3GL9A

The structure of a histidine kinase-response regulator complex sheds light into two-component signaling and reveals a novel cis autophosphorylation mechanism
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
120
structure length
119
Chain Sequence
b'SKKVLLVDDSAVLRKIVSFNLKKEGYEVIEAENGQIALEKLSEFTPDLIVLIMMPVMDGFTVLKKLQEKEEWKRIPVIVLTAKGGEEDESLALSLGARKVMRKPFSPSQFIEEVKHLLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Response regulator
publication title Structural Insight into Partner Specificity and Phosphoryl Transfer in Two-Component Signal Transduction
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Signaling protein
total genus 43
structure length 119
sequence length 120
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3gl9A00
8ABPA 3C3KA 3O2JA 5KI6A 4YWHA 1YMVA 4RXTA 3H5LA 2PUAA 1FFGA 4MR8B 5C5EA 5JNWA 2FTKE 3DGFC 3OO1A 4DADA 5ED4A 2WJAA 4G0QA 3C97A 3OQOA 2QXYA 1LBIA 4PEVA 4G0YA 3KJXA 3RVNA 1ZAYA 2HQRA 4KQCA 4DN6A 4EGSA 4MAAA 3OM0A 1QP4A 3OMWA 4UHKA 4WWHA 4WXMA 2JBAB 2E4VA 1M2FA 3LKBA 2V0NA 2A9OA 2IYNA 3VNAA 4RDCA 5EWLB 1DCKA 1NTRA 4HNSA 4KZKA 3BRQA 4Q7EA 1ZITA 5FWYB 3HK2A 5C5CA 1PHRA 2LPMA 7ABPA 2QSJA 2X7XA 3N53A 4JASB 3SY8A 5DKFA 1A04A 1SXHA 3GYBA 1RZRA 3T38A 2YHAA 3ILYA 4G0MA 5TPZA 2O20A 1Z2DA 3C3WA 3DLBA 2IKSA 4KMRA 2PUCA 4G86A 2FVYA 1DRKA 1Z15A 3EDCA 4RZSA 4EYKA 1BVHA 1ZH2A 1F51E 2H0AA 4EYQA 2YHBA 3N75A 4Z4IA 1U0SY 3H1FA 3JVIA 4MQFA 3RVKA 4JA2A 4W5RA 1OXKB 3H6GA 3R0JA 2OENG 4OTZA 1L5ZA 2BGGA 1UDRA 1KMIY 1B00A 3Q9SA 4G0PA 4GPAA 4W5TA 4JAVC 2WWVD 4F8JA 3LKVA 4RY0A 3H5OA 3NNNA 3QX8A 4N0QA 1JX6A 3CZ5A 4W5OA 1NXWA 4OLBA 2PUFA 4RXUA 5ABPA 2HQOA 3FFTA 3IP5A 2R47A 2IDMA 2JK1A 4FB4A 3G1WA 4YCSA 5CNIA 5CNJA 4WZZA 4TLMB 2L17A 4F11A 2R25B 1H9CA 3OM1A 1USIA 1TMYA 3GA5A 5EWMA 1QNLA 2ZAYA 1CEYA 2PLNA 1BAPA 3QLTA 5KWSA 5B3JA 3CS3A 2FLWA 2Q5CA 1EWKA 4YLEA 3E61A 2FXIA 1DCMA 2GI4A 1JHZA 4MS1B 1USGA 1E6KA 2MYTA 2NZVG 1TJYA 1C0EA 1U8TA 2FN9A 3I09A 1NY5A 1KRWA 4G0ZA 2WJWA 1SRRA 4KREA 2PUEA 5JNVA 3GL9A 3KTOA 2PAFA 3OQMA 1TM2A 5FWXA 1QP7A 2R48A 3TMYA 3NHZA 3LUDA 4MS4A 3CU5A 4P1ZA 5PNTA 4KQ9A 4LE1A 4O5AA 1ZN2A 3HXMA 2WY2D 1SXIA 4OG2A 1ISRA 2HPHA 2F8SA 3SAJA 2QR3A 4ZMSA 3LUKA 3KCNA 2PUGA 2M1ZA 1DJMA 4MRMB 4XFKA 2FQYA 5IUKC 3OLWA 3JTEA 3SQNA 5IEJA 5TQ0B 1YVUA 1NATA 3O1HB 1Y1LA 4QICA 4IMJB 4LDAA 1JH9A 4ZPJA 2PUBA 3MM4A 1Z25A 4O1IA 1KGSA 2NT4A 4H60A 3LFTA 4E7PA 5I4CA 4RKRA 4Z9AA 3EODA 4KK4A 5FBKA 1NXOA 3NHMA 1K68A 3JPYA 2FW0A 4RU1A 3HUUA 3H75A 5JS2A 3NNSA 2RGYA 1D2AA 1SXGA 2PL1A 1QKKA 1URPA 3MMNA 4WXEA 2PUDA 3SNKA 5JNUA 5IX8A 4W5NA 3I45A 3H5IA 3QK7A 3KS9A 4NCAA 3F6PA 3HCWA 3QELB 1VRVA 5D2CA 2WMYA 1JFSA 3QLVC 3TD9A 1YK1A 1GCAA 3H5TA 4KPYA 1KRXA 1VLZA 3BREA 3OLXA 2MYPA 3O75A 2P9HA 3IP7A 4IRXA 4JB0A 2B4AA 3ILHA 1FSPA 3QEMA 4KFCA 3KKEA 3L49A 1XHFA 2HSGA 1IIBA 4JOQA 3E3MA 3LUJA 1QP0A 1BDIA 2FEPA 2JCGA 1MVOA 5CHYA 4MQFB 5TPWA 4LE0A 1XWWA 4Z4FA 3TO5A 1U2PA 1Z12A 1U04A 2RJNA 3CTPA 4KV7A 4RV5A 1NXVA 3QEKA 1LJUA 1I3CA 1QQAA 1Z17A 4RY9A 4MQEB 3QLUC 4EVRA 4OATA 4EY3A 1JBEA 4RK7A 1MIHA 1PNTA 2E4YA 2VUHB 3NNDA 1E6LA 3M9WA 3CLKA 4MR8A 9ABPA 2HQBA 3S99A 5IUJC 1ABEA 2FSPA 4N0PA 2R4QA 1Z2EA 4FE4A 3B2NA 3DBIA 3N8IA 4NQRA 4NV3A 3RQIA 3TB6A 1PEYA 2FQWA 1YIOA 4MS3B 3ROTA 1P6QA 3K9CA 3O2QB 4WUTA 2JBAA 3MA0A 4ZYLA 4JP1A 1DP4A 3QX9A 3DLHA 3KYJB 2HJ9A 3MQ4A 3O1IC 4KK3A 3HDGA 4LZLA 2N9UA 4O1HA 2FEKA 4XLTA 2E4UA 2QV0A 1ABFA 2A9RA 2AYXA 2FN8A 3RH0A 1W9HA 3OLZA 3G85A 3A10A 5FWYA 5IUNC 4HNQA 1DZ3A 1QO0D 2JRLA 1RNLA 3C3MA 1JLKA 2E4WA 2JVIA 4RS3A 1QMPA 5EWJB 4YR7A 4G0XA 3W9SA 2ID7A 4RK0A 2FQXA 3EQZA 4KRFA 3NBMA 1QQBA 4NCBA 3N0XA 4G0OA 4MYRA 2I6FA 1JYFA 4MR9B 1SD5A 3CFYA 2RDMA 4JB2A 3RVJA 5CNKA 3HSYA 2IOYA 4F3TA 5KQGA 2PL9A 1EAYA 2AYZA 1TLFA 2H3HA 4ETNA 3T6KA 2QW1A 3KG2A 1JWLA 3CKMA 4MR7A 3OMXA 3KHTA 4EVSA 3Q7TA 4RSMA 5DGCA 1HEYA 1ZGGA 4LRQA 1YK0A 2MYUA 1P2FA 1U2QA 1W25A 4YV7A 4RXMA 3KYIB 2A9PA 3N6VA 4YRZA 3HO1A 4D6XA 3CRNA 3O1JC 1PUXA 4IGAA 4IF4A 3DZDA 3A3KA 4IMIB 1EWTA 3OO0A 3H1GA 5TQ2B 4N41A 2CHEA 4RK6A 1APBA 1M2EA 3RVSA 3HM9A 4IILA 3MF4A 3H5VA 4PICA 4PYRA 1XHEA 3UKJA 4CBVA 4RY8A 3ROFA 2FMIA 3BILA 1ISSA 1NXTA 1RXIA 3F6CA 4MLDA 4RK1A 1DG9A 1NXXA 3M9XA 2E4XA 1DBPA 5F64A 2ID9A 3LMKA 4KNYA 4D6YA 4MGEA 3JS5A 4KVFA 4RK4A 1VKRA 4Z4EA 5BQ3A 3O21A 2GX6A 1NXSA 4HNRA 5IULC 4MS1A 1ZHHA 1YS6A 1T34A 1RPJA 2FKAA 5JNRA 3IP9A 1FQWA 2F8TA 3SG0A 3KLNA 1JFVA 3IP6A 2W42A 1E2BA 3LUAA 1PEAA 4UHJA 2FEWB 2LP4Y 3IDOA 2JB9A 1ZESA 2QU7A 2PKXA 1VPWA 3JVDA 3JY6A 4ML3A 2QVGA 1AB6A 4N03A 3L6UA 1A2OA 4LX8A 4XAQA 3H6HA 4TMYA 3O74A 3URMA 1R8JA 3RVQA 3LUCA 1MAVA 1Z18A 3LOPA 1J56A 1JFTA 4Z4GA 1RXEA 5IEBA 5BR1A 3BRSA 4Z0NA 1BDHA 5T7BA 4MRMA 4LDZA 1MB3A 2FMFA 3JPWA 3FMVA 3GBPA 1OXBB 2WRZA 5TQ0A 3RVPA 1BDJA 2JVKA 4EVQA 5KQPA 1PNRA 3N0RA 4XXHA 4N76A 3T95A 2GKGA 3M6MD 2E4ZA 4ETIA 1ZVVA 3RVRA 5BRAA 3P9YA 3CG4A 1ZDMA 5DTEA 4N47A 3GV0A 1A0OA 4S05A 4RK5A 3IPCA 1JDPA 3T8YA 1RZRD 5IC5A 5TPZD 3EGCA 1DRJA 1FFSA 1DC8A 1M5TA 2JVJA 1ZGZA 2ZWMA 3D02A 1FFWA 2J48A 3F7NA 3FFWA 4OBBA 4Q6WA 4YGXB 3MYYA 4P98A 1DCFA 4MLCA 5KC9A 1DBWA 4B09A 3QELA 