3GL9A

The structure of a histidine kinase-response regulator complex sheds light into two-component signaling and reveals a novel cis autophosphorylation mechanism
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
120
structure length
119
Chain Sequence
SKKVLLVDDSAVLRKIVSFNLKKEGYEVIEAENGQIALEKLSEFTPDLIVLIMMPVMDGFTVLKKLQEKEEWKRIPVIVLTAKGGEEDESLALSLGARKVMRKPFSPSQFIEEVKHLLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insight into Partner Specificity and Phosphoryl Transfer in Two-Component Signal Transduction
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Signaling protein
molecule keywords Response regulator
total genus 43
structure length 119
sequence length 120
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3gl9A00
2M98A 5TE9A 1EWKA 3JVDA 5JNWA 1P8AA 3LKBA 4ETMA 4WXMA 4EYOA 3O2JA 4MS1A 2NT3A 1ZN2A 2MYNA 3URMA 2CHFA 4WWHA 4KK3A 5TQ2A 3O2SB 2FVYA 3KYIB 2GX6A 1ZH2A 1D2AA 3OMXA 3Q9SA 5IULC 2LUOA 1DBWA 1KMIY 5HQJA 3KJXA 1ZH4A 2L2QA 1YVUA 4RK5A 3L49A 2AYZA 3DGEC 3IP6A 3K9CA 2YHBA 3C3WA 1ABEA 3LUAA 4S04A 1ZESA 4D6YA 4W5TA 3RVSA 3KTOA 3CLKA 2FKAA 3N8IA 3KKEA 5JS2A 3ILHA 1Z15A 1DJMA 1Z26A 2ZWMA 4MR7A 3HXMA 4OG2A 3TMYA 2MSKA 3FFXA 6ABPA 4NICA 4F11A 1ISRA 2J48A 3LKVA 1R8JA 4JP1A 4DN6A 4YCSA 1U2PA 4IMIB 3EQZA 3LFTA 1RZRA 1A2OA 5B3JC 5EWJB 5IUNC 5ED4A 3QEMA 1BVHA 1DP4A 1USGA 5DCLA 5DKFA 1DCMA 2E4ZA 2ID9A 3I5AA 3MF4A 3W9SA 4LX8A 3DLHA 4HNRA 2WY2D 2OQRA 4MS3A 2HQRA 2FEWB 1YTUA 3GWGA 1BDHA 4QICA 4NCBA 3N53A 2A9RA 5TPZA 2V0NA 5C5EA 4F3TA 3LUKA 3GBPA 1P2FA 2FSPA 2IPMA 1Z16A 2HJ9A 2QU7A 3N0RA 5EWMA 5FWXA 5BRJA 4Z4IA 2RGYA 3Q7SA 3QLVA 3OM1A 4HNQA 4MR8B 1BDIA 2FN8A 4RV5A 1FSPA 2FQYA 4OBBA 1F4VA 3JPWA 2PJUA 1VKRA 4IILA 3E3MA 4NCAA 5IUJC 4H60A 5KQPA 1DC7A 3LUFA 3KLOA 2FLWA 1PNTA 3OQNA 2IPLA 4FE4A 1ZITA 2X7XA 3KHTA 4JA2A 3OQOA 1D1PA 1EHCA 1BA2A 2F8TA 4WZZA 5GOTA 5CHYA 3T38A 2A9PA 3CG4A 3KG2A 2W42A 1QKKA 3LUGA 3OM0A 1ISSA 1FFGA 1QMPA 1Z25A 1QNLA 3RVOA 2E4WA 2R48A 3G85A 3T95A 4Z9BA 1ZHHA 2QZJA 1M5UA 4NV3A 3TO5A 5T7BA 2QXYA 4O1HA 4KQ9A 5KQMA 3HUUA 5IUKC 2ZAYA 2MSLA 2L17A 1U2QA 3FFTA 3QELA 4KV7A 5BR1A 5TQJA 5TPWA 3HV2A 4JASB 4D6XA 4P1ZA 3CZ5A 3KYJB 1E6KA 1D1QA 3Q7TA 3BRQA 3RQIA 3BRSA 3N0WA 3NHMA 4EVRA 5C5CA 4S05A 4MS4A 3I09A 3NHZA 1PNRA 3A0UA 2OENG 3O1JC 1NXVA 2WRZA 1GLGA 1SD5A 4MRMB 4E7OA 2I6FA 1DBQA 3F6CA 1DBPA 1YS7A 3FMVA 3TD9A 4EUKA 3O75A 3HK2A 3DZDA 4XXHA 1C4WA 2P4UA 1YK0A 3JTEA 4YLEA 3M9XA 3BBLA 5KQLA 4TLLB 1URPA 4F8JA 5IBQA 4ETNA 1FQWA 4MR7B 3QLUA 3LOPA 3H75A 3NNDA 4Y9TA 4G0QA 4RK6A 4LZLA 2PL1A 4RK0A 3H1GA 4LE2A 2HQOA 2P9HA 3CU5A 3QLVC 3K4HA 4RWEA 4TMYA 3MA0A 3RVKA 4RY0A 1SXHA 3FGZA 3H5TA 4Z4FA 2B4AA 1DZ3A 1LBHA 2LIVA 4G86A 1TVMA 2LP4Y 5BRAA 1JF8A 2BGGA 4EVQA 4KRFA 5HKOA 2MYTA 5CNIA 3SY8A 5JNRA 3GRCA 3H6GA 1Z13A 3CNBA 1JX6A 1UDRA 3CKMA 1Y1LA 3RVQA 1FFWA 3OO1A 3TX6A 3HDVA 3KCNA 1DCKA 3QX8A 4YR7A 3C6QA 3UK0A 1I3CA 1ZVVA 3KLNA 1RXIA 1LK0A 3IDOA 5T3YA 3H5WA 2FMFA 2PL9A 1DRKA 2GI4A 4LDZA 4ML3A 1VPWA 4MQFB 1RPJA 3HM9A 2JRLA 3CG0A 3HCWA 3VNBA 4JOQA 2CWDA 2PUEA 1GUDA 1E6LA 3H6HA 4RDCA 1JDPA 4LE1A 4PICA 2WWVD 2FLKA 1SXIA 4Z4CA 1EWVA 1BAPA 4KFCA 1KGSA 1D5WA 1U04A 3FFWA 3MYYA 4RU1A 3E61A 1QO0D 2L19A 1TLFA 1JDNA 3EODA 3MIZA 4EYGA 3D02A 1NXWA 2JK1A 5KC9A 4EYQA 1YK1A 4RKQA 4DQDA 1U0SY 1J56A 1CHNA 2QV0A 1K66A 3ILYA 5JNVA 1JFSA 4KREA 1JYEA 2B1JA 2N9UA 3N6VA 4RXMA 1D4ZA 3OLVA 4MR9A 4RXTA 3H5LA 5CNJA 1MB3A 8ABPA 2H3HA 4ZPJA 1H9CA 1Z18A 4PEVA 1C0EA 4M88A 4XAQA 4MQEA 3QEKA 1SXGA 1OXKB 2ID7A 4H3HB 2QVCA 5IX8A 1NXTA 3RVNA 3T8YA 3H5IA 1QQBA 4KVFA 4RS3A 3R0JA 1JHZA 2M1ZA 1A0OA 5DGCA 1JH9A 4HYEA 4RK7A 5TPWB 2FMKA 3HS3A 3IPCA 3SNKA 2IOYA 2NT4A 4XASA 4G0MA 1JLKA 2RDMA 5IEJA 1QP7A 4N47A 3EJWA 1EAYA 4RK1A 3HO1A 4L85A 2RJOA 3C3MA 4RY9A 3H1FA 3JY6A 1APBA 1B00A 3Q7RA 2MSWA 3SQNA 2GWRA 4MLDA 4YGXB 3DLBA 2KYRA 5ABPA 4G0OA 4OTZA 3RH0A 5IC5A 1Z2DA 4PYRA 4CBVA 4W5NA 4MQEB 4W5OA 3S99A 1ZAYA 3N0XA 3LUDA 3OMWA 3I45A 3SM9A 5BQ3A 3A0RB 5PNTA 1PUXA 3O2QB 1GUBA 3NNNA 2IKSA 2FQWA 1W25A 2JBAB 3QLUC 4Z99A 3G1WA 3GL9A 4MLCA 2A9OA 3HZHA 4ZMSA 3CZCA 1NXSA 1RNLA 2IPNA 3EDCA 2IYNA 1KRWA 4LE0A 6CHYA 2O20A 2GBPA 1M2EA 5DLEA 1HEYA 4IRXA 5F64A 4IF4A 4Z0NA 4WXEA 3LTEA 4G0XA 2E4XA 2QR3A 4N03A 3HVRA 2FMHA 3CS3A 1OXBB 1T34A 3FDFA 5EWLB 1XWWA 3NNSA 5JS1A 1K68A 3A3KA 1E6MA 4TLMB 1USIA 3JVIA 1M5TA 1NY5A 4KZKA 5FBHA 1NXPA 4N41A 5JNUA 3HEBA 1EWTA 2MYUA 2XDYA 4KK4A 3RVPA 2IPAB 5FWYB 3QELB 5TQ0B 4WT7A 5FWYA 2L18A 1QO0A 2PMCA 2WJAA 1JL3A 1E2BA 7ABPA 1NXXA 2R25B 3OLZA 3SG0A 1QQAA 2HQBA 1CEYA 2YHAA 4YWHA 1ZY2A 4RZSA 4XFKA 5CNMA 1RZRD 1JBEA 1YMUA 2FXIA 2PUCA 5GQSA 3TB6A 4JB0A 2PAFA 1S8NA 1AB6A 1P6QA 4KMRA 2JCGA 4NQRA 1GCGA 1TM2A 4GPAA 4MR9B 1JYFA 4LRQA 1GCAA 4ETIA 3F73A 2E4UA 3KSMA 3UUGA 3BREA 2PE5A 5TPZD 4KPYA 3HJFA 5CNKA 2PUBA 2NZVG 4Z4EA 1W9HA 4QYWA 4QPJC 4P98A 1ZGZA 4B09A 1DG9A 4MPTA 4RKRA 1ABFA 3IPAA 3JS5A 3O1HB 3CHYA 2VYCA 1JFVA 9ABPA 5FBKA 1XHEA 3EGCA 1MVOA 3L6UA 2QW1A 3LUCA 3EQ2A 4F06A 1CYEA 1DCFA 3KS9A 3A10A 4OATA 2LPMA 1USKA 2FEPA 4MS4B 4MS3B 5EWMB 3M6MD 1DRJA 3BILA 4PE5B 4HNSA 3ROTA 4OLAA 4JAVC 3I42A 4WUTA 