3GLBA

Crystal structure of the effector binding domain of a catm variant (r156h)
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
215
structure length
215
Chain Sequence
b'SQTLRIGYVSSLLYGLLPEIIYLFRQQNPEIHIELIECGTKDQINALKQGKIDLGFGRLKITDPAIRHIVLHKEQLKLAIHKHHHLNQFAATGVHLSQIIDEPMLLYPVSQKPNFATFIQSLFTELGLVPSKLTEIREIQLALGLVAAGEGVCIVPASAMDIGVKNLLYIPILDDDAYSPISLAVRNMDHSNYIPKILACVQEVFATHHIRPLIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator catM
publication title Inducer responses of BenM, a LysR-type transcriptional regulator from Acinetobacter baylyi ADP1.
pubmed doi rcsb
source organism Acinetobacter sp.
molecule tags Transcription
total genus 59
structure length 215
sequence length 215
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3glbA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3glbA02
1Y20A 2I0BA 3C36A 1HSLA 1UTHB 3ZKLA 3O29A 4P11A 5LOMA 1MY0A 3CG1A 3PMVA 4F29A 5A5XB 4NWDA 2RCBA 4O3AA 2FA7A 3RN8A 2D5WA 4ZEBA 4F1YA 1H3DA 3CFLA 3GZGA 5CI5A 4AB6A 3FVNA 3HPIA 3C33A 3FJMA 4ELRA 1LBBA 1D9YA 1LFIA 2PBWA 3VDFA 4K3FA 1XVYA 4KYEA 4LA9A 3THIA 1URSA 4GL8A 3I5OA 4X9TA 2F7BA 2I6EA 2H99A 4G4PA 3D4GA 3GBBA 3MJNA 3OSRA 1FQBA 3G7WA 2M8CA 4ELPA 2YPNA 3O2AA 1ZBMA 5L9MA 4KD5A 3O6IA 3FVOA 4QRZA 3N26A 3KZGA 1POTA 3V83A 3PUXE 1MM6A 1B5HA 4P0GA 3C32A 1QW0A 3FV1A 3H4ZA 3G3JA 1UTBA 4KYSA 1LAFE 1AMFA 4UA8A 2P2AA 1WVJA 4JB7A 3IAZA 1MPBA 2XX8A 2NOOA 2CZLA 3O97A 1JW1A 2XXXA 1TFAA 1UTBB 3MPLA 4GIZA 1FTOA 1ZJLA 1LB9A 4H1XA 5EYFA 3W15C 2QPQA 3N6UA 2A5TA 2HAUA 3UK4A 2HEUA 3VE1B 4IO6A 4GQOA 1B3FA 1EU8A 3OD7A 2V3QA 3PV0E 5IKBA 4R2FA 1SBPA 1VSOA 3RTFB 3BFTA 5I58A 1UIVA 1P1UA 4LZ5A 5DYHA 3B6TA 4KCCA 4WEDA 3RPWA 3FXQA 3MUQA 3LSFB 3OSQA 4LP2B 2A5TB 2ABHA 1TT1A 3PPPA 3OELA 1SYIA 2G93A 3S2VA 4OEUA 2VD3A 1H43A 1B3GA 1FCKA 1DSNA 3O6HA 3MZBA 1GTKA 3CR9A 4H0WA 3L6HA 3PUYE 2Z22A 5I58B 1FW0A 4ZDMA 5FHOA 3PPOA 2RKMA 2DVZA 3K2DA 3GBAA 1R9QA 4NE4A 4DZ1A 4RPNA 1B1HA 1B3LA 2OZZA 4BDMA 2D21A 4N13A 3HO7A 4DDDA 3IOVA 4IY6A 3K1MA 4RNSA 4MBPA 4ELOA 1BIYA 1GR2A 5IAIA 2DP8A 4EF1A 4QFNA 2DQVA 1B5IA 4ZEKA 3TEPA 1OVBA 4LATA 2CMOA 2Y7RA 1NMUA 2FYIA 4KCDA 4ZEIA 3EQ1A 2YJPA 3MPKA 1D9VA 1NH7A 4GLIA 3TKDA 2DYXA 4GWOA 1FQEA 1Y4CA 3SEXA 2QS4A 4ELQA 4IGTA 5AA4A 3T9UA 3HHFA 4WEPA 1DTZA 4H6DA 1I6BA 2ALUA 1B3EA 2XXIA 1B2HA 4LONB 5JEIA 3K6UA 1H45A 3SKPA 1J1NA 2THIA 5CC2A 2GH9A 4R74A 4H5GA 4FEDA 1TFDA 1GVCA 1BLFA 1NNTA 4POWA 4DXBA 2DOJA 4IY5A 4EQ9A 2V3TA 1PB7A 2XXVA 4ESWA 4GRKA 1A8FA 4RYAA 2AL4A 3IJXB 4BDRA 2VOZA 4OESA 3LUYA 1F9BA 1FQAA 5KDTA 2LAOA 1VE4A 5AA1A 2B65A 4NF6A 2F35A 2UVJA 4RY1A 2OLBA 4ESXA 3U94A 2PT1A 3PMXA 3OO8A 3IOUA 2B3BA 5L8DA 4NF8A 3K0VA 4F2OA 2I49A 4PFYA 4ND9A 1OQGA 4L17A 2HZKA 5L9SA 1YAEA 2DWAA 3FVKA 1B40A 2WKYA 2QMXA 4LZ7A 2Q89A 2UYFA 1Y3NA 3MVXA 4TLLB 3SETA 4GOTA 4F22A 3O9PA 1JW5A 3FGSA 2H98A 3EHUA 3ILUB 1RYXA 4NF8B 4E0XA 3I3VA 3DP6A 5AA2B 4OYVA 3MWBA 4DCXA 2UVHA 3UA8A 3E13X 4PFUA 5TPAA 3ILTB 4C1TA 3HCQA 2NXOA 3VXCA 2RCAA 4U22A 1SYHA 3PUVE 1MY2A 2AIXA 4OENA 3H06B 1XVXA 3HSTA 5DVJA 1NNPA 4M1VA 3CFZA 3PU5A 1MXZA 1O7TA 3SEUA 2OBGA 4KPTA 1IQ7A 1A54A 3KJ7A 3UP9A 1LGBC 3HN0A 3CFXA 5DTBA 4YKJA 4OFJA 2X7PA 3KG2A 4IO7A 1P1OA 3KSJA 1VR5A 2RF1A 2UYEA 3TCGA 4MH5A 4UACA 1A99A 1B0HA 4OERA 3M3KA 3ZS6A 3PPQA 3RY3A 5TP9A 4FATA 4QHQA 2Q88A 4OZ9A 2Y7WA 4LQ5A 4YMAA 4F31B 1UTHA 1Q35A 2ONSA 2R9JA 3CSGA 5I56A 3EHSA 3U72A 3FZVA 3MVZA 2VP1A 1MQIA 5H8QA 3IO4A 4R9GA 1IIWA 3CVGA 4XTCQ 4RJZA 1BKAA 1SW2A 3R26A 3TCHA 1MS7A 4Q0CA 2HZLA 4NF5B 4OQOA 1FTLA 1B4HA 1Y1ZA 4YU0A 4XIGQ 4G2ZA 3MP6A 4YB7A 1O63A 4EUOA 2V25A 2Z8FA 2G29A 1B6HA 2HFBA 5FHMA 3CI8A 4GXAA 2OWSA 2ONRA 4RPOA 4QSDA 5I56B 3S9MC 5H8QB 3E9XA 1XHYA 3TTKA 2REJA 2DWHA 3TZAA 3UIFA 4U1ZA 3RQTA 2F8DA 4GVOA 1I6AA 1DOTA 4EQ7A 1IXHA 2XX7A 1LCFA 3T9HB 5CBRA 3MQ9A 3K00A 1N0TA 1B7HA 1B1XA 2DWIA 3FJ7A 1QUKA 1FTMA 4OFLA 3IX1A 4POXA 4Q8RA 1OQHA 4R73A 4JSDA 2XXUA 3Q27A 1N3WA 3Q28A 3IB2A 3LSXA 4HTGA 5DEXB 2DVCA 1M5DA 2RINA 1SI0A 4R72A 1M5BA 2W7YA 3UGWA 4X48A 4YMBA 4F18A 4O3BA 1ZLQA 3H6UA 4FIMA 4XKRA 3TUSA 3MP8A 3B6QA 1MXWA 1XT8A 1Z7ME 3EHTA 2GHAA 