA 3WK6A 2VPZA 1H3EA 1I6WA 2DVMA 1TM1E 4TX1A 5FTJA 2R3SA 1Y0BA 3CUWA 4B71A 5AXCA 2Q9BA 2YWXA 2ZRKA 4FWTA 2O8EB 1K5PA 1U0NA 3PEVA 5L6LB 3JQFA 2EBUA 3SHQA 1NLZA 4HYYA 2XA1A 4RVSA 1B4DA 3TAUA 1ORRA 4Z9YA 3ER9A 1JJFA 1KOFA 1G64A 1YJBA 1YS2X 4CIWA 4KRGA 5P21A 4PZPA 1MJNA 5EWJB 3N7UA 3W5CA 1VL2A 2F1OA 1JW9B 2NLOA 5AI9A 1T3SA 2NZJA 4XD7D 1M6VB 3UMYA 2ODQA 4LF6B 4W8GA 2RCYA 2V1XA 5AJWA 2WV9A 1I7QB 4PYLA 2RGWA 3Q3CA 3EWIA 1Z2EA 3DAYA 4Q4AB 2JAOA 2VYVD 2P6MA 3E18A 4I8DA 4L07A 4G97A 2XI4A 1W48A 2C4HA 2YWRA 3RS3A 3FTFA 4NG4A 3GL9A 1JZQA 3GRRA 1IXRC 4EHLA 5BV1A 4FX2A 4X3CA 2QMHA 4UPVA 1XQ9A 4A7PA 3AYZB 4EHDA 2FB9A 1QC5B 1E79A 2UYCA 1I24A 3W34A 2VK8A 1LXCA 2E6UX 1X2BA 3G8BA 3ZGVA 1GZDA 3UUEA 4TT3A 1UK7A 4W5OA 1EEHA 2X6RA 5EXTA 4EJ2A 1E3QA 2IWRA 4EMSA 1V8OA 4YQYA 4DLBA 4P3OA 5F76A 3QXSA 3ZKWB 4MVXA 2QM7A 4AP9A 1OGIA 4JSTA 2PJZA 1DQNA 1SCDA 2VYFA 2J0VA 1VSUA 4OHFA 5DBEX 4EGJA 3QVLA 1XF9A 3F47A 4PC7A 1ZWKA 4WN3A 2QTAA 4L0DA 1TCBA 5JZOA 2PS9A 5ALUA 4OMUA 1JBQA 1I2AA 2XEXA 2YWHA 4G85A 4IEEA 3WNBA 3LOQA 4BIMA 8GPBA 3G9ZA 1L5KA 1J21A 2R85A 1D5WA 4D45A 4DSOA 4G26A 1US8B 3BSWA 1DINA 3GRUA 3SE7A 1X3SA 2C98A 3ROEA 2AXNA 2QUJA 1IK4A 5K3DA 3VH1A 4AW9A 1YCFA 1YUMA 1DT5A 2WYWA 3WBFA 3QTLA 3KKNA 2QAIA 4U7HA 4J1TC 1DQRA 3UWKA 5KYGA 3CT4A 4UUNA 4WKBA 1NPYA 3UYKA 2PKYX 4JI7B 1Q1AA 2AA3A 2QZ9A 3DAOA 3OPXA 2GT1A 4C05A 2FFJA 2X0NA 5KDLA 3BIOA 1WXEA 1F0YA 3D4OA 1VHQA 4G5GA 2SKEA 1IHYA 1N6HA 4JLSA 5CA0A 4GNKA 4Z0PA 1JN0A 1MNAA 1K7YA 2WU3A 3HSYA 3FGPA 3N2LA 3WL3A 3O4GA 3EAQA 4FW8A 3U7EB 3GK3A 3SQXA 3PR1A 1W52X 5E6UA 1L7AA 2CL0X 3D59A 1LA2A 3BMQA 3TI7A 2GTIA 3HO6A 4N7BA 4OA5A 2VJPA 5M3BA 3S2ZA 1IRIA 2AMLA 5LKRA 4NK5A 1KP3A 4GBMA 3HDGA 4BO8A 4E94A 4ENTA 3VU3A 1V8FA 1ADJA 1M6NA 4JBLA 3V4FA 1C4XA 1NJ5A 1NOIA 1X1DA 3KPWA 1A2BA 5DCLA 5THXA 5I9NA 2NSLA 1EE2A 3UB2A 3UFBA 4DAEA 2AKEA 1E32A 1G4HA 4JBNA 3CG0A 1L4HA 3QZUA 3L84A 1QG4A 5JQGF 5ECYA 4KVFA 2XWBF 3M1YA 2YHIA 5HP4A 4ZA2A 2E3JA 5FPKA 5B58T 4FXOA 3FUWA 2HMAA 2QYTA 4XIIA 3IVAA 1KZ6A 3RK4A 3PVZA 2XT0A 5BRJA 1PZGA 2AVNA 1VSVA 3D8RA 1E7RA 3JXEA 1SVIA 3DF7A 3JAWB 1BKDR 1Q6YA 3MAAC 3NHPA 5G0SA 3ZCTA 2AMJA 2OXRA 4DIOA 3FNIA 3AVWA 2NWQA 2RARA 1CQWA 1DAIA 3KTAA 4LHZA 3ZC3A 1SXQA 2IKQA 2E6KA 4FFOA 4E11A 2X42A 1Y48E 4LZOA 4S1OA 4XA8A 3DE4X 1W46A 2IV2X 2F9FA 2H7CA 2CGEA 4FBMA 1JT2A 4XD7A 3DR5A 2E2WA 2NYRA 3C85A 1PT9A 3EULA 4OX9Y 3TSZA 5D3QA 3SYLA 1QQ5A 5HJEA 1MJHA 1PWXA 4MPRA 2MYNA 1H3NA 4K3VA 3ZK7A 2ENWA 4CZ2A 2VQFB 3F4BA 1U1DA 1JXQA 2CK3D 2R6GA 3B2EA 3R6WA 3NMUF 3DE5X 3WIOA 1VMEA 2ZBQA 3FTNA 1NVGA 4ZXPA 4NABA 5I9IA 3QVGA 4HNUA 4FNGA 1RI3A 1FNMA 2XUPA 3D6HA 1RAIA 2C1XA 2NU6B 3TUJC 3HXOA 4OQ4A 2XUJA 1RLOA 3UJCA 2F1IA 3KEQA 1T8PA 4GXTA 4WCFA 2OCPA 4DLWA 4OKSA 2GD0A 1EFTA 1L7DA 3BMOA 4HVTA 4NVRA 2VWPA 2ZBRA 5HIKA 2JIOA 3RVKA 1NONA 3KJXA 4DG9A 1KH2A 4ALNA 3EW9A 3HB5X 4KP7A 1IUNA 1FRFS 1O58A 2CHGA 2FN4A 2Q2NA 3HYSA 2C5FA 2IELA 4OHMA 2KLBA 1YL6A 2PO7A 2G0NA 3G2QA 3GBVA 3SC2B 4ANFA 4C7OA 3T7AA 1YE3A 3HY3A 4LVCA 1R6TA 5AVTA 4B3HA 3TR6A 4ZFNA 1ZX1A 5BWOA 1DFHA 2HJHA 2ZJ0A 1IWBB 1E7QA 1S1CA 4M1OA 4TYMA 3ZYCA 1L5NA 2EBHX 3QHAA 4WZAA 1YFZA 4ESHA 4D3FA 1Z4OA 2QDKA 1ENPA 2VRCA 3ELBA 1XA3A 5FL3A 5CDFA 3VC1A 2VQ6A 4B5KA 3ZW8A 4N5LA 3ABIA 4LE1A 5M04A 2HT6A 2J3EA 2JGIA 1PJ8A 2W6QA 3Q5GA 4BV2A 5IDXA 3SJUA 3K70C 1EPUA 2C9YA 1KK3A 2B94A 3UAZA 4QDTA 3K9NA 