4RK4A 2PLNA 5TQ0A 3O21A 4GNRA 3QLTA 2DRIA 4G97A 3F7NA 3H5VA 3HUTA 3OLXA 3M9WA 4G0PA 2PUDA 1PEYA 2HSGA 4G0ZA 1NATA 2LBPA 2WB4A 3B2NA 3H5OA 3OLYA 3QEMB 4N0PA 4EYKA 4ZMRA 3O74A 1EFAA 3O1IC 3QX9A 4G0YA 2JVJA 4Z9AA 2TMYA 5JNSA 3MM4A 4YRZA 3Q15C 4YV7A 2GKGA 4MGEA 4W5QA 1JFTA 2MYPA 3LMKA 4IMJB 3OLWA 1LJLA 3D8UA 2R4QA 2F8SA 2FQXA 1M2FA 3H1EA 2VUIB 4MAAA 2E4VA 3C97A 4YS6A 3RVJA 3SAJA 1MAVA 4YP9A 5D2CA 3P9YA 1YMVA 2VK2A 2PUFA 3CTPA 4FB4A 2RJNA 4E7PA 4UHJA 3NBMA 3EAFA 3GBVA 4EVSA 3VNAA 4EY3A 1F51E 3IP5A 1U8TA 3OO0A 3Q41A 5E3JA 1MIHA 2Q5CA 4EGSA 1AB5A 4MQFA 1ZDMA 2JVIA 5FWXB 4OLBA 1Z12A 3F6PA 5TQ2B 4IGAA 5KC8A 4MRMA 3GYBA 3MQ4A 5DTEA 4D74A 3LUJA 5EWJA 4MS1B 3LUHA 4XLTA 1JWLA 2QSJA 2NZUG 3T6KA 4XARA 2FTKE 4Q6BA 4JB2A 4MYRA 3RVRA 1NTRA 4QYMA 2WMYA 5I4CA 4O5AA 2NUBA 1TMYA 5JNTA 4RSMA 1A04A 2E4YA 1MB0A 3N75A 2IDMA 1L5YA 3UKJA 4Q6WA 4L4UA 2PKXA 5EWLA 4ZJPA 2AYXA 2FW0A 4ZYLA 1L5ZA 2HPHA 3DBIA 1KRXA 4Z4GA 5B3JA 1BDJA 4PZ0A 5KWSA 1DC8A 2FMIA 1ZGGA 2JVKA 4KNYA 4FE7A 3HDGA 1SRRA 2A9QA 1YS6A 2WJWA 3GV0A 1VLZA 3HSYA 4KQCA 4YO7A 3RVMA 2CHEA 5KQGA 1QP0A 1LJUA 1QPZA 2PUGA 1IIBA 2VUHB 5KI6A 4H3KB 2FN9A 4DADA 2PUAA 4Q7EA 3CFYA 3MMNA 4N76A 2JBAA 3C3KA 4O1IA 4MR8A 3DGFC 3RVLA 4Z4HA 2QVGA 3CRNA 4W5RA 5IEBA 2H0AA 2JB9A 1WETA 5HM6A 1FFSA 1TJYA 1RXEA 1NXOA 1PHRA 3IP7A 2CD7A 1QP4A 3ROFA 1LBIA 1YIOA 4UHKA 3QK7A 3OQMA 2FEKA 1Z2EA 3GT7A 4LDAA 3GA5A 4RY8A 1P6UA 2R47A 5HSGA 1XHFA 1Z17A 1VRVA 3EULA 4TN5A 3JPYA 4RXUA 1PEAA 3IP9A 4F12A 4N0QA
chains in the Genus database with same CATH superfamily
2OCXA 3U9LA 5JNWA 1FLVA 2IXGA 2YJZA 2FEOA 2BFAA 2MSNA 3NX4A 5LCXA 3B6ZA 2YWBA 2HK7A 3R3YA 5NLLA 3TR6A 3VZQA 4O2AA 3Q9UA 2X14A 1JDBC 1M10A 4BO1A 4J1QA 2ZJ6A 2RJ3A 3FJYA 3PHLA 3SC3A 2JAXA 3FUCA 3DFUA 1RWOA 2HSDA 4ZV4A 3OPVA 4BUJA 1K7SN 1KFEB 1ZCFA 3HABA 3OTQA 3SIPA 2ZEJA 4BUCA 4DV6B 2QE6A 4N4AA 3FPAA 3THXA 3G2JA 2A86A 3HL4A 5EJIA 2RH4A 3GPCA 1D2GA 3KKQA 4C6TA 5A06A 3AJEA 2VJLA 2W22A 1J39A 4L0CA 4WINA 5B1YA 2I29A 2ACKA 4KXFB 1GQRA 1OR8A 1C9JA 2Y1XA 4S04A 4FOLA 4GQBA 4UZFA 4BWGA 2ZB8A 3HJTA 1XXLA 2GEUA 2CXNA 4RLQA 1BN7A 3PHGA 5JS2A 5CDFA 4DLNA 1FSSA 4JSRA 1PS9A 2D1SA 1AXEA 2R8OA 1RQLA 5TC4A 1VPEA 1Q5PA 4V2IA 3W3AD 6ABPA 1CDDA 3QXXA 5IK2A 3WMGA 2V5VA 1KKMA 2ZBFA 1XVUA 4LHSA 4NCIA 2CL5A 4YCSA 1CFZA 4WZAA 3E3NA 2FFRA 3C1AA 2C5SA 3OIDA 1ORTA 3VO1A 2GRUA 4MRVA 4C07A 1J6UA 2LRHA 5JAZA 3OIYA 3HCCA 1GITA 1OYWA 2NIPA 5EVJA 4JN6B 1IN5A 1NR1A 5EFZA 5BSWA 3NETA 4D3YA 2ZT6A 3M5CA 1V5FA 2EKDA 2YZGA 4EATA 3Q2KA 2WY2D 2YYAA 4QOJA 2JIZA 3GGSA 1BWRA 4B8ZA 1E3MA 4BMVA 1P7PA 2X13A 3EW7A 4A0SA 1MMFB 4RFLA 4TL9A 4FD2A 2VDWA 3HG7A 5IKOA 5KTOA 4ARIA 2I1VB 1H2YA 2XPCA 3S2GA 2IPMA 3N0RA 3F4KA 2V4ZA 4I50A 5JRZA 3FYSA 2ZB7A 3OZDA 1DKPA 5DPMA 3SIXA 4FOSA 3CKLA 1FSPA 1MA0A 4BMPB 1PWZA 3WNVA 4QD3A 4K03A 1JLMA 2P62A 1JEQA 3SYMA 2X9NA 1D4OA 4IILA 4BRWA 1CZUA 2FHPA 1E77A 4MWZA 3UJHA 3BTOA 3CXRA 4G36A 3RS4A 3V6MA 5A6SA 4ZO7A 5EYPA 1EVEA 2BMJA 1DDGA 3DCNA 2BH2A 1J99A 2FF5A 3ZX5A 1DXQA 3K2BA 1BVRA 3EAGA 1JRLA 4GW3A 1V6CA 3MELA 3KBBA 3ET5A 5EG5A 4LY0A 4UU7A 2VXYA 2XWQA 2D06A 4CR6A 1Q2XA 1UMDB 1MGOA 1JQ5A 5JDCC 2GN4A 3OBBA 2VDNB 1US8B 3IILA 5C4GB 2AOUB 5L4SA 4E2FA 1OXSC 5CYFA 3SXJA 1Y3IA 4KBYA 3J80A 3VBCA 421PA 4RMHA 2YVKA 4PR0A 3EDQA 4EO4A 4JX9A 1N7IA 1R0YA 5I9IA 1ZU4A 3QELA 4QUGA 2FCAA 5IBRA 4DGQA 2DLCX 2XUZA 3KZMA 3FCEA 3JQ8A 4RAQA 3GNQA 1NJGA 1G16A 3QITA 3DYIA 4B3SB 2Z3VA 4S05A 4Y9UA 3CZ4A 4M22A 4KHPB 5IN5A 1BE8A 1MUUA 2BMFA 3SSNA 1I5EA 1E60A 1FBNA 4C22A 5DK6A 1HX7A 1G21A 2RIRA 2J5XA 5C8YF 1XDWA 1PJ8A 2D2IA 1AY0A 2CVHA 4YRLA 5E8JA 2VWHA 2C5BA 3OKCA 3PFHA 1DRWA 1J8MF 3OZCA 1TE2A 2ATXA 4MR7B 3ZDEA 2I1LA 4UUNA 4MXDA 4V2UA 1DFHA 1ADCA 1WD5A 5DFAA 4DYVA 4F3KA 3F6SA 5KOJA 4Y9TA 4DDUA 1M2VA 5HF6A 1WXFA 3LLSA 3VU8A 4EL5A 2QTRA 2DHQA 3RAJA 1IQ0A 2QIPA 2PYDA 2V7QD 4N82A 5DBGA 1W34A 3G8CA 4JR0A 3BMCA 3CU5A 3RVKA 1AUOA 5DLQC 4YYZA 4RY0A 1GDTA 2VBCA 3NT2A 2AOVA 2REQB 3BMCB 3I9NA 3L6DA 3SZGA 2ECFA 2IQIA 3TSYA 4D0RA 4JC8A 4DNPA 3NGXA 4ESOA 2CHGA 1Q1NA 2IIQA 3V8NA 2EGGA 3H2JA 5I9NA 3TNDA 5SY9A 2QMQA 3LYHA 3NV7A 3ODGA 5CNIA 1PWHA 1F6BA 3DS8A 2XQJA 1ES9A 3O31A 2I6XA 1NW8A 4B80A 1JX6A 4F6LA 3CKMA 3RC9A 3N58A 3PKJA 3T06B 3ILXA 1QPGA 4EARA 5DOZA 2ZR0A 3U49A 3KCNA 2ZROA 2F3UA 4YT5A 5AVQA 3C6QA 2JARA 5HFJA 1UKAA 5KVQA 4C76A 5IFKA 2YXPX 2P77A 3PC7A 1E79D 3ICWA 1K63A 1WZCA 4WXPA 1RU3A 4GICA 2P2GA 4ZOCA 2YQ5A 2W2XA 5HJEA 2HTFA 1Z4QA 2OHXA 2YW2A 2J4DA 4UAUA 4ZMBA 4BE4A 1ORIA 3GLKA 1ML4A 3JQ8B 1I4EB 3AUFA 1C2TA 1RLJA 3D81A 2PIAA 3IELA 4QA9A 1SXIA 3NBUA 4NXNB 3F49S 1AMUA 1ZH0A 3M34A 2L19A 4LZPA 2C4MA 1U02A 1Z4OA 5C8YA 2YNMC 4AWAA 1OAOC 4J2HA 2H7VA 4MMZB 3UJ6A 3I5YA 5ARCA 3G0OA 2VYVD 1X87A 2GD1O 1CJTC 4DSNA 1KYTA 1V96A 3GFTA 5IAAA 1U2SA 3JYLA 3PIRA 1Q3TA 1N7GA 4KPUB 3BL5A 5EHGA 4C4AA 3K0CA 4CZ2A 5LNK6 1YQQA 4AYXA 3CKKA 3ITEA 3CZPA 2QR5A 3GJXC 1NG9A 3PXBA 3IERA 3A1FA 4LOIA 3KXIA 5CNJA 4E6EA 1WLSA 2VDKB 2VDUE 4HOYA 4BVKA 4OI2A 4OHUA 2D8AA 1I24A 4B31A 1OFTA 3EEYA 5GJVC 3VQTA 2GKSA 2ID7A 3P0RA 3QI2A 3GLSA 4GI1A 2XCOA 1I5OA 2CEAA 2FA9A 1NQ5A 3C85A 3WYAA 3K4QA 1BWSA 1H1LB 3TL3A 