3R6UA 3GXAA 5I57B 4TOZA 1VFDA 3C9HA 1N04A 3KN3A 3FIRA 1T0KA 4JXIA 4EXLA 3C31A 3V8XB 3RGYA 2BJJX 1NKXA 4QSCA 2F7CA 3G3HA 4F2QA 1EZ9A 1M5EA 1MQJA 2V84A 3FVGA 4XKNA 3K02A 1B0LA 1MQDA 1JVXA 2Y7KA 1VFEA 4RA1A 3PUWE 3FXUA 2AYSA 4FJPA 3SEWA 1QJMA 1WDNA 2F5XA 3T22A 3SESA 5M2VA 1SQYA 4Z0IA 5ISUA 2I3VA 1SDXA 1XS5A 4MLQA 2R71A 3QIMA 4GFRA 1SW4A 2UVIA 5B70A 1R6ZA 4U23A 3H03A 4NTLA 4PFWA 4BLAA 1NL5A 2DXRA 3DP8A 1A55A 2PYYA 3E3KA 3K1NA 2I48A 3BKIB 3W9VA 3S4UA 4F3SA 1JNFA 1LBCA 4Q5TA 3K4UA 3VVFA 5HM4B 3VVDA 4EDPA 1XOCA 2H9BA 1ZU0A 3TDJA 1BTJA 3OENA 2OJTA 4QF9A 3HHGA 3DELB 3N5LA 5FHNA 5EHSA 4C0RA 2XHDA 1GV8A 1Y1MA 3TODA 3MVWA 3FJGA 4LZ8A 4BDLA 2F97A 5JTYA 2V93A 1MH3A 2O1MA 1N7XA 1IXIA 3G3GA 2H4IA 2ZMBA 3V5AA 3DP4A 1LSTA 5K2YA 3A3UA 3USDA 4GXSB 1JETA 2QRYA 4N07A 1M5FA 2H25A 2X7QA 1RYOA 2O68A 1CE2A 4ZS9A 5JTYB 4G68C 3G3IA 3CRBA 1MXUA 3JYRA 3KOTA 4PP0A 4DLDA 2ZYOA 1GGGA 4DCYA 3TPAA 3VFJA 3LC8A 4OFOA 1B32A 3PMWA 4ZZEA 4AB5A 3N94A 3FV2A 4IB2A 1TXFA 2F6GA 2XX9A 4HCWA 3BFUA 3UN6A 3DLNA 2ZYMA 5H8FA 1OVTA 3TELA 1QVSA 1B51A 1JQFA 3OO6A 3Q26A 1Z7NE 4R6YA 1H76A 4ISUA 3FASA 2O6AA 1A7LA 4GD5A 1H44A 2ONKE 2X26A 3ZKKA 4JDFA 2O51A 4ZE9A 4MLVA 4KR5A 3CG3A 3QYTA 1B3HA 4YICA 4TQUQ 1D3KA 5H8FB 3IORA 2F34A 3M3FA 4YZZA 1ZIUA 4Z7EA 3QUFA 1R9LA 2I58A 5I59B 4FORA 3PUZE 3KN8A 1B58A 3IR1A 1DPEA 3C35A 3LSWA 5AA2A 3EN3A 4OVJA 2IA4A 2F7AA 4KYDA 4BDOA 2O7UA 1I69A 2E1SA 5ELVA 2F36A 3P7IA 1P99A 2Z8EA 3V89B 1O64A 1MH4A 4HS7A 2VHAA 4EF2A 4NF4B 3TTNA 2F6PA 1II5A 1ELJA 4GL0A 4JBZA 3PPNA 2F78A 3QUJA 1YTVA 1SVXB 2XD2A 5F7VA 1QULA 3PD9A 3F11A 3IB0A 4KHZE 5ITPA 1B05A 1OIBA 1LAHE 3O66A 2UVGA 2DE3A 3QXMA 4P0IA 3A09A 3RUMA 4PQJA 2ZXTA 4FAJA 5H8NB 4ZZAA 4NWCA 3T93B 3E4RA 1N84A 2O84X 3QK6A 4F19A 1B7ZA 2QL3A 3IO6A 1Y9UA 5HPQA 3OO7A 5FTHA 4ZE8A 3N6TA 1Y3QA 2ZNTA 4NF5A 2HCAA 4OETA 3VLUA 3VVEA 1LLSA 4IO2A 4U1OA 2RC7A 4OWDA 5CBSA 2OCUA 2YLNA 3G3FA 1UQWA 1MM7A 1AIVA 3W9WA 2RC9A 5B7DA 3D4CA 1ZTYA 3KFMA 3TFLA 3OO9A 4R75A 1SD3A 4R9FA 1N3XA 1B5JA 3MC2A 1SW5A 5ICTA 4X1DA 1ATGA 3IL1B 3R7XA 2VGQA 1DMBA 1PC3A 3S9NC 4ZEDA 5ICQA 2UXAA 4DXUA 3JZJA 3A3CA 2OWTA 3H6TA 5CM6A 4BDQA 2PX1A 5KCJA 1ZMGA 2Q2AA 3B7DA 4PE5B 1P1NA 5CRYA 1B46A 5DEXA 5HBCA 2NVUB 3G3KA 3VLWA 4JWYA 4EXKA 1YCJA 1A8EA 3ONMA 1EH3A 3KSXA 4KQPA 1CB6A 1LCTA 1IITA 3MAMA 3KJTA 4KFQA 5KCJB 4G77A 4QFPA 4FEBA 3K6XA 1UIUA 4U4SA 5H8SA 1D4NA 4AQ4A 3O28A 1EZPA 5I57A 3GLBA 4IO4A 1FTKA 3MVYA 1OMPA 1MDQA 5AA3A 3FATA 1OLAA 4H5FA 1QKBA 1PDAA 3WAEA 3SEVA 3IB1A 2FNCA 3OXNA 4IO3A 5I2NA 4OEVA 1MXVA 3VXBA 3H3GA 2GFEA 3OEKA 5K2XA 5BWJA 5AE4A 5CMCA 2VD2A 3U8QA 3IK6B 5ITOA 2V3UA 1HSEA 5DT6A 3ODBA 2ESNA 1PB8A 1FQDA 1MPDA 4KI0E 5I2NB 3MP1A 2NWJA 1USYE 5F1QA 1QKAA 2ZYKA 2I4CA 2Q9TA 1MQHA 4R2BA 4F3PA 5DVFA 2XXYA 4XXUA 3FD3A 3RT8A 3U1OA 4MFIA 3VV5A 2QJEA 3IJOB 5JK4A 1M5CA 1DTGA 2ANJA 4YB6A 2NUVA 2Y7PA 4WXJA 3Q29A 1AOVA 1SI1A 3M3LA 4H8IA 4H8JA 3ZSFA 3RT6B 4U2RA 4G8NA 4I1DA 3TQWA 1HSJA 3H6VA 1IEJA 4RK2A 4I8CA 3K1PA 4HW8A 2QS3A 2Z8DA 4YB5A 1PBQA 1JVYA 4ZECA 4XKPA 3MZ1A 3H7MA 2OK2A 2XXTA 1N76A 2I3WA 4PETA 1Q1KA 1JEVA 2ZYNA 4LVQA 4JWOA 4OXVA 1URGA 1USYH 3M8UA 2Q2CA 4F3BA 2HAVA 4FE8A 1MPCA 4O3CA 2Y84A 3SERA 1L5TA 2GRVA 4JSOA 3UORA 5I84A 4THIA 3C34A 5BUUA 2QS2A 3QAXA 4WKMA 2XXHA 3RLFE 1EZOA 1MG1A 2R6GE 3K6WA 4LUBA 2ZNUA 4ECFA 3PGFA 1LFGA 4DE8A 3TTRA 3KOSA 1US5A 1ZKBA 3TTMA 1MY1A 4I9DA 5KZTA 1Y3PA 2PT2A 2B3FA 3RNNA 3KGCA 4ONYA 2O69A 4YAHX 1B52A 2I0CA 1JEUA 4NMYA 3L6GA 3QSLA 3AXFA 5I2KA 1ANFA 4QSEA 1LAGE 4C1UA 3VLVA 4R6HA 1S50A 3OOAA 3IOWA 4DXCA 2XXWA 2DWJA 3H6WA 3KBRA 3TAJA 4OTEA 5TU0A 1XC1A 1US4A 3LR1A 2QSXA 3O6GA 3HV1A 1POY1 1MXXA 3PPRA 3MBPA 5J1DA 5DVIA 5I2KB 1JW4A 4I62A 1DPPA 1PBPA 3K6VA 3C4MA 3TMGA 1MRPA 4MF3A 3TQLA 1RKMA 1NFTA 4R6KA 3KN7A 3EPEA 4H67A 5I59A 1IUDA 3T9XB 3TCFA 1BP5A 4X1BA 3DM0A 1B9JA 3WAFA 4OHNA 1MY3A 2KLFA 1IXCA 2XXQA 3T66A 5AA2D 1I6QA 3U93A 4QFKA 4RXLA 5AA4B 4IGRA 1FQCA 1NNFA 2Y7IA 2HXWA 4H65A 1IZ1A 2QS1A 3SDFA 1SW1A 4XKQA 4F1UA 3BBRA 2P1SA 4GF8A 2DXYA 3OMBA 3I6VA 4YKKA 3EF7A 4NF4A 4G8MA 1A40A 3B6WA 4NEDA 3U92A 3ECRA 4QFLA 1QUIA 3Q25A 4G68A 1LAXA 5CMKA 1PB9A 2DS9A 