2NUBA 4QPJC 4L85A 3UUGA 3CNBA 3HZHA 2WB4A 3I5AA 4Z4CA 5B3JC 2PMCA 3D8UA 1YTUA 4RKQA 1WETA 1Z26A 3EJWA 5JS1A 3LTEA 1D4ZA 3HEBA 4H3HB 5EWLA 5EWMB 4NICA 2IPMA 3C6QA 6ABPA 2XDYA 2MSWA 5TQJA 3BBLA 5KQMA 3QLVA 2LUOA 2TMYA 1TVMA 1S8NA 3CG0A 4D74A 5TE9A 2VK2A 2KYRA 1ZY2A 3K4HA 4PE5B 1BA2A 3O2SB 3Q41A 3HS3A 4MR7B 4PZ0A 4OLAA 2A9QA 2M98A 3GBVA 1Z16A 3LUFA 4GNRA 4MQEA 3RVOA 4Y9TA 4W5QA 4Z99A 4YO7A 4F06A 5IBQA 2P4UA 2LIVA 1JF8A 1GLGA 1QO0A 2IPLA 4LE2A 3GWGA 3IPAA 4DQDA 4EYOA 5FWXB 4ETMA 1EFAA 2DRIA 4QYMA 4MS4B 1USKA 1GCGA 2CHFA 3LUGA 1LBHA 4L4UA 2QZJA 3QLUA 2FMHA 3H5WA 1E6MA 4ZMRA 1M5UA 1P6UA 5HKOA 4TLLB 2B1JA 3EULA 3H1EA 3Q7SA 4MS3A 4XARA 2MSLA 3DGEC 1ZH4A 2MSKA 3GRCA 2LBPA 4Z9BA 4Z4HA 3A0UA 3HV2A 2VUIB 5DCLA 2IPAB 2RJOA 5KQLA 1D1PA 5HSGA 1AB5A 1GUBA 5CNMA 4H3KB 2VYCA 3CHYA 2NT3A 4XASA 5GOTA 1K66A 2MYNA 4RWEA 5JNTA 5JNSA 3N0WA 1DC7A 4HYEA 4YP9A 2QVCA 4FE7A 3FDFA 3VNBA 1LJLA 3A0RB 1Z13A 3FGZA 3EAFA 1JDNA 3I42A 1YMUA 5GQSA 5EWJA 5FBHA 3LUHA 1NXPA 4M88A 2IPNA 3UK0A 2L18A 1P8AA 3HVRA 1CYEA 3KSMA 3CZCA 4WT7A 1JYEA 3F73A 4MR9A 1D5WA 5HQJA 2CD7A 2NZUG 3GT7A 2GBPA 2PJUA 3OLYA 5HM6A 5T3YA 5E3JA 4YS6A 4F12A 1L5YA 3HDVA 3HJFA 4ZJPA 4EUKA 4E7OA 3OQNA 6CHYA 2PE5A 3FFXA 2L19A 3HUTA 1EWVA 5DLEA 1DBQA 1D1QA 4G97A 5KC8A 3EQ2A 1C4WA 3Q15C 3SM9A 3RVLA 3RVMA 2CWDA 3QEMB 4Q6BA 1QPZA 4EYGA 3TX6A 4S04A 2GWRA 4QYWA 5TQ2A 1LK0A 5BRJA 1EHCA 1GUDA 1CHNA 4MPTA 1JL3A 2FLKA 3Q7RA 4TN5A 5TPWB 1F4VA 3MIZA 2OQRA 1YS7A 2FMKA 3OLVA 3KLOA 1MB0A 2L2QA
chains in the Genus database with same CATH superfamily
2VQDA 1JQKA 1FU7A 1XN1A 4JLSA 1DXYA 1AXEA 4LK2A 1KDYA 2I2DA 3S2ZA 1E1QD 4KQGA 1DELA 4G9GA 4ZEWA 8OHMA 3KRTA 4KPGA 4RTRA 2Z6UA 3NZEA 1LPNA 1HLFA 4D8YA 1XC7A 2AFIB 1HKUA 1UBSB 5TX7A 1H5NA 1W0KD 1IDOA 4HDOB 4OP2A 4QYTA 4FM9A 1A97A 3D8HA 4KIUA 3W05A 2AMFA 4B5LA 3GOHA 3V8EA 1R9JA 5IN5A 1ZRSA 3DDHA 3KJXA 5HZKA 1ANKA 3BH6A 4II7A 4URUR 1TK2A 3G5MA 3HVUA 1KS9A 2AFIE 5CXSA 1H3EA 2XCQA 3OU2A 4EKDA 4DLYA 1RU3A 4B3CA 1E9VA 4ZHQF 1AUXA 1H2YA 3O0TA 4ZICA 2FOIA 4F1WA 4NEQA 4M9RA 4BMVA 1JZQA 3RDPA 1ZWKA 2XGMA 1S2MA 3PKIA 4V0LA 1R6DA 1M34B 2RFLA 2X7XA 2IV3A 2HO4A 4RAOA 3EXEA 1NG1A 2ZRKA 4J7XA 4YUVA 1DRWA 2HM7A 4N8SA 4AJ1A 1NNEA 3FRJA 4AKTA 1DXQA 1J90A 4G5QA 4YH1A 1DRKA 1G98A 5CDSA 4RF2A 1T3ZA 2YICA 5H70A 2VYND 3TLKA 1HX7A 3EOAI 1QYVA 1TTPB 2D7DA 3QPUA 1IK6A 1JAYA 4DBLC 3T0FA 1MQ9A 1STOA 2G28A 1CUFA 3R5XA 2C3MA 3PIRA 5AW9A 3H1AA 3G8BA 4NMLA 1G66A 1OX5A 5FBLB 4AY4A 4Z7QB 5KTMA 1N8NA 1O6ZA 3FJ1A 4OSPA 2GPAA 4Z9XA 4UHFA 3I4CA 3CVXA 1QE3A 3W5VA 2G71A 4XFDA 1GPWB 4IDFA 2ENWA 2HA0A 3PXBA 1PQWA 1ZIPA 3NETA 5DCYA 4ICIA 3JAWA 4A8JC 4AG3A 2FZLA 4OXIA 5A9SA 1JKIA 2A0FA 3KZ1E 2QL5A 4H08A 2XUKA 4KB5A 4LSGA 4CKCB 2Y0CA 4JJAA 3TLZA 2IOFK 4JEUA 5LMZA 3DSRA 1IN6A 2IEIA 2OFWA 1CLUA 3WGMA 1VSUA 3VBEA 1TM5E 4W9NA 2DHQA 1NFFA 4X7MA 3DL2A 1FRQA 2O2SA 4MCJA 3A9RA 3VVBA 3HCAA 3UAZA 3NYIA 5C2JB 3AETA 1G3RA 1GR0A 2YINC 2GXSA 3HO8A 3WNBA 5IZCC 1L7MA 5LOVF 3LC1O 1V5EA 1XZHA 2VJCA 1JHXA 3B85A 5BO5A 2A5YB 3OTIA 1KI8A 2IPOA 1I33A 2F55A 1SQ5A 2IZZA 5DDIP 3W90A 5LQCA 1MO6A 3RRBA 2GRJA 1LS1A 3OFND 5BPFA 5KTRA 1TL7C 1YBHA 2FZ4A 2J3EA 3QYJA 1P7YA 1SHLA 1TKAA 2FFJA 2RHGB 3UEOA 3ILXA 4B3TB 5B2EA 4ND8A 2Q4OA 1U31A 2QUKA 1YJBA 3L43A 1Z6ZA 4PSCA 3E0XA 1XI2A 2BOVA 3L0BA 4YPOA 1KPIA 3E1KA 2NU9B 5JXIA 2O19A 4OIMA 2ZJ3A 2ZPTX 1RM3A 3BZUA 4FQ7A 1F9AA 2J87A 4YJDA 4M1EA 4TTTS 1KERA 5IC4A 2QX8A 3N3BC 3NFRA 1VDZA 3FDXA 2UYQA 4RY2A 3CU5A 4LZJA 2GN6A 3WZLA 1SC6A 1KZ4A 5C8DA 3KKMA 3IPRA 3KJQA 4DT1B 4QUBA 1VI6A 1L8QA 2OBMA 5LQNA 3G1TA 1NW5A 4RVUA 3HU5A 2PMDA 1QQ7A 2PWYA 7REQB 2X0IA 2BKVA 3VAYA 4EB8A 2OBXA 3IRVA 4EI7A 4BKMA 3WIDA 4Y7CA 4XFKA 4X3OA 3M82A 5ALRA 4CIBA 1KYIA 3CCFA 3LQYA 2D5BA 3K5HA 3Q7PA 4XYMA 2NZYA 5DEOA 2C4MA 4HNUA 4HUJA 5FDFA 1JHAA 2B8WA 3DR5A 3I6IA 4TLDA 1J39A 1YZQA 3PCXA 3MM4A 3WBFA 3WDSA 3JQAB 3WQRA 1WUKS 4HDQB 4WLFA 1V25A 5JH7F 4Q7MB 4KUGA 4CG2A 3AM4A 3WJ2A 1UODA 5BVGB 5JROA 1TAQA 1XCBA 4KK4A 3MG9A 4WKCA 4DDWA 1HE2A 4AZ0A 1T9HA 3OOYA 3H75A 4URWR 3OAAD 3TL6A 3L4JA 1WDLA 3EXHB 1VYTA 1YZ3A 2GZAA 5JS2A 1EU1A 3SOPA 4A2QA 4ENTA 2ZBDA 1GTZA 4DUPA 2J4FA 3RFUA 3WYCA 2ACVA 3ZGLA 2XW6A 5GVRA 3TL3A 3G8AA 3U7IA 3U3RA 1EUZA 2MINB 1TZBA 3UWKA 3FKSD 4I1VA 2V6FA 4OHCA 2HPAA 3GGSA 4IDDA 5AJZA 1LQ2A 1PR4A 1C1YA 2A0UA 3FRIA 2A0WA 1Q16A 3D5QA 1W5TA 2ECQA 2OZLB 3W6OA 4K1XA 5FL7A 3L1JA 4OJTA 5ESDA 4RIGA 4FMDB 5BW8A 2Q1SA 1YCGA 2A88A 3DHNA 3LPAA 1QFXA 4MV4A 4OJQA 3CINA 4H77A 5FLXA 4OHPA 1XVAA 2JJQA 1K3UB 2R8XA 3PYXA 1JZSA 3AI2A 1U7ZA 5G1OA 4B0PA 4CTNA 2K7FA 1YS1X 5JMPA 2NU8A 3TRIA 1XF9A 4L2IB 3G9ZA 2M6RA 4L4YA 3DQQA 2IV2X 4E32A 5JCPA 1WULS 3SBDA 1L1RA 1ND5A 3P9CA 5AJVB 1PSZA 1ZQ9A 3FSEA 4PNEA 1A4XA 4EPYA 1F0YA 2QW8A 3VH1A 4BTEA 1E7RA 3RYIB 1VBMA 1M6VA 2IW3A 1R88A 3B8HA 3WLRA 4DRYA 4BUCA 2YQ5A 4Y6PA 2W6ZA 3KOWA 4OQEA 3QLUC 2XGSA 4QKQA 1EXMA 4QDOA 2VUTA 1OWNA 2QT1A 4DMCA 1ADBA 4RNCA 2AFIA 2ZM6B 3CLKA 1AZSC 4FT4A 5FKJA 2C9MA 4DZTA 3BF8A 4ZO8A 4KIJA 4Q02A 1Z5OA 3RU9A 3TLMA 4ALNA 4C07A 4EEZA 4EG1A 1WUTA 5HNKA 4ZTZB 2C3OA 3S29A 5C7YA 2V9CA 3N8IA 4IO0A 3ITEA 1GU7A 4LN1A 4W9MC 3SBXA 