1ZNZA 2V7WA 2M1ZA 1N8TA 3GLFE 4HYEA 1E3WB 5TPWB 5A4DA 1ZI9A 3FRIA 1DDOA 4CM9A 4GM4A 3B6EA 5AVZA 1EP2B 3SK0A 1UJ2A 1KGDA 4WCDA 1HT0A 4W5JA 4EW3A 3QEAZ 2GN8A 4N7JA 1IXKA 4DPKA 1KIMA 3OQBA 7GPBA 3MJRA 2YZKA 4S2EA 1B00A 3NTUA 3OTGA 5TLSA 4WOCA 1XUOA 1PSWA 4FW9A 1AE1A 2HRZA 1PFVA 2Q07A 3M8KA 4JL6A 5KJCA 4LN1A 5TXGA 4XM1A 4W5NA 5FTWA 3I9V1 3HKBB 1EINA 4I5GA 4QASA 4RDHA 4H6VA 3L0ZA 4LYHA 1NPTO 5DYNA 1EXMA 3GDGA 1ZK4A 4M7RA 2EKBA 1GL9B 3W8EA 4DOMA 1K92A 2GO7A 3TW4A 4BAUA 5FR2A 5JCPA 4QOIA 4RM2A 4C30A 3AXTA 2IKSA 3GELA 4TPKA 1D04A 1F3OA 2WILA 4QEDA 2EF1A 4QO7A 3RDPA 2VF7A 2Z3ZA 3VU3A 1CUEA 4J0EA 1CY8A 2X23A 4IV5A 4QDJA 1E9DA 1TKRA 1ZM9A 1NW7A 4LBZA 4JNKA 1TIKA 1KS9A 1RWBA 4E5MA 2ZJZA 4AW9A 2OE2A 5H4HA 6CHYA 1SU8A 1EWYA 3B3JA 2BUAA 1CZLA 1LZLA 4B84A 5KYWB 5CLGA 3CEAA 1JPUA 3JQ9A 4HCJA 3RHTA 1OZGA 2QPTA 2Q27A 3HVRA 2C3OA 3NC0C 2DYKA 1E9EA 1XELA 2DF8A 1C4OA 1WG8A 4Z1MD 1CS4C 3E23A 3ZCVA 2J6IA 1P60A 4DXAA 3JVIA 4MUFA 1JVBA 3QWFA 3DBRA 3I5UA 4RENA 3RTCA 3VV2A 4POAA 4RTLA 1EWTA 2G88A 1U6IA 2NMVA 2CBZA 1NF3A 3ADPA 5KWJA 2N3ZA 3PFFA 4KE6A 4GWLA 1NRJB 4QWMA 2L18A 5JJCA 3EVBA 4QGAA 3O0TA 1PGQA 3ADCA 1BWPA 3FOWA 2IXDA 2P67A 3GYGA 4LJ7A 4XJTA 4BMYA 1SUBA 3ORQA 4REMA 4QOHA 3WK6A 1XU7A 4UE2A 3MINA 1ZY2A 1MAHA 1V37A 2OHVA 4ZALA 1FSZA 1OOEA 1YR8A 4J16C 1W5SA 2YN2A 5LXTF 4D6PA 4MI1A 1TADA 3IDSA 4N65A 1QX4A 1S8NA 4NRDA 4ALJA 3T9BA 3P32A 5B7GA 3L1UA 3PU6A 2EW2A 1A7JA 2MWMA 4UNIA 3EZFA 2X77A 1TM2A 3EH1A 1FXUA 4K6MA 1E63A 2ZYUX 3CN9A 1GCAA 1BHO1 3VKHA 1JW9B 4GBED 1JILA 5ELXA 3VISA 3Q6MA 4MV1A 1VL5A 5BQ5A 3WTCA 3PEFA 4EMBA 1WVMA 3QKIA 2ZBPA 1P5HA 1PD0A 4UDXX 1ZGZA 5B1HA 3O95A 3DDUA 4NSNA 1YE3A 3VNUA 3GZ4A 2XY4A 3I9LA 4F86A 1SCBA 2HIAA 3IALA 4R69A 2C4NA 1QH9A 1YZHA 5CRIA 3P45A 1TEVA 2QMEA 1LBSA 1Y80A 2WT8A 4EO7A 5B4UA 2XGJA 4X5OA 5H5JA 4OY3A 4YECA 4U2KA 4F06A 4D96A 1DCFA 1PVVA 1C1XB 3O73A 4KV9A 4ED9A 2ZIUB 2P5UA 4MS4B 5DB4A 4WCFA 2QI9C 2SECE 3TDKA 5BXYA 1RQ7A 1NIPA 1AUPA 3GEEA 3T7SA 4DTIA 4DSAA 1U0BB 2B4KA 4LNUA 3ESZA 1OCEA 3RABA 3C7DB 3PHBE 2UV8A 1M34E 4GNRA 4A8JB 1MT3A 4GOJA 4AX4A 3N76A 5E6UB 3S5JA 1O94A 1VKOA 1R8XA 2WQ6A 3N7AA 4K9MA 1X77A 3K9FC 1QU2A 4CV1A 4R9VA 3TLZA 5KYKA 1PDWA 1VCNA 3F9CA 3R3UA 2H2GA 2X5NA 5JCJA 5ICCA 2IP4A 4ESEA 2FP4B 4RVNA 1HLDA 4YXWA 4XJXA 4A10A 1GXSA 5ALNA 1DIAA 1TCUA 2GM9A 2NSHA 2NZ2A 3RSZA 3GFVA 4BLSA 4LI0A 2H5EA 4W9NA 1XTUA 4BB6A 1PYOA 2NQ8A 3AKDA 4Y2YA 3ZWOA 1DMSA 3FE2A 1P2BA 2I66A 1LI4A 2P78A 3B60A 2PRKA 4WLOA 1A5ZA 1DAGA 1Q1BA 5GONA 5F7OA 5L3SB 4L3WA 4BUZA 3N86A 5C7LO 1S1CA 1Q77A 2XA9A 3OZ7A 4MAFA 3SQDA 3L0IB 4IS2A 2IIPA 4RMIA 2WV9A 4RJLA 5B6JA 3P9RA 4UATA 4GEKA 4RTMA 4ZOLA 2QX9A 1GNQA 3WVNA 4AUEA 2FQQA 4EVSA 4EGQA 1RAFA 4FYPA 4H08A 4JUFA 2QRHA 1U8TA 3A6ZA 5FPTA 1W5AA 3UAZA 2PR2A 1MH1A 3GVIA 2P3LA 4AM8A 4DWOA 4F2HA 1BXGB 1DBSA 4Y0VA 4A2PA 4ALLA 1GTSA 3DDZX 3FF4A 1AZWA 5G3ZA 5TQ2B 2AC2A 1T15A 1IHPA 4WK6A 4XB2A 4AG5A 2QTBA 4QSMA 3LUJA 3PDIA 4FIDA 5D87A 3PVCA 3H0CA 3GEMA 4I4TA 2OZKA 4I3HA 1G66A 2F3PA 1KI9A 2HDWA 1YMQA 4K3VA 3BX1A 4WAUA 4FFVA 5HRCA 1VSTA 3DMPA 3I6MA 3P9NA 5FI3A 2NUBA 1ULHA 3O9ZA 3QU4A 4N3CA 3VBEA 4BVEA 3KQSA 3BHIA 4QBTA 4Q1AA 1A4XA 4Q6WA 4R54A 4B48A 2WNSA 3P8ZA 3W5UA 4R98A 3KWLA 1ONNA 4BNYA 4TQAA 3FR7A 1ZLXA 2NO5A 3FPKA 1KRXA 2YJ5A 3X3HA 1BDJA 4ARBA 4C6HA 4XQGA 4JBHA 4X41A 4B3TB 4X62B 1LQUA 3L79A 1LPNA 1G38A 2J45A 3HSYA 4FHFA 4LYGA 3CMMA 3QP9A 3T7CA 4BJ6A 2AZTA 3CX6A 2RHRA 5BV2P 3C1UA 4L9AA 2EXXA 1VPLA 3T9DA 1PWEA 2O2CA 4D5EA 3GNSA 3KOZA 1CJMA 4BNXA 2IHUA 1UXJA 4JNCA 4KIUA 1QQAA 1XV5A 2BCGY 2NYUA 1RQXA 3PEUA 3N8DA 1KYQA 4FFWA 3USCS 3KKOA 3WLJA 3L6OO 4D3DA 1C1DB 3RSSA 1P2GA 4Q1BA 4M7OA 3U7QA 1A7AA 1K7EB 2LXNA 3DDHA 2CL6X 3BB4A 1ZMBA 3CVWA 1WKBA 5A9TA 2IUUA 2WUFA 3GY0A 4ZOQI 1ZPDA 4HB0A 4JQOA 5GZ1A 1CUCA 5HS6A 3BB1A 3FTQA 3PXXA 2I99A 2QAGA 4MVWA 2KSQA 2OXEA 2J31A 3E9DA 1HDOA 1JQEA 3QVVA 1T1JA 1I01A 1A72A 2D1YA 3K9NA 4MVJI 1Y3BE 1PEAA 4W7IA 1ICEA 1OU0A 1P4JA 1OI2A 4PZCA 2UXCB 3MYRA 2I7VA 1TJ5A 1KZ7B 4C05A 2MYNA 3T7EA 2BMEA 3V2HA 1NRIA 3BJEA 3HXPA 3B82A 1A96A 2IW3A 4WZBA 4RWZA 3F0TA 2WPDD 3QUBA 3FOFC 4KPEC 2O8NA 4KR2A 1E7MA 1EK6A 3V4PB 2X1LA 4EYEA 4DVGA 3DL7A 1N2OA 2BM1A 2H54A 1T3SA 1AGYA 3NOXA 1A9YA 4DRXA 4YT8A 5JC8A 4EELA 1G2IA 4JB8A 4GZLA 4JBLA 2PWZA 3BDIA 1GZDA 1H6DA 1IM5A 1WSBA 3N2KB 3OJCA 4EHLA 1G9SA 1H8HD 3LVRE 3ZVNA 2AIRA 2C99A 4EG3A 4IJ6A 2Q5FA 2Q4DA 1FMFA 1EP1B 4FEYA 1VCIA 3TD6A 3AUSA 1XQWA 3D6AA 4QYSA 3LPLA 2ZLBA 4NYJR 5P8WA 2HQ1A 3W2EA 2HRDA 2VRWA 1N92A 3H83A 4Q21A 3O4HA 3HFRA 3PGA1 4NMLA 2YOGA 3WJ2A 4JP2A 2Y1WA 2YUIA 3WGVA 1C0LA 1FMJA 2HW8A 2JD1A 2NZJA 4JXKA 3BMQA 1G20B 3T12A 2YVUA 4XIFA 5E4JA 4IQ8A 3CPJB 1DTWB 2Y27A 3F5SA 3ICPA 1E2KA 1RLTA 3AIKA 2HK6A 4GSYA 4A5SA 4B71A 5B3JC 5JJIA 2GAFA 1BVHA 3L0OA 1SUCA 2Z83A 3AR8A 4P0TA 1F8FA 5DCLA 1WB9A 1DCMA 1X7XB 2ZYAA 1MLDA 4MITA 1EFVB 2H9YA 2HDNB 1NVVQ 3MAJA 1FJGB 3CUEF 3PCRB 1EXVA 3ECCA 4K05A 2ZUTA 5LMCA 1LDMA 2WW8A 2JGJA 4NARA 3BXHA 3ANMA 3CZ9A 3PC2A 3ASUA 3N0VA 5IABA 2PH3A 2BJWA 2FPRA 2GTPA 1XALA 1YH3A 5AOCA 1ST3A 1VYUA 1GOTA 2HJ9A 2VQ3A 2AN5A 3ZHZA 5JQGB 5BT8A 2AN4A 3ONNA 2RGYA 3Q7SA 4AZVA 