1R1NA 3K01A 2RC8A 2Z23A 5KDTB 1PEBA 2AL5A 5H8HA 4HCYA 4NF6B 1P1QA 1S7YA 5EHMA 3FXRA 2A5SA 3JV9A 1N7WA 4U4XA 4LQ2A 3FUZA 5H8NA 1B7UA 4G68B 5L9OA 4F1VA 3MZ9A 2E0SA 4M4GA 2PMSA 3MW0A 2REGA 5H8HB 3KEIA 2DE4A 1AH5A 4Q30B 4FECA 3LBSA 5FTIA 4U21A 2IEEA 2XXPA 1Y4TA 5CMBA 2I4BA 2PVUA 3T9VA 3LSLA 1FTJA 1AL3A 4YKPA 4QFOA 2O1LA 2XXRA 2XD3A 1TWYA 4TLMB 5TPAB 1YPNA 2QMWA 1MY4A 3SEYA 4PFTA 3TTLA 4EQBA 1WODA 2O7IA 2DE2A 4YKIA 1FQFA 4BDNA 1KWHA 4E0WA 3S9LC 2HQ0A 4G8HA 4OMBA 3RTWB 1NH8A 2H5YA 2DSFA 1LB8A 4IO5A 4ZEFA 2ZNSA 4F39A 1MXYA 3OEMA 3S9EA 4N6PA 2D3IA 3T96B 3PD8A 4RK9A 2Q8JA 1MDP1 4F3GA 1B4ZA 3IOTA 3TYHA 1P1WA 5A5XA 1IXGA 2P0SA 1NNKA 1QUJA 4JWXA 1OLCA 4DIGA 1LFHA 3CSBA 1URDA 2GHBA 3CIJA 1MQGA 5CMMA 5TP9B 1S9TA
chains in the Genus database with same CATH superfamily
1Y20A 2I0BA 4HE2A 3C36A 1HSLA 1UTHB 3ZKLA 4H46A 3O29A 4GX3A 4P11A 5LOMA 1MY0A 3CG1A 3PMVA 4F29A 5A5XB 4NWDA 2RCBA 4OVRA 1RDZA 4O3AA 5I3SA 2FA7A 4PDDA 3RN8A 2D5WA 5IZZA 4ZEBA 1K9ZA 4F1YA 1H3DA 3CFLA 3GZGA 5CI5A 4AB6A 2ZZXA 3CHGA 3FVNA 3HPIA 3C33A 3FJMA 4ELRA 1LBBA 1D9YA 1LFIA 2PBWA 3VDFA 4K3FA 1XVYA 4KYEA 4LA9A 3THIA 1NV6A 1URSA 4GL8A 3I5OA 4X9TA 4N6KA 2F7BA 2I6EA 2H99A 4PAKA 4NGUA 4G4PA 3D4GA 3GBBA 3MJNA 3OSRA 1NI9A 1FQBA 3G7WA 2M8CA 3LUZA 4ELPA 2YPNA 3O2AA 1ZBMA 5L9MA 4KD5A 3O6IA 3FVOA 4QRZA 3N26A 3KZGA 1POTA 4PBHA 3V83A 1DK4A 3PUXE 1MM6A 1B5HA 4P0GA 5EQ9A 3C32A 1QW0A 2WBDA 1FSAA 3FV1A 3H4ZA 3G3JA 3FBPA 1UTBA 4KYSA 1LAFE 1AMFA 4UA8A 1INPA 2P2AA 1WVJA 4JB7A 3IAZA 1FBFA 1MPBA 4I40A 2BJIA 2XX8A 3E79A 2NOOA 4DI4B 4MNPA 2CZLA 3O97A 1LBXA 1JW1A 1FPGA 2XXXA 1TFAA 1FJ9A 1UTBB 3MPLA 4GIZA 5LDZA 1FTOA 1ZJLA 1LB9A 4H1XA 5EYFA 3W15C 2QPQA 3N6UA 4G61A 2A5TA 2HAUA 3UK4A 2HEUA 3B50A 3VE1B 4IO6A 4GQOA 1B3FA 1EU8A 1IMEA 4I3YA 3OD7A 2V3QA 3PV0E 5IKBA 4PFBA 4R2FA 1SBPA 1VSOA 3RTFB 3BFTA 5I58A 1UIVA 1P1UA 4LZ5A 5DYHA 2XXKA 3B6TA 1KA0A 4KCCA 4WEDA 3RPWA 3FXQA 3MUQA 3LSFB 3OSQA 4LP2B 2A5TB 2ABHA 1TT1A 3PPPA 3OELA 1SYIA 2G93A 3S2VA 4OEUA 2VD3A 2V4CA 1H43A 1B3GA 1FCKA 1DSNA 3O6HA 1FPBA 3MZBA 1GTKA 3CR9A 4H0WA 3L6HA 3PUYE 2Z22A 5I58B 1FW0A 4ZDMA 5FHOA 3PPOA 2RKMA 4PFRA 2DVZA 3K2DA 3GBAA 1R9QA 4NE4A 4DZ1A 4RPNA 1B1HA 1B3LA 2XA5A 2OZZA 4BDMA 3NOHA 2D21A 4N13A 3HO7A 4DDDA 3RPLA 3IOVA 4IY6A 3K1MA 4RNSA 4MBPA 3MYUA 4N4UA 4ELOA 4OVQA 4PDHA 1BIYA 1GR2A 5IAIA 2DP8A 4EF1A 5EYHA 4QFNA 2DQVA 1B5IA 4ZEKA 3D1RA 3RPLB 3TEPA 1OVBA 1FPIA 4LATA 2CMOA 2Y7RA 1NMUA 2FYIA 4KCDA 4ZEIA 3EQ1A 2L5VA 4MHFA 1YYZA 2YJPA 2CZKA 3MPKA 1D9VA 1NH7A 2ZZVA 4GLIA 2B4MA 3TKDA 2DYXA 4GWOA 2DDKA 1FQEA 1Y4CA 3SEXA 2QS4A 4ELQA 4IGTA 5AA4A 3T9UA 3HHFA 4WEPA 3HFUA 5F24A 1DTZA 4H6DA 1I6BA 2ALUA 2FBPA 1B3EA 2XXIA 1B2HA 4LONB 5JEIA 1EYIA 3K6UA 1H45A 3SKPA 1J1NA 2THIA 4MEVA 5CC2A 2GH9A 4R74A 4H5GA 4FEDA 1DBZA 1TFDA 1GVCA 1BLFA 1NNTA 4POWA 4DXBA 2DOJA 1NV7A 4IY5A 4EQ9A 2V3TA 1PB7A 4MIJA 2XXVA 4ESWA 4GRKA 1A8FA 4RYAA 2AL4A 3IJXB 4BDRA 2VOZA 5I7IA 3T1BA 4OESA 3LUYA 1F9BA 2MKZA 1NV0A 1FQAA 5KDTA 2LAOA 1VE4A 5AA1A 2B65A 4OANA 4NF6A 2F35A 2UVJA 4RY1A 2OLBA 3BIGA 4ESXA 4X8RA 3U94A 2PT1A 3PMXA 3OO8A 3IOUA 2B3BA 5L8DA 2KQZA 4JVDA 4NF8A 4FBPA 3K0VA 4F2OA 4HE0A 2I49A 4PFYA 4ND9A 1OQGA 4L17A 2HZKA 5L9SA 1FPDA 1YAEA 2DWAA 3FVKA 1B40A 2WKYA 2QMXA 4LZ7A 2Q89A 5T3JA 2UYFA 1Y3NA 3MVXA 4TLLB 3SETA 4HE1A 4GOTA 4F22A 3O9PA 1JW5A 3FGSA 2H98A 3EHUA 3ILUB 1RYXA 4NF8B 4E0XA 2HHMA 3I3VA 3DP6A 5AA2B 4OYVA 3MWBA 4PGNA 4DCXA 1RDXA 4GWXA 2UVHA 3UA8A 2WBBA 3E13X 4PFUA 5TPAA 1FBHA 3ILTB 4C1TA 3HCQA 2NXOA 3VXCA 2RCAA 5EYGA 4U22A 1SYHA 3PUVE 1MY2A 2AIXA 4OENA 3H06B 1XVXA 3HSTA 5DVJA 1NNPA 4M1VA 3CFZA 3PU5A 1MXZA 1O7TA 3SEUA 1FBCA 2OBGA 4KPTA 4GWSA 1IQ7A 1A54A 3KJ7A 3UP9A 1FPJA 1LGBC 2P3VA 3HN0A 3CFXA 5DTBA 4YKJA 4OFJA 2X7PA 3KG2A 4IO7A 1P1OA 3KSJA 1VR5A 2CEYA 2RF1A 2UYEA 3TCGA 4MH5A 4UACA 4IR8A 1A99A 1B0HA 4OERA 3M3KA 3ZS6A 3PPQA 3RY3A 5TP9A 4FATA 4QHQA 2Q88A 5ET5A 4OZ9A 2Y7WA 4LQ5A 4YMAA 4F31B 4N8YA 1UTHA 1Q35A 2ONSA 4O8MA 2R9JA 3CSGA 2FVZA 2KR0A 5I56A 3EHSA 3U72A 2OX3A 3FZVA 3MVZA 2VP1A 1MQIA 5H8QA 3IO4A 4R9GA 1IIWA 3CVGA 4XTCQ 4RJZA 1BKAA 1SW2A 3R26A 3TCHA 1QGXA 1MS7A 4Q0CA 2HZLA 