1P4HA 3ROTA 3QVXA 3PSAA 3MOIA 3P9KA 3UO8B 1E59A 3JVVA 3R5TA 4JJ4A 4QAQA 4S1PA 3UJBA 3ZBTA 1DP4A 1TAGA 1IHUA 3AZPA 3QX9A 1LV8A 1SJ9A 4O1HA 3PWSA 2LTAA 2NP6A 5DNUA 2JLCA 4IQFA 1V41E 1LDMA 4UPEA 1E3EA 2NU7B 4IJKA 2PVPA 1Y3CE 1BHJA 1XTVA 2QRNA 4XB6B 4YMUA 1R4MB 2G1JA 5DGIA 1NQUA 3MUEA 1M7HA 1SQGA 1U8YA 2CNWD 5F98A 2JDIA 3KX2A 1AGYA 2ORVA 1EVLA 2DTEA 2ZZNA 4FQ8A 3P2JA 1GN9A 3LBAA 5KKAA 4YT5A 5FPYA 4K1LA 2VN8A 2DWQA 4ZEMA 5AW7A 3OTWA 3R75A 3NM6B 4AY5A 4D46A 1K75A 2CYBA 1P62B 3ZHVA 1KP2A 2GUWA 4LGMA 1XWFA 4JLOA 4DJFC 4W82A 1J9ZA 4L8YA 2II6A 1EFLA 4BVKA 4WZAB 3DC2A 1JA9A 2NTVA 1FMJA 4GYYA 5KS2A 1E3MA 3ORRA 5I7OA 3Q3EA 4MYSA 3B36A 3OX1A 2BMJA 3CH7A 4NPCA 4O25A 2ZI9A 1ZGGA 5B3KA 3COYA 5CBPA 2R8RA 1CRPA 3N6VA 4L16A 2BKAA 1J20A 2WFZA 2YW9A 3BC1A 4WZAE 3WYEA 3L04A 3NVKI 1O9HA 3EASA 1NN3A 3LXXA 3QEJA 4S3MA 4UNNA 4ZAVA 4BVGA 4CKCA 5EPEA 3UMRA 1AC5A 3A1VA 3A3KA 1CXZA 2AKYA 4M1WA 5AK4A 3RS3A 4BLQA 4KWIA 1I7SB 3ZTYA 2FQQA 2JCBA 3TAXA 4C2BA 2C58A 1XQXA 5A7FA 3T52A 1PR6A 1P8JA 3AMVA 3E35A 3EIFA 3GU3A 5DSTA 3M8KA 3ZV3A 4BBZA 2VF7A 3ABOB 3W8FA 4DSUA 2ZYIA 5LJIA 2IC5A 4NY1A 3TZKA 1V2GA 1QX3A 3QIVA 2BMFA 1Y6GA 2AKAB 4I3FA 4BO9A 3HSSA 4KVFA 3M4XA 1I30A 4R2IA 1FJXA 2QXUA 5ALNA 2A1TS 4DRZA 5IAAA 4HNRA 4C1NA 5E1MA 2HMTA 3GH3A 1R6XA 5BYBA 1ZHHA 2GCPA 5HZGA 4J3FA 5CCXA 1M8GA 2JFBA 5H9VA 4F9FA 4CMEC 4GC9A 3UQZA 4IY1A 4E11A 2NU9A 4UM7A 2NYAA 1YA8A 1OAAA 4ISBA 2J8ZA 4RTLA 4GKKB 1TAUA 4BFVA 2JGKA 3RSSA 1P0QA 2CJWB 2Y0BA 4HJXA 1WJGA 3BKWA 5KSYA 2PKXA 1IZ7A 1SBQA 4ML3A 4YDHB 5FORA 2VDKB 2VQSA 3BGSA 4INZA 5BYJA 3WK4A 3PL5A 1G41A 4C0AC 3FSJX 4C3UA 2B69A 3CM0A 4IJQA 3B9PA 4BFUA 4DT1A 5IDXA 5JZMA 4N6OA 2D0OB 3MW8A 2QNBA 2IJGX 4EHIA 4XR9A 5AW3A 1J56A 2PWPA 7REQA 3TGPA 4PHTA 1NW4A 3GJQA 4BJ3A 1QRSA 2XB4A 1JPVA 4EB3A 4OV6B 3TXAA 4K9PA 3ESRA 4MH0R 1E61A 3SC3A 3RVPA 2ZIWB 3SJUA 3BMQA 3RTCA 2HSWA 4XM1A 3P2OA 4LJSA 4XXHA 3IBFA 3FPKA 3HDTA 3IAXA 3OVMA 2HGSA 3ONNA 5CA0F 4K6FA 3JQAA 5K8IA 2VSXA 1N92A 2WAXA 1AA9A 5BQOA 1VLJA 4N65A 2G1AA 4F9EA 1CWUA 2I3ZA 2XX3A 4X24A 1FMTA 2R8PA 2ZUWA 5D01A 5DTEA 2JFUA 1NVFA 2OMEA 4NESA 2A1IA 1QVZA 3K0FA 3M6MD 2CVHA 4QXAA 3C6KA 1KHHA 4TQ9A 1PW7A 1ONNA 5BQXA 1YI8A 1KPGA 5JASA 2EFGA 2PX8A 3VYUB 1NBEA 4J7AA 1K92A 3B1YA 3H04A 2MINA 5JC1A 2BHNA 4NJEB 4TTRA 4Q7QA 4KRYA 621PA 2FPIB 3WIEA 3U4QA 4GP7A 4L85A 4QA9A 3FOCA 1N78A 3K72B 3SZOA 2OAQ1 2OZLA 1UFQA 2QA5A 4BX9A 3A1DA 1I6LA 3NTUA 1CRQA 3K8YA 4PLGA 4YRJA 1E1MA 5JHHB 3HVHA 1JDZA 4OK3A 3C6QA 1DUVG 4C05A 3AJDA 4RJTA 1GPJA 2D3WA 5TV2A 3HUEA 3WGUA 1IJEA 5TXGA 3QLVA 1RKXA 3IVXA 1Y34E 4CM9A 3AUYA 1NI4A 4F4FA 5J1TB 4G5XA 1U3CA 4MB0A 1ZCZA 2I2WA 3ZIDA 3MUOA 1MH1A 3QWFA 5EI5A 5CG2A 1UFKA 2OO5A 2WJVA 3O2SB 3ENQA 3KZMA 3DF9A 3Q41A 4YCDA 4JC0A 4LOAA 2IU0A 3RYIA 1I4OA 2D7CA 3ZU2A 4P0QB 1U4SA 1LWNA 1LNZA 2WWRA 4NV1A 2BMVA 1QV6A 1E2IA 4Y9TA 3V97A 3PE6A 3F5DA 2FR8A 4YO7A 4EA9A 1GTG1 4QDKA 4JJGA 3T1QA 4LF8B 3SYRA 1HDYA 1NVBA 1PVDA 3ZGXA 4BMNA 3BB1A 1GRNA 1I2MA 5F3DA 5ARDA 2NV6A 3V1KA 2FU5C 1KI7A 4Q9KA 1Z82A 2ZIGA 3PUJA 2WJHA 3PGLA 5AIAA 1KZ1A 4A6DA 3KKNA 1VJRA 4QBGB 1J07A 1MCZA 2DZDA 3O83A 1TYCA 2JF0A 4RJIA 3HI6A 4TT3A 1Q57A 2OECA 5MF6A 2JFQA 5FTWA 1T1EA 4QOHA 2FZ5A 2VHZA 1R5JA 2IPAB 2VWHA 3SYNA 3TIXB 3WRVA 3TW8B 3ZS8A 4DIKA 2XHEA 3R3XA 1EVJA 3OCUA 1SA0B 2CB0A 3D8SA 2JG3A 1LVHA 2NU7A 4WRRA 5IP5A 3CE9A 3OKFA 4NHEA 5IC6A 3DMDA 3L46A 3N0WA 5HVNA 2EZ8A 1IH8A 4CXMA 4GM4A 4TV8F 3QF4B 5LUBA 3V7YA 3ZQKA 5TVGA 4ZCSA 4C4TA 3E3AA 2CXQA 2LD4A 4ZXPA 2GPJA 3BTUA 3ZG6A 3CEAA 1RWQA 1T3GA 1T5BA 3N8NA 4AI6A 1S02A 2W8BA 3AOEA 3IPLA 2NPIA 3PWTA 4BBPA 2WWWA 1XZNA 4F60A 3NWBA 3SFTA 3I5YA 1W96A 3KTFA 4C87A 2H2WA 1HSZA 3CUEF 4WZAA 4ALMA 5IKOA 4BY9E 4TWAA 4P7BA 2GRUA 4YS6A 4PG8A 1L5YA 1EA5A 2WZQA 1A5BB 5C34B 4YMLA 4NWIA 3AIOA 4ITUA 4N5DA 1OH8A 1S3SA 2L19A 5K7SA 3HUTA 2QP3A 4UUMA 1VB5A 3PUWA 4Z6KA 1DAOA 1V8PA 5AVQA 2HXSA 1F8FA 1WXHA 3EXG2 4IQGA 2C4VA 2JI7A 5CLIA 1IQRA 1G2QA 1LF0A 1UXHA 2OK8A 3D4OA 2O3JA 4WOPA 3F7TA 1H0KA 1SVUA 1LBEA 3SR3A 1TUGA 4UPDA 3JX9A 1T9CA 2HIAA 1YD7A 1OVMA 3PUHA 2PQ6A 3INRA 5D7BA 3WLMA 3FYUB 2IS6A 4E14A 2P4SA 3NM5A 1Q0QA 1YI0A 2FMKA 1UOPA 3DVSX 1GGMA 3ZK9A 4DLTA 3LX8A 2YFYA 1G21A 2IY9A 3DEJA 2C3UA 5CRIA 2G9ZA 3GCGA 1KIFA 2JGAA 5F1PA 1UKZA 3WSVA 4YRBA 4B44A 4ZYWA 3L8GA 4YWHA 3LYLA 1SB8A 1YMVA 4RXTA 2PUAA 2DTXA 4A2PA 4PF1A 1YB2A 4DADA 3UCXA 5ED4A 3D6VA 2XT0A 3NHPA 3SM3A 3PRHA 4A16A 1GKYA 3ZE0B 3B3JA 1IJKA 2QLFA 2WUDA 1BHSA 3KAQA 3IILA 1JHQA 3LO8A 1N3BA 2F4VB 3DMNA 4R7ZA 1XIVA 3AEUB 1BA3A 2BVNA 4U7WA 4K8RB 2XKAA 2DHCA 3CO0S 2CJWA 2PX3A 3U61B 3K3PA 3ZI7A 2GEJA 3S2IA 1ZMRA 1KWGA 1FQJA 4Z4EA 2PH1A 2WFMA 4CE6A 3MEQA 4R9RA 2PXHA 1KIAA 3QVOA 5E8JA 4DIDA 3I2KA 1VOTA 4POAA 1VHWA 3DYIA 3BXZA 4G1FA 4CT4B 5CB4B 4LTNA 5BN3A 4QT4A 4B6FA 5KVVA 2DLCX 4NPHA 4CQNA 3TINA 1QRUA 1H2FA 3OCZA 3HKDB 5JCOC 4CQMD 1OA1A 3PJEA 4M9QA 2QM0A 4MAMA 3F71A 1ULBA 1ML4A 1E1RA 4EHLA 2B1RA 2JIPA 1D09A 1FFHA 5EJAA 1CUCA 4WCFC 3OE1A 1V5IA 2FW6A 1RQRA 1L5ZA 1U3FA 1KFBB 1WF6A 4N49A 4J0IA 4YQZA 5K4GA 5AM4A 1DC5A 5LQUA 3IEXA 3N0TA 4Y3UA 3LKVA 1T29A 1T4GA 1VG1A 3P4UA 3W5AA 3WA6A 2LKCA 5ECWA 