4XFDA 2ZJ5A 1RYFA 3NHLA 4W7HA 4DJJA 5FBQB 5K0FA 4G9BA 4GE3A 1AKYA 2EG5A 4N3GA 3MWFA 5EMLA 2FGJA 3KWFA 4K6FA 3RC7A 4D5GA 3JAWB 5IH3A 3PE6A 3EZNA 1ZONA 2ZUBA 3EMKA 4G4IA 5GZ6A 3ZV6A 3HGMA 4EKDA 4P7FA 4RV4A 3FCYA 3GGCA 4JI8B 4ZI5A 5JJLA 3F6YA 3OP1A 2CVFA 4GUAA 2DKOA 4HN9A 3KE9A 1HXHA 2IODA 3D8SA 4FT2A 1QJCA 4I1RA 2W42A 1TCVA 1L3IA 1QKKA 2XZPA 4EK9A 4GZ3A 3W0LB 1XNHA 3GMDA 3ISJA 1Y8ZA 4TM7A 1A97A 3C6BA 1U0RA 2B92A 2V3VA 3GPIA 1DFIA 2IUFA 2XCQA 3GCZA 1BCSB 4KKVA 4N8EA 5G53C 1P1JA 4BN5A 5U4XA 4CDGA 1KI2A 1XDBA 2WZQA 4IIFA 5ICFA 3TO5A 4KR9A 2H59A 3WBKA 5ICMA 3NASA 1CUSA 4YJ2F 2Y9PB 4JC0A 1P7ZA 5K0TA 1XPOA 2B5OA 4LYJA 1TKCA 1KMQA 5DHSA 4NECA 4XWYA 3H5AA 1PZFA 4MIOA 1GQQA 2HBZA 3CZ5A 2SCUA 1ZK0A 4TSRA 3GRYA 2CN1A 3HYLA 2A84A 4H27A 2C98A 4X91A 4P33A 5LA6F 5LOVA 1RM4A 4R8VA 5DM1A 4BQSA 1ZCBA 2GN9A 2XEXA 3H9BA 2IYFA 3NHZA 2X2EA 3JQGB 1ZUD1 2R60A 3AP2A 3E5MA 3QUCA 4II2A 3OX4A 3SZMA 3ZTWA 1XL0A 4BQIA 1P44A 3WGUA 3IP3A 4EB6B 1JYSA 4PZDA 3R5KA 3U5TA 3ND8A 3PNLA 3JZFA 1N2ZA 4XXHA 3TLGB 1GAQA 5BN3A 5DM60 2IXAA 3HU1A 4HX9A 1WCXA 2JJ1D 4XIJA 2K4MA 3WKBA 2D7JA 5FUQA 1PR4A 3LV8A 1A77A 4L7VA 2ZP1A 4BMXA 1VDZA 2GJ4A 3ESDA 5EERA 1GAJA 1FP4B 1D6JA 2B30A 3BVPA 4G0QA 2EOAA 3QY0A 1WXXA 1W7AA 3N8NA 1U81A 2CJPA 2XKJE 5ICGA 2JG3A 3TQTA 3ZV5A 4E51A 2DFTA 3DCIA 3IX7A 3MT7A 3R6DA 4ZZ2A 1XKQA 4H7IA 2OPBA 3TRJA 3NYQA 4PAQA 5BV1A 5K9ZA 2IYUA 4AULA 2JH3A 4XSHA 5EJ5A 4ZYYA 4GM0A 3ET4A 2R5FA 1UQTA 3ZWQA 1LNQA 5T3UA 2WM9B 2ZJ7A 4AXBA 3I3SR 5DHFA 2IHTA 2R4UA 4B4WA 1EM6A 1UKBA 3GDWA 1A8HA 2BOVA 2FFQA 2TRSB 2XGMA 2FR0A 3EASA 3U7EB 4EJ6A 1W2GA 4HH4A 4RVHA 1ZN9A 4Q24A 1ULUA 2QAGC 2GPWA 1FFWA 2FG6C 3PLNA 2AQKA 4PSAA 4E4TA 1N2BA 1J06A 2GFQA 4LVOA 1AZLA 2G1UA 2I2BA 4Q5IA 3HP1A 4BQQA 4JT4A 5BOSB 1T0UA 1EXWA 3X1ZA 1I2ZA 3GT0A 3HR8A 4PGMA 3C2QA 5J5VA 5C3UA 3NKLA 2BDUA 2OQIA 2CWDA 3OICA 4OKIA 5BSUA 3H6HA 3NC1C 2BHLA 2G7MC 4MHOA 5CHEA 4ZQEA 3RF7A 5FOWA 5AUOB 3CR8A 4Z4CA 4KQIA 1T8YA 1T0IA 2GK4A 3TSZA 4AU1A 2QJOA 1PFUA 3V1NA 1GU1A 3HDHA 3KTAA 3KJGA 3QVGA 4J0IA 4WZAB 2YQZA 3LOUA 4YJKA 3ELDA 4CIWA 1MHTA 1KI4A 2DJ5A 5CGZA 2YUTA 3CBQA 1DO2A 1JJ7A 2JK1A 1DQYA 1FRZA 1F2VA 4YJGB 4DQDA 1U0SY 1M0WA 5L3ZA 5KINB 1K66A 4GKKB 2YFYA 1M8GA 3QMMA 1W0KD 3EVDA 2B1JA 1KAMA 5HZMA 1OAKA 2BJHA 1W0CA 1E0SA 3N6VA 5LQMA 3WK9A 1QZ3A 2OXFA 3LK7A 2P8SA 1EK1A 1R8SA 1Z82A 2NAPA 3QV1A 1QOPB 1I4WA 4KHZA 4PANA 3T3NA 5AKIA 2QD3A 4JYCA 1M2VB 4G1EB 5CM9C 1XPJA 1XZKA 4RY2A 3GQBB 4EKNB 3ZHUA 2AFIE 1SHKA 2DHEA 2GA8A 3C5CA 3DKRA 1IVYA 4N0MA 1MC1A 1GN9A 2HCRA 4FC6A 5FB3A 3H5IA 3C5WP 1DFGA 3BE6A 2O8CA 3T3IA 2CFSA 2WZDA 3H19A 4LMPA 5CTAA 4INOA 5A5FA 3EWSA 1OWOA 4IDNA 3SOPA 5CR9A 4QXRA 4KQWA 3WLAA 1ZOSA 3LT0A 4RK7A 4U6SA 2FDRA 3L06A 5H0IA 1UDCA 1DEKA 2BL4A 3TFWA 3AWDA 3W5IA 5GMOA 4H1WA 1QQ6A 3OWOA 1CRWG 5ALEA 3AFHA 3GA7A 3C3MA 5FTMA 1K7CA 4JBIA 3RBVA 5AW1A 4XTCS 2GWRA 1US8A 3GT3A 1YS9A 5DYTA 4Z0HO 1YI8A 4TRNA 3QH4A 1H6CA 3AHGA 3G5UA 5THKA 4XE5A 3PT9A 2BUCA 4N7MA 4INJA 1L9XA 4KOEC 3S99A 1G8JA 1WHSA 4YB8A 1FU8A 1NRXA 3HA7A 3PPIA 3NFYA 2OSBA 1NX9A 3KR2A 2QGNA 1KC1A 3A0RB 1U0LA 3OEHA 3QLEA 3EXEA 3GEIA 4B45A 3RRNA 1U9JA 2DLDA 1LVGA 3KWMA 3IKLA 2YZNA 4LYYA 1VMEA 2CJXA 1H8EA 1OBFO 1X7YB 2CNLA 4YAFA 2IYXA 5BSFA 4GDFA 2YJ6A 4PO9A 2XAAA 4PGFA 4DUGA 1ORDA 3B38A 1OT3A 4GI2A 2P75A 3Q2OA 2ZKLA 2IYNA 3A1CA 2NXCA 3GH3A 4QBHA 1KO5A 1TW3A 2VCHA 2B1GA 4GH5A 4LE0A 4J3NA 3VU9A 1E4VA 1EK5A 3KZXA 5LB2A 4PYJA 3KZNA 3LGSA 2VAVA 5F64A 1AF4A 2V97A 2ZCUA 2N47A 1Y42X 2PX5A 2A4KA 1T4BA 2VPWA 4IF4A 4PINA 2NTNA 1IAQA 2AJTA 1JAHA 2H4ZA 3CF4A 5EKTA 5JLJA 5KOJB 1ZCJA 1JIIA 1PR0A 3S2YA 4YCDA 2G77B 1MPTA 1XWWA 1AF7A 1J2JA 2BFDA 5E7IA 5TS3A 4EBFA 5HTOA 3UMGA 3U4AA 1GZSA 5FCDA 2H1LA 2QLTA 1UBSB 1L7AA 2R1VB 2VJNA 1J5XA 3S8YA 1WTAA 1UKZA 2I7XA 2Q1UA 2I65A 1R37A 3V4ZA 3ZXXA 3GLVA 5B2EA 4ZU1X 3W5SA 2COUA 2DPYA 1V3VA 1IOZA 5TS2A 3FNHA 2XHEA 4X3PA 2A94A 2FPGA 2HA3A 3WNQA 2ZIFA 5JBIA 3GCGA 4I9GA 3OE5A 4IDEA 3SG0A 3ZGYA 5TEVA 3UWDA 3R3WA 2I9KA 3QW4B 4LBWA 5CPBA 4ZCQA 2F59A 3QA3E 3QMVA 4H0CA 3WMWA 4DZZA 1T1IA 2IEYA 2J5QA 1YBHA 4RZSA 1RJFA 3P2OA 1TI7A 3G9TA 4C08A 1RTKA 1JE1A 1JSXA 2C5FA 4P7GA 3C39A 4AJIA 5KNBD 5EJ7A 2OORC 4RPLA 4HJXA 2NXNA 4ND8A 4LSGA 5AJTA 4M1WA 1OI4A 2GT1A 4G26A 2JASA 4GP6A 5FWAA 5KTTA 1GCGA 3IPYA 5BORA 3LA8A 3FJOA 3C3DA 4XGNA 1LA2A 2P2NA 1NAHA 3AY0A 2XB8A 3FG9A 4IGEA 4RPGA 4DNFA 1L8OA 1KDYA 4D7AA 1NVFA 1SGWA 2AS0A 2ZRCA 4H7EA 3WSVA 4QYIB 1KPGA 3DDWA 1C9EA 4GI3A 5CNKA 3G5MA 2PUBA 2Y4NA 1RABA 3KC2A 2ZSHA 4F56A 1HUQA 3I9MA 4QXAA 4QYIA 4I08A 4DPMA 4ETWA 1PQPA 1I4OA 1NSTA 1Q57A 2A8YA 5CA0A 5DM2A 4R2LA 3CHYA 1I6MA 1SKMA 4PSUA 4RBNA 4WLNA 5EN4A 2WU0A 4RNDB 2FSVC 2B2CA 3A2NA 5TDHA 4F4HA 2QTFA 3H9GA 3T9EA 1CUHA 1MO5A 2OTCA 1E1QD 4UPEA 3WGZA 1E5QA 3HCDA 4MCIA 4DLKA 4PHGA 5KYTA 3L5OA 3OTHA 2WHRA 3FWPA 3WFZA 3C3JA 4RZ2A 1N1EA 3RUHA 4ZGBA 1OKKA 1XGKA 4EZEA 4KXQA 5CX1A 4QGHA 5EHZA 2VP0A 1R0LA 1VLHA 3A6HA 1SOWA 5K6AC 1H1LA 2XD4A 1N2GA 2H4FA 2HR1A 2HA2A 4IF6A 1WOMA 1KC3A 2DRIA 3A3PA 3ZH2A 1S9DA 1KAGA 1CKEA 4XVRA 1HSOA 1TM4E 4A16A 3WSTA 2ZI6A 5JC1A 1ANKA 3HBLA 3E9ZA 3UB3A 3H86A 1V4VA 1HWYA 4G0UA 