5IM4A 3H1GA 1TTTA 5CPBA 1CE8A 5L4NA 1E3IA 1VFNA 1XU4A 2O8FB 3SVTA 3E2IA 5K99A 3NKVA 2P6OA 2D06A 2FWAA 4Y9DA 2R11A 3MCTA 1ULHA 4JBXA 4N3CA 4XI9A 4Z8XA 4IDPA 2XJ9A 5AOVA 5B1YA 5BNIA 1NPDA 1W0JA 4YJ2B 4U0KA 1MDBA 3CVUA 4ZALA 1K7FB 5K2OA 3V8VA 2W98A 3ESZA 3K1JA 3T34A 5FF9A 3TIXB 2IIVA 1NKSA 1DRWA 3BGVA 3DZJA 3E9ZA 1LPBB 5CCDA 4D4IA 4DCGA 3OX3A 5K09A 3EWNA 4JLJA 3MIZA 4E14A 1QTRA 5ALVA 1ACMA 1JB1A 5HA5A 1YB4A 2ICAA 1MV8A 3NNNA 5LBTA 4PNPA 4RZ2A 1Z2PX 4IJWA 1UFRA 2K7FA 2FK8A 4JI3B 3WLLA 3ZNQA 2M1XA 4RCZA 4TS1A 4ZMRA 5IJ0A 1C8VB 1JSRA 3T7IA 5K6AA 3R77A 1CUJA 1RYDA 1SR8A 4KFCA 4R6WA 4D0LB 5JCJA 5KKCA 4MB2A 3VNUA 2DTDA 1ISPA 1UUFA 1GNQA 2QE7D 3KT6A 4MLPA 3JR7A 3UPDA 4YRIA 4NAHA 2BFOA 3FHLA 3BM5A 1G21B 2R6CA 1JAZA 3PFGA 4IDQA 2W90A 2X0JA 3IO5A 3QLUA 1ML3A 4CFYA 3GUUA 2GPNA 3ORFA 1OMOA 8ABPA 2FRXA 3PXGA 3RT7A 2BJVA 4JJFA 4X1IB 4OFWA 2AVDA 4HBGA 3T5BA 3VYRB 3NJRA 4EB3A 1QMPA 3SSMA 2QRVA 3VDXA 1JEEA 3BGDA 3GRCA 3W5DA 3RAEC 4MNTA 2W83A 2ASVA 2YWDA 3E5MA 2FZCA 2PXCA 3AF5A 2HK9A 4OY3A 4RV5A 3BCUA 3C15C 4E1BA 5K0ZA 1QLWA 2NO7A 4UW9A 3KKOA 4G9GA 2YN4A 1GHTA 2JJ1A 1X80A 3O8LA 1GZVA 3ROXA 2L17A 4W5NA 2HNKA 1B6RA 5AOAA 3BWBA 4RPGA 3URMA 2CJFA 2WYUA 1JG3A 4M1KA 3UH1A 2C9CA 3ZK9A 2PQ0A 4OQYA 4WZBB 3WB0A 1M1NA 1I9CA 1XT6A 3N59A 1HQDA 7GPBA 1ZNZA 1D2CA 4Y6QA 2PKWA 3HB4X 4D82A 3KYDB 5DIZA 5JYBA 3AVVA 2ZK7A 5BPFA 1MB0A 1WZIA 2AFIE 2OV2A 1ZG3A 1ZBDA 1P4JA 1THGA 2IXEA 2GJ8A 2YINC 3TR0A 3KCQA 1C8LA 1ZI6A 5LKAA 1VYVA 3M1LA 2X0DA 4PSDA 1Y1LA 3OUTA 3ZU4A 1EAMA 3F98A 3R7WA 1XJ0A 4HVLA 1UANA 3MGKA 3EXEA 3SGLA 3FWNA 3TCXB 3EXIB 1UWKA 5KX5B 3NWOA 1C29B 2I34A 3H2HA 1MXHA 3IA2A 3IX7A 1LLUA 4C6TB 3V8EA 2FI1A 3M6AA 3NGLA 4Q3BA 3NZEA 4TV8A 1MD9A 2XCTB 3NNDA 3STUA 4MINA 3H17A 4CL8A 1M33A 3ADCA 1M1YA 3EN0A 2GAOA 2P9EA 1GQFA 3HP1A 4YGYA 4C01A 1KS9A 2QTTA 2HMWA 4J43A 1RXCA 3ITKA 4C2AA 1CJTC 4AZTA 4KO8A 3BWDD 1ES9A 4YRQA 5ARDA 2YWFA 2PZBA 1TC1A 3DEAA 3TZ6A 4H4EA 3N28A 1KO7A 5KSOA 5CXUA 3BYZA 1XPJA 4E13A 3MA0A 1RXYA 1ULUA 4QDKA 1S8AA 2HFKA 3LNCA 2XTMA 4EPWA 1RJWA 1GZ7A 1V43A 3OEED 1BOOA 3S2FA 5B6JA 1JR3E 4UOQA 1VLJA 3CRQA 3WADA 4BO9A 4TKMA 3TTXA 5JI3E 1BJRE 3AKEA 3S2UA 3A0RB 2Q5HA 3VNBA 2QR5A 1U8AA 1M76A 2QRGA 1PF7E 5CD9A 4MQ6A 2G9UA 3N58A 3TLMA 4LHWA 1SUIA 3PYLA 3WGYA 4F21A 1ISMA 2DQYA 2I6GA 3OHMA 4FDMA 1PJRA 3ZWPA 1NY5A 3KSBC 2WQ7A 2XEDA 5F52A 3NIWA 1UJ5A 1H0RA 1QCZA 4R1MA 5EIWA 3S1LA 1Y6FA 3K0EA 3OEHD 3MS2A 2F17A 3QQ5A 2J9RA 2A0YA 1FFAA 1TVKB 1JH8A 4HH4A 5LZ4A 3EG9A 4UDXX 4M3NA 3T9FA 1DXHA 4TZ0A 1EM8B 1IK6A 1T2UA 4MS4A 5ADVA 1DJQA 4AS3A 4A6DA 1Y8RB 3W78A 3ZS8A 3OLZA 1ZNYA 5JNWA 2B4RO 3OIFA 4ID9A 4FFDA 3T3HA 2VN8A 1OLOA 1Z2CA 2C03A 4J94A 3ZE0B 5BV7A 2IS4A 5HW0A 1TIKA 3AV0B 4TWJA 4EVQA 3MVEA 5C1BA 3WHIA 1HNWB 1Q0LA 5TGDA 5EJ9A 4S12A 4O25A 3ANXA 1B0AA 2Q4TA 2P9BA 3MWDA 1WKBA 5BORA 4HAWA 5H70A 4EGAA 1J2JA 2XE6A 3AOEA 3G9TA 3PS9A 3H4IA 4Y98A 4ZIRB 1GFSA 1IN8A 1YR6A 3OY7A 1NM5C 1FS5A 4BGUA 1T9BA 4URUR 1JHPA 1MJGM 1EUYA 1RBMA 1QH0A 3COSA 3HA7A 4OHCA 4AULA 3LVRE 5HFAA 5C0OE 2L19A 3RYHA 4TV9A 2YRFA 3ENKA 3OP4A 3S8EA 3GNSA 1TI7A 3ORYA 4B32A 5GAJA 4X3PA 4TLBA 3LDUA 1UADA 2PO5A 1K7EB 2IQIA 3FWPA 4TTIA 3RKRA 3AUXA 3BH0A 1QYDA 5BVHA 4MDYA 4DR7B 1KZ9A 4GE3A 1PLLA 2GCOB 5JSKA 3NHFA 2N42A 4Z1MD 1RWMA 1JWLA 5DGHA 3EODA 3I1FA 1K5DA 3E9MA 1QM5A 1Z6QA 5EJ5A 1DX4A 3LVFO 3W8NA 4LRSB 1U7WA 4ACAA 