1Q9DA 4NF5B 4OQOA 1FTLA 1B4HA 1Y1ZA 4YU0A 4XIGQ 4G2ZA 3KC0A 3MP6A 4YB7A 1O63A 4EUOA 2V25A 2Z8FA 2G29A 3ROJA 1B6HA 2HFBA 4P47A 5FHMA 3CI8A 4GXAA 2OWSA 2ONRA 4RPOA 4QSDA 5I56B 3S9MC 2F3DA 5H8QB 3E9XA 3GYYA 1XHYA 3TTKA 2REJA 2DWHA 3TZAA 4KXPA 3UIFA 4U1ZA 3RQTA 2F8DA 4GVOA 1I6AA 1DOTA 4DI3D 4EQ7A 1IXHA 2XX7A 1LCFA 3T9HB 5CBRA 3MQ9A 3K00A 2CZHA 3A29A 1N0TA 5EQAA 1B7HA 1B1XA 2DWIA 3FJ7A 1QUKA 1FTMA 4OFLA 3IX1A 4POXA 4Q8RA 1OQHA 4R73A 4JSDA 2XXUA 1NUYA 3Q27A 4PAIA 1N3WA 3Q28A 3IB2A 3LSXA 4HTGA 5DEXB 2DVCA 1M5DA 2RINA 1SI0A 4R72A 1M5BA 1XI6A 2W7YA 3UGWA 4X48A 4YMBA 4F18A 4O3BA 1ZLQA 3H6UA 4FIMA 4XKRA 2WYPA 3TUSA 3MP8A 3B6QA 1MXWA 1XT8A 1Z7ME 3EHTA 1FPFA 2GHAA 3R6UA 3GXAA 5I57B 4TOZA 1FJ6A 1FBPA 1VFDA 3C9HA 1EYKA 1N04A 3KN3A 3FIRA 1T0KA 1NV2A 4JXIA 1FTAA 4EXLA 3C31A 3V8XB 3RGYA 2BJJX 1NKXA 4QSCA 2F7CA 4MX6A 3G3HA 4F2QA 1EZ9A 1M5EA 1MQJA 2V84A 3FVGA 1LBWA 4XKNA 4QBAA 5IZ3B 3K02A 1B0LA 2PFZA 1MQDA 1JVXA 2Y7KA 1IMBA 1VFEA 4RA1A 1NV5A 3PUWE 3FXUA 3IFCA 2AYSA 2R8TA 4FJPA 3SEWA 1QJMA 1WDNA 2F5XA 3T22A 2FHYA 3SESA 5M2VA 1SQYA 4Z0IA 4PC9A 5ISUA 2I3VA 1SDXA 4MLQA 1XS5A 2R71A 3QIMA 4GFRA 1SW4A 2UVIA 5B70A 1R6ZA 4U23A 3H03A 4NTLA 1FPLA 4PFWA 4P1LA 1IMCA 4BLAA 1NL5A 2DXRA 3DP8A 1A55A 2PYYA 3E3KA 4N17A 3K1NA 2I48A 1D9QA 3BKIB 3W9VA 3S4UA 4F3SA 1JNFA 1LBCA 4Q5TA 3K4UA 3VVFA 5HM4B 2Y5KA 3VVDA 4EDPA 1XOCA 2H9BA 1ZU0A 2CEXA 5J16A 3TDJA 1BTJA 3OENA 2OJTA 4GX6A 4QF9A 4OVPA 3HHGA 3DELB 3N5LA 2Q8MA 2CZIA 4N6DA 5FHNA 5EHSA 4C0RA 2XHDA 1GV8A 1Y1MA 3TODA 3MVWA 3FJGA 4LZ8A 4BDLA 2F97A 5JTYA 3U65A 2V93A 1MH3A 2O1MA 1N7XA 1IXIA 3G3GA 2H4IA 2ZMBA 3V5AA 4GBVA 4OVSA 3DP4A 1LSTA 5K2YA 3A3UA 3USDA 4GXSB 1JETA 2QRYA 4N07A 1M5FA 2H25A 2X7QA 1LBYA 1RYOA 2O68A 3B8BA 1CE2A 4ZS9A 5JTYB 1NUZA 4G68C 3G3IA 4P1EA 3CRBA 1MXUA 3JYRA 3KOTA 4PP0A 4DLDA 2ZYOA 1GGGA 4DCYA 3IFAA 3TPAA 1FPEA 3VFJA 3LC8A 4OFOA 1B32A 3PMWA 4N81A 4ZZEA 4AB5A 3N94A 3FV2A 4IB2A 1TXFA 2F6GA 3E78A 2XX9A 4HCWA 3BFUA 3UN6A 3DLNA 2ZYMA 5H8FA 1OVTA 3TELA 2XWVA 1QVSA 4OVTA 2QVUA 1B51A 1JQFA 3OO6A 3Q26A 1Z7NE 2PFYA 1NV4A 4R6YA 1IMDA 1H76A 4ISUA 4NF0A 3FASA 4JVIA 2O6AA 1A7LA 4GD5A 1H44A 2ONKE 2X26A 3ZKKA 4JDFA 2GQ1A 2O51A 4ZE9A 4MLVA 4KR5A 3CG3A 3QYTA 1B3HA 2FIXA 4YICA 4TQUQ 1D3KA 5H8FB 3IORA 2F34A 3M3FA 4YZZA 1ZIUA 4Z7EA 3QUFA 1R9LA 2I58A 5IM2A 5I59B 4FORA 3PUZE 3KN8A 2HXRA 1B58A 3IR1A 1EYJA 4AS5A 1DPEA 4GX4A 3C35A 3LSWA 5AA2A 3EN3A 4OVJA 2IA4A 2F7AA 4KYDA 4BDOA 2O7UA 1I69A 2E1SA 5ELVA 2F36A 3P7IA 2PCRA 4PTKA 1P99A 2Z8EA 3V89B 1BK4A 1O64A 1MH4A 4HS7A 4MNCA 1DCUA 2VHAA 4EF2A 4NF4B 3TTNA 2F6PA 1II5A 1FBDA 1ELJA 4GL0A 4JBZA 3PPNA 2F78A 2WEFA 1NV1A 3QUJA 1YTVA 1SVXB 2XD2A 5F7VA 1QULA 3PD9A 3F11A 3IB0A 2WYKA 4KHZE 5ITPA 1B05A 1OIBA 1LAHE 3ISPA 3O66A 2UVGA 2DE3A 4MCOA 3QXMA 4P0IA 3A09A 3RUMA 5LTCA 4PQJA 2ZXTA 4FAJA 5H8NB 2P3NA 4ZZAA 4NWCA 5EQ7A 3T93B 3E4RA 5IZ1A 1N84A 1LBZA 2O84X 3QK6A 4F19A 4P8BA 1YXIA 1B7ZA 2QL3A 3IO6A 1Y9UA 5HPQA 3OO7A 5FTHA 4ZE8A 3N6TA 1Y3QA 2ZNTA 4NF5A 2HCAA 4OETA 3VLUA 3VVEA 4PF6A 1LLSA 1LEVA 4IO2A 4U1OA 2RC7A 4OWDA 5CBSA 2OCUA 1KZ8A 2YLNA 3G3FA 1UQWA 1MM7A 1AIVA 3W9WA 2RC9A 5B7DA 3D4CA 4H45A 1ZTYA 3KFMA 3T0JA 3OO9A 3TFLA 2FIEA 4R75A 1SD3A 4MNIA 4R9FA 1N3XA 1B5JA 3MC2A 1SW5A 5ICTA 4LN5A 4X1DA 1ATGA 3IL1B 5ESYA 3R7XA 2VGQA 3EKIA 1DMBA 1PC3A 3S9NC 4ZEDA 5ICQA 2UXAA 4X04A 4DXUA 3JZJA 3A3CA 2OWTA 3H6TA 5CM6A 4BDQA 2PX1A 2QVVA 5KCJA 1G0HA 1ZMGA 2Q2AA 4GWWA 3B7DA 4PE5B 1IMFA 1P1NA 5CRYA 1B46A 5DEXA 1FRPA 5HBCA 4N8GA 2NVUB 3G3KA 3VLWA 4JWYA 4PE3A 4EXKA 1YCJA 1A8EA 4GWYA 3ONMA 1EH3A 1CNQA 3KSXA 3KC1A 4KQPA 1CB6A 1LCTA 1IITA 3MAMA 3KJTA 4KFQA 5KCJB 4G77A 4QFPA 3FXBA 4I3EA 4FEBA 3K6XA 1UIUA 4U4SA 4NQ8A 5H8SA 1D4NA 4AQ4A 3O28A 1EZPA 5I57A 3GLBA 1SPIA 4IO4A 4PCDA 1FTKA 3MVYA 1OMPA 1RDYA 1MDQA 5AA3A 4UABA 3FATA 1OLAA 4H5FA 1QKBA 1PDAA 3WAEA 3SEVA 3IB1A 2FNCA 3OXNA 4IO3A 4PGPA 5I2NA 5I5PA 4OEVA 3KBZA 1MXVA 3VXBA 3H3GA 5IZ3A 2GFEA 3OEKA 5K2XA 5BWJA 5AE4A 5CMCA 4NN3A 2VD2A 3U8QA 3IK6B 5ITOA 2V3UA 1HSEA 5DT6A 3ODBA 2ESNA 1PB8A 1FQDA 1FBEA 1MPDA 4KI0E 3MSTA 5I2NB 3MP1A 5EQ8A 2NWJA 1USYE 5F1QA 1QKAA 2ZYKA 2I4CA 2Q9TA 