1M2OB 1OWNA 1G8PA 1FDWA 4G0YA 4UBJA 3GLRA 4BNTA 4HY3A 2IWHA 5C1BA 4A8TA 1VB5A 1OLOA 1NUSA 3Q15C 3F5DA 3TX2A 4RMNA 2Z9CA 5EGNA 4RTKA 2MYPA 5T4HA 4L0DA 3INRA 3BOSA 1Q6ZA 1GSOA 5IP5A 1R66A 4ZYTA 2VYQA 2XGOA 2DUNA 4E5SA 3KO8A 4YS6A 1EPUA 2NN3C 1MAVA 2OHOA 3BE8A 2N75A 1CUYA 2WAOA 3P9YA 4JYZA 4ZODA 3ZS8A 2FZ4A 2XT6A 1EE2A 3EIXA 2IYOA 3MCUA 1G18A 1RAIA 2BEKA 3R3SA 1AJEA 2RMKA 5AHRA 4FFOA 3HU2A 4EY3A 3PGLA 2VDMB 5B58C 1ZISA 1Z5WA 3I34X 1P2TA 2AG6A 1K3UB 4OHVA 5HJ2A 1N6RA 3W6ZA 4DA6A 3E3LA 4OLBA 1G8GA 4XDYA 4DQKA 1NU8A 3RROA 1O5OA 4NL4H 3D2BA 1MN6A 3FDZB 3ZHBA 1D5CA 1PE0A 4HUJA 4C0BA 2YFQA 3RR2A 2BTOA 5A3JA 1KSJA 4CODB 4OVKA 2QMZA 4O4LF 4URXR 2P6NA 3G02A 1WDKA 4IQ0A 3WRWA 4E5VA 2FU5C 3LPMA 5B5SA 3SBXA 3KSUA 3VOTA 4XQEA 2EERA 1QPBA 3EGXB 2OAP1 2REXB 2C2KA 3VC7A 1QX3A 1K27A 4BLUA 2YV2A 4UU1A 4ZYLA 1M8PA 3L6RA 4M9UA 3LP8A 5E0KB 5EHIA 1YHNA 1K98A 2ZREA 5CA1F 2DJIA 3TDNA 2G9NA 2GBFA 5FOXA 3OZWA 2PUJA 2C9ZA 1ZGGA 4ZT5A 4KNYA 5HE9A 1MKYA 1H5UA 1EFUA 1SRRA 3QFSA 4YO7A 4CKEA 1KARA 5KHOC 2CMFA 2OGUA 4EQ6B 2OAEA 4J0HA 3ISVA 5KQGA 1TK9A 2W2MA 1R0XA 4KPFC 3LXMA 2JFZA 3CLTC 1TF5A 2WSSA 3ESXA 3KKKA 1QFZA 1WY7A 4NTZA 4DADA 1X1DA 4MH0R 2UYHA 1EI9A 3PRJA 5JCZA 2APJA 1Z8HA 3FRHA 2ZSBA 4O1IA 2OYRA 2KBFA 3CRNA 3A6GA 3FDIA 4LYDA 4JLMA 5EXSA 2H0AA 2XDQA 1BG6A 2Q4BA 2VCEA 3MCWA 4Q4JB 1DMRA 3K5PA 3GDFA 1F0YA 3BD6A 3WLOA 2FWIA 3WKCA 4BLRA 1CQXA 2XOXA 3QK7A 4R9UC 4IVQA 1YZUA 3EBLA 4JROA 1XCGB 4P08A 4R2WA 4XYEA 5G4KA 2BEWB 5AXDA 1DRUA 1P6UA 5EPOA 1YUBA 5I01A 1XHFA 1QAOA 4QYTA 2FSIA 3EULA 3N8GA 2PZAA 5I7HA 5J2TA 2WUWE 1U3WA 1YJXA 1E0KA 4LIPD 3EQ9A 4DWJA 1GTL1 1A95A 2VF8A 3BBPA 3WIUA 6AT1A 3PE3A 1QV6A 3DMRA 1IY9A 4KL8S 1Y7TA 3IR5A 3PDIB 2QTVB 4F9EA 4HATA 3KYDA 4HH3C 4PRZA 4TXJA 1QH0A 4PZEA 1TQHA 4WWHA 4A6DA 5TQ2A 4B33A 4UAGA 1HNXB 2XYRA 2E5LB 2XKAA 1I7PA 3LT4A 4HZUA 1DOZA 4NXMB 3BS4A 1T5IA 2H5LA 2PSFA 4XW2A 3OLQA 5G0UA 5HQJA 3AI7A 1SBNE 4ZEXA 4ZQHA 3EA0A 1DC3A 1K6MA 1CUZA 1JKFA 1E7SA 2L42A 3R3VA 4MW6A 5DBIA 2VN8A 4U3JB 5G0VA 4C6SA 4RD6A 3IP6A 3A2MA 3PR3A 4UEWA 5FEMA 2SKEA 5TGTA 1NNLA 5DGXA 4JJ7A 1QF6A 1SN7A 5EXEA 1HQDA 3WLTA 3I2IA 3SE0A 3OE7D 4MZDA 3DW1X 3K35A 3S40A 2ODQA 4Y2PA 3RIYA 3AOGA 4JI3B 1O6CA 3E4CA 1BH2A 4M89A 3ZHQA 1D8TA 4WZAE 3JQAD 1JPNA 1LS6A 3JD1A 1S3IA 3TR0A 1BCRB 4MUKA 4NBWA 5EHNA 5JCOC 2G4LA 2NZ8A 3AKEA 3ITKA 3L1HA 1T9HA 3T5DA 2O5CA 3FSGA 4CWAA 2AN9A 2ERYA 2I6QA 3PXCX 4L7QA 4TTTS 2FP4A 1ENYA 2ZUUA 2VWQA 3FETA 1D2CA 3U31A 4LUCA 3TOSA 4M7WA 3HB0A 1DJPA 5FH9A 5IF9A 2FN4A 3NAZA 4BEJA 5F4ZA 1EQUA 1FNSA 1DI0A 1EM8B 1SVKA 3C7KA 1RSZA 1HDIA 4PCAA 1YUNA 2XGSA 4MS3A 5I7FA 5JADA 2FEWB 1DPFA 2O1WA 4BKQA 1TYAE 5EA2A 5K0SA 4F4JA 4OIFA 2A9RA 2BZ0A 2ZRMA 1TZJA 3HJBA 4FGSA 1DVRA 2QR2A 2HCJB 2FSPA 3L4EA 2YIVX 2B2XA 2O3JA 3THWA 3TI9A 3CUSA 3LCRA 4QJ5A 4GP9A 4D9MA 1VYHA 5EAIA 1ZNQO 2B82A 4O4IF 4RV5A 5J2TF 3KU1A 4Q19A 4KEAA 3RJTA 2NX2A 2YDXA 1MB2A 3TKAA 3WL6A 3LCJA 4ONEA 2HXGA 1C8BA 2H1OA 3ENZA 2A35A 4B9AA 1Y9AA 5AI9A 1SQ6A 3E3MA 1YULA 4OKNA 3G82C 1JGTA 3LQ1A 4OFBA 5HOQA 2FLWA 3PC3A 4PX5A 2FCRA 5TEWA 5GAJA 4QVKA 3V9PA 2JCVA 1AQUA 3A27A 3MJSA 4XIGS 1BTOA 1QYDA 3I6IA 1KI8A 3OM0A 1UT8A 1BN6A 3JVUA 5FAXA 3ICQB 3PFCA 1XMPA 2RBKA 2Y0DA 2P3SA 5A9RA 1PYDA 4AKSA 4ZP1A 4RNCA 1TAQA 5BUSA 4Y0NA 1YNSA 5I7UA 1B6TA 3AEQA 2XMQA 3EC7A 5T7BA 3FMGA 3PHCA 5IUKC 4KXLA 4Z3KA 2QB5A 5LM3A 1X1EA 3VO9A 4IFTA 3LHSA 3N07A 4EZBA 1SIUA 1PTJC 3SR0A 1HETA 3C3BA 3DV0B 2Y0EA 1J33A 5EHQA 4P1ZA 5K8CA 1TO6A 5AK4A 1WQ3A 1JIKA 1VBMA 1NI3A 2R4TA 4K9PA 4RDIA 4F92B 3C3XA 3P26A 5FPKA 1QOZA 2Z09A 1G8AA 2GZRA 1Q0ZA 1IRXA 2IGBA 2OENG 3FTCA 5IZCA 1WUIS 1FU4A 4P3KA 2FZKA 4YIKA 1XKLA 1A3CA 4Q3DA 3VR2D 4ZI7F 3HVKA 4C3ZA 1X7XA 2QVYX 1EBUA 1NP3A 2WJ4A 3U7QB 4KO3S 4CTJA 1WQ1R 3R7FA 2GILA 3M3HA 4WFJA 3N9IA 3LX5A 4MWOA 2POCA 4C7OA 4XIIA 1P1RA 3WK4A 4YAUA 1YQGA 3M4YA 3N70A 3TW8A 4DHWA 2CUZA 1PL0A 4P32A 4OSOA 1LPAB 2QN6A 3GZNB 5LQJA 2RE8A 5A0TA 5L4LA 2CDCA 2FSHA 3LYAA 4W4TA 3R44A 5JWRA 5CYOA 3IA2A 3MAAC 1THZA 2VYNA 3RF6A 4IUCS 1P75A 5HVNA 3LF1A 5F3WB 3PGMA 3A8TA 4XI9A 3DP9A 3EEFA 5IKPA 2O2ZA 4GLOA 5BRAA 2VHJA 4WY2A 5I8ZA 1JLLA 2GPNA 3UMRA 4BNUA 4Q47A 1XJCA 3ROMA 3QU9A 4QPDA 3SLGA 5CFRA 5JS6A 1XCLA 3QVTA 2IU0A 1MP0A 1RCUA 4CT5A 1J90A 4MRRA 2EW1A 3TX6A 4GZ6A 3RS7A 2D54A 1WW2A 4IDQA 4P5PA 5AHXA 1AK9A 1R9JA 1T6ZA 2GPJA 3BJRA 5HCIA 5M5BA 1JBKA 2LKCA 3JQQA 4YQYA 5JFGA 3U7GA 1I30A 3SNHA 2I3DA 2FMFA 5IFLA 1WAMA 2VH1A 3GK3A 4RHCA 1GPYA 2RHBA 3IBTA 5J2UB 3VHQA 3L6CA 4AKEA 1GA1A 5KNBH 1GNPA 4WGGA 3ZWMA 5LMNB 2QRVA 2XB6A 1EWVA 1OZAA 1R7RA 3D8NA 1E3DA 1TZCA 4ECAA 4E5KA 2F3RA 1ZJYA 1ZGCA 1N6IA 2XUKA 4C0HA 1N9GB 3H2SA 1IVSA 3GN1A 2BLLA 3CJQA 1GRQA 3KUXA 2O0LA 3LT1A 4INZA 4J0DA 4TQ9A 2HMAA 1R6XA 3JARA 4M9CA 1ZL2A 4J0QA 4LWPA 1FDVA 3VU1A 5I9BA 1SG9A 2QNIA 4KSYA 3WQQA 4B34A 4EKGA 3GRKA 3KZKA 5A5GA 3ZQUA 1CQWA 2C0QA 1CUXA 2AKEA 3O9VA 2AUTA 2HK9A 2VYVA 5HUJA 1G98A 3HB5X 5C31A 1C7IA 3IA7A 4HKTA 4KBFA 2QPLA 4MR9A 1WPRA 4WOBA 2UUPA 1JA1A 3WWOA 3DA8A 4HAXA 3R7SA 5A5DA 2HA6A 4OHMA 1FTQA 3EPLA 3MZ0A 4ID3A 4E4YA 2IL1A 3H9CA 2V03A 1U5BB 3HLKA 3RT9A 2HU2A 2YVQA 1KOJA 3PITA 1U7DA 