2GBIA 4YVFA 5DVZA 1C9NA 2Q27A 2WHPB 1KL7A 2Y1XA 4JROA 2EIHA 1LLCA 4B3DA 4C3VA 1FQJA 2BI4A 1GPLA 3JWGA 2R6JA 1VHLA 2GI4A 4E51A 4HNGA 5CJ2A 2EWMA 3S5UA 3DMTA 5LB4A 4KAJA 3EQ7A 4HRVA 2WAMA 4WNAA 1N57A 4C78A 2WWVD 2AI1A 3GLGB 4HWOA 4NOJA 1WB5A 2B4TO 3KVVA 4R9UC 3MJFA 1Y8CA 1MJFA 5TMEA 1HL3A 3B6EA 4PIMA 4PRZA 3SHFA 2PXXA 2AZ4A 1KXJA 1TA0A 4CJXA 4HGRA 4KR3A 1YMVA 1G4UR 2CVFA 2FW8A 3FYUA 5L51A 4GX5A 3K73O 1SIOA 2K6GA 3PLNA 3LCRA 4HLUA 4FWBA 3EW7A 3B1KA 3ZTTA 4UUMA 4IO1A 3NBKA 3TSAA 4MPTA 1Z35A 3WISA 1T25A 4JDPA 1KTIA 3MK31 2Q1UA 4J07A 4IQ4A 4J4BA 2HSGA 4GP9A 3H9GA 1G2OA 3EGCA 4XDGA 4BJ6A 4RHXA 2YV4A 4BKUA 1PFVA 1OPRA 1AKNA 2F2TA 3AIOA 4LNHA 3BFVA 1RMQA 2J6HA 4MDHA 4FMDB 1GILA 1SCNE 2JK1A 1S6YA 2XE4A 3KTOA 1F9EA 1Z0UA 1HYQA 3L4KA 1MA0A 1V3TA 1FXWF 1A9TA 2C2WA 1R16A 4K6GA 4OHVA 3E9EA 2Q7DA 4H3VA 4LE2A 4TLCA 2DH6A 1DEKA 4PU0A 3QE0A 2J9XB 4RK7A 1UXJA 4P6VF 3DNFA 2YYAA 3TD9A 1XYVA 2WA2A 5TMDA 2EWVA 3ZIUA 1FMFA 1PWHA 2JCXA 4M83A 1Z75A 4KXNA 1XMJA 4II3A 2SCUB 1U2GA 5TF4A 1SIBE 1L5RA 2PMDA 5DSXA 1D0VA 3GVPA 4UU0A 3THRA 3H3JA 4XCQA 1M8GA 3B7PA 1QIMA 2ZSAA 1KK0A 3W5IA 3IKJA 4NMHA 4D79A 5G4KB 1M2GA 5L53A 1WQ4A 3DVAB 4EITA 2OD9A 2B7BA 2AL7A 4O2BA 4QJBA 1T4GA 3SDZA 1W1WA 2Q8NA 3RG2A 5DWDA 2FPIA 2RIRA 2ZT7A 4LZAA 5LBIA 3W5UA 4PS0A 3HL0A 1W36B 2IBSA 3AR5A 4JJ6A 1RQGA 1RQNA 4LXHA 4PFKA 5JZBA 4GGOA 5ELLA 4J03A 4M55A 1W36D 2OV8A 3GVXA 3NBXX 1O8CA 4HGQA 5LXTB 2OBYA 1HQKA 1P18A 1PDOA 2EJBA 1CV2A 1M8JA 5D3MA 2DWCA 1V25A 2EJUA 1NOKA 4LC1A 4OKNA 4PYRA 1CQXA 4CV1A 4E70A 5ABPA 1WABA 3ZHSA 4UUBA 4AF6A 1B23P 1E94E 1XTRA 3M6XA 3PUWA 4IIJA 1F2UA 5CIWA 1MEEA 3GYGA 4KWCA 2RHHA 1OREA 3PGMA 3RFVA 1MQ8B 1KDTA 2C2YA 2QLFA 3LRTA 2IW1A 5DHUA 3WGGA 3FA2A 4DV1B 4H18A 2UAGA 3CN9A 3RNLA 1C14A 3DHWC 1B0UA 1LQTA 1Q0RA 1QH9A 1T36A 2AN5A 4KW7A 4BO6A 3RC7A 3GOQA 2HJVA 5AKKA 3LLSA 2NU8A 2XF2A 3VJMA 4QGHA 1T3ZA 2O3JA 3RS4A 3OCVA 1HWYA 1GNPA 1T3TA 3IP7A 4V2IA 4UUQA 3MJSA 2VPTA 3E9DA 4PZEA 3LLMA 4RLFA 1U1GA 4Q9IA 5EWLA 2R68A 3LV8A 2ID8A 2NVUA 1E9DA 2ORIA 2QOEA 1CXZA 3H2GA 1J0CA 1ZHHA 2HJWA 3PJGA 3KXKA 1FMCA 3B60A 3DAFA 2IEAA 4AX4A 3HDQA 1M34B 4LX0A 1VJ1A 3DWGA 4LYHA 1NVAA 4N9WA 3U62A 2BKLA 4FZ3A 1UMCB 2YOFA 4Y30A 1H4SA 1MNQA 1WVIA 4HR7A 2FP3A 4YJFA 1W73A 5KINB 3N8IA 3IIIA 1X8XA 4FM9A 1IVNA 3AH8A 3PQ8A 4GSYA 1A4RA 1BS1A 1K6JA 3BFXA 1QB8A 3JYPA 3PR2B 5DI3B 3WMWA 1VL8A 4WZAE 1F6DA 2JJ2A 2PCJA 1RQ2A 3GCXA 2YN2A 3L0YA 4YFVA 4MIKA 4PBSA 1ECLA 4U1RA 2H06A 4BQIA 4K9LA 3JVIA 2ZUUA 4BTEA 5AP9A 4BOYA 3LG2A 1K89A 3CWQA 3PXAA 1JS1X 2Q3EA 5FEMA 1T9CA 1L5WA 2FKAA 2GBPA 2J1LA 3G9XA 5BOVA 4LSMA 4Z3DA 3RC2A 4NENB 3W77A 4HWSA 4GU5A 3CGGA 4CHTA 4BN5A 1CJUC 4LXIA 2LE0A 4M8NE 5JRDS 1DC4A 1NU8A 4IQ0A 1LX6A 2IITA 4NOMA 4QL3A 3LU1A 3TRFA 3TSCA 1OAOC 2IYPA 3O5AA 2IHVA 3DMNA 5B1HA 3MN1A 3UWOA 4BO7A 4CF4A 3OH8A 4DJTA 1T2NA 5EQTA 2JKYA 1PYDA 5CA0F 5TQ0A 4N6NA 2QDXA 4OREX 3KKMA 1KYVA 3U4HA 5BVGB 1HPLA 5E9JA 1IVYA 3TE6A 3B38A 4F97A 3LUGA 1CC1S 1HE3A 2PLAA 3ABZA 3KQQA 4NZPA 2QN2A 4NMWA 4OO3A 3WXBA 3EJ6A 2RJ3A 2NZVG 2AH5A 2VHUA 4TRMA 3KDSE 4UHEA 3K1AA 4BMYA 3NI2A 3RDPA 4ERNA 4KGZA 5GONA 1IATA 1P8AA 3SKXA 2PKXA 5AHKA 1U5AA 3BREA 3WNZA 1ESZA 2PV0A 1Q22A 2N0SA 1ZMBA 4AJIA 1AXGA 1ZPDA 1CJCA 1HZZC 1UK9A 4LECA 4PSUA 4GBED 3OUZA 1HFJA 4OIFA 2DETA 3W9SA 1ZJ4A 2H1VA 1FRZA 2EF0A 4W1PA 1MV5A 3NHAA 2PMFA 4FMBB 3R3ZA 2EW1A 2D0OB 