2OD2A 1JX6A 2VWGA 1KOLA 1CVRA 1FA9A 2PUFA 3Q0EA 4D0RA 2R47A 3SZ3A 2YOHA 2IDMA 2K6GA 4DY6A 4FB4A 2R4UA 4NJEA 3WLOA 2YWEA 4DCNA 2FPIA 1KA9H 3DT9A 4ND1A 1Q1NA 4TLMB 2R6ZA 3A9SA 4FHZA 4JU9A 3GJ7A 4ONEA 3VZRA 4DYVA 2ZIEA 4HWPA 1H9CA 1VL2A 3A25A 4EYSA 3OFVA 1MN6A 4DUGA 3GDWA 2QUBA 3VNUA 1VPEA 1NKSA 2J46A 2ZFUA 1T1JA 5B3JA 3ZQUA 1W7AA 2FYTA 1IBMB 4WPGA 3RUCA 1NQ5A 3W2FA 1EWKA 2CMHA 2CLEB 2GD1O 4EGCB 2VTBB 2BTEA 4DLWA 2F1RA 4J4TA 4RMHA 1CUGA 5HF5A 3WRYC 4ARAA 2GUGA 1ZVMA 4H9GA 4RE5A 3VC1A 1E6KA 2CW5A 2MYTA 1C0EA 1QWOA 2DHRA 2WBLC 2HHHB 3H5RA 2WOJA 1AGPA 2PN1A 4JUBA 5CLQA 1HQDA 3KUXA 3FZQA 3KD2A 4BJHB 5L45A 5EJ9A 3R8CA 1T5LA 4KREA 1A7JA 5KCMA 4GFDA 3AHCA 5FNVB 1JMKC 4TQAA 3QHAA 4LXIA 1TW2A 3IUBA 2WD9A 3QGMA 1PJTA 1OH6A 1RYZA 5REQB 1SG0A 2QLTA 3F96A 1E79A 4DLRA 5LP6A 3W2TA 4PU0A 4A5OA 4MUXA 1E98A 4EJSB 2GJSA 3HJGA 2F8SA 2YWRA 4KBFA 3PQDA 5GJCA 2I8CA 5C3MA 4ED9A 3UHJA 1KQGA 4B2YA 3IQXA 3O82A 4K2HA 4OHYA 1PV4A 5HG0A 3TW8A 3Q2KA 3OLWA 3O95A 3ECCA 4YI5A 3UMCA 4MO2A 1ZI9A 4N9WA 1QZUA 1SA0A 3NH6A 1TF2A 4M0CA 1D6SA 3ZD7A 5L51A 3ETDA 3KJIA 4OKNA 3VPGA 5IXJA 3MN1A 1OT3A 3L01A 4NBNA 4OCZA 5JXJA 4RTJA 3K70B 5BMVF 1LDNA 3DG9A 1WV1A 1LC0A 3QF4A 4KAJA 4JJIA 4CLHA 2ODBA 2NQTA 2B30A 3EODA 1O8CA 3U1TA 4BNGA 2AC2A 4E21A 4PG4A 1F2UB 1ONBA 2XRYA 3FCEA 5FL7D 1RAGA 1BQEA 2H1RA 4KH1A 4TYQA 2YJ3A 1EJ6A 4UAJA 4LPSA 2P6RA 2Y0DA 3WYGA 2GFHA 1XNHA 3COJA 1Z3IX 2PKRA 4B84A 5HGXA 3L6RA 1NY6A 2R2AA 2ADOA 4KGVA 1OJ7A 2QZSA 4FBGA 3KZCA 4UTVA 1SBZA 1ZNXA 4AWBA 4IOMA 1EFUA 4YRCA 5JSHA 4IIJB 1GEEA 5EVJA 3BS4A 3NP9A 1Z5NA 2CV1A 1PT5A 1NZFA 1ZW6A 4P5EA 2DKNA 4Y2VA 2YMPA 5CLHA 2AE2A 3MWYW 1SHTX 4EHDA 1FSSA 1ZGJA 1N1GA 5CITA 2ADMA 4FGWA 2VPYA 2EZTA 4R1LA 1YCDA 1R0WA 2EATA 1QM5A 2WFLA 4RUKA 5CIQA 3AL0C 5CHYA 3BD8A 5CDFE 1DRVA 4WQMA 1RD4A 5DW0A 2WAOA 1WPGA 1NXQA 2QPTA 4C01A 3TZBA 4PLWA 5EJMA 3CTPA 5CVCA 2O50A 2G09A 4MJ3A 4JYZA 4RTSA 4ZCMA 4FGUA 5H0IA 1ECFA 4XSHA 3ICQB 4RY9A 1E58A 4RMJA 1ISPA 3A11A 1J1ZA 3B89A 2KJQA 2UZ4A 1N7GA 3N6RA 4BNXA 4H0NA 1GNLA 4FNGA 4FVTA 3EC7A 4B8WA 1VPDA 1I1QB 3F8WA 3WDKA 3NVMB 3GQBB 4N0PA 4I5EA 5ARCA 5T57A 5BQ5A 1O6CA 4ADSG 1WY5A 3RO7A 2J32A 1KJNA 3BIWA 1UXKA 2H17A 4CDNA 4GMDA 2FPGB 4I46A 4G0WA 2VJMA 2ERCA 2V74B 5EQFA 3UXYA 3TX2A 4GLOA 2JAOA 5AMXA 2H4FA 3AWDA 1L4NA 4B46A 3FM9A 1WCXA 1RDFA 3A70A 1PZEA 4FDLA 4RF3A 2A5JA 5CFQA 1AUOA 1DZ3A 2O7NA 2RCYA 5BVHA 1LA2A 1OX4B 4DBLE 1E6EA 3K0CA 3I5UA 1DARA 1JSRA 4NRDA 4Q4LA 3LF2A 2YXLA 4I4TB 4JQCA 1KJQA 4XVHA 1GZSA 3W79A 2E5FA 2W2KB 3F5FA 1L4LA 2YXNA 4ARUA 4YR7A 5BOSB 2QV7A 2I7TA 1P2DA 2HD4A 2PGJA 2YXBA 1G6Q1 1QDEA 1P9WA 1TUEA 1V7ZA 2GPBA 4HEJA 5KYGA 1O0BA 5E0OA 5C80A 3HKDA 5AP9A 1YZNA 1CEQA 2L42A 3I9FA 3RYTC 2VF2A 2QAGC 2M6SA 3MPUA 4NU6A 3MQFA 3PUXA 3KB8A 1C2YA 1E2NA 1FY2A 3O31A 5CT4A 3IUNA 1WMDA 3P0HA 2D5LA 3LLSA 3OMXA 3GGPA 2X4IA 4GVPA 4R68A 4BNLA 1E7QA 4CFZA 3U17A 2O3RA 3U62A 4LDNA 1P2FA 4U7FA 3WC4A 1U90A 2OUKA 4RXMA 4EG4A 2H00A 1LC3A 1YOVB 3EHDA 2EZ9A 3C4JA 3CRNA 2OCPA 3FPFA 4FHDA 3H3XA 5I7VA 1F7VA 2YXPX 3RAGA 2VHUA 1J49A 4K81B 4ZOLB 4ANFA 3B6JA 3G0OA 3KLMX 1YR1A 1HFKA 1PWYE 2P8SA 3OKAA 4HN9A 4ALLA 3P9NA 3UPUA 3OCCA 3SMQA 2OILA 3I62A 1ZYUA 5BV2P 3WOVA 1KMNA 1A9SA 2XQFA 4HFRA 3WHKA 1Y80A 5SY6A 3CNLA 2P6UA 2FG5A 2QVBA 3EVEA 2VDOB 3G2IA 1MB2A 3UJDA 4E5PA 2WB2A 1XHEA 2WTEA 3SYMA 3B5JA 3VA7A 2C8VA 4JT8A 5B7GA 2VDQB 4WLVA 4RK1A 4ZRNA 1AE1A 3MJDA 1XMJA 2XZTA 4U2EA 2E4XA 2M1XA 4ZYUA 2ID9A 4UCFA 1YRAA 4L1KA 5I8ZA 4LJ5A 5FYDA 1L7BA 2E82A 3M4ZA 2H1CA 2JJ1D 1OXXK 4YDRA 2VTBA 3BAFA 2B6NA 1J2JA 3AEXA 1U94A 5AVRA 1JUDA 1ZXBA 1OYYA 2KQUA 3V2UA 4YMGA 1SC4A 2Z98A 2JFNA 2O0JA 3BB4A 2R79A 3WKCA 1JJBA 2D8MA 2V1XA 3AG5A 4IQ0A 3NANA 1GJRA 4MMXB 1AV7A 1P81A 2WTNA 1KEVA 5FNVA 5HBRA 1IBKB 4D4GA 1HZZC 2Y76A 4U63A 3VZCA 2IZ5A 1CS0B 1D9ZA 3LCJA 3Q98A 2BI7A 2G04A 3IBYA 3OETA 2I22A 5LB2A 5REQA 3WJ1A 5CFZA 1HE5A 2WILA 3HCOA 2X76A 2BJVA 1QP8A 2I29A 1C7EA 3F5SA 4G4GA 2ZT6A 3JQPA 4H4EA 1JDJA 4IQ8A 5D5PA 3G2NA 4ZU6X 3S2FA 3UYKA 1Z18A 4RZUA 1P2GA 1N7HA 3JQAD 3M3PA 3O7WA 3SGLA 2RD2A 3AVYA 3NMUF 1IXSB 1RC1A 4OMDA 1T1RA 1K4YA 2JFXA 3JTMA 1EFVB 1XTJA 3N86A 3UJ7A 4C0HA 5HS4A 2I7CA 5K3AA 1QCCA 2HN9A 4L0MA 2GZHA 4PTYA 3FNQA 5ECGC 3FWHA 3N0RA 4KQWA 5LYYA 2Q3EA 4Q05A 5IAEA 3L7AA 4FOSA 1DTEA 1KPHA 2XGOA 1ZVKA 4K6OA 5K0TA 3TJMA 4KXMA 2E4ZA 4YT2A 3QXSA 4XJTA 1YA6A 4RZ2A 3DMRA 1AGNA 4JP2A 1R18A 4LHVA 3AF0A 2CKDA 2W6QA 4FKMA 3HKCB 4GEKA 3VPSA 3MCVA 1XFAA 4RD2A 2ZWMA 2XRFA 4L6IA 2J48A 4Q6WA 1UL1X 2YHSA 3I23A 3MCTA 4Q5IA 1SQFA 4OUDB 3V7WA 1ISHA 2ODQA 1OFIA 1OFUX 2Q9AA 4AIRA 3G7NA 2I0FA 1RXSA 4HY3A 4MIOA 4PZCA 1OAOC 2J6HA 4B7AA 4QD3A 2W58A 9LDTA 1NUQA 4IIJA 1UQUA 5CDFA 1SR8A 5CYGA 1SBNE 1KEEB 3UXHA 3CYFA 3F6EX 4Q3EA 4RYDA 3RIGA 2CYAA 1TF7A 4NZMA 4RYLA 3SJZA 3ADCA 3GPLA 5DNDA 2IPMA 2GASA 2IH5A 2YYZA 4YO8A 3SLKA 2J67A 4DV0B 1ZXLA 4MYUA 1KY5A 1EBFA 2Z95A 4LHXA 3EWSA 3LM8A 1OH5A 4LCJA 4YVFA 4EA7A 2YRWA 3GC6A 3IC5A 2E18A 2X5OA 3NWJA 2CLLB 1G1AA 4Q4HB 3AYZB 2A9QA 3T9BA 1JEQB 1DAEA 1FFAA 2CBGA 3A05A 4FFDA 4OI2A 4YRTA 5JFGA 3LLVA 3CISA 4C2TA 5EUCA 2I4TA 3K94A 4KAAA 1J2YA 2DPYA 2R87A 1EPUA 1UINA 2LIPA 