1MQHA 4R2BA 4F3PA 5DVFA 2XXYA 4NHBA 4XXUA 3FD3A 3RT8A 3BIHA 3U1OA 3QMFA 4MFIA 5ET7A 3VV5A 2WX9A 2QJEA 3IJOB 5JK4A 1M5CA 1DTGA 1YZ0A 2ANJA 4GWZA 4YB6A 2NUVA 2Y7PA 4WXJA 3Q29A 1AOVA 1SI1A 3M3LA 4MJOA 4H8IA 4H8JA 4GWUA 3ZSFA 1JP4A 3RT6B 4U2RA 1FPKA 4G8NA 4I1DA 3TQWA 1HSJA 3H6VA 1IEJA 4RK2A 4I8CA 3K1PA 4HW8A 2QS3A 2Z8DA 4YB5A 1PBQA 1JVYA 4ZECA 4XKPA 3MZ1A 3H7MA 1FBGA 2OK2A 4N91A 2XXTA 1N76A 2I3WA 4P9KA 1NUWA 4PETA 4P3LA 1Q1KA 1JEVA 2ZYNA 4LVQA 4JWOA 4OXVA 1URGA 1USYH 3M8UA 2Q2CA 4F3BA 2HAVA 4FE8A 1MPCA 4O3CA 2Y84A 3SERA 1L5TA 2GRVA 4JSOA 3UORA 5I84A 4THIA 4PAFA 3C34A 5BUUA 2QS2A 3QAXA 4WKMA 2XXHA 3RLFE 4XFEA 1EZOA 1MG1A 2R6GE 3K6WA 4LUBA 2ZNUA 1NUXA 4ECFA 3PGFA 1LFGA 4AS4A 4NX1A 4DE8A 3TTRA 3KOSA 1US5A 1ZKBA 3TTMA 1MY1A 4I9DA 5KZTA 1Y3PA 2PT2A 2B3FA 4MMPA 3RNNA 3KGCA 4ONYA 2O69A 4YAHX 1B52A 2I0CA 1JEUA 4NMYA 3L6GA 3QSLA 3AXFA 5I2KA 1ANFA 4O7IA 4QSEA 1NV3A 4NG7A 1LAGE 4C1UA 3VLVA 4R6HA 1S50A 3OOAA 3IOWA 4DXCA 2XXWA 2DWJA 3H6WA 3KBRA 3TAJA 4OTEA 5TU0A 4NAPA 1XC1A 1US4A 2Q74A 3LR1A 2QSXA 2JJKA 2XWKA 3O6GA 3HV1A 2XWOA 1POY1 1MXXA 3PPRA 3MBPA 5J1DA 5DVIA 4GBWA 5I2KB 1JW4A 4I62A 1DPPA 1PBPA 3K6VA 3C4MA 2VPNA 3TMGA 1MRPA 4MF3A 3TQLA 1RKMA 1NFTA 4R6KA 3KN7A 3EPEA 4H67A 5I59A 1IUDA 3T9XB 3TCFA 1BP5A 4X1BA 3DM0A 1B9JA 3WAFA 4OHNA 1MY3A 2QVRA 2KLFA 1IXCA 2XXQA 3T66A 5AA2D 1I6QA 3U93A 4P56A 2F3BA 4QFKA 4RXLA 5AA4B 4IGRA 1FQCA 1NNFA 2Y7IA 2HXWA 4H65A 1IZ1A 2QS1A 4O94A 3SDFA 2VPOA 1SW1A 1IMAA 1G0IA 4XKQA 4F1UA 3BBRA 3RYDA 1AWBA 2P1SA 5ET6A 4GF8A 2DXYA 2ZZWA 3OMBA 3I6VA 4YKKA 3EF7A 4NF4A 4G8MA 1A40A 4PBQA 4QXDA 3B6WA 2HPGA 4NEDA 3U92A 3ECRA 4QFLA 4N15A 1QUIA 3Q25A 4G68A 5DW8A 1LAXA 5IGAA 5CMKA 1PB9A 2DS9A 1R1NA 3K01A 2RC8A 2Z23A 5KDTB 5A5LA 4OA4A 1K9YA 1PEBA 2AL5A 5H8HA 4HCYA 4NF6B 1P1QA 1S7YA 5EHMA 3FXRA 2A5SA 3JV9A 1N7WA 4U4XA 4LQ2A 5ET8A 3FUZA 5H8NA 1B7UA 4G68B 5L9OA 4F1VA 3PTYA 3MZ9A 2E0SA 4M4GA 2PMSA 3MW0A 2REGA 5H8HB 3KEIA 4XF5A 2DE4A 1AH5A 4Q30B 4FECA 4PFIA 3LBSA 5FTIA 4HXVA 4U21A 4PF8A 2IEEA 2VT5A 2XXPA 1Y4TA 5CMBA 2I4BA 2PVUA 3T9VA 3LSLA 1FTJA 2OWZA 1AL3A 4YKPA 4QFOA 2O1LA 2XXRA 2XD3A 1TWYA 2XWIA 4TLMB 5TPAB 1YPNA 2QMWA 1MY4A 3SEYA 4PFTA 3SZPA 3TTLA 4EQBA 1WODA 4MAGA 2O7IA 2DE2A 1VDWA 4YKIA 1FQFA 4XEQA 4BDNA 1KWHA 4E0WA 3S9LC 2HQ0A 4G8HA 1LBVA 4OMBA 3RTWB 1NH8A 2H5YA 2DSFA 1LB8A 3LV0A 4IO5A 4ZEFA 2ZNSA 4F39A 1MXYA 3OEMA 2Y5LA 3S9EA 4N6PA 4JVCA 2D3IA 3T96B 3PD8A 4RK9A 2Q8JA 4O7MA 5FBPA 1MDP1 4F3GA 1B4ZA 3IOTA 3TYHA 1P1WA 5A5XA 1IXGA 2P0SA 1NNKA 2QFLA 1QUJA 4JWXA 1OLCA 4DIGA 1LFHA 3CSBA 2B4LA 1KA1A 1URDA 2GHBA 3CIJA 1MQGA 5CMMA 5TP9B 1S9TA
chains in the Genus database with same CATH topology
1Y20A 2I0BA 3C36A 1HSLA 1UTHB 3ZKLA 3O29A 4P11A 5LOMA 1MY0A 3CG1A 3PMVA 4F29A 5A5XB 4NWDA 2RCBA 4O3AA 2FA7A 3RN8A 2D5WA 4ZEBA 4F1YA 1H3DA 3CFLA 3GZGA 5CI5A 4AB6A 3FVNA 3HPIA 3C33A 3FJMA 4ELRA 1LBBA 1D9YA 1LFIA 2PBWA 3VDFA 4K3FA 1XVYA 4KYEA 4LA9A 3THIA 1URSA 4GL8A 3I5OA 4X9TA 2F7BA 2I6EA 2H99A 4G4PA 3D4GA 3GBBA 3MJNA 3OSRA 1FQBA 3G7WA 2M8CA 4ELPA 2YPNA 3O2AA 1ZBMA 5L9MA 4KD5A 3O6IA 3FVOA 4QRZA 3N26A 3KZGA 1POTA 3V83A 3PUXE 1MM6A 1B5HA 4P0GA 3C32A 1QW0A 3FV1A 3H4ZA 3G3JA 1UTBA 4KYSA 1LAFE 1AMFA 4UA8A 2P2AA 1WVJA 4JB7A 3IAZA 1MPBA 2XX8A 2NOOA 2CZLA 3O97A 1JW1A 2XXXA 1TFAA 1UTBB 3MPLA 4GIZA 1FTOA 1ZJLA 1LB9A 4H1XA 5EYFA 3W15C 2QPQA 3N6UA 2A5TA 2HAUA 3UK4A 2HEUA 3VE1B 4IO6A 4GQOA 1B3FA 1EU8A 3OD7A 2V3QA 3PV0E 5IKBA 4R2FA 1SBPA 1VSOA 3RTFB 3BFTA 5I58A 1UIVA 1P1UA 4LZ5A 5DYHA 3B6TA 4KCCA 4WEDA 3RPWA 3FXQA 3MUQA 3LSFB 3OSQA 4LP2B 2A5TB 2ABHA 1TT1A 3PPPA 3OELA 1SYIA 2G93A 3S2VA 4OEUA 2VD3A 1H43A 1B3GA 1FCKA 1DSNA 3O6HA 3MZBA 1GTKA 3CR9A 4H0WA 3L6HA 3PUYE 2Z22A 5I58B 1FW0A 4ZDMA 5FHOA 3PPOA 2RKMA 2DVZA 3K2DA 3GBAA 1R9QA 4NE4A 4DZ1A 4RPNA 1B1HA 1B3LA 2OZZA 4BDMA 2D21A 4N13A 3HO7A 4DDDA 3IOVA 4IY6A 3K1MA 4RNSA 4MBPA 4ELOA 1BIYA 1GR2A 5IAIA 2DP8A 4EF1A 4QFNA 2DQVA 1B5IA 4ZEKA 3TEPA 1OVBA 4LATA 2CMOA 2Y7RA 1NMUA 2FYIA 4KCDA 4ZEIA 3EQ1A 2YJPA 3MPKA 1D9VA 1NH7A 4GLIA 3TKDA 2DYXA 4GWOA 1FQEA 1Y4CA 3SEXA 2QS4A 4ELQA 4IGTA 5AA4A 3T9UA 3HHFA 4WEPA 1DTZA 4H6DA 1I6BA 2ALUA 1B3EA 