3SJ7A 1Y8ZA 3ZDAA 2XXAB 1EJ2A 2YX1A 1P80A 5JWHA 3NAQA 4MJXA 3RODA 2HT1A 3BEDA 5KEIA 3SN6A 4K6CA 2Y0CA 2ZANA 4QUBA 5IASA 3BX1A 5ERXA 4A0GA 5T5QA 4DSUA 5KB3A 1CY2A 4R8KA 1Z5GA 4IHJA 4MK4A 2XB9A 3MWFA 1G8MA 4URWR 5JH7F 1KU6A 4UBJA 5EE0A 2C88A 1HY3A 2V7VA 2UVDA 3SYNA 5AM3A 3SYTA 5J9FA 2RHMA 3FZQA 3QUBA 4H3HB 2BLLA 2HU2A 2X14A 4K2AA 3WQHA 5IJZA 1CR0A 4KJXA 3EZFA 1EIZA 4MGIR 3WNVA 3FPEA 1Y4AE 4QXRA 2EJCA 4EYEA 3EZGA 5H02A 3IR5A 3G2OA 5JC1A 2E1RA 2PLFA 3E6AA 1DFGA 4D9JA 1GPDG 2HIHA 2GRUA 4GI1A 1BHQ1 2ZCUA 1KY3A 3LUAA 3KKZA 3NBMA 2H17A 1S96A 3QPAA 4UD2A 4Y18A 1C30A 5EKSA 1JG2A 2ZJFA 1KSHA 4FDVA 2CXTA 4OUDA 2VHXA 3PVCA 3AHJA 4QBGB 4C4OA 2J33A 3NHZA 2BMDA 1WSAA 4RK6A 1CDDA 1U5BB 3SHOA 3CLUC 4RXUA 2PS0A 3AESA 4CKYA 1QZXA 3NGMA 4X93A 5EERA 2HHCA 4FFVA 4WBSA 5ALOA 3WS7A 4C4XA 1JFFB 3MGCA 3NKFA 4C0HA 5B12A 4B4OA 1UQRA 3A6JA 3ADPA 2GD1O 1RRVA 1TQDA 2GPJA 5JQGB 2VXYA 3W1EA 1M1YE 4JSYA 5FPYA 5A7GA 3DYVA 1AD2A 4KFUA 4GLOA 4XFKA 1ZY2A 2X7XA 3KUXA 3QX3A 1JPJA 4WOBA 1U81A 2ZZNA 2WJAA 1ZGBA 3ZD6A 2QTHA 1T2FA 4WVFA 4BVGA 5JJCA 1EFAA 1ZHFA 4KQWA 3DLCA 3TPCA 2QBYA 3L9WA 3PC8C 4C0XA 3BDIA 3UUFA 1PHPA 2OVBA 2WM3A 3RU3A 3R09A 3C7CB 3UICA 3K09C 3FIJA 4PICA 3TTYA 4DV6B 1C81A 4V0SA 3TTWA 5CBPB 4QYIA 5KQMA 4OSOA 3WOHA 4RMIA 2FPGA 4UEWA 3ZBTA 3PUVA 2H5LA 1QQ7A 2HSWA 4NBUA 4B75A 4BWFB 4YAUA 1JJBA 4F2PA 3MPUA 4Q47A 1PYOA 3CMCO 3QVSA 1OI3A 1ZK1A 2BFPA 4XX1A 1COZA 2P2ZA 4OV6B 3V97A 3FI9A 1E1KA 1YQXA 1UQTA 2XNJA 3MUNA 3BWYA 2G9RA 3BXPA 4XYBA 3BKWA 3CNBA 3EFBA 2GDJA 3DHVA 4YMSA 4K2HA 3U39A 4COOA 1BKSB 4I9FA 1WPXA 3IEUA 1UT6A 3RJMA 5AVYA 1XIVA 3AEKB 3BH6A 3QXJA 4NI5A 3IOCA 4ZODA 2XZPA 4OQNA 5ENDA 3H2JA 2P9CA 2XCOA 1NBIA 4BE9A 1A04A 4XYEA 1KE2A 3UUGA 3Q87B 1H0KA 5FWDA 1XA4A 1P7ZA 3IEIA 1OZGA 3KT3A 2WWFA 1SIUA 3FR8A 4AQDA 2VXBA 5U1PA 1EYZA 2VEDA 4FIZA 5JTUA 2H8KA 1Q7CA 1WD5A 2VDQB 2IEBA 2HK6A 2JHAA 3N9IA 2Z57A 1GYRA 2ODAA 1K63A 5K3FA 4B7XA 4L8YA 4OBEA 2YZ2A 3KOMA 1COWA 2C3MA 3PXUA 5CR9A 4ZT2A 1KO8A 3R44A 3AEZA 3E9NA 3HNPA 3W0LB 4HNHA 4S05A 2FMXA 3FUUA 2C1EA 4BP8A 2VLIA 2JIDA 4IDNA 1ECBA 3WYBA 3OF5A 4MUYA 2ZBFA 1TZJA 2VWHA 4Q34A 2J4CA 1HYBA 3B6KA 5JQWA 2NUTA 3HSSA 4DA6A 3GRZA 3AEQA 1E6MA 5I5GA 3TLGA 2O5EA 1FP4A 3MIIA 4BNFA 3LI2A 1XX6A 3LSYA 2ZCJA 1XDBA 2P40A 5DCYA 4EVSA 1F1BA 1YU9A 2PSSA 2VHTA 4M0MA 3V6LA 4BNNA 4AT1A 3O4IA 3Q9SA 4Q7EA 1E3TA 4GSKA 5CT8A 1QHNA 3C1TA 3HB7A 4PSAA 3FSGD 1X92A 8ATCA 2EU8A 3IPRA 4E5NA 1CU1A 1QS0B 3NX4A 1PU2A 1M6EX 3LVBA 4NMLA 4XX0B 1GZ5A 2AWNA 1UZNA 4OCZA 1EDEA 1R5BA 2QG9A 4GR9A 3E27A 4DAOA 4GRAA 4XWTA 1JHAA 1XMSA 3D6NB 4QFBA 3BAFA 5DX1A 3S99A 3QY0A 3TIGA 4ZN6A 3HXMA 1H2RS 1VKNA 2ANCA 1N5JA 1ADGA 2C96A 3AP1A 3DE3X 1D0IA 4EHFA 4Q4CA 2OXEA 1X1BA 1OOEA 5CNJA 3EH1A 3I34X 1OVMA 1XRMA 4NU8X 3UW3A 5KC8A 1VBFA 3KSMA 4HLNA 3WLEA 2V59A 1N7JA 3C14C 1XKQA 4QJ5A 2BGUA 2OL4A 2J9GA 4U7PB 4E30A 2IOYA 4AQ7A 1UK6A 2F8MA 3AHEA 4AXXA 1U5CA 3KT8A 1T5LA 1UQUA 2H6EA 2OSBA 2Z04A 3MMZA 5CX4A 5F3DA 1FJXA 2UYHA 1AB6A 1MVNA 2CLCX 4MVJI 4JP1A 1A5SB 3L82B 1XTPA 4MUMA 1AHNA 1V2HE 3QU9A 4PS1A 2OCDA 5AHWA 2HMYB 2HK8A 3D8HA 3HUDA 4WXPA 5T6MA 3ZLTA 3ISJA 2ZB8A 3OQ6A 1EQAA 4J3FA 2ISSD 4RQTA 4UVDA 1I4TD 2VAVA 3H1EA 4MAAA 3OJWA 4WA8A 4LWOA 2BFBA 3IEKA 4OJQA 1Q2XA 3RE1A 5JS1A 1DLJA 4TV8F 3JATA 3V2UA 3KLNA 3MLBA 5LZ5A 4RGQA 3TGLA 2I66A 3BGOS 4RF5A 5D3KA 5ALPA 4KB5A 2ZTVA 1MW9X 5CB4F 