3AWIA 4PZAA 4O8ZA 3PXGA 3OT4A 3PFGA 2HMTA 1QAQA 3TBHA 3UF0A 2VTBB 5AM1A 1H3EA 2J0UB 2Z4TA 3EDRA 5BUZA 1O8BA 1J00A 5AW8A 2XCRB 3AM5A 3NUGA 1KY3A 1R8YA 5ALGA 1RCTE 2IKQA 3FUWA 3H11B 3PWSA 5TJHA 1M2WA 3IPCA 1I7LA 3E1SA 1Z6QA 2IOYA 4HRVA 4UBNA 1Q1QA 2BP7A 4WUVA 2ZETA 4D26A 4N47A 5I5EA 4RK1A 3NTOA 1JSLA 2XX3A 4U9UA 1GL7A 2IQ5A 1D2HA 3H1FA 2PWPA 3K31A 4PSKA 1MW9X 1U2DC 4XDZA 5DBOA 1PG5A 3SQNA 3GG2A 2C88A 3WLMA 1B8UA 4JP8A 1U6JA 4W9MC 2NW6A 4H77A 1Q7BA 3BXGA 3GUZA 5H70A 1Z6TA 3DHYA 3M33A 4W5OA 1WBDA 4PPQA 5LDGA 3D31A 5BVGA 5AM0A 3COWA 5BXQC 1ZS9A 5EKXA 3K0FB 3FPEA 5ALZA 4KB5A 1KH1A 2UYOA 4KI0A 4TUYB 3GFSA 4U7GA 4JC5A 4XRGA 3DDSA 1NL3A 1XEXB 4NBLA 4YMWA 5H16A 2BM0A 2J3MA 4EPXA 1TYZA 2ODEA 3T1VA 2O4CA 2A9OA 3WK5A 4B3DA 2VA8A 1Z2PX 5BV0A 3UJ3X 5T6BA 1NXSA 2GAIA 3FFAA 3OF5A 3GO4A 4I55A 2D4HA 1EA7A 3GGPA 1XAGA 3FTFA 1WABA 1H1TA 3PKIA 4ZXFA 5AKEA 2AK2A 1CUFA 1ULSA 3IOMA 5ADWA 3KDPA 4DC1A 3A04A 2HU5A 5CIWA 4BNWA 3A4MA 1NF9A 4MW7A 3BKWA 2P5SA 4UXJA 1T34A 3MFQA 1MC4A 1H6BA 1IU9A 1B1AA 1MDFA 1RJGA 4MUGA 4RHEA 3PICA 2ZTHA 1NUUA 2AC7A 1U80A 3VYTB 2AZ4A 3WWDA 3ZWVA 1OBHA 2CLMB 3TIGA 1O0CA 1XP5A 1QV7A 1L4YA 2F1HA 5FADA 5KSOA 2IY7A 4Z54A 1FUEA 4AS3A 5LNK1 3FZNA 3A9RA 1F0PA 2O05A 3AM3A 4Q9KA 4QJBA 4AMVA 5BQXA 3R0IA 5KNCA 1DAFA 5BWNA 1MTOA 5CDGA 5KPDA 1XL1A 2ACVA 2CD9A 1EVJA 3WL3A 5AESA 5BMOA 4NQZA 5ER6A 1RWQA 3FUVA 3KPVA 3KYBA 1NW4A 3ZDZB 1JJAA 4EJSC 4AN1A 2PKEA 2YOHA 5CJJA 1B42A 2YJGA 1I2DA 2ONKA 1ML3A 3VUEA 3ZDRA 4QUDA 3LL4A 5KNCH 3DF9A 4JEMA 5A2GA 4GXNA 4ZWNA 5KCZA 2IXBA 3UGJA 1GGEA 4KMRA 3AX6A 3EYWA 4N12A 5IBPA 5FFMA 4ZXPA 5TSDA 2C07A 5L6MB 4KR6A 1YJAA 2O2IA 1UPTA 4CKBA 2IELA 1X92A 3T5AA 1QZUA 3P2EA 4WQMA 2PWAA 4PVCA 4PLZA 2Z2KA 4GGPA 1M1NB 2GN1A 3DNPA 4HPJB 3W4JA 3SS7X 1YDWA 1TMKA 3PX3A 1D6SA 1H2AS 1PT5A 4IBOA 4HUQB 1KYWA 1U4NA 1GGVA 3ZCTA 4CG0A 5LVAA 3X1JA 4XYLA 5HZHA 1XPUA 3FMIA 1NUAA 3ZVLA 4A0GA 3IPAA 3P7MA 3FYTA 3AVTA 4PYLA 3AJAA 9ABPA 3HN7A 3ZV4A 1SCUA 1QYRA 2JLXA 3IQIX 2PBZA 3GR6A 5GGYA 1LGYA 2VDWB 1TA9A 4FNOA 3T1NA 4UJ5A 3A10A 1RJEA 2ID8A 1U99A 3MIIA 3U9SA 1PQUA 1K4MA 2C0CA 2O2SA 1YKSA 3LYLA 5FBLB 3FVWA 4DMHA 4EPTA 1EEXB 4B87A 3CUUA 4URUR 4Q7MB 4S24A 2QKYA 1R4ZA 3G9QA 2C2XA 3ROQA 4WUTA 3O26A 2EFCB 2IXTA 4QTYA 3DF7A 2O3TA 3LF2A 2B34A 1F3LA 1B74A 2VHYA 2VNHA 4ITUA 3AETA 5ARBA 3T5CA 3P9SA 4B9EA 1CNEA 2A58A 1G8FA 2PVSA 2VHZA 3NW9A 5SZHB 2XUIA 3I28A 2OZLA 4N0PA 3HU5A 3NBZC 1TIPA 4OHXA 2GAAA 1II0A 3PQFA 3H0EA 4NYMR 2OYCA 1XRJA 4DC0A 3V1UA 4C29A 5IXSA 3FTDA 2CB9A 3KZ1E 3RQSA 4MGEA 4M8LA 3LAWA 4P82A 4ADSG 4RMGA 4AJ1A 2X8LA 2GTIA 1P33A 3HN6A 2WF9A 2F8SA 3BWEA 3TLJA 3LU1A 3KQOA 1YVPA 1HK7A 1GEGA 4WACA 1Z8FA 2J0SA 4GSKA 1Y6QA 4WEQA 1Z0FA 5KVSA 4QARA 3N05A 2A1TS 4ND8B 1N2SA 3GF4A 3IIEA 2ZM5A 4E7PA 5BSMA 1WHSB 4L75A 3GBVA 4FJ2A 3LVQE 1F5SA 2ZIWB 3WY9A 2FGKA 2QP9X 1F51E 2Z5VA 4X92A 3KCQA 3NLLA 1E1YA 3DOEA 1MIHA 1R5NA 3FWKA 4R1NA 5DX1A 1E32A 1WXQA 2ZKIA 2QM3A 5C81A 4Q3NA 3GQVA 1XTZA 2WD7B 4E5UA 4DBLC 5KTMA 2P2YA 1WSAA 1C7EA 3WR5A 3TAXA 1LNZA 4G56A 4NOKA 4P80A 1WZIA 2VUUA 4PYIA 1DX6A 5IS2A 1H0SA 4GD3Q 3K0BA 4KMMA 4XZ3A 4Z3DA 5EWJA 2PXAA 4OP1A 4J3FA 3EVEA 1GGHA 3THRA 3TR5A 3ENNA 4IINA 5A62A 5JSKA 4W1RA 5DBEX 1QYIA 4IJVA 1NY6A 3R7AA 1PR5A 1NLYA 3RVRA 3N3BC 4P53A 2JFQA 4CM8B 3A4IA 4H1UA 4B40A 2PK3A 2X2PA 3HNPA 4NYIQ 4WD3A 1ISFA 2QZ9A 2W2KA 3BH6A 4RETA 2F1KA 4I66A 4RFSB 2BFDB 4LZJA 1OROA 4DIBA 1YI1A 4DE5A 2XWBF 1FNDA 4CLXA 3L0CA 1AG9A 1G6OA 1OA0A 1U2TA 4R83A 3FNFA 1NQAO 4UNRA 1O0BA 2QXUA 3UMCA 2O2YA 1U65A 3V4VB 3EHEA 3HLTA 2DGDA 2X3YA 1TT5B 4BZWA 1VLZA 3CLSC 3RVMA 1O89A 1CY7A 1XRPA 2BZSA 2E4AA 4GYYA 4B1FA 4HDOB 3GLIE 1QPZA 1W73A 4A2CA 4DR2B 2CE7A 4PC3A 5J58A 5I6DA 1P1KA 2ZVDA 3MTQA 1E3SA 1QGYA 3B1KA 4M9RA 4AP5A 4B0OA 4B5LA 4BZPA 1KJWA 3PQEA 1PBNA 1Q0QA 2DUUA 3ZD8A 3DMTC 4R81A 5EP2A 4Z4HA 3I8XA 2H1HA 2DY0A 3DL4A 2FPUA 4TV8B 3UV3A 4EFNA 3JQ7A 1EJBA 1OPXA 4JKYA 5EMNA 3PDCA 2CD7A 4N8DA 3T4XA 1F6DA 1C29B 1K3FA 1MJGA 2BMAA 2Z9BA 4MK4A 3UH0A 2Q5EA 3SCZA 5C7IO 2HLHA 1T9GS 3EXG2 2J08A 2OP0A 1QTQA 1J4AA 4M98A 4C01A 1E9AA 1BXRB 1C30A 5D01A 1IPHA 1XDZA 1ZCAA 3E84A 2W2OA 2QRZA 2ORIA 3D5TA 3F4LA 1LW6E 4GMKA 4X54A 2BGUA 2UVPB 4M4SA 4Z53A 1QU3A 4LPKA 1O08A 1THGA 2B94A 1C0KA 2CXOA 3H9JA 3IUYA 4BEBA 5BV7A 4X0EA 4L15A 1ZD8A 2IVFA 4WI1A 1MB4A 4LYFA 1NDQA 2VH2A 2RHOA 2XTJA 5HE8A 1CF4A 3I2GA 4PLVA 3MD0A 2Q1SA 1E8DA 2CHQA 3G6KA 1RAAA 5AO9A 1ZOIA 3HV0A 1U3VA 5ALRA 4ZTBA 2JCYA 5IULC 2X9QA 3PF9A 4CMIB 5KTPA 3T5BA 3P2JA 1U11A 4R1LA 3UCFA 2IHYA 3M1IA 3ZI7A 4J94A 2VQFB 3THSA 2W00A 3ZS9A 3M82A 1LFDB 4OK3A 2IF0A 1KVQA 3GC6A 4JLUA 5TQVA 1HNWB 3W8DA 2X40A 4M37A 1KQ3A 1ABEA 3B1WA 3E7DA 1ZCZA 2YIDA 3RS9A 2F90A 5LU9A 1XEFA 2J32A 3RE1A 3UKOA 2P6UA 5DTMA 1J49A 1J8QA 1TT5A 1K2WA 1S2GA 4I1SA 2MSKA 5I5GA 4E5PA 3CX8A 2PU7A 4BEVA 5KX5B 2CT8A 5C35A 4BP8A 1JT2A 4CIXA 4CKCB 4ROSA 2OBMA 5J3JA 2NO4A 4IMIB 4M36A 3VX4A 3BWDD 2WYVA 1PQ4A 1CUAA 2IEZA 4KX5A 4A03A 4TKVB 1PJRA 1B16A 1HE3A 3AR9A 4TTAA 2FFAA 1YBAA 3BMNB 4DQVA 5JAMA 1SKYB 1BX3A 2AG0A 5JWOA 3HKBA 2EV9A 4GKVA 4FCVA 1UWVA 2IV3A 4E32A 4GMDA 3DDOA 1J5PA 2ZQYA 4HVAA 5KTYA 5BY2A 