2XXIA 1B2HA 4LONB 5JEIA 3K6UA 1H45A 3SKPA 1J1NA 2THIA 5CC2A 2GH9A 4R74A 4H5GA 4FEDA 1TFDA 1GVCA 1BLFA 1NNTA 4POWA 4DXBA 2DOJA 4IY5A 4EQ9A 2V3TA 1PB7A 2XXVA 4ESWA 4GRKA 1A8FA 4RYAA 2AL4A 3IJXB 4BDRA 2VOZA 4OESA 3LUYA 1F9BA 1FQAA 5KDTA 2LAOA 1VE4A 5AA1A 2B65A 4NF6A 2F35A 2UVJA 4RY1A 2OLBA 4ESXA 3U94A 2PT1A 3PMXA 3OO8A 3IOUA 2B3BA 5L8DA 4NF8A 3K0VA 4F2OA 2I49A 4PFYA 4ND9A 1OQGA 4L17A 2HZKA 5L9SA 1YAEA 2DWAA 3FVKA 1B40A 2WKYA 2QMXA 4LZ7A 2Q89A 2UYFA 1Y3NA 3MVXA 4TLLB 3SETA 4GOTA 4F22A 3O9PA 1JW5A 3FGSA 2H98A 3EHUA 3ILUB 1RYXA 4NF8B 4E0XA 3I3VA 3DP6A 5AA2B 4OYVA 3MWBA 4DCXA 2UVHA 3UA8A 3E13X 4PFUA 5TPAA 3ILTB 4C1TA 3HCQA 2NXOA 3VXCA 2RCAA 4U22A 1SYHA 3PUVE 1MY2A 2AIXA 4OENA 3H06B 1XVXA 3HSTA 5DVJA 1NNPA 4M1VA 3CFZA 3PU5A 1MXZA 1O7TA 3SEUA 2OBGA 4KPTA 1IQ7A 1A54A 3KJ7A 3UP9A 1LGBC 3HN0A 3CFXA 5DTBA 4YKJA 4OFJA 2X7PA 3KG2A 4IO7A 1P1OA 3KSJA 1VR5A 2RF1A 2UYEA 3TCGA 4MH5A 4UACA 1A99A 1B0HA 4OERA 3M3KA 3ZS6A 3PPQA 3RY3A 5TP9A 4FATA 4QHQA 2Q88A 4OZ9A 2Y7WA 4LQ5A 4YMAA 4F31B 1UTHA 1Q35A 2ONSA 2R9JA 3CSGA 5I56A 3EHSA 3U72A 3FZVA 3MVZA 2VP1A 1MQIA 5H8QA 3IO4A 4R9GA 1IIWA 3CVGA 4XTCQ 4RJZA 1BKAA 1SW2A 3R26A 3TCHA 1MS7A 4Q0CA 2HZLA 4NF5B 4OQOA 1FTLA 1B4HA 1Y1ZA 4YU0A 4XIGQ 4G2ZA 3MP6A 4YB7A 1O63A 4EUOA 2V25A 2Z8FA 2G29A 1B6HA 2HFBA 5FHMA 3CI8A 4GXAA 2OWSA 2ONRA 4RPOA 4QSDA 5I56B 3S9MC 5H8QB 3E9XA 1XHYA 3TTKA 2REJA 2DWHA 3TZAA 3UIFA 4U1ZA 3RQTA 2F8DA 4GVOA 1I6AA 1DOTA 4EQ7A 1IXHA 2XX7A 1LCFA 3T9HB 5CBRA 3MQ9A 3K00A 1N0TA 1B7HA 1B1XA 2DWIA 3FJ7A 1QUKA 1FTMA 4OFLA 3IX1A 4POXA 4Q8RA 1OQHA 4R73A 4JSDA 2XXUA 3Q27A 1N3WA 3Q28A 3IB2A 3LSXA 4HTGA 5DEXB 2DVCA 1M5DA 2RINA 1SI0A 4R72A 1M5BA 2W7YA 3UGWA 4X48A 4YMBA 4F18A 4O3BA 1ZLQA 3H6UA 4FIMA 4XKRA 3TUSA 3MP8A 3B6QA 1MXWA 1XT8A 1Z7ME 3EHTA 2GHAA 3R6UA 3GXAA 5I57B 4TOZA 1VFDA 3C9HA 1N04A 3KN3A 3FIRA 1T0KA 4JXIA 4EXLA 3C31A 3V8XB 3RGYA 2BJJX 1NKXA 4QSCA 2F7CA 3G3HA 4F2QA 1EZ9A 1M5EA 1MQJA 2V84A 3FVGA 4XKNA 3K02A 1B0LA 1MQDA 1JVXA 2Y7KA 1VFEA 4RA1A 3PUWE 3FXUA 2AYSA 4FJPA 3SEWA 1QJMA 1WDNA 2F5XA 3T22A 3SESA 5M2VA 1SQYA 4Z0IA 5ISUA 2I3VA 1SDXA 1XS5A 4MLQA 2R71A 3QIMA 4GFRA 1SW4A 2UVIA 5B70A 1R6ZA 4U23A 3H03A 4NTLA 4PFWA 4BLAA 1NL5A 2DXRA 3DP8A 1A55A 2PYYA 3E3KA 3K1NA 2I48A 3BKIB 3W9VA 3S4UA 4F3SA 1JNFA 1LBCA 4Q5TA 3K4UA 3VVFA 5HM4B 3VVDA 4EDPA 1XOCA 2H9BA 1ZU0A 3TDJA 1BTJA 3OENA 2OJTA 4QF9A 3HHGA 3DELB 3N5LA 5FHNA 5EHSA 4C0RA 2XHDA 1GV8A 1Y1MA 3TODA 3MVWA 3FJGA 4LZ8A 4BDLA 2F97A 5JTYA 2V93A 1MH3A 2O1MA 1N7XA 1IXIA 3G3GA 2H4IA 2ZMBA 3V5AA 3DP4A 1LSTA 5K2YA 3A3UA 3USDA 4GXSB 1JETA 2QRYA 4N07A 1M5FA 2H25A 2X7QA 1RYOA 2O68A 1CE2A 4ZS9A 5JTYB 4G68C 3G3IA 3CRBA 1MXUA 3JYRA 3KOTA 4PP0A 4DLDA 2ZYOA 1GGGA 4DCYA 3TPAA 3VFJA 3LC8A 4OFOA 1B32A 3PMWA 4ZZEA 4AB5A 3N94A 3FV2A 4IB2A 1TXFA 2F6GA 2XX9A 4HCWA 3BFUA 3UN6A 3DLNA 2ZYMA 5H8FA 1OVTA 3TELA 1QVSA 1B51A 1JQFA 3OO6A 3Q26A 1Z7NE 4R6YA 1H76A 4ISUA 3FASA 2O6AA 1A7LA 4GD5A 1H44A 2ONKE 2X26A 3ZKKA 4JDFA 2O51A 4ZE9A 4MLVA 4KR5A 3CG3A 3QYTA 1B3HA 4YICA 4TQUQ 1D3KA 5H8FB 3IORA 2F34A 3M3FA 4YZZA 1ZIUA 4Z7EA 3QUFA 1R9LA 2I58A 5I59B 4FORA 3PUZE 3KN8A 1B58A 3IR1A 1DPEA 3C35A 3LSWA 5AA2A 3EN3A 4OVJA 2IA4A 2F7AA 4KYDA 4BDOA 2O7UA 1I69A 2E1SA 5ELVA 2F36A 3P7IA 1P99A 2Z8EA 3V89B 1O64A 1MH4A 4HS7A 2VHAA 4EF2A 4NF4B 3TTNA 2F6PA 1II5A 1ELJA 4GL0A 4JBZA 3PPNA 2F78A 3QUJA 1YTVA 1SVXB 2XD2A 5F7VA 1QULA 3PD9A 3F11A 3IB0A 4KHZE 5ITPA 1B05A 1OIBA 1LAHE 3O66A 2UVGA 2DE3A 3QXMA 4P0IA 3A09A 3RUMA 4PQJA 2ZXTA 4FAJA 5H8NB 4ZZAA 4NWCA 3T93B 3E4RA 1N84A 2O84X 3QK6A 4F19A 1B7ZA 2QL3A 3IO6A 1Y9UA 5HPQA 3OO7A 5FTHA 4ZE8A 3N6TA 1Y3QA 2ZNTA 4NF5A 2HCAA 4OETA 3VLUA 3VVEA 1LLSA 4IO2A 4U1OA 2RC7A 4OWDA 5CBSA 2OCUA 2YLNA 3G3FA 1UQWA 1MM7A 1AIVA 3W9WA 2RC9A 5B7DA 3D4CA 1ZTYA 3KFMA 3TFLA 3OO9A 4R75A 1SD3A 4R9FA 1N3XA 1B5JA 3MC2A 1SW5A 5ICTA 4X1DA 1ATGA 3IL1B 3R7XA 2VGQA 1DMBA 1PC3A 3S9NC 4ZEDA 5ICQA 2UXAA 4DXUA 3JZJA 3A3CA 2OWTA 3H6TA 5CM6A 4BDQA 2PX1A 5KCJA 1ZMGA 2Q2AA 3B7DA 4PE5B 1P1NA 5CRYA 1B46A 5DEXA 5HBCA 2NVUB 3G3KA 3VLWA 4JWYA 4EXKA 1YCJA 1A8EA 3ONMA 1EH3A 3KSXA 4KQPA 1CB6A 1LCTA 1IITA 3MAMA 3KJTA 4KFQA 