3U7JA 3HU5A 2HRBA 1XRLA 1RZVA 3KQVA 2DFTA 4FI3F 3KC2A 4KGVA 3QFRA 1L3IA 1SKUA 4LRYA 4B7AA 1PR0A 1IM8A 2ZT5A 5HF8A 2PUWA 1FTQA 3ROZA 4F1JA 1RXIA 4GYWA 1Z68A 4KZPA 5FBHA 2H1SA 1E1DA 3G2NA 3O91A 4O4JF 5J2TA 3D43A 4BMOB 1PBTA 2Q7OE 3C6ZA 4MCIA 1ZP6A 1N0UA 2D1TA 4QICA 1Z5WA 3PHIA 5ESRA 5KREA 3EIOA 4IVQA 4H7EA 4QUKA 4PBTA 4C2UA 2DHEA 1VMAA 4JBIA 1SBNE 4J7AA 2W42A 2BUCA 1J2RA 1RABA 3ZI0A 2H4WA 4BQEA 4UDOA 4XM1A 3WC4A 4YRZA 4DOMA 4ENPA 4YJGA 3I0NA 1LCIA 1WUJS 3T3NA 1F2TA 3KUDA 5A7HA 4WXMA 5HRAA 2IU0A 5JY6A 3K9GA 1PO7A 1HSOA 1ONOA 4MW0A 4ZRNA 1DOZA 5DLDA 5AWFC 3IPYA 4V3BA 5BT8A 3OPYB 1ORWA 2ZJAA 3IMGA 3MUOA 1QPZA 1BSVA 1FL9A 1SB8A 2ZRQA 3COZA 5ITVA 1PR9A 2O2YA 3AJAA 4IDAA 4OL9A 1CS0B 3V1YA 3N1UA 3LGXA 4YV2A 4KDFA 1VLZA 1XZJA 4LW8A 3II6X 1R00A 3EQ8A 2VPQA 4FILA 3CF2A 4QYTA 1RIIA 2FOLA 5I01A 4L0MA 1NV8A 1MC4A 3DOJA 2EEPA 3S68A 4ZJZA 2QSZA 2LTAA 2QL5A 4XASA 3UOGA 4HAYA 4AJOA 3UJBA 4DCTA 1G3RA 1M10A 2V7QD 2QS9A 3GHYA 4ZO7A 5FKJA 3QU2A 1FFWA 4J1TA 2VSXA 1CHDA 1ND6A 3T41A 4BQPA 4QFMA 2B1GA 3T1VA 3J81k 2CV1A 2ATEA 1V48A 3ZJYA 3AI7A 2P5SA 1IBSA 4P7JA 1VPDA 3I53A 3LGAA 4IP0A 1AOXA 2H4XA 4P8RA 1DC8A 3C3BA 3L7KA 4JX9A 4XJVA 4BCBA 3MTGA 4PRYA 3VZRA 4DLLA 5CEJA 1ZCFA 3SZMA 5F9HA 1F38A 2GDZA 3LGSA 2IUYA 3IR7A 3B7GA 1AQ6A 2ZIWB 4L51A 2PSEA 4YV0A 3LZDA 1QTNA 5ADWA 2DKNA 5F9FA 5DGXA 1Z16A 4MW9A 1GPWB 1HMYA 4U9IS 3ZG6A 5JDCA 4AUKA 2MJLA 4MWSA 1N3IA 4CIVA 4AKHA 3F3KA 5EVCA 1JDBB 1LD3A 2H1LA 3AVOA 1YBHA 3QVVA 4JUCA 4TV9F 3UXYA 1SXHA 3C6QA 1IULA 1UDWA 3LMKA 4A9AA 1R2QA 1DAKA 3MWEA 5AW4A 5BR8B 5G0WA 3KKKA 5IC6A 1YUNA 2OHXA 3TX2A 2XYQA 4LRTB 1P3JA 3BFKA 2VSOA 3CLSD 1T8RA 2XH8A 3HI4A 3SDSA 1JQBA 4K03A 4KFTA 5FLKA 5TPWA 1KI9A 1XTIA 2DQKA 1J7KA 4TS4A 4KPFC 3I62A 1XVAA 3RCBA 3EFHA 5A4IS 3LECA 4GOJA 3KFXA 1BN6A 1CK4A 1U28C 2ZYUX 4MRAA 4N0PA 4ZC1A 2VHYA 4KDCA 3WFZA 3NO4A 3LZ6A 1FDUA 3T94A 1QU3A 1PR2A 1DADA 1LNQA 1BMFA 4C4YA 2PX3A 3B13B 3AM3A 5FHQA 2N1BA 5AKXA 3RUCA 1GIAA 3KFLA 4RTKA 3NVKI 1T6YA 2GILA 4HDKB 4Q1VA 3IURA 4GPAA 1H0SA 1O5OA 1ORIA 3IVRA 2CB9A 4RA9A 4YCJA 4DNPA 1BXGA 3MCZA 3TN7A 4DG8A 5EIBD 3REQB 3RIEA 3V3KA 4CQLA 4E2ZA 4B44A 5F12A 3ODPA 2NOAA 5EWMA 4EF6A 3D3WA 2B78A 3EOZA 4GDFA 2IZZA 2Q9CA 4CCYA 2CBZA 1UINA 3AF2A 2UV8A 3GH3A 3TOSA 3A11A 2CSUA 2QZ4A 2C5SA 3M6WA 2J59A 3VJLA 4XWKA 2PUTA 2WNHA 4B8WA 1PFKA 4XE5A 3LHDA 4E4TA 1CJSA 5K8JB 4YEDA 3H1FA 2PKRA 4X6LA 5FBZA 3AY3A 1QHYA 3DWEX 2X40A 3ZNNA 3CVWA 2YJNA 3K9BA 1KQPA 3INYA 2R9VA 4PQRA 3CF6R 1PT6A 1DV1A 2WE7A 2NQ8A 3VSAA 3A6HA 4H31A 3EX7C 4ER5A 2C7RA 4J7CA 4LDZA 3PD0A 4F84A 1N6PA 2WMOB 4ZYYA 4GX2A 1CNFA 4CIAA 3L8FA 1SD1A 4KREA 2PWYA 5LDDC 1PLJA 7ABPA 4MROA 3F5QA 2WD7B 1G3IA 1JA1A 2B35A 3EF0A 3O8NA 4GHWA 4X7MA 4F2HA 1ZR4A 2IUEA 4X6XA 2BP7B 5FPPA 1BD3A 2PU5A 3WLTA 1KEEB 4RVNA 3C6KA 3E15A 1QYRA 1F14A 1LF0A 3I39X 2YXBA 1YOVA 3LBHA 2IOQA 2VHEA 4YMGA 3GLGE 3L0DA 5SZIA 3GAAA 1SOMA 2J3JA 3GRKA 1SXJD 2XUIA 2ZR7A 2QVXX 4Y1RB 1EFDN 3OKCA 1L7XA 4GYJA 1KYWA 1SG0A 3E70C 1W4RA 5JEEA 4E0BA 4JXZA 1M5RA 3RRZA 4LJ9A 4X90A 4CTKA 1SBIA 1XLWA 1JDSA 4KPUA 5HFNA 4RLQA 4O2BF 1GU7A 4X00A 2H9YA 1E2EA 2JGNA 1X87A 4L0QA 2D74A 2GARA 4FNMA 3U4DA 4I55F 5FL7D 1I3LA 4MMYB 2FSHA 5GM1A 4MWDA 1Y7IA 3BB3A 1XTZA 3G2KA 1UBFA 1RZRD 3FNBA 3TLYA 2R0QC 1N2XA 1QXSA 2PVSA 2PT6A 3LKZA 1GJRA 2Q62A 3WRXC 9ATCA 2WJIA 1XVUA 2I4MA 3PFIA 4H7IA 4NICA 3ROTA 5IF3A 