2PUWA 3CEHA 3L8ZA 3U13A 1JB9A 3TW6A 4EYOA 2PS9A 5TT0A 1EP1B 3QUCA 1DDOA 1LNQA 4Z0HO 3GQBA 4AY2A 1A2BA 1AY0A 1N6RA 2CHFA 3F9IA 4PC6A 2B0JA 2ZS8A 2X6RA 2BFFB 1EE9A 4G26A 1L7EA 4GOND 2WF7A 4Y0AA 5LLSA 121PA 2GCGA 2FPGA 4X94A 3FE2A 2ZR9A 1V9SA 4B2IA 1F8GA 3UAOA 3GFSA 3WL4A 1KO1A 3BAZA 3LQQA 1IN1A 5JO0A 4L07A 4XPZA 1J9GA 3RS0A 3PIIA 4DVJA 5JI3E 2DEUA 4MI3A 2ATXA 4GW3A 1NJGA 2Q9UA 2R44A 2XQKA 4H3KB 3R3UA 4JEIA 5CNMA 1X1TA 3WYFA 4GQAA 4ALKA 2V7XA 2FRDA 1TX4B 3RT7A 4OX9Y 1G8AA 1JB1A 1ETUA 1HYEA 4FB5A 3PWKA 2H0QA 5EE3A 2Q3FA 1QH9A 4QO7A 1KJIA 3F6YA 3UAWA 1QYRA 5L7WA 3ZU3A 5KTSA 2FW8A 1G5QA 1PT8A 1ODJA 2GBLC 5TDHA 3M3DA 1X80B 2NV0A 2W2KA 3LQRA 3PDJA 4P5PA 5BOSA 1CQJB 4RHTA 1U99A 3LY8A 1W4AA 4NBUA 1FLNA 4Y9UA 1BCRB 1FF9A 5EP2A 4P4TA 2KS6A 1Q15A 1PS0A 5IMSA 2D4AA 4MLZA 3ZGOA 3A4MA 1J0AA 1O6BA 3QOFA 2JD2A 5BWOA 5ALYA 4L78A 4D3ZA 5K9ZA 5LYJF 3AF6A 4IZHA 1ZKDA 5IZCA 4I3HA 5AUNB 5DOVA 1E6UA 1UBHS 5JS7A 2HWUA 3BWBA 2PE5A 3RC8A 2AD5A 3FJYA 3RJ9A 4AUEA 1V0JA 5C1BA 5DP1A 2C7GA 5ITWA 5DLEA 3J81A 7GPBA 1U2DC 4R31A 2RH4A 1U8UA 2HR1A 2FUKA 1YOVA 3SM9A 5BXYA 1FC0A 2VTDA 4IGFA 4OREX 5NLLA 3A8TA 4C4PA 1YRHA 2WIJA 4QOFA 1Q0HA 4ZOLA 2YJ4A 4QXPA 2IEYA 1XKLA 5FJJA 5EJ5A 3A6FA 3GEBA 2HPVA 3O73A 4IXWA 3DHWC 3MBOA 4QARA 4TN5A 1NGSA 1XK6A 2V7GA 4O02B 4RESA 1MVNA 1RWWA 2C7PA 3OLVA 5DHFA 4J43A 4YAOA 4EG3A 3DLCA 2VNKA 4QXOA 1EYZA 4D9JA 3FI9A 4Q0MA 4I4CA 1J6UA 2XUFA 4LJKA 4RW0A 1U7PA 1B2LA 5E1OA 2O3QA 4E94A 3F46A 1UBUS 1RIIA 1LRKA 3ZE9A 1GGNA 1QOPB 2BUAA 4I4NA 5E4JA 3ADPA 1EGHA 1LJ8A 3T9AA 3OQOA 1I3LA 1X1SA 1OYWA 2XOXA 4H17A 5JO9A 1GKKA 4HYTA 3WL5A 1Y4SA 3FSGA 4JI0B 1ZSNA 1LTQA 5CPBA 4PYLA 4GR5A 5E1DA 4ASUA 3HHEA 3ANNA 1D8AA 4ILKA 3KKKA 1QVVA 3ETJA 3MJEA 4NENB 2OGUA 4RIFA 1U9JA 3WFZA 1YRQA 2OC9A 1M2FA 2REXB 4XUDA 2ZB3A 4ZMBA 3ESCA 4ZJZA 4FI3F 4DMHA 4NXNB 1NTRA 3OY7A 5DFAA 4YASA 4CIXA 4DCTA 3QG1A 4LC1A 5FAKA 2YS7A 1NRJB 2ZBEA 5BN4B 3A04A 3BXPA 1CS0A 1BC5A 1XL1A 1YAJA 3SX4A 3P0FA 3MWFA 1SK9A 5HUQA 1W35A 1ZC3A 3KWMA 3OUZA 2PT9A 3SY8A 3ZCXA 1X1DA 3K8QA 4NFLA 1XMSA 2N47A 3LC0A 5TJHA 4RVDA 1PZFA 2POQX 2NXWA 4AQ7A 1GV0A 3IKMB 3KFLA 5K05A 4KMRA 3UAYA 4AURA 2X4DA 3TBHA 4PZUA 2JLQA 3LWNA 3EDCA 1E1YA 2GS9A 1JQJC 3FYSA 1A9QA 2AZDA 1EFVA 4JCOA 1P9OA 1LF5A 2Y8EA 3MWEA 1SXQA 2IDKA 3FUCA 3PR2B 3VM6A 3ZWDA 5HRAA 4JLJA 1QB8A 3BFJA 4OX9B 1VQ1A 1TZCA 4KR0A 3BJIC 1WMFA 5ENZA 4AY3A 2QPAA 1TRHA 4HRVA 1MEJA 1SZDA 5M2QA 2OENG 4E5YA 1UDRA 1SVNA 4IQ4A 3L41A 3LDGA 4EPTA 2UV8A 1Y1PA 2XPCA 2X1VA 3MBKA 3HKCA 4JAVC 2WNHA 1E8MA 4GG1A 1SQ0A 3SHOA 1WEKA 2PEYA 3HBMA 2CLIB 4CTKA 1X1BA 3JAMA 2X8AA 4F4HA 5KWEA 4W5OA 4OUDA 2DPGA 4GPTA 4XFJA 3FUWA 2ZYHA 3K5WA 3I1IA 1CJBA 3P9RA 5E9WA 3TQHA 2IYTA 2VF4X 4X6YA 4F3RA 3TTUA 4ABYA 1ODSA 3HJUA 2FG7C 3WGOA 3KZOA 3EPJA 1XCJA 3OPMA 3OZRA 4DARA 2WF8A 3KKOA 3OM1A 2RONA 3K0KA 1ZINA 1OI7A 1C2TA 2FR1A 1CUEA 5BRNA 2ZAYA 3PI6A 2Z3WA 1TC2A 3QLTA 3OBBA 5A05A 4FSDA 5BSUA 1H2WA 2V4MA 1AD2A 2DF8A 2N1MA 3OZDA 3WAKA 5LP1A 4HBGA 1DU4A 2JAUA 1V3QE 1VA4A 3DZIA 3D0OA 1DCMA 4DG8A 2GCIA 3P26A 4BN4A 1Q0RA 5D1NA 1JHZA 4OGGA 2WT4A 4TKUB 4AP5A 2VJAA 2QX9A 3P20A 4PHCA 1JEQA 3HA5A 2OFOA 2F67A 1DXHA 1E2LA 2WKSA 3L40A 4Q9IA 3FX2A 1PFUA 1SRRA 3FGPA 4BFTA 2O07A 1VIVA 1B0UA 1SCNE 1CZRA 2HSZA 3BSSA 4JUAA 3IOBA 4LCBA 4UCWA 5EQTA 2LCQA 4BNTA 4KXLA 1Q12A 1YACA 3E9NA 2E5WA 5J2TF 4BO7A 4DRXB 2QVYX 4ZKEA 3NRCA 2R48A 4YT8A 1SVWA 3LUDA 1CTQA 3JASB 2G06A 2VJLA 4KQ9A 4F3KA 4LE1A 4FWTA 2Z83A 2WY2D 4TSRA 4Q7JB 4BZXA 1S6YA 2C1ZA 3K05A 1Z6PA 1A98A 4YRLA 4ZOAA 1EGAA 1NF2A 3BUSA 3OZUA 3V5NA 4GYWA 2X6QA 2Z8YA 5EIBD 4A10A 3E7DA 4XCXA 5MGBA 2ZDGA 2Y66A 5AKGA 2EXXA 2OCXA 3DS8A 1P0IA 2RHLA 1M74A 1W36C 3BWYA 4BKPA 3EOZA 1XOIA 1YZTA 1FYVA 2WSIA 2REQB 5ICFA 3ZE7A 3PRKE 4JSRA 2EJWA 4GU5A 4AQDA 4CKYA 4GT1A 1AK1A 1SIUA 1G4HA 2A3RA 3A1UA 1EINA 4IXTA 2AXNA 4JDUA 4JIMA 4NNOA 4HI0E 4QXRA 2HIGA 4XDHA 1L6IA 1NVMB 3L1IA 1P3Y1 4FYPA 3U1VA 1X80A 3C3JA 4OEHA 3A1SA 3UK7A 4QGAA 4GDMA 4UD2A 1PV2A 4C5AA 3OJFA 2BISA 2DWUA 3QVLA 1SOAA 2W6CX 1BCRA 1RM0A 1T5TA 4RPJA 4TMXA 4UUAA 2FSIA 3GLQA 5JU6A 5AIBA 3WB0A 1QG4A 1NJFA 4AP9A 3KS9A 1COWD 3F6PA 4RELA 1UC4B 4RDIA 2P4EA 3PE4A 3FNFA 1JLLB 1NZDA 4YV2A 1VBKA 3H0EA 5FT9A 3C70A 4YQFA 1GCAA 2XMZA 2G6BA 4FOTA 3IP7A 2P5SA 3DAPA 4W63A 2AJDA 5K0CA 1IUOA 1MX1A 1NNLA 2G1KA 4A1FA 3CEMA 4K05A 2C5FA 4RAQA 1ZS9A 4PLCA 1BDIA 1FSZA 3AEYA 3FMIA 5SICE 1USWA 5E2IA 3QNUA 1UPUA 1NMSA 2B36A 4S1WA 3IGFA 3OM9A 2WWYA 3DAOA 3D64A 2BSQA 1QQ6A 2FXVA 2QZ9A 1Y42X 1P3DA 4ZT3A 1KTIA 4MQEB 1WXQA 1JKXA 2JHFA 2OZPA 1QNFA 1I2AA 1YB4A 3D6FA 2OR3A 3DTVD 5TEWA 4LWZA 3M81A 1PNTA 4JUCA 4KN8A 3EZ7A 2WI8A 2FX3A 1V39A 2VHEA 2Q5OA 3QY0A 3HCNA 1NG9A 1OV6A 1SUIA 2O1XA 4N5LA 4RA9B 2NXCA 2PT6A 3B2NA 4MROA 1Y8QA 4ZP1A 1K6XA 4C6TA 1XNJA 3DDUA 3T4EA 2NYVA 3U3XA 3WO1A 1I8TA 4B82A 4N7BA 2LCFA 4E03A 4KR2A 3TNJA 3JAKB 4UEJA 1E99A 2R8EA 4R9SA 3E2PA 5DX1A 1SWVA 3O6VA 2WU0A 4XEHA 5KSOA 2WJYA 2C77A 4N3GA 3OECA 3UGJA 1VPTA 5ES3A 1DBRA 4EKGA 1JXAA 1PFYA 4LZLA 5DU2A 3QHPA 1ZD5A 2A9RA 1A95A 2BFWA 3GXOA 5BN4A 1PFKA 5EJ2A 4ZHQA 4J2HA 1QAQA 3RR2A 3RSQA 4PX9A 1UWCA 2HNAA 4RLQA 1FP2A 1YDFA 