5KCJB 4G77A 4QFPA 4FEBA 3K6XA 1UIUA 4U4SA 5H8SA 1D4NA 4AQ4A 3O28A 1EZPA 5I57A 3GLBA 4IO4A 1FTKA 3MVYA 1OMPA 1MDQA 5AA3A 3FATA 1OLAA 4H5FA 1QKBA 1PDAA 3WAEA 3SEVA 3IB1A 2FNCA 3OXNA 4IO3A 5I2NA 4OEVA 1MXVA 3VXBA 3H3GA 2GFEA 3OEKA 5K2XA 5BWJA 5AE4A 5CMCA 2VD2A 3U8QA 3IK6B 5ITOA 2V3UA 1HSEA 5DT6A 3ODBA 2ESNA 1PB8A 1FQDA 1MPDA 4KI0E 5I2NB 3MP1A 2NWJA 1USYE 5F1QA 1QKAA 2ZYKA 2I4CA 2Q9TA 1MQHA 4R2BA 4F3PA 5DVFA 2XXYA 4XXUA 3FD3A 3RT8A 3U1OA 4MFIA 3VV5A 2QJEA 3IJOB 5JK4A 1M5CA 1DTGA 2ANJA 4YB6A 2NUVA 2Y7PA 4WXJA 3Q29A 1AOVA 1SI1A 3M3LA 4H8IA 4H8JA 3ZSFA 3RT6B 4U2RA 4G8NA 4I1DA 3TQWA 1HSJA 3H6VA 1IEJA 4RK2A 4I8CA 3K1PA 4HW8A 2QS3A 2Z8DA 4YB5A 1PBQA 1JVYA 4ZECA 4XKPA 3MZ1A 3H7MA 2OK2A 2XXTA 1N76A 2I3WA 4PETA 1Q1KA 1JEVA 2ZYNA 4LVQA 4JWOA 4OXVA 1URGA 1USYH 3M8UA 2Q2CA 4F3BA 2HAVA 4FE8A 1MPCA 4O3CA 2Y84A 3SERA 1L5TA 2GRVA 4JSOA 3UORA 5I84A 4THIA 3C34A 5BUUA 2QS2A 3QAXA 4WKMA 2XXHA 3RLFE 1EZOA 1MG1A 2R6GE 3K6WA 4LUBA 2ZNUA 4ECFA 3PGFA 1LFGA 4DE8A 3TTRA 3KOSA 1US5A 1ZKBA 3TTMA 1MY1A 4I9DA 5KZTA 1Y3PA 2PT2A 2B3FA 3RNNA 3KGCA 4ONYA 2O69A 4YAHX 1B52A 2I0CA 1JEUA 4NMYA 3L6GA 3QSLA 3AXFA 5I2KA 1ANFA 4QSEA 1LAGE 4C1UA 3VLVA 4R6HA 1S50A 3OOAA 3IOWA 4DXCA 2XXWA 2DWJA 3H6WA 3KBRA 3TAJA 4OTEA 5TU0A 1XC1A 1US4A 3LR1A 2QSXA 3O6GA 3HV1A 1POY1 1MXXA 3PPRA 3MBPA 5J1DA 5DVIA 5I2KB 1JW4A 4I62A 1DPPA 1PBPA 3K6VA 3C4MA 3TMGA 1MRPA 4MF3A 3TQLA 1RKMA 1NFTA 4R6KA 3KN7A 3EPEA 4H67A 5I59A 1IUDA 3T9XB 3TCFA 1BP5A 4X1BA 3DM0A 1B9JA 3WAFA 4OHNA 1MY3A 2KLFA 1IXCA 2XXQA 3T66A 5AA2D 1I6QA 3U93A 4QFKA 4RXLA 5AA4B 4IGRA 1FQCA 1NNFA 2Y7IA 2HXWA 4H65A 1IZ1A 2QS1A 3SDFA 1SW1A 4XKQA 4F1UA 3BBRA 2P1SA 4GF8A 2DXYA 3OMBA 3I6VA 4YKKA 3EF7A 4NF4A 4G8MA 1A40A 3B6WA 4NEDA 3U92A 3ECRA 4QFLA 1QUIA 3Q25A 4G68A 1LAXA 5CMKA 1PB9A 2DS9A 1R1NA 3K01A 2RC8A 2Z23A 5KDTB 1PEBA 2AL5A 5H8HA 4HCYA 4NF6B 1P1QA 1S7YA 5EHMA 3FXRA 2A5SA 3JV9A 1N7WA 4U4XA 4LQ2A 3FUZA 5H8NA 1B7UA 4G68B 5L9OA 4F1VA 3MZ9A 2E0SA 4M4GA 2PMSA 3MW0A 2REGA 5H8HB 3KEIA 2DE4A 1AH5A 4Q30B 4FECA 3LBSA 5FTIA 4U21A 2IEEA 2XXPA 1Y4TA 5CMBA 2I4BA 2PVUA 3T9VA 3LSLA 1FTJA 1AL3A 4YKPA 4QFOA 2O1LA 2XXRA 2XD3A 1TWYA 4TLMB 5TPAB 1YPNA 2QMWA 1MY4A 3SEYA 4PFTA 3TTLA 4EQBA 1WODA 2O7IA 2DE2A 4YKIA 1FQFA 4BDNA 1KWHA 4E0WA 3S9LC 2HQ0A 4G8HA 4OMBA 3RTWB 1NH8A 2H5YA 2DSFA 1LB8A 4IO5A 4ZEFA 2ZNSA 4F39A 1MXYA 3OEMA 3S9EA 4N6PA 2D3IA 3T96B 3PD8A 4RK9A 2Q8JA 1MDP1 4F3GA 1B4ZA 3IOTA 3TYHA 1P1WA 5A5XA 1IXGA 2P0SA 1NNKA 1QUJA 4JWXA 1OLCA 4DIGA 1LFHA 3CSBA 1URDA 2GHBA 3CIJA 1MQGA 5CMMA 5TP9B 1S9TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y20 A;  2I0B A;  3C36 A;  1HSL A;  1UTH B;  3ZKL A;  3O29 A;  4P11 A;  5LOM A;  1MY0 A;  3CG1 A;  3PMV A;  4F29 A;  5A5X B;  4NWD A;  2RCB A;  4O3A A;  2FA7 A;  3RN8 A;  2D5W A;  4ZEB A;  4F1Y A;  1H3D A;  3CFL A;  3GZG A;  5CI5 A;  4AB6 A;  3FVN A;  3HPI A;  3C33 A;  3FJM A;  4ELR A;  1LBB A;  1D9Y A;  1LFI A;  2PBW A;  3VDF A;  4K3F A;  1XVY A;  4KYE A;  4LA9 A;  3THI A;  1URS A;  4GL8 A;  3I5O A;  4X9T A;  2F7B A;  2I6E A;  2H99 A;  4G4P A;  3D4G A;  3GBB A;  3MJN A;  3OSR A;  1FQB A;  3G7W A;  2M8C A;  4ELP A;  2YPN A;  3O2A A;  1ZBM A;  5L9M A;  4KD5 A;  3O6I A;  3FVO A;  4QRZ A;  3N26 A;  3KZG A;  1POT A;  3V83 A;  3PUX E;  1MM6 A;  1B5H A;  4P0G A;  3C32 A;  1QW0 A;  3FV1 A;  3H4Z A;  3G3J A;  1UTB A;  4KYS A;  1LAF E;  1AMF A;  4UA8 A;  2P2A A;  1WVJ A;  4JB7 A;  3IAZ A;  1MPB A;  2XX8 A;  2NOO A;  2CZL A;  3O97 A;  1JW1 A;  2XXX A;  1TFA A;  1UTB B;  3MPL A;  4GIZ A;  1FTO A;  1ZJL A;  1LB9 A;  4H1X A;  5EYF A;  3W15 C;  2QPQ A;  3N6U A;  2A5T A;  2HAU A;  3UK4 A;  2HEU A;  3VE1 B;  4IO6 A;  4GQO A;  1B3F A;  1EU8 A;  3OD7 A;  2V3Q A;  3PV0 E;  5IKB A;  4R2F A;  1SBP A;  1VSO A;  3RTF B;  3BFT A;  5I58 A;  1UIV A;  1P1U A;  4LZ5 A;  5DYH A;  3B6T A;  4KCC A;  4WED A;  3RPW A;  3FXQ A;  3MUQ A;  3LSF B;  3OSQ A;  4LP2 B;  2A5T B;  2ABH A;  1TT1 A;  3PPP A;  3OEL A;  1SYI A;  2G93 A;  3S2V A;  4OEU A;  2VD3 A;  1H43 A;  1B3G A;  1FCK A;  1DSN A;  3O6H A;  3MZB A;  1GTK A;  3CR9 A;  4H0W A;  3L6H A;  3PUY E;  