2I7CA 4ND8A 1RAFA 3QWAA 3EHDA 4LRXA 4EA6A 3WX0A 3WYCA 3FVTA 1CVLA 3G2PA 4D4GA 4GXQA 1WHSA 2E4YA 3AM4A 5JYCA 2KW5A 1PX2A 5KHOC 2XCQA 2FN9A 2GNPA 3VR5H 2A0FA 2H7VA 3PGLA 3WLPA 2LW7A 5CXSA 5JT1A 1NVFA 1WHTA 3HNOA 4DCPA 4M1QA 5DWVA 3IQFA 3PEFA 2WIBA 1KAMA 2M1ZA 3ASYA 4H1WA 1CZKA 1Y4DE 2FSSA 4EENA 1ZK4A 1NNLA 1P2GA 1XMQB 1X3LA 5FI1B 6LDHA 2W6ID 3FPAA 3QFFA 4YQFA 1QGDA 1MC5A 3WYGA 5FA5A 1ATZA 1C7ZA 4PZCA 5JDIC 4I1PA 2WYHA 3KYCA 3OZTA 4LQCA 1KI6B 2QTGA 3I2FA 3H2SA 3J7AC 1TVEA 1UBKS 5T4EA 3QKSA 4OG2A 3UHFA 9GPBA 1BWSA 2OLJA 1Z74A 4XWAA 1QORA 3HCCA 3WYNA 4AZ0A 1P1HA 4EVIA 1HE4A 3B78A 3RO7A 5JY1A 2V6GA 5E8JA 3VV2A 4NZMA 4BNDB 5BSFA 5C53B 4RADA 1J0AA 4ABTA 1PT8A 2Y1EA 1NMXA 3ORSA 4QATA 1JDZA 2WU4A 3GLUA 1R27A 2F9MA 4X1KA 1ODCA 3ORQA 4RHFA 5A06A 4ZPXA 3EDMA 5C9ZA 3L0BA 4NDNE 1NAHA 1J06A 5FORA 1SOAA 1ZH6A 2C9DA 4LYEA 3CJQA 2AK3A 4HYQA 4KMRA 3E5HA 3W3AD 5C35A 1RXWA 1GAWA 3NKLA 1U3TA 2LP4Y 4EIWA 1SZPA 3ZVMA 2XDQA 3WMEA 3ZE8A 5FBKA 3W4IA 2WSYB 2HF2A 2EL7A 3V5NA 1Z82A 2AD1A 1JQAA 2NU9A 3OJOA 2G4CA 4J7UA 3DZGA 4M0UA 1F5SA 2J30A 1H8HA 2FLVA 1KMCA 3IAS1 3K5IA 1VHWA 3COVA 3P9YA 5DXJA 3TPFA 2C4MA 3WSWA 3A1EA 3WL4A 3EOAI 1V1JA 1CLEA 3B85A 3C8UA 3KQPA 4IV5A 4D3XA 5LQUA 2C7QA 4G0VA 3O8DA 4RULA 4PLHA 4OJNA 5EP1A 1E3EA 2HAEA 4BGIA 1ZN7A 3T7RA 4EI9A 5JAPA 3D6TB 2F64A 2IODA 4ETWA 4C3OB 1XL0A 1C0EA 1UDXA 3EEIA 2SICE 3R5JA 2XCRB 4AJ9A 1AS0A 2BZGA 4K46A 1DUVG 4BO0A 4Q1FA 5D51S 4FSXA 3FFWA 1QAOA 1ZD3A 2IT1A 1KYTA 3PFWO 1LNSA 1HDEA 4Y9UA 2FQXA 5BNFA 3ROPA 1SXPA 3ICEA 1TM7E 1HE8B 4RPIA 5AM4A 1JFTA 3JD4A 3W6UA 2TS1A 5C1IA 2Q46A 1U65A 2RGCA 4G8JA 4IJMA 3IALA 2QAJA 1XRQA 4YBZA 4L08A 1AHIA 1XZAA 3KWFA 4ENWA 3LS2A 1V95A 2W6OA 5DMHA 2IPAB 4YT8A 2JGJA 3PI7A 2AW5A 1LNZA 3P0FA 1VYHA 3JQAA 3NM6B 4L8FA 5GONF 5EJ7A 1N8NA 2R7KA 4XZ3A 6CHYA 2VQEB 4AY6A 1DO2A 2CZQA 1GPJA 3EAGA 4OQXA 1TKBA 2P90A 3VR5A 4F38A 1ZM7A 2GFHA 1UBMS 2XTNA 4YH1A 1FK8A 3JAMA 3COWA 3ERCA 3LK7A 4P34A 1L5SA 3GZ4A 1XR3A 3URKA 2PN1A 3R74A 2PXAA 4H6XA 2CFIA 3P9IA 5FD8A 2WV7A 3R1IA 2RGGA 3P0EA 4OFXA 1U8CB 3NBZC 5IRCD 1EBBA 3Q2OA 5FUWA 2NYVA 4AF8A 3OT1B 1O6FA 1C7EA 2PZFA 2QM0A 4D9NA 1ZIXA 2HHJA 2HCTA 4IHJF 1LK5A 1RWVA 4U5XA 4X54A 5LYJF 1DC5A 3BE5A 3HDYA 3QVXA 4RCYA 4QA9A 2F3SA 3L7DA 1JMKC 4LCEA 1EVZA 1Q15A 4FKBA 4ND6A 4GUAA 3TO5A 3DFUA 1MDFA 1PEKE 3TSWA 3N2EA 1KJQA 4OM7A 2F4VB 2R6DA 3W9YA 5CA0B 1D6MA 5CG1A 5SV2A 4JGGA 5HQTA 5BSHA 3S81A 1N2SA 4A92A 1TU3A 1OFTA 3T1YB 4M86A 1NIPA 2QX7A 3T7KA 2FEKA 4CEHA 2VT7A 5TNXA 3E2MA 1P1BA 3KOXA 4EG8A 5E6UB 1CR4A 1PSDA 2BELA 1JEAA 1VKZA 3BMQB 1W4AA 3DMDA 3JQBC 2FOXA 4OTZA 3VHXB 3SBDA 6ABPA 3CEAA 2HY7A 3K0KA 1QAMA 3WV5A 3PPXA 4AWBA 5GZ3A 2C2OA 1IAQA 4DNXA 1WUIS 1EDBA 4MVJG 4O29A 4ZARA 1N4AA 5IBPA 2FX5A 3GDWA 1YDGA 2GEJA 1ZI9A 4UEJA 4K1LA 2YHIB 4DQLA 4BX2A 1QUEA 2YRXA 2L42A 1YIDA 1EFUA 2P0YA 3RJ5A 2CNOA 1BROA 1GA6A 2OHOA 3L2OB 4PEVA 3FPJA 1QG0A 1GFIA 1OXVA 2QT9A 4HATA 1I94B 2HU8A 2DKFA 2H0AA 1GV1A 2FSVA 4DJDC 2XQKA 1HE2A 4TTJA 4B6PA 2ZAMA 4DDTA 1HG1A 2ZYVX 2A4MA 3VPAA 1T2CA 3EH2A 4DYVA 3T4EA 3BPSA 3WHPA 4KQEA 1IPFA 2JVJA 1ZGHA 5JH7B 3D3NA 5KWVA 4CODB 1B15A 4Y0NA 1AM4D 2GS9A 3I42A 1PQ4A 4UFNA 4XEHA 4F4UA 2CFTA 5J4VA 2YNMA 2VKTA 3A2MA 4I1UA 3QU4A 4JEHA 3V4RA 4E15A 4IF6A 4K40A 3TDKA 4Q3KA 4YO8A 1R88A 1F8GA 3SS7X 2BN4A 1PQPA 1VE5A 4YN3A 4ZEXA 3ZXYA 3DPUA 1E2LA 1IOLA 1Z37A 2VP5A 2VP6A 