4P0TA 2E9SA 3PC8A 3BHMA 1LLCA 2PU5A 3C16C 2AEFA 3ZY2A 3T7RA 3HCEA 3HO6A 1UZUA 4R71A 4BZPA 5G3YA 3JQFA 3ZE6A 3C7KA 3GK3A 4M9ZA 4E30A 2I6FA 4L9RA 1M1NB 3DFFA 1VPLA 1FNNA 1M6HA 1SAYA 3F74A 1XD9A 4JLNA 5ECDA 3E8XA 5K03A 1RADA 4NJMB 3QWIA 1ESMA 2XLBA 1H93A 3CR3C 2AZXA 4JUDX 1UMDB 1LW6E 2H3HA 5I3ZA 3BGOS 5FR1A 1IQPA 2IDJA 5E7MA 4DIBA 2GR9A 4HH1A 2ZIUB 4RD4A 2VNHA 1PR1A 2MYUA 1DC3A 2NNLD 3Q5GA 5CJPA 2BGNA 3OA0A 3HH8A 3RQSA 1U3DA 1K5PA 1ULTA 1I6KA 1LPAB 1M0SA 1SBHA 3GYGA 1V4BA 4AYTA 3IX7A 3WWZA 5THXA 1GU0A 3KZXA 3CGWA 1EESA 5F33A 1NDUA 1W59A 2RK4A 3OIDA 3OQ1A 5HKLA 6REQA 1II9A 4JP8A 5E7IA 1M2EA 2VDJA 2Y1XA 5K2OA 3CC8A 3MF4A 4NU8X 3VTZA 5A4KA 2QE7A 1Q6YA 2B8NA 2ZQZA 1Q14A 1VZ2A 4QOEA 2NAPA 1IZZA 2NSDA 1B8PA 4HWKA 4M0UA 2YCLA 3DO8A 4Z2AA 3BILA 2FUG6 5A03A 4I1RA 1SC1A 1JR6A 4F04A 1NLFA 5AJTA 2DH6A 5T3UA 5JWRA 3M9XA 1K4KA 4PO9A 3NEPX 2WTUA 2HBQA 4QSHA 4TWJA 1XROA 1FXWA 2MMGA 3NHSA 4PFKA 2FFAA 3EZ9A 3WGLA 4D6YA 3H19A 1LKZA 2NIPA 5CW2A 2E2WA 5AXCA 1JJAA 4DSZA 2EKBA 1XDDA 3VRHA 1QR2A 1ZZEA 7MHTA 3R77A 4TKUA 4U0KA 5KMGA 2C4UA 1FS5A 4CUZA 3AFIA 4L4XA 4WX2B 1DDGA 2QN1A 3I5XA 1XVTA 1WMEA 4EBFA 4EGQA 4EZEA 3FYHA 5EIOA 4UHJA 3Q9LA 4GR9A 2VBFA 4W7IA 4CWAA 4BNHA 2LP4Y 4CMBA 1V9LA 4WXPA 1A9YA 1O54A 4DRXA 2BCGY 2OQIA 1KNQA 4TTAA 4B7XA 2FN4A 1T2AA 2YTZA 3ANYB 5ARBA 4JWTA 1JPUA 2J59A 2MU1A 3JASA 3TVYA 1TIBA 3LWBA 1EWYA 1ZJ6A 2YWXA 2ON6A 5TMBA 3WYBA 4BNJA 5FX2A 1R0XA 3LUCA 4D8UA 3BWDD 1E66A 4MTLA 1MQSA 4ZVUA 4V24A 5IEBA 3THXA 4EJ2A 5K8UA 4KIGA 1T26A 5FBWB 2P9BA 4B74A 5K0BA 2HBZA 1RQ7A 1QH1B 2C03A 3KSZO 2XH8A 2ZRDA 3AFNA 1NMYA 3QE4A 4U7TB 3F98A 3IAM6 4O0LA 4UREA 5FUXA 5CVTA 1Q0TA 1G4AE 1A7AA 3GT4A 1Z63A 2ZRPA 1X9IA 1CUDA 1ETHA 1WW3A 2QD5A 2BDEA 4X44A 1L5VA 3MT8A 3QUQA 3IBTA 4P2GA 4RTOA 3GLGE 4A15A 4FI3C 4NKRA 5DTQA 3R6GA 3R7NA 5DHSA 5JH7A 3OPNA 3ZZ1A 4H7PA 1HK7A 4RD6A 4DA7A 3D8BA 1V6CA 3EGCA 3VO2A 2NZXA 4AICA 1VKOA 3CNHA 1RCFA 3CNEA 3IMGA 4E5SA 5JXHA 1Y63A 4WGGA 1N2JA 1NBAA 2BGMA 4IIVA 2A92A 4JJKA 2D54A 2FF5A 4KXNA 4CF6A 3DULA 2XMBA 1NR5A 5D1HA 3MGBA 5HJ2A 5JCJA 5FPKA 1JHYA 3MCWA 3WLKX 4JQOA 1L5HB 1K7CA 2XGJA 4KV9A 1JLLA 1XJ0A 2H54A 3G5UA 4A1OA 2PMCA 5B7PA 2YV2A 1XL0A 5D8DA 1QH0A 2EU8A 4G65A 4KO4S 4QT0A 4HDNA 3A4LA 2Z04A 3ETGA 4YCBA 1WCYA 2AQKA 2MT9A 3OQ6A 3CLUD 3KJEA 4JBNA 5DEIA 4TV9F 4AZVA 5BSKA 1M0EA 1RVDA 2RGGA 1M2NA 4XQ0A 1UAAA 1P4RA 3ZNOA 4OBXA 2O5EA 5K8JB 1TLLA 2VK2A 5THKA 1BDBA 3SC6A 2I80A 4B6OA 3GAAA 1K88A 4UULA 1IXYA 4MDYA 2WJ3A 1EVEA 1ZUIA 4QDXA 2BF4A 3ANTA 4Y2UA 4JSYA 3UHOA 3VSBA 4IAOA 4TYMA 5EZYB 4MQEA 2FGKA 3JQ8A 3BDVA 1E60A 4Z99A 3WGTA 1P4SA 3PD1A 4F5WA 3T7EA 1EXNA 1KOJA 1Y98A 5JSQA 1C3VA 4HB2A 3N2IA 3G0DA 1WR8A 2NQ8A 1WA5A 4MMYB 5AVZA 2EP8A 2J08A 3T99A 1SUAA 2OCBA 3LUGA 4PHGA 4RA9A 3RV3A 2QZJA 3V9AA 4KC0A 5IBPA 4RTPA 2R1UA 3EULA 1QIHA 1WUIS 3H1EA 3NIWA 4XARA 4EPWA 1FLDA 1L4UA 1HT0A 3JAKA 3WWCA 4JXZA 2MSKA 4I9GA 4UM8B 1U6IA 5CDUA 1Z56C 3F9CA 1ORDA 4RPLA 3UOAB 3U40A 3K35A 2V3CC 4EKIA 1ZGBA 3GF4A 1ULUA 2NT3A 3FFAA 3H83A 5DJ5A 5T6BA 3UJ3X 4E2XA 4XWTA 4D0LB 1DQRA 3HWRA 1OF1A 1JGTA 2BGJA 4PSVA 2CFOA 2JD1A 1LFAA 2APJA 3L79A 2NZ2A 4QSMA 3KXKA 5JHGB 4O29A 4UFPA 1LJLA 2QG9A 4DHEA 4QOIA 3E9CA 3L1KA 1JDNA 2GF0A 1JU3A 3THOA 1KJJA 2QVLA 3F6BX 4K8OA 1WEHA 5JVDB 3GLKA 1KORA 2C2HA 4JGIA 4LMAA 4MQ6A 4MV9A 4RVHA 2BKUA 5HFJA 2YV3A 5HIKA 3A7EA 2HQSA 5LA6F 3KE9A 3GD5A 2EGGA 2IYVA 1M1NA 1ZMXA 5BW6B 4UDYX 4J3NA 5DGHA 4FDMA 4EIWA 4BEVA 3EVGA 2OCYC 3GRFA 2NX2A 3EY9A 2I4MA 3OLYA 3CCBA 5CFPA 2DFDA 3BFKA 2VDRB 3CMMA 2X86A 4CGZA 1L3BA 5CFNA 1JH8A 2V58A 1AKWA 4CMHA 4EUKA 3OEHA 1Z34A 2FKNA 2I1WA 4R84A 4ZAFA 1RQNA 3EWAA 5HGJA 2XMQA 1I9GA 1DC4A 4ZGGA 1D1TA 4G97A 2BELA 3H9EO 3EQ2A 2Y1EA 3WRYA 1IOZA 1VSBA 3KAJA 6GPBA 2K87A 3Q6MA 3KQOA 1SUPA 4LUCA 3VR2D 2C2ZA 5HE8A 4I19A 5FWNA 3VKVA 7MDHA 1DTSA 4EARA 1J8QA 3ICVA 5U4QA 3N9IA 1J99A 1VGQA 4HPJB 2PX2A 2QMOA 1Z4IA 2PMEA 5J3JA 3PQEA 4II3A 2WJPA 1YI1A 3LGAA 3BMCB 3HU1A 4X7PA 1E9FA 3WL7A 1KAGA 3A1FA 4F7WA 2R1TB 4B6QA 4H3VA 5JJCA 3NR2A 4FYWA 3WTBA 4H7JA 3DMGA 4HQ0A 1N1DA 1OE0A 2C4NA 2DC1A 2PR7A 2HH9A 4LBYA 1MMFB 4OQMA 3USES 1ZGAA 2AOTA 4KN6A 2JGEA 4AS1A 2VEDA 2X2FA 3GRZA 2FDRA 4G0QA 4D4LA 1HV8A 2C29D 4TZKA 1Z5VA 1OBHA 3QM1A 2R66A 2ZBRA 3WWDA 1V45E 1R6UA 5G0VA 4DN6A 1GQ2A 3S5JA 2VS1A 5PGMA 3CX7A 2W6JA 4WWHA 4O1MA 4I9FA 3CNQS 4WXMA 3F6SA 3GZTB 2AN4A 1NU6A 4KBYA 3S7TA 2CLCX 2D1SA 3NS7A 2VOJA 4K26A 4E1BA 4CU2A 4YRSA 3F7MA 3BRQA 3TTWA 4MUIA 2DUMA 4TUYB 5IMBA 3RYHA 2Q4BA 4O4IF 4NCIA 1OW3B 2ZTMA 4N0MA 3GARA 2HZ7A 1QR6A 5D3ZA 1LGYA 2YHIA 3OE7D 2YHAA 3LFUA 3GLUA 5DM4A 3GRUA 3Q6IA 4KEAA 2BFMA 3EVAA 4IVPA 4LJLA 3OD5A 4N7MA 3VGJA 2VCYA 4G86A 2XXBA 5E38A 3T41A 1SN7A 3PHLA 2JCSA 3RRFA 4AN1A 5LQKA 4HWGA 1QH1A 3FTQA 3GLGA 3L06A 4ZT5A 2WNIA 3D0RA 1PHPA 1RI2A 1MJ5A 4FDTA 1PUIA 2FDXA 3QI2A 3V8VA 1ATZA 1RYMA 4AVYA 3ER8A 3MJRA 5H81A 5J4LA 4MQFA 5CCDA 5AJWA 1B93A 3I83A 1YDGA 1GP2A 5K6AA 2O7QA 3ZIAA 2JH8A 2LKDA 1XQWA 1NASA 3L8EA 4OTZA 3BMXA 1CZKA 4C30A 3CA8A 2F4NA 5F52A 1Q3HA 1F5NA 4MOWA 4QRDA 1F12A 3KOYA 5LP6B 1ISIA 2WTBA 3TK1A 1AM4D 2D5AA 3TD6A 3DEKA 3P5BA 5LQDA 2NNWB 1JFFB 4X9XA 4X1OA 