3H1TA 3QBVA 2QRKA 1XQ9A 1HMYA 3OU2A 2H1FA 5TPZA 4BNFA 4CG3A 4XJVA 5C5EA 2EP8A 2Y8EA 2WQZA 4WPGA 3U3DA 1Z0IA 1HDRA 2IDJA 3A1NA 4D44A 5G4KB 4E11A 4L95C 4KVGA 2DZDA 4MA0A 2N1BA 5JVDB 1Z6ZA 3G6WA 3V4SA 3V8QA 1W85B 3QE2A 4IDPA 4D4GA 3L6BA 4PGGA 4LFAB 4EUEA 4ZVVA 5BW5A 4G5FA 1Y8RB 4FYIA 3TTVA 4NCAA 3DAYA 4H60A 4KODA 3NMUF 3I73A 1QWSA 3PDHA 5FFFA 4C4RA 2IS2A 1YQUA 4UD6A 5SICE 1TLLA 2CDAA 3GJZA 4N18A 3AYZB 1AQJA 1R27A 5AJUA 3HN2A 3PFNA 5LPNA 3WL5A 1QK5A 1ZD3A 2IS1A 1K6EA 3AUYA 1XVAA 1U3FA 2GDZA 1Z25A 3OQ1A 4CL8A 3EXFA 1VBKA 3E58A 3NG1A 1XMIA 3KJEA 4Z86A 4DDTA 1D1SA 3KKPA 3ZYCA 3GLTA 2H63A 2Z56A 2ZSDA 4B2YA 4XOUA 1JI0A 3U1BA 1PL7A 5M2QA 2XYVA 4NOLA 2ZAYA 4FMBB 2XZLA 4PV7A 1FA9A 1KMMA 1U7OA 3EWAA 4URFA 3ZTYA 1UP4A 3SC4A 5FPPA 1N9KA 3MOIA 4WBNA 4WDQA 4DF3A 1JDBB 2CF6A 3HACA 5IXJA 1Y5IA 4L76A 3QI7A 1A88A 3OKPA 2JFNA 2HBYA 2XGGA 1JG7A 3IRUA 4QSHA 2DMRA 5F52A 4A0RA 1UODA 4MA5A 3SF0A 3WS7A 1NFQA 3O1JC 1PNRA 4KQXA 2RC6A 3R7WB 1W2HA 1D6NA 3KT8A 4EABA 2V5UA 2GN6A 3F6CA 1K6JA 1MAUA 2ZR9A 2HDOA 3CLUD 4TYWA 1OLSA 4Y6LA 5HF8A 4DY6A 1Z68A 1C1DA 1RACA 2UZ0A 1YK0A 3HO8A 4B32A 4C87A 3ETEA 4S0XA 5FA6A 4YRSA 4RD2A 5KS2A 5HIJA 1QZTA 4D2IA 5JXHA 1P31A 4OHRA 3K1JA 1O6BA 4FWIB 4TS9A 4M60A 4Q9JA 4Y2RA 2GN0A 3KFVA 2EJBA 1LWNA 1K5GA 5I3ZA 1GKYA 4RTOA 1JHMA 2HQOA 3MLAA 3TW0A 5TT1A 4CKWB 4C3OB 4I9UA 1YFJA 2PA3A 3DOCA 4WADA 4G1UC 4LJ6A 1QDLB 1U5CA 4C20A 2Y2VA 4UQPA 4I8IA 2GEKA 4O4JB 1ECJA 1LBHA 2GHRA 1W5FA 1NLZA 2QTAA 1G55A 3E3AA 1SIWA 3E5RA 4R5MA 1RPTA 2VCYA 1NV8A 3QVOA 4PTZA 3ZZTA 3KAJA 4B7ZA 3GI1A 3H6GA 4BVLA 4CKZA 1T1GA 1TUIA 3STYA 3C7CB 1RBMA 3QTLA 2V7UA 4O3FA 5EXTA 3TIFA 2J0VA 2HLPA 1UZAA 1ZXXA 3LUBA 3M4ZA 3RVQA 2FSFA 1FUKA 1RQ2A 4A4DA 3AR2A 2NZWA 1MORA 3LPDA 2WJ3A 2C20A 4JX8A 1P9RA 2B4QA 2EX0A 1KFCB 2ZI5A 4DLVA 4F96A 1HZJA 4H6PA 3QXHA 5AI4A 5T3YA 3TK1A 1FDOA 2R6ZA 5K8VA 3A4TA 4DR4B 3TLBA 5JHGB 2NUPB 2YN0A 2ZTMA 3BICA 1O9HA 1E6LA 3VHXA 3KXDA 2RGWA 2X42A 1GPBA 4OI0A 3HVIA 4LE1A 4TMXA 2UZIR 3PJEA 2AG1A 2R7NA 4RQTA 5IMSA 4KFCA 1PGJA 1KGSA 2OD2A 3AFNA 4B43A 2XDWA 3K7EA 2ZRNA 4YRIA 5BSKA 2WLTA 5KSYA 4COKA 1JDNA 2J6CA 3MIZA 4L72A 1E1LA 5AM4A 2E5WA 2NO9A 1NXWA 4HEJA 4WN9B 1Z6PA 5FUYA 2HZ7A 3RHZA 4Z1OA 4N5IX 1XAIA 2BBTA 3ILYA 3U7IA 4JXXA 3UICA 5B6PA 1P80A 3E82A 4AMBA 1RP1A 1SXJB 1NVUQ 2FN3A 2QBYB 2C2YA 1D4ZA 3QX7A 4H6WA 4RXTA 2X3FA 1UOPA 2GETA 5G1OA 3RYFB 4G5RA 1MB3A 3PUJA 5ITWA 4RIHA 1ABBA 4L16A 2XZDA 1I14A 2IVZA 5I8PA 4KWCA 1C0EA 3IMGA 2WWGA 3NQ41 2O0MA 1C14A 3CB2A 4M88A 2NV6A 4XAQA 3JW8A 1UBFA 1UEIA 5ANRB 3RC1A 2YICA 3SBOA 5KMGB 2C31A 2CL0X 3Q9NA 4DS3A 4KVFA 2CUNA 4FGJA 1WSWA 2X6RA 4DHEA 4EG1A 1CWUA 3OTIA 2GNOA 4OQYA 3L4JA 1CT9A 3EX7C 3ZY6A 1UPXA 1NJSA 2XKBA 2OXRA 2J3JA 2DM6A 4X7RA 1OXUA 3MPUA 3HJAA 5AT1A 1PZMA 2YNMD 1Z36A 4TZKA 2H08A 4Q3CA 4R6WA 3F78A 4DV7B 3P19A 4LTDA 5DTRA 1F2TB 3LQFA 1YQWA 5M3BA 2Z6QA 3AVUA 2B7CA 3PRYA 4W82A 1OMOA 2KYRA 1PK8A 2XMPA 1A9XA 2FDCA 121PA 5I9LA 3DE2X 4U2CA 5LYYA 4U2GA 4WA7A 4OHYA 1ATZA 1GDHA 4J1TC 1CUVA 3N0XA 1QFJA 1KDPA 5DHTA 1WO8A 3LG2A 3OMWA 2NYAA 4G5YA 1S9HA 1WRBA 2RKOA 1V6AA 5EJGA 5PNTA 3PXDA 5K0CA 5ILOA 2D2VA 2YV5A 2H1WA 1P0PA 3KZOA 4D8UA 3MRSA 1WKCA 3JD3A 3AFGA 2HIHA 2ZOSA 1NYRA 3CCBA 3IE0A 1G5TA 2ATEA 5LZ7A 3OJLA 1QRSA 3R5XA 2AN1A 4GC5A 2PRSA 2PKQP 1YD7A 4TRJA 1ELOA 1HTTA 4WMLA 5G0SA 4BRZA 4YRQA 4DA8A 4PFSA 1AKTA 2NOAA 2PX4A 2P41A 2FNAA 2KQUA 1UBJS 1SQGA 5EZYB 2H7YA 2VS1A 3BFKA 2HSJA 3QYJA 5CW1A 1OBVA 1ZXBA 3HPQA 5BRNA 3UIEA 5C37A 3CS3A 4YAOA 2B0CA 1OXBB 4BKRA 1NW9B 3TYXA 4DLWA 2FUNB 2VPYA 1VE7A 1DQNA 4ARUA 4D02A 1OREA 3CLVA 3CF2A 3S29A 1P7WA 4FP9A 5JNUA 1DL5A 1MEJA 3GCDA 4H7JA 4B4UA 4DDMA 1VJ0A 5BWCA 5ADVA 2V58A 1ESNA 3V1MA 4QTXA 2O8VA 3SYLA 2QRGA 1AQYA 1F06A 1J22A 1G7TA 1PWXA 1V8BA 5IKMA 1SOMA 4D57A 1E2BA 1QQTA 2JIRA 2GARA 1CEYA 3GUYA 2EBWA 1BE1A 3DWFA 3U48A 1VYTA 2I8LA 2GPAA 2Q2NA 3Q7EA 4RACA 3T3HA 2PQMA 2DR2A 1VBNA 2E9SA 1RZRD 1J0AA 4PCVA 5SYNA 1SOAA 2EFDB 2W6NA 2PUCA 2VO1A 5BSEA 1ZSYA 5INTA 2WWFA 5HXAA 2PAFA 1Z6GA 5HMMA 1LSOA 4A73A 2ZDGA 4ACBA 1BCSA 1IBRA 1WBBA 4ILKA 1U7WA 2VWGA 4GPAA 4COOA 1TK3A 3GZJA 4MGHA 1MABB 2ZRGA 3RYIB 5JTUA 4KMSA 3F73A 4MMYB 1WPXA 1ADBA 2BBSA 3IL2A 3HJFA 1DX9A 5HQ3B 2O2DA 1NGSA 1YB4A 4BB0A 3OJEA 4CDRA 2VZ0A 4OSEA 2C9OA 4CCYA 3P94A 4XVUA 4QYWA 5BUCA 4K9DA 4EHJA 5I9SA 3TOVA 1IXZA 2XRMA 2BEVA 4YCBA 2Z5GA 5EINA 1X8KA 4I4NA 4KQJA 3MJVA 5IHPA 3E35A 1B3RA 2YFKA 2IDKA 3RIXA 2XMDA 1KXJA 2ZE6A 1UIRA 2JL1A 2P30A 3PNYA 4YAWA 4CL3A 5LXTB 1N6OA 1EESA 4BO5A 4JBGA 4OM8A 1UBKS 2JD2A 4HB4A 4KIJA 1LJ8A 4FCTA 1NFFA 4AO7A 1DQSA 5CYPA 3DEIA 2L0XA 2HMSA 3ZIDA 3LECA 1NHWA 1Y9EA 2HWUA 1TKBA 4XIYA 3VOSA 4I2VA 2XVAA 3D5EA 3IJPA 1SR8A 3T61A 2IYEA 4HAVA 2AKYA 4MVJM 4EA8A 1HE2A 4AI6A 2E49A 1T9KA 3VGPA 2ZJAA 3M4NA 4ILEA 4IDHA 4P4GA 2H1IA 1E3EA 3ABZA 3E9NA 2DHDA 1EFAA 1L4GA 1KOLA 2QUJA 3BHJA 3JZDA 1YASA 5HJ7A 2QROA 3LT5A 3VAAA 2X5OA 2KB0A 3P0FA 1TGVA 5F33A 1QCCA 3WHLA 4BAZA 5EE3A 4YMIA 2X9LA 2WPDA 4J0KA 3WWEA 1PR1A 3ROZA 3Q7IA 4GGMX 4W5QA 1DXHA 1GEEA 2RHTA 4B76A 2VEOA 5DSXA 5BW4A 1IBMB 5TF4A 4G8JA 1P0FA 4PR3A 3GPBA 2DTDA 4AP6A 1OHHA 1MABA 2OLJA 5GVSA 3I58A 