4K9RA 2WLSA 4MS3B 4B9AA 5D87A 4CCWA 5HVNA 2VUIB 2Z8YM 3LFTA 2P2SA 1LUAA 1RHQA 4QOSA 2GTHA 4WN9A 1M2OA 7REQB 2DHDA 3B6IA 1RAGA 2DUUA 3ILYA 4IXWA 4UPDA 3QVGB 1JKXA 2PPVA 1HXHA 1Z7EA 1SKBA 4OHKA 4U6NA 4XDZA 5CT4A 4GVLA 3ZX4A 1G8FA 4RTJA 3PUXA 1RPZA 2I2CA 4QULA 4MW7A 1ULSA 3U09A 1KSFX 3WJAA 1ZSNA 1SHTX 3GFOA 2VP2A 1IMJA 2ZRGA 1A77A 3M9XA 2I1LA 2JHPA 1BWPA 1TW2A 4W7SA 5AVSA 2WYOA 4J90A 4A82A 3EARA 4QEZA 1WXQA 1O95A 1VOTA 2OV1A 4HLDA 4ZQFA 2Q28A 4D4KA 2O2XA 4DSZA 2GLTA 3DG9A 4PX2A 4MEBA 2WWGA 3FPCA 2CCKA 1YNOA 4KXWA 2FJUA 3WGMA 3BC1A 1ADYA 1L6IA 1FFHA 4N3BA 5FWYA 1M2VA 3T5GA 3F2VA 3KOZA 3RU7A 4WZAB 1W34A 4QELA 3Q3JB 3CLRD 1PTJC 3HQ4O 5U4XA 4EB8A 5EHNA 3RLIA 5C5EA 4LDNA 3EEBA 2Y92A 4PYQA 2J9FA 3KS9A 1CR2A 1Z7BA 2DF8A 4HRAA 1T2VA 2HMVA 2P5TB 5IAOA 5A5GA 2FMTA 5JATA 2EHDA 4HSEA 3RUFA 5K9ZA 2H0RA 3DV9A 2D7JA 3GT3A 5JMPA 1CE8B 5F78A 3W2IA 4XAQA 2WDPA 5DN9A 2AYXA 4UAJA 5K4AA 1TJYA 3M1AA 1BE6A 3KHSA 2H0QA 4FJ1A 2FPWA 3HDJA 3TB6A 2XNHA 1WSWA 2Z98A 5KSYA 1YQ9A 1OBVA 5KTSA 2RFLA 3VRHA 2IYFA 1IZ9A 1G5RA 1MX5A 3FDJA 3ZE6A 3OLXA 5AHOA 3WKCA 2ZUEA 3QWIA 4M7WA 4CM9A 2CCJA 1W8DA 2IYWA 5HK8A 1TAGA 1UBHS 1AA6A 1P2UA 1PEYA 3NYIA 1I36A 3FZNA 4F71A 3OOSA 3H2KA 2AR0A 2GCGA 1VM6A 3EVBA 4FS3A 4Z9AA 5JZ9A 3WWPA 1R7RA 2VQ3A 1AU9A 4PR0A 4FYMA 3I28A 1AK9A 1YOBA 4MXDA 1O4VA 2ZSDA 1FJ2A 4ZYWA 5IJ0B 1T1EA 3F71A 4BQNA 4PXAA 5K5EA 4P5DA 3KAQA 3WO1A 4DLSA 2CXNA 4X85A 4O2AA 2VJDA 2AC4A 2P9FA 3CW2A 2I29A 1TCCA 4LWZA 4Y7DA 4B6QA 5LJLA 2CW5A 4TL8A 2XWQA 5IYZA 3BE6A 4YP6A 3OF2A 1V7QA 2KLHA 4CUKA 2EXXA 3QELA 5IXJA 3AONB 1JUDA 3L8CA 3LPMA 1DJMA 2Q5LA 4YJ3A 5I9BA 2NXWA 1WKCA 4DA0A 2ZYRA 4IVNA 3MTAA 4URHA 3ZS9A 4EKEA 3ETNA 4GOXA 3GFPA 4P38A 2QRVB 4QYMA 3RSCA 1D1TA 3MTBA 3DE2X 2IYYA 1YRWA 1Z0IA 3AKDA 3Q3VA 3J81A 3GWGA 2AF3C 3NXSA 5JAOA 2ONKA 1XMOB 4BNUA 2QRZA 3VZPA 1JJIA 1CUWA 4EM6A 1JSZA 3G8DA 3L8YA 3MS4A 3D5TA 5BXQC 2VPPA 4XRGA 3E7DA 4BLUA 1V1MA 3MGGA 4HXYA 1IPEA 2REQA 1C0IA 1GTL1 5J2TF 2B2XA 4PZAA 4BMCA 1NVTA 1VYUA 2V7XA 3Q72A 5ELXA 4Q82A 2GK7A 2XQFA 2YXDA 3DQQA 1DL5A 5JTTA 3GUZA 3IXLA 3Q3GE 1GG2A 1LBQA 1J1ZA 5JZVA 1Z26A 1UMKA 4XYMA 3UIEA 1GPNA 2P9ZA 2QN3A 4KVZA 4Y2GA 4C0WA 3RRNA 3I2JA 1CVIA 4W8OA 1DXYA 2L2QA 5C7LO 3LP8A 4FBLA 2G6TA 4REMA 3RBVA 7ADHA 5FWXB 5C3MA 4X1YB 1NF2A 1EK6A 4Q7KA 4GPBA 1AE1A 2PHZA 2CXXA 4FHZA 3DXYA 3CVXA 2DFLA 3G2IA 1UT8A 3SDBA 2VF4X 2B4QA 4LMAA 3NHYA 4M9SA 3DOEA 4DRZA 4KI7A 1CB7A 2H1HA 2BEKA 4ARIA 1SA0B 1LDYA 1A8HA 2R1VA 4EPVA 1D5CA 1KS2A 2EKBA 3CKLA 1QKIA 3FBWA 5HIMA 3OZWA 4KV7A 3W3ZB 2PX2A 3HYLA 1E6KA 1SC9A 3RGGA 4PHHA 3FYTA 4TV8B 2TSYB 4RKWA 4OJYA 3ZHVA 3LBFA 4YMIA 2OLEA 3HCRA 3MS7A 4GRIA 6AT1A 2B8EA 3ME5A 1VJTA 4YK7A 5CB4B 1IBLB 2D54A 2YJ3A 4JJGA 3T9CA 6PFKA 1VA4A 4WDQA 5KNCH 1E1NA 1G5HA 4XIFA 4CEHB 1OAOA 3QTBA 3K94A 2HOQA 2MU1A 5I9SA 5K0SA 4RPJA 1ICEA 3DOIA 4O4JB 2AJ8A 2ZE6A 3P5BA 4FFBA 4YBRA 4F60A 5ALWA 2BTEA 2B34A 4FB5A 4L4RA 3VR6H 4RD0A 4KIUA 4OYRA 3RWOA 2CXUA 2GGSA 1TZKA 5EESA 4KVAA 5EYPB 5LZ2A 4LXUA 1H6AA 2NZYA 3O4VA 4U3JA 2B5WA 2GN8A 4TLEA 5FI3A 1F4PA 1GN8A 2QUKA 4LYGA 1Y3HA 2JKZA 5K4GA 3TRIA 4ENRA 1NNI1 3NCHA 3ITDA 4W7IA 2JLSA 3QLEA 5K3BA 2B6NA 2F1HA 3F7OA 3VO2A 4AIRA 5E3IA 1SHUX 3RUEA 4CM8A 1Q0QA 4GMFA 4CMEA 3R7LA 1KSJA 5FTKA 4M1YA 4OHYA 3DVSX 4O02B 3D7LA 4RZUA 3I6ZA 2Q0SA 1HI9A 3G6WA 4CLRA 1AIPA 4DEYA 2VFAA 3H8SA 3HR7A 2NT4A 1Y3CE 2CLHB 