5ES4B 3L05A 4DLBA 1BCSB 1BS2A 1L5HA 1VECA 3ORSA 3RKRA 4M0MA 1ZOOA 2XYGA 1MEOA 4KUEA 4WY2A 2DFPA 2ZUBA 1R0BA 1XTIA 1XG5A 2AMYA 2BM1A 5ERXA 4PLFA 1YR3A 3OZIA 4BLOA 5AVXA 3KO8A 1RP7A 4KSBA 4UXHA 3IP1A 1RWXA 1TZJA 4X5OA 1M66A 2FVXA 5BPHA 1YJAA 5FBZA 5IJ9B 4WDQA 3LK6A 3PEYA 4ZYZA 3QEOA 3TOXA 1Y3AA 2HU8A 1RFLA 3QMVA 3AHIA 5L4SA 2ZYTX 4JOCA 3RE1A 4CLRB 3MWJA 3D3WA 3A28A 1RYBA 3N7UA 3R9XB 1O4WA 4DS3A 4GH5A 3TNLA 3HE3A 1PBNA 2IHNA 4B87A 2PUEA 1QBKC 2F3RA 3IVCA 4B4WA 3DC7A 4ZI7B 1U0BB 5JNVA 1RWMA 3SHWA 1Z0KA 3BDIA 1Z8FA 3F47A 4MPRA 3RIHA 1N3IA 3WK8A 1PP4A 1SKBA 1GPMA 3RSOA 1EMDA 3PC4A 1ZUNB 3UBTA 1SXIA 4HDSA 5SZHB 1JHPA 4W1PA 4MGYR 1W49A 2VEOA 2IBTA 1NRXA 3T12A 4LJAA 5K3CA 5KOIA 4QPZA 1AQIA 4LX0A 1CUIA 3EN0A 4EG8A 5CTAA 4BMXA 5ITVA 2HF9A 2ASEA 1P75A 4UHDA 5SZKB 2W2OA 1GNSA 1YJ5A 1Y8AA 2ZJFA 4PLTA 4EHJA 1YU6A 4G09A 4C7JA 4URXR 3TECE 2CLOB 3PNSA 1XLWA 2WHRA 2YYSA 1H3FA 1ZVJA 4IMJB 4AROA 5L95A 1KSHA 4POOA 1KFKB 3GCWA 2R68A 1Y9JA 1KBZA 1XDWA 1FUIA 1AKYA 5A0FA 1KK1A 1RTTA 3ZWPA 5JVDA 2YJ5A 2PX4A 3IUEA 3P52A 1KEUA 4JBYA 5FBKA 5IK2A 4G1UC 1AQJA 3O3NB 1CUJA 2OA0A 3NBKA 3CX3A 4UASA 1MGPA 4RABA 3WLNA 1SXGA 4YRRA 3IVRA 3CPJB 4KI7A 1M8FA 1HQYE 4MI9A 1H05A 2ZUVA 3U7FB 2I3DA 2G83A 2I8AA 1QVWA 1II8A 1G59A 4L5AA 4FFNA 3HCWA 2H07A 4QQNA 4ER0A 1N5MA 3E7FA 3HHPA 3IT1A 1BOFA 3HDYA 3TD9A 5FH9A 4HXFB 4O2AB 1J8VA 3QTTA 3WFJA 3KETA 4RACA 2VFAA 3NCTA 4XI9A 3TIIA 2ZYGA 1CC1S 1A9XB 1J25A 1N5OX 2G9RA 2JGNA 2OBFA 3ILHA 3GJ3A 1C7JA 3KKEA 1IIBA 1NT2A 1X8KA 2WWXA 3QBTA 1FZQA 4V3BA 3E3MA 3GFOA 2IKQA 1CIVA 3K1JA 4AJIA 4B5KA 2R5FA 4IHQA 3JYOA 2YH2A 3R3JA 5C8VA 1VB3A 3LY9A 4IIUA 1I2CA 2CJPA 4M3NA 1SVSA 4Q3DA 3HP7A 4B0OA 5EXPA 1U2PA 1Z12A 2R1VA 2RJNA 2EW8A 3NATA 5AJYA 3QEKA 4HMQA 3RU2A 1JDTA 1VMAA 4B73A 2IP1A 3BMCA 3EVFA 1VG8A 1XZCA 1QIGA 1PDVA 2WMOB 3DWIA 1EB9A 3CONA 4YFYA 3FSRA 4HH4A 2VUHB 2LE0A 1CCWA 1CRZA 1W47A 3OFSA 3W5SA 5J43A 1SUFA 3UPTA 2AZMA 3THXB 1LD3A 5AKHA 1S3IA 3GEIA 2EQBA 1M67A 4DQUA 2V65A 1J8MF 1AO3A 1ISJA 1Z33A 2O48X 5CP8A 4QTYA 2EF1A 1VIDA 1KK0A 1AKEA 2QN6A 4EUNA 4LNHA 5JWOA 3UC9A 4ZYLA 5F76A 3PSHA 3KE8A 2C2BA 3GEMA 3COSA 4IGIA 3DLHA 4B6PA 4MKGA 4ARVA 4MW0A 1XWIA 1JFRA 2HZBA 5FXMA 4PGFA 1CIJA 1T8WA 5IJAA 1FFDA 3CVVA 1N5IA 3VMMA 5C4GB 1XMOB 4QPNA 4YT4A 4TUYA 4DJEC 2HY7A 3Q7QA 4ETWA 1QOZA 4IX9A 3NAGA 1E8NA 4FBLA 4F1KA 3TBFA 2JVIA 2EJBA 1XR3A 2O2GA 3AJEA 3T06B 4EX6A 6LDHA 2PO7A 2IEDA 2QTNA 3WR5A 5LKAA 3EEBA 1GUZA 1SH7A 2GT1A 3C8ZA 3IQGX 5LNK6 1YHZA 1XTTA 1OAOA 2B78A 4MDHA 3K2BA 4AJ4A 4IJUA 3F1LA 3GLTA 5JJBA 2I54A 5CT8A 4AJHA 1A77A 2IOYA 2C8KA 4KMOA 5IM4A 3HFSA 5J5CA 5F5NA 2FCRA 2YV5A 4JQSA 2B7CA 4ZQHA 5EPUA 2I9PA 2R6AA 3HDJA 4EHFA 2DFNA 4HX9A 4FZJA 3GNTA 3H1TA 1QE0A 2HTEA 2ZKIA 4CETA 1FP1D 3TZCA 2YNMC 2G8NA 1CUAA 1L0BA 2G5TA 1C7QA 4EFKA 4G2NA 2F1HA 1EWTA 3FWKA 3GFRA 5E2BA 4M0PA 2F64A 1A5AB 2OGTA 4LQCA 1JFFA 2JLYA 2CHEA 3D81A 3L4KA 3BSWA 4KU4A 1H2RS 2O3TA 2OQVA 3RVSA 1BCSA 4BXOA 1G60A 4PICA 3FB1A 3L8MA 2DFLA 2OORA 2ZJ4A 1KYVA 3N2YA 5EJEA 5J2UF 3IAS1 1CF4A 4DCVA 1PLKA 5IAOA 4BO5A 1KEPA 1ZOPA 1ZN8A 2Y68A 2YVUA 1Y4UA 4QATA 3COPA 4A0QA 2V5UA 1NXTA 1A5ZA 4Q66C 4MLDA 4GOOD 1DEHA 4LHYA 4YRQA 4ZZ2A 3VKUA 1PNQA 4DA0A 1QPBA 4IZ6A 4OMCA 1FDOA 3ZJ4A 2V9PA 3II6X 4EB0A 5IJ9A 4GI3A 1R5OA 4CLDA 5A4MS 2LCIA 1GPKA 2BBTA 4LJ6A 1A3CA 1IM2A 4YGYA 2OHIA 1W36B 1Z6XA 4F21A 2RAVA 4CLRA 1WB9A 3WQQA 1FQWA 2GHQA 2F8TA 4BS9A 2C1EA 5LLDA 3KLNA 2DFTA 1BN7A 3D6MA 4ZI7A 2QP4A 3DVAB 3JYLA 3CSUA 1D3AA 4E2WA 3H11B 3WDMA 3JY6A 1BWRA 1PG5A 4MGIR 2GBLA 4H7EA 1RBZA 1IWBB 4RANA 3ZOKA 1C5KA 2AXEA 3WISA 1ONSA 1QCYA 1PWZA 4MUHA 5ALVA 2ZUFA 3IXLA 3AJ8A 1MJGM 1ZUNA 1NQVA 3LOPA 2GJ9A 5H16A 2W7TA 3OF5A 4OJKA 1U28A 4LRTB 4E1AA 4WKBA 1OC2A 2FWNA 1MA0A 2CXOA 4ZYXA 1A9PA 1BMQA 4P4NA 3JPWA 4TKZA 1GT91 2JKVA 3OQBA 3LL7A 4DZRA 2O23A 3DPSA 1TUIA 3LCRA 5BXQC 4DR1B 4L5CA 1G6OA 5EFZA 1CJCA 1O9BA 5EJGA 1VSTA 3CXRA 1UPBA 3RIXA 3UHFA 2H2AA 3FMGA 2IIQA 4ETIA 4F71A 4GZ6A 2D74A 5HPYB 1KMHB 5JCJD 2NW6A 3A2KA 3RHFA 1A8PA 2QAIA 5E3IA 1F9EA 3EQ8A 4OBWA 4BVBA 3MGAA 4TSFD 1WB4A 2OLJA 5CHEA 3G82C 4BV2A 3T8YA 5AKLA 4DPMA 5K99A 2H9YA 3FHLA 3K4PA 4FOOA 3IALA 5TPZD 3S2SA 3U4DA 4EDFA 1C14A 3OKPA 4KPEC 4RHFA 3E05A 4DQVA 1Z2NX 1ICIA 2H52A 3TYXA 2G5PA 3EFOB 3R8XA 3I8OA 1CUSA 1U6JA 3KQVA 1DEAA 2G77B 3BHIA 3WMRA 3TGLA 5AHXA 2CZCA 4Y2HA 5SZIA 1C0PA 3FPAA 3A1CA 2C07A 3GELA 4OMFG 4O2AA 5JJ5A 3BA6A 3LTEA 3U7HB 1Q83A 2ZTSA 2H6EA 1Q77A 1A9XA 3PX3A 4WEOA 3AHJA 3H8VA 3A6DA 1PR9A 5EKXA 2JLZA 4WBNB 3EZYA 1DQPA 2D06A 2AG5A 4PIPA 1RPNA 5ALFA 4BIMA 4MZXA 3DBVO 3PPVA 1AN9A 2PU7A 5TE9A 3WFIA 4DMKA 2V4UA 1HFWA 3M6UA 4Q1FA 1BWPA 1Y6JA 2WLTA 4QODA 4OHUA 5IF3A 2PL5A 3GLVA 4ZVNA 3GBVA 3L0OA 4F2PA 2H11A 4XWYA 4BN5A 5JG7A 1IM5A 1W48A 1UWLA 1XELA 1RYFA 2QUHA 4FYMA 3UMFA 1I32A 1KRHA 3PC6A 1VA5A 5H5JA 4TL7A 1GCGA 2FPUA 3FDJA 2Y9PB 3ASZA 5AM1A 1WQ1R 1TAHA 4J9UE 3G0BA 4J7UA 3OQVA 4A4DA 3WA7A 5HM8A 3VH4A 5L3SA 5LZ4A 5JYBA 1LEHA 1Z8HA 3O8NA 2PKWA 3K2EA 4OJYA 1DMSA 2AX3A 4RADA 2FE4A 2NACA 3C74A 5KQLA 3VX4A 4A03A 1ULSA 5F7OA 4X60A 2R00A 2DULA 2WM8A 3HU2A 5GOTA 2BE9A 2PUHA 3QU2A 2BSAA 2ZPAA 3QFCA 