2HMVA 1FNBA 1RHUA 2QJRA 5EQJB 3FXAA 3NRCA 1LLFA 1T3HA 4X1IA 5D2CA 3W6NA 1FDTA 2NVUA 2XADA 3DJFA 1OIXA 3L0DA 4PY2A 5CK5A 1C3LA 3SLKA 3T1QA 2W48A 3JRXA 2R96A 1JPJA 3GMIA 3PNPA 4A6PA 4EJFA 1YBVA 4IJMA 3E8XA 3IP5A 2WBLC 2V8BA 4EM6A 3QVGB 4DCJA 5K4AA 4MW4A 2WIBA 2O7NA 1EVZA 1U2EA 2VP5A 1ZDMA 2DU8A 5HDBB 3A6JA 4F6RB 3C3YA 1XVTA 4XLZA 3VO2A 3VSEA 3RFTA 3UG7A 1I4LD 2DWUA 4PXSA 5CA0F 2GZSA 3ZCSA 2V7PA 4ZN6A 2QSJA 4ME6A 3HFSA 2FTKE 4RGQA 5JMPA 1JEEA 1JHUA 1Z4IA 4HTFB 3WHIA 3SZLA 3AOEC 1T5DX 2WICA 1E2IA 1ID1A 2RBGA 1Z8DA 1ZUNA 1LNSA 1RMYA 1I7NA 4PC2A 3S2FA 5JNTA 2OV2A 4GZ5A 1ADYA 3DZBA 2IE8A 2ODAA 5AVXA 3UKJA 4B0PA 4WCFC 3EZLA 4MUHA 2VJQA 3PUIA 1JHPA 1T5BA 3R0ZA 1GRNA 1OXTA 2ODTX 2WA2A 3U40A 5IM4F 2GM3A 3IKMB 2AXEA 3WA7A 3UB2A 3V7WA 3NHAA 1Z45A 2QLMA 2VP6A 4EY6A 3GAMA 3GB9A 2W2TA 1YZTA 3P9ZA 1WJGA 2A9QA 3LHDA 4TWIA 3X2FA 5F51A 1OI7A 3SJBA 4CGZA 1VGRA 3GLUA 3K1AB 1UP6A 3DR5A 3W5HA 3TFQA 4OQZA 2DR3A 5CDUA 1AA6A 2O48X 4YRJA 3KQLA 5GTDA 1OVGA 1SK8A 5FL7A 3ORFA 1PV2A 2OLKA 4ZQBA 4X00A 4YLGA 2F7SA 4TVOA 4WERA 5TVGA 1MXHA 1J8YF 1UXGA 2G6BA 3ETDA 3LKDA 5IEBA 4C9BA 3WJ1A 1KSHA 4MGZR 4ECEA 1TJYA 1RXEA 2QUZA 3LXUX 1NXOA 2BTQB 3IP7A 3PA6A 3HC7A 5I9TA 4DIKA 1SXJC 5CCXA 3ZDYB 4HMOA 1UPBA 2JKZA 2FEKA 3D3NA 1ZSVA 5DCYA 3QBDA 3WLLA 1Y81A 4OAQA 2PUVA 4LW8A 2DG2A 1K2VN 3GNLA 1GG2A 1S0UA 3LHIA 4ENVA 1A2KC 2Z1NA 3DMGA 3FDJA 3Q8XB 4F8YA 2ZPAA 2ZW9A 1XZJA 1JR3A 3D7RA 3I6QA 1NJFA 1WU7A 4Z3OA 1TVCA 1D03A 1JHVA 1WXHA 2HT6A 3COPA 4ETMA 4WXMA 1K8XB 3O2JA 3VFDA 1SAYA 1SXQA 1ILWA 2GM5A 4RD3A 2M6SA 3B89A 5C5IA 5JXGA 4YP7A 1A4RA 1QUEA 4Y9DA 5FOUA 2AG5A 2WSMA 1KIAA 2KJQA 4BATA 1G7CA 2EARA 4QUJA 5SZJA 4ND5A 4BC1A 4CCSA 3I1IA 2Z8ZA 2VBGA 4MCJA 2LUOA 4YP6A 4W5HA 4IICA 4EAQA 4DTCA 1L3BA 2L2QA 1GP2A 1MOZA 2FRVA 3C4JA 1YVUA 2HJHA 3D3KA 2GOYA 5H83A 3BEDA 1CUGA 2OY0A 4WESA 3UJCA 1A9OA 4I1OA 4CMEC 2K7FA 5F98A 4NU5A 4XOIA 1I2CA 3ZDCA 1M6NA 4DMLA 4PSDA 4JBWA 1QHSA 1JR6A 1RR6A 4HN2A 2EBUA 1HYEA 3M49A 2QYHA 2FPMA 5K3BA 3DZKA 4BX2A 1RM5A 4LF9B 2YDYA 4JL8A 4HFNA 2QUAA 2PN1A 4PS0A 3BHNA 1Y8QA 1ZK2A 5IWCA 1KK0A 1PFYA 1V0JA 2Y66A 3AU9A 1JU9A 4JUIA 4KIFA 1OFIA 4P38A 5CK4A 4BFWA 2GCNA 2JGAA 3TEMA 2I54A 3K6KA 3M89A 1FNMA 1EGAA 4YI5A 2BFFA 2OGZA 2PQ6A 4URZR 1RZRA 2QJTA 3F98A 1RYMA 3UAXA 3AF0A 3KXKA 5EJ8A 1MQAA 4HT3B 3MF4A 4UDYX 1NBIA 3A4VA 2LGJA 2OFXA 4YDQA 1VKZA 3CVOA 1IQRA 3K9HA 3VVMA 4K40A 1FSGA 5BT9A 5BWBA 2QD4A 3EQ8A 2XWPA 3KB1A 2HYDA 4CR7A 3A3NA 1G4AE 1IY1A 2UZAA 1HSZA 4DA0A 3QEOA 4QRHA 1UJCA 3W05A 4IKPA 3C8MA 4OYYA 2V54A 4US0R 2FWJA 3BTUA 2WJ6A 3I92A 3ZJUA 3STUA 3OCJA 4Y9SA 2BMWA 4Z4IA 2Q5HA 2JGDB 4I8DA 4E70A 3ACDA 1VP3A 2PH1A 4HNQA 3T5PA 1TVEA 3THOA 1E59A 3RO7A 1U0NA 2X0IA 3FGNA 1EG2A 4YC7A 1R6DA 1W0JD 4AMUA 5FA8A 1Y5LA 2VZEA 3L41A 3OC0A 4QU0A 4QUKA 4BNMA 4G5OA 4LJ9A 4YAGA 3F1KA 5LU8A 4A2QA 3DB2A 3ENKA 5BP7A 1GR1A 2IBMA 2EP5A 5KJEA 1RXSA 3MHTA 3V9AA 4N5DA 4JLSA 4ZQGA 2B8JA 2C4VA 3OQNA 3QBTA 4KQEA 2CXQA 2F8TA 3QW2A 2ZM6B 2ODBA 3E18A 2NUAA 2Q5JA 5AM5A 1T8RA 4I1UA 3R1IA 2IZ6A 1JIQA 1FPQA 2GZDA 3LD9A 5ARDA 4DA7A 3D2LA 2YMLA 3HKEB 4G09A 2EAUA 5DGDA 3ZW9A 5LUAA 4RJIA 5BN1A 1U8FO 4YREA 5L7WA 1JQDA 1NONA 2PKYX 3F6EX 3U3XA 2UXDB 2Q7OE 3WADA 3RFVA 1FLNA 1SUDA 1NSYA 2YV3A 3MINB 3F3KA 5KNBA 2AVDA 2AOTA 4M38A 4F5EA 5KYNA 5EJ2A 5IYZF 3DQQA 3UKDA 4ZARA 4EPYA 3LC7O 3UMJA 3RQIA 1WMFA 1YIDA 5IJZA 1UBUS 1XIVA 4JIGA 3REQB 4NS4A 1NBAA 1WUYA 4K6CA 4BASA 4ZGWA 2DVMA 4BV8A 4E7OA 4R51A 3UMVA 2OB2A 3ORHA 5FKJA 1XWIA 2I4MA 3DZCA 3FMVA 2XOEA 3LWBA 1CJKC 3QUAA 3TD9A 2OQVA 5KQRA 2XXAB 1LXCA 5FXMA 2XDQB 1QH1B 4HWOA 3U17A 3BBLA 5KQLA 1URPA 3MXOA 4Q7KA 4ETNA 3HNOA 2WZCA 3BWYA 4YJFB 1LUAA 1Y34E 1Z4LA 1GPJA 1R4MA 4CL0A 4XJSA 4GL2A 2NLOA 2RIPA 1QOQB 2GEFA 2XWJI 5LIRA 3RAFC 5I4KA 2OK8A 4OA5A 5H59A 1ZUIA 1J42A 1XD2A 1B1CA 3ZNQA 1E6CA 2AFHA 2V55B 4RWEA 3K4HA 1KAOA 3QUQA 2P7IA 4MCAA 1RTTA 2W93A 2D00A 3DZGA 4G8CA 4X66B 4WVLA 1WVGA 2IUEA 5FYDA 5DE3A 3SX0A 2YVLA 2YRFA 4KQ1A 4CMIA 2NQ2C 1TVMA 4PYOA 2NM0A 1A4UA 4JVOA 5CITA 4LDJA 1YHYA 3IS3A 2RH8A 1O9GA 2R65A 3UEOA 3CNBA 3GP8A 4RKYA 4YRRA 2CBXA 1GPWB 2HZBA 2O3UA 3EEIA 1I3NA 1T1EA 3AI1A 2H7CA 3PPWA 3V1YA 2WFMA 2VSFA 4CCWA 3D9QX 1NI5A 2B0JA 4HQOA 4XEHA 2IUYA 3M6AA 3WQRA 4DYHA 4WFKA 3JX9A 1WXWA 2FFHA 4OHOA 4XUEA 1O1YA 3SHWA 2QQGA 1Z2NX 4MIYA 4NZ9A 1QXSA 4W7SA 4J6EA 3ER9A 1RXUA 1XZCA 2BM8A 2BW0A 4TLBA 1G1AA 2GI4A 3IEKA 1AKQA 3KHUA 4O0LA 4DUGD 4CQMD 1IBLB 2WKQA 4IOLA 1RHQA 1U9ZA 3ZQKA 4ZI3A 3ONWA 2WWVD 5A4MS 1VE6A 1W4BA 3JV7A 2HJVA 3JQBC 1EB9A 2NV2B 4NZZA 5F3RA 1R0WA 3TG8A 3E61A 3UXEA 2O19A 2G0AA 1DLIA 2HEGA 3MJTA 4L6AA 4N40A 4NFLA 2I80A 4KP7A 4ZEOA 5BN4A 4XWKA 1ZWKA 2EJUA 3IO5A 2XUFA 3DHEA 4EHFA 4AC9A 3PC8A 4BFSA 1GNSA 3RFFA 2D0PB 4OQXA 5K2OA 1CHNA 1MNAA 2YXBA 3NS7A 3BD8A 1SBHA 2J7KA 3NYRA 2GHQA 1UDAA 4I4IA 5AUPB 3F9IA 3NO4A 5DISB 4BFZA 1EVIA 1C9DB 3H17A 1PK9A 2VRCA 4MEAA 4DJEC 4GXTA 4YASA 4E15A 3DMTA 2PKQO 1OASA 2IHKA 4DNXA 4OUDB 1IATA 1FFXA 3HDYA 3NM5A 4F85A 3A9TA 3LK6A 4KKXB 4PZPA 2ZCVA 1K5DA 4MQEA 1TMGE 1W47A 2WG1A 1UPUA 4N49A 1E18A 4G01B 2QTVA 2GSDA 4KTTE 1QWOA 3RVNA 3WC4A 3MXTA 3ZU5A 3THWB 1FF9A 3HSKA