3EEQA 3W6ZA 2EZ4A 4QPDA 4UHBA 2IYVA 1NQOA 3L6BA 3PNLA 5GQSA 3R24A 1XZLA 4WEOA 4M49A 1HNXB 5K2MA 1BC5A 4MHTA 2PK3A 4RNDB 5F2KA 4ZDKA 4DJJA 2X5OA 1E6LA 2H2IA 3EG9B 3HCEA 3CE6A 4H17A 2G1PA 2IXDA 5IM4F 3WY9A 5C5CA 1EWRA 1RADA 1VJ0A 2JZOA 1YR8A 2ODPA 3A28A 1E7WA 3FH0A 5C5IA 5ANRB 3Q4GA 3RTCA 3ZDCA 2JNWA 1PQUA 4ARAA 2B8NA 5L3SB 1V8DA 2E4XA 4FNOA 3WO0A 4OYHA 1Z9BA 2O8DA 2KS6A 1N9ZA 3HCDA 1QGAA 3LCUA 2O59A 5M29A 3TG8A 4D5GA 3NVMB 1EVYA 5JIBA 4NXMB 4PPFA 2M2IA 3HDVA 5T3UA 1KK2A 3O75A 1GUAA 3HZHA 1U2QA 3I5MA 4N3NA 3K0AB 2OORA 4POAA 1V8BA 2P75A 2JL1A 2CLIB 3HM2A 5ES3A 2CL6X 5EUMA 4ZV4A 4OI0A 3DVQX 5DTIA 3N75A 4F4DA 3C16C 4CMIA 1QCCA 2BDEA 5FOWA 4CMJA 3SHVA 4BLTA 2JH9A 2DB3A 3G2HA 4YCSA 2TMDA 3ON5A 3PCXA 4Q4DA 4Z54A 1D4FA 2PX4A 4L72A 4Q12A 4DMKA 4IOLA 4EFNA 3GUYA 5JHHB 2AQ8A 3P8ZA 4P86A 3ONWA 4TV9B 3RYHB 4DRXB 4CM3A 1V5GA 4KC0A 1NR7A 1JEQA 1GEEA 3FBTA 1Q7RA 4V0LA 3TNFA 3CWCA 4FDLA 4LCJA 5BVHB 3RS2A 5AJYA 3DONA 3I05A 2OY0A 3FNGA 2ZI9A 1SXJE 4FYJA 4HQFA 4PZDA 5BUZA 1NBOA 4IDDA 4TUYF 3PQ6A 5CA1A 1JG7A 3MSCA 1KFKB 4KR6A 1EZZA 3A10A 4P7KA 4DR1B 1CG6A 2C8LA 4BO4A 2I80A 1RRPA 4E31A 2X9NA 1JQEA 3F6SA 4R05A 2XVZA 4GPTA 1UPXA 2R7NA 2FXVA 3FOCA 2C83A 2NM0A 1NDUA 2BGNA 2LNDA 2XVMA 3AVXA 5BMOA 1AZSC 3PC8A 4XQ9A 4BMZA 2C8JA 3W5JA 2OV6A 3RIHA 3RRXA 3OCZA 2OMEA 4ETNA 2OCXA 4LJAA 4Z9FA 1NQWA 1KORA 3STHA 3QUSA 3G02A 4CM4A 2YS7A 1PNTA 4I4LA 3WZMA 2GA8A 2EW8A 4EVRA 1CEEA 1FP1D 5GP1A 3FYUB 2MSWA 2CZCA 3P71T 3HKBA 4JS0A 3TJMA 3Q8KA 1CJVC 1ORVA 1YVPA 3ZEIA 4MZXA 3SAJA 2GAAA 3FDXA 4QWWA 5CUQA 1QOPB 4N5IX 3T9EA 3UK7A 4G65A 4UD6A 1KP2A 3EDYA 1I6LA 3BTOA 3OICA 4Z9XA 3EPPA 3HPRA 4Q03A 1NYQA 4HDMB 4IGIA 5EJ8A 3DNPA 1PGPA 1ULBA 2PV7A 2YQZA 2GLUA 2HA2A 4RJJA 3X2EA 1AUOA 3LVQE 4B7CA 5EAIA 1EESA 4RWEA 2JGKA 1I30A 1NJ6A 4QUHA 2H4FA 3PRJA 1A8IA 4S1VA 3AFMA 4JVNA 1QDEA 4O3FA 4C5CA 2G25A 4DA9A 5DHPA 5FBLB 3AHDA 3UAYA 1P5FA 4AJHA 1VLVA 3I0MA 2G0TA 3OOYA 3DXZA 4BEVA 2N3ZA 3TDMA 2QMUA 3UJDA 2V6BA 3DDZX 3LD9A 1XZIA 2VP4A 3B1ZA 2FNAA 1Y7LA 3JYQA 1BE1A 3DFFA 1YZGA 4JC8A 1NW5A 2VJOA 1A7AA 4F2WA 3IMFA 1EDOA 2FR8A 2PRKA 2A9VA 1U99A 2XKBA 5DPMA 1T26A 1ZHOA 1G18A 1W5TA 2R7MA 4Q48A 4YPOA 2OHIA 4ZEMA 4C7OB 2PJUA 3WL7A 2QG6A 3T4PA 2CUNA 2GKGA 1ZVJA 1DHTA 2XWJI 3ECSA 2RGUA 4KK3A 3W7AA 3ZYZA 3MRSA 4DTIA 4GICA 3GD5A 4NBVA 3N53A 2DY1A 3UC5A 4Y6GB 5BR4A 1Q50A 1I10A 5CLHA 1ZCJA 2PKQP 3D9QX 4MVJA 4CR7A 3U19A 4ND4A 1YAJA 1DWQA 1P72A 1E1RA 4O2BB 1ONSA 1F2DA 1MP0A 2AC2A 2FPIB 2X13A 1LKZA 4V0QA 3V7NA 4XWWA 3FOZA 1U04A 3KV3O 2I99A 3NJ4A 1RHMA 4I55B 2QG4A 5BR7A 4JYZA 1X1TA 4BFLA 1UBOS 1W44A 4AQYB 3LM8A 1JDUA 1V9CA 4TVKA 4BO1A 4WK6A 2ECOA 4EF4A 1MBZA 5ALYA 4F86A 1NI4A 4UU7A 2NPFA 1K9SA 1P5JA 2WPDD 1P9LA 4MB0A 4NRDA 4BLOA 1MH9A 1BX1A 3HGTA 3C6YA 2Q21A 4MYTA 3BTSA 1I33A 1IZ7A 1YFJA 1TIPA 1DRKA 4KQCA 1G98A 2G7MC 2AWOA 2AZXA 1DKMA 2XVYA 3L0CA 4KR0A 4D8UA 3V8BA 1P9NA 2J67A 4MRNA 3FTCA 5IKPA 3ECAA 3IIJA 4QXPA 4AMBA 2QLLA 1PJ2A 3S2GA 3G68A 3TLXA 1QTQA 1TJ5A 1D07A 3N8NA 1EXMA 1I2BA 1OIWA 1QX3A 2IPMA 1F7UA 1WXIA 1OILA 3U4GA 3C7KA 3RSHA 1XKTA 3R4VA 1SCUA 1NJ2A 5FXMA 4MWTA 4D6YA 1ETUA 4HZGA 4L4SA 5EIAA 4BFCA 1T36B 5EKTA 3JPYA 4GOLD 3M9LA 3T9AA 1MO6A 2VSQA 4TOIA 2CHQA 2NU8B 4JV5B 3ZHTA 1HLPA 5CLFA 4BP9A 3TF5A 4W1QA 1H9CA 2ZDGA 3HBNA 2G5CA 3LYLA 4XVUA 4GX0A 3ND6A 2H5EA 2ZJYA 3HTXA 2EKZA 2CLKB 4IQFA 5HF5A 4B3RB 4FZVA