3ZNNA 1KK2A 1N3YA 2P2SA 3B53X 5B53A 1QOQB 4IOJA 3WB2A 3ZE8A 1SBTA 2DBYA 4G4SP 3MVEA 3ZJYA 2AW3A 3OZTA 4RTMA 2YZGA 4NH4A 5GQSA 2CGEA 3C43A 4F0JA 2H1HA 5GADl 2G6TA 2MWMA 1OYOA 2A1UB 2I7XA 2D1TA 3OEHD 3WQSB 2B6HA 3OZGA 3ZOZA 2GNAA 4FOLA 3C0KA 3PT9A 3V1UA 2XMGA 3PR3A 3AVTA 5A3QA 3S68A 4HB0A 1ITZA 3R3VA 3AM5A 3L4EA 2ATCA 2PJUA 4ZVLA 1XNGA 1JDUA 4TRMA 2HLHA 2Z8YM 1XU9A 2NTJA 3Q8WA 3HN2A 2C7VA 1J0EA 1H5UA 1VC2A 2FP3A 4PBRA 1RW4A 1ZXXA 2VNIA 1CUHA 2ZJOA 3LAWA 1RAIA 1EWVA 5JD6A 3PTAA 3QPBA 1K2WA 3ELYA 1QDUA 2C97A 4YLYA 1IVSA 3DZ8A 3HB7A 5EA2A 3DLTA 4OQFA 4EFNA 3DTYA 1OLUB 3CV3A 5AJHA 4HO1X 2MTBA 4JI3B 1MTZA 3K9GA 3V6LA 1PO7A 5EAIA 1T1IA 4GXNA 1VP3A 1LB1B 1UBFA 4HS4A 1HA3A 3KPYA 2C5BA 5G1NA 1UBRS 3QBJA 4M53A 3EDQA 4MPTA 2PBFA 2ZJ5A 4BGDA 5AVTA 5IZ4A 3PHIA 1JKFA 5HA5A 2AVNA 4YCMA 1QJ4A 1YVRA 5F77A 1WXXA 1U63A 2DCMA 2O1WA 3E7XA 4MGHA 4DAOA 3B7GA 3IESA 3M2PA 3P2YA 1L5SA 2D2VA 1XXHB 5IKPA 4KIFA 1SKUA 5FR2A 2OWDA 1OBCA 2QT0A 3WMWA 4X45A 1XGKA 2WC1A 1L7OA 1YHNA 4ENPA 1XNQB 3DLIA 3P9ZA 1EBUA 1KYWA 1HKHA 1P39A 1QHXA 3RSHA 3STVA 3CH5A 2NO6A 1RQPA 3WYDA 2C3PA 3FHOA 1XZQA 4LFCB 1XXHE 1S8AA 5CR9A 3QPVA 3ACDA 4TLCA 3FB4A 1FBNA 2D59A 1EIWA 3QJ5A 1A1SA 3ROEA 2IYNA 5AKZA 4B3XA 3O90A 4RDCA 4QJ4A 3DVAA 5G02A 2H7CA 3UMJA 3BCUA 4BUJA 1IVNA 2R8OA 1T0IA 3H11A 1H85A 1OASA 1ZLXA 4LIPD 2YOGA 3L0IB 2ZGVA 3UJ8A 2QSJA 5AVYA 2XB8A 3QHQA 1Q2UA 4KKVA 4LSZA 4R0VA 1BE6A 2YY6A 3TQCA 2J31A 5K1ZA 3GUYA 1FTNA 1WE2A 4I55B 2HK8A 1Z0DA 1INLA 1XHLA 4I08A 4P7FA 5ENDA 3ZIAD 2PUCA 2QM7A 1HT3A 3I28A 3R74A 3VVCA 4C7OB 4DLVA 1C30B 4J07A 3E6AA 1J22A 1Z6YA 4UVEA 4YRKA 4UARA 2Y1KA 2K5UA 4JKYA 2J3DA 3RJTA 2AKEA 4HPWA 2FFHA 3QWBA 2WJIA 4LDRA 4OVKA 1OBFO 3BCRA 3JVIA 2BI4A 3CKKA 3HLTA 4DA8A 4RLFA 1SC3A 4HTFB 5DNWA 2VPTA 1KMHA 1G42A 2J3MA 3H4TA 4Z7NB 1NC1A 1Z5UA 3GGDA 2JGDB 3PFCA 3UK6A 3K0HA 1S9DA 3EMKA 1GSOA 1EUYA 4NVRA 2O8CA 3EZNA 3O8CA 2ST1A 2ZSKA 2P2NA 3QX8A 1WPQA 2VJBA 3ECSA 4P4SB 4DIOA 3EFOA 3I64A 4N01A 5B3AA 2C00A 1NUPA 3G1WA 1M6YA 5CNJA 4L76A 1BMFA 4KR3A 5EG5A 5HDQA 2BMAA 1L4KA 2HLDA 3ET4A 3LKZA 3ZBUA 2Q2OA 3GLGB 4K5QA 2QNRA 2BZSA 2R25B 4D6PA 2ZI6A 2OAP1 4PYNA 1IBCA 1GZ5A 3EOBI 4YV0A 1RHRA 2NSYA 4L8LA 4PLZA 4P84A 2AOVA 2EDCA 2XQGA 3QG5A 3QRWA 4YAUA 5T5QA 3TWOA 4N54A 2D8AA 5IARA 5T41A 4BQPA 3P97A 4GOXA 3E61A 1ECGA 2C8LA 2HK6A 3JZMA 4LRXA 3ZQ6A 3Q7EA 1WBDA 2AI3A 5GY7A 5ALOA 2WIKA 3HLKA 4KN5A 4U5XA 4GO1A 1WOYA 3ZCSA 4G5OA 4BQNA 3UWOA 1PCXA 1OAKA 1Z75A 3TAHA 4WHMA 3EVCA 3HB0A 5DNYB 3GUUA 1MAUA 1RWPA 3ZCTA 1US8A 2O6HA 4U2DA 1IPEA 1E1NA 1PQPA 3NT5A 1FRFS 2SHKA 4UE3S 5D84A 2X42A 4K9RA 1VPVA 4PLVA 4UCXA 4ISCA 3HXMA 4R1PA 5F7JA 4I99A 1YDMA 1ISRA 1DX6A 2ZANA 2ZRGA 3JWPA 1T1SA 4J4HA 3U44B 1P5ZB 1S2DA 3R0VA 5DHRA 4BC0A 4BEWA 4EO9A 4ZI3A 1OTYA 2C31A 4REMA 3WBBA 4CM1A 3JVUA 4F2HA 3V4FA 1MFZA 3FLMA 4C0BA 1NUUA 4G3XA 4JVLA 4HFMA 1YJXA 1JLSA 3DCNA 3O38A 5KYNA 4QICA 2I8LA 1JE0A 4F93B 4QX6A 2MDTA 1OTHA 1ZA1A 3HPRA 1YC5A 1U65A 2ZK7A 4JSTA 4GR4A 3IEMA 5KHOC 1C8VB 3WGNA 4PCLA 1MC1A 3JPYA 2RMKA 3TNDA 1L5OA 4OLJA 5JNLA 4XLLA 4Q93A 1QKKA 3W3AH 4MWZA 1VRWA 5E6UB 1I3MA 1QIMA 1U0RA 3GIWA 3SNKA 5FEUA 4KWHA 2EFCB 1KVRA 1E9BA 1ECJA 4DC1A 4LZAA 5JY1A 3L7IA 3EW7A 3EVZA 4D96A 2NO4A 3QELB 3OESA 3TSZA 3AXSA 3EIOA 3QP9A 1W2HA 1HFEL 2PNFA 4NP6A 1VL6A 5LYJA 3LYHA 4XIGS 5F4BA 1TU3A 1YMQA 1JA1A 4C6SA 4UBNA 1U81A 3O75A 3QW2A 4FJ2A 4XX1A 1B43A 1IHPA 2X9NA 3H2GA 4PQRA 2PLFA 4QOSA 4F46A 2XUHA 5KX5B 1OLUA 1DJLA 1SXJB 1X92A 3F90A 4LJYA 1YZGA 2M2IA 3B38A 4NFYA 1JWBB 3PFNA 4S0ZA 1IB6A 3I9MA 3CLSD 3RJ5A 1ZRNA 2VIIA 4NE9A 4UTOA 5TNXA 1R00A 1YQEA 1WKBA 3V8BA 2HDOA 1NXVA 2QGNA 2CEAA 2ORYA 3VYTB 3ITNA 1SXJE 2PRIA 3WY9A 2EWVA 3M1LA 1X7YB 4QG7A 4R81A 3EPKA 1XXHA 4DA4A 2QDKA 1RLTA 3R3ZA 2VXOA 3I53A 2NVUB 3C5HA 3ETNA 1WUHS 2HQBA 4JBGA 1DTWB 1J23A 4N6GA 1GVNB 3B6EA 4Y1GA 1CP3A 4OGLA 1TM7E 2FUEA 1OILA 1ZNZA 2B7LA 2JI6A 2JLSA 2Z1DA 5ALUA 3TB6A 3V1MA 3KYBA 1U7HA 4NR0A 3DL4A 3K9CA 2GK7A 4WUTA 4NG4A 2M9MA 5IHXA 3V48A 3TUJC 3RC9A 2A7XA 3G2LA 1BX1A 3LU1A 3NAMA 4Q39A 4X1YB 2VWQA 1QFMA 1R12A 2ZJ1A 4P4GA 4YTEA 3W4IA 4B6EA 5BN5B 4FHFA 4ZOQI 5KC8A 3FPCA 4MPPA 3VU3A 3OU6A 1OX6A 2W83A 5BSHA 1IATA 1TU4A 1X9HA 4UEWA 4DIEA 4M2LA 4IS2A 3LYUA 5LPNA 3JQ9A 2JRLA 3KIPA 4LOJA 4MP8A 4Y0NA 5F2OA 1XYYA 1XTUA 3EB9A 3ZVLA 3IOYA 3OI7A 4YP0A 2QN9A 2W0MA 1FRZA 1OU4A 2EC5A 1XZ8A 2IYZA 3OOEA 1N4DA 1QMPA 2V96A 2YC2C 3IBSA 3QVVA 4I55A 2DQYA 3KR0A 4MQLA 4TSKA 4GBED 3GUHA 4C7OA 1GAXA 4QDUA 4TTVA 2I6SA 1NJSA 1C30A 4U00A 3LT2A 4CKXA 4EG7A 4FWBA 1X8LA 4Y7DA 1SB9A 4C88A 4DLPA 2BW0A 3COVA 3HWX1 4LYYA 1O95C 4TVBA 4MWOA 4DPLA 1GYPA 2O8FB 4JXKA 2IQ5A 4JL5A 4ZCQA 3WLHA 2FSUA 1DIHA 2I65A 1TLFA 3IRUA 3EH1A 3TKLA 3L7BA 2QW1A 2R7KA 4UDXX 3ZVMA 4HTFA 3INNA 5JALA 2WEKA 2BONA 2BBOA 1JNYA 5CXXA 2IU3A 2X77A 3BDAA 5AVKA 5GGYA 2FB9A 5U4XA 2JGDA 1KZ6A 4IFTA 4M9UA 4D9KA 2O7SA 1MAAA 2XUJA 2GERA 4IGAA 1PD1A 4NOJA 3AB7A 4V38A 3MTIA 3OD1A 4IH4A 4EYEA 4MO9A 1B8UA 1N2XA 4P4SA 1AGXA 3PGKA 4RE6A 3ERCA 1L5KA 2WINI 3HBLA 5FOQA 4C03A 2IFTA 1EG2A 1ZJ4A 4Y2QA 4HGRA 4BZWA 5GPBA 3O91A 1DAGA 4QXMA 1QYXA 5B1HA 2BYTA 3UKJA 2PKYX 3QW4B 2ODPA 3RU3A