2Z22 A;  5I58 B;  1FW0 A;  4ZDM A;  5FHO A;  3PPO A;  2RKM A;  2DVZ A;  3K2D A;  3GBA A;  1R9Q A;  4NE4 A;  4DZ1 A;  4RPN A;  1B1H A;  1B3L A;  2OZZ A;  4BDM A;  2D21 A;  4N13 A;  3HO7 A;  4DDD A;  3IOV A;  4IY6 A;  3K1M A;  4RNS A;  4MBP A;  4ELO A;  1BIY A;  1GR2 A;  5IAI A;  2DP8 A;  4EF1 A;  4QFN A;  2DQV A;  1B5I A;  4ZEK A;  3TEP A;  1OVB A;  4LAT A;  2CMO A;  2Y7R A;  1NMU A;  2FYI A;  4KCD A;  4ZEI A;  3EQ1 A;  2YJP A;  3MPK A;  1D9V A;  1NH7 A;  4GLI A;  3TKD A;  2DYX A;  4GWO A;  1FQE A;  1Y4C A;  3SEX A;  2QS4 A;  4ELQ A;  4IGT A;  5AA4 A;  3T9U A;  3HHF A;  4WEP A;  1DTZ A;  4H6D A;  1I6B A;  2ALU A;  1B3E A;  2XXI A;  1B2H A;  4LON B;  5JEI A;  3K6U A;  1H45 A;  3SKP A;  1J1N A;  2THI A;  5CC2 A;  2GH9 A;  4R74 A;  4H5G A;  4FED A;  1TFD A;  1GVC A;  1BLF A;  1NNT A;  4POW A;  4DXB A;  2DOJ A;  4IY5 A;  4EQ9 A;  2V3T A;  1PB7 A;  2XXV A;  4ESW A;  4GRK A;  1A8F A;  4RYA A;  2AL4 A;  3IJX B;  4BDR A;  2VOZ A;  4OES A;  3LUY A;  1F9B A;  1FQA A;  5KDT A;  2LAO A;  1VE4 A;  5AA1 A;  2B65 A;  4NF6 A;  2F35 A;  2UVJ A;  4RY1 A;  2OLB A;  4ESX A;  3U94 A;  2PT1 A;  3PMX A;  3OO8 A;  3IOU A;  2B3B A;  5L8D A;  4NF8 A;  3K0V A;  4F2O A;  2I49 A;  4PFY A;  4ND9 A;  1OQG A;  4L17 A;  2HZK A;  5L9S A;  1YAE A;  2DWA A;  3FVK A;  1B40 A;  2WKY A;  2QMX A;  4LZ7 A;  2Q89 A;  2UYF A;  1Y3N A;  3MVX A;  4TLL B;  3SET A;  4GOT A;  4F22 A;  3O9P A;  1JW5 A;  3FGS A;  2H98 A;  3EHU A;  3ILU B;  1RYX A;  4NF8 B;  4E0X A;  3I3V A;  3DP6 A;  5AA2 B;  4OYV A;  3MWB A;  4DCX A;  2UVH A;  3UA8 A;  3E13 X;  4PFU A;  5TPA A;  3ILT B;  4C1T A;  3HCQ A;  2NXO A;  3VXC A;  2RCA A;  4U22 A;  1SYH A;  3PUV E;  1MY2 A;  2AIX A;  4OEN A;  3H06 B;  1XVX A;  3HST A;  5DVJ A;  1NNP A;  4M1V A;  3CFZ A;  3PU5 A;  1MXZ A;  1O7T A;  3SEU A;  2OBG A;  4KPT A;  1IQ7 A;  1A54 A;  3KJ7 A;  3UP9 A;  1LGB C;  3HN0 A;  3CFX A;  5DTB A;  4YKJ A;  4OFJ A;  2X7P A;  3KG2 A;  4IO7 A;  1P1O A;  3KSJ A;  1VR5 A;  2RF1 A;  2UYE A;  3TCG A;  4MH5 A;  4UAC A;  1A99 A;  1B0H A;  4OER A;  3M3K A;  3ZS6 A;  3PPQ A;  3RY3 A;  5TP9 A;  4FAT A;  4QHQ A;  2Q88 A;  4OZ9 A;  2Y7W A;  4LQ5 A;  4YMA A;  4F31 B;  1UTH A;  1Q35 A;  2ONS A;  2R9J A;  3CSG A;  5I56 A;  3EHS A;  3U72 A;  3FZV A;  3MVZ A;  2VP1 A;  1MQI A;  5H8Q A;  3IO4 A;  4R9G A;  1IIW A;  3CVG A;  4XTC Q;  4RJZ A;  1BKA A;  1SW2 A;  3R26 A;  3TCH A;  1MS7 A;  4Q0C A;  2HZL A;  4NF5 B;  4OQO A;  1FTL A;  1B4H A;  1Y1Z A;  4YU0 A;  4XIG Q;  4G2Z A;  3MP6 A;  4YB7 A;  1O63 A;  4EUO A;  2V25 A;  2Z8F A;  2G29 A;  1B6H A;  2HFB A;  5FHM A;  3CI8 A;  4GXA A;  2OWS A;  2ONR A;  4RPO A;  4QSD A;  5I56 B;  3S9M C;  5H8Q B;  3E9X A;  1XHY A;  3TTK A;  2REJ A;  2DWH A;  3TZA A;  3UIF A;  4U1Z A;  3RQT A;  2F8D A;  4GVO A;  1I6A A;  1DOT A;  4EQ7 A;  1IXH A;  2XX7 A;  1LCF A;  3T9H B;  5CBR A;  3MQ9 A;  3K00 A;  1N0T A;  1B7H A;  1B1X A;  2DWI A;  3FJ7 A;  1QUK A;  1FTM A;  4OFL A;  3IX1 A;  4POX A;  4Q8R A;  1OQH A;  4R73 A;  4JSD A;  2XXU A;  3Q27 A;  1N3W A;  3Q28 A;  3IB2 A;  3LSX A;  4HTG A;  5DEX B;  2DVC A;  1M5D A;  2RIN A;  1SI0 A;  4R72 A;  1M5B A;  2W7Y A;  3UGW A;  4X48 A;  4YMB A;  4F18 A;  4O3B A;  1ZLQ A;  3H6U A;  4FIM A;  4XKR A;  3TUS A;  3MP8 A;  3B6Q A;  1MXW A;  1XT8 A;  1Z7M E;  3EHT A;  2GHA A;  3R6U A;  3GXA A;  5I57 B;  4TOZ A;  1VFD A;  3C9H A;  1N04 A;  3KN3 A;  3FIR A;  1T0K A;  4JXI A;  4EXL A;  3C31 A;  3V8X B;  3RGY A;  2BJJ X;  1NKX A;  4QSC A;  2F7C A;  3G3H A;  4F2Q A;  1EZ9 A;  1M5E A;  1MQJ A;  2V84 A;  3FVG A;  4XKN A;  3K02 A;  1B0L A;  1MQD A;  1JVX A;  2Y7K A;  1VFE A;  4RA1 A;  3PUW E;  3FXU A;  2AYS A;  4FJP A;  3SEW A;  1QJM A;  1WDN A;  2F5X A;  3T22 A;  3SES A;  5M2V A;  1SQY A;  4Z0I A;  5ISU A;  2I3V A;  1SDX A;  1XS5 A;  4MLQ A;  2R71 A;  3QIM A;  4GFR A;  1SW4 A;  2UVI A;  5B70 A;  1R6Z A;  4U23 A;  3H03 A;  4NTL A;  4PFW A;  4BLA A;  1NL5 A;  2DXR A;  3DP8 A;  1A55 A;  2PYY A;  3E3K A;  3K1N A;  2I48 A;  3BKI B;  3W9V A;  3S4U A;  4F3S A;  1JNF A;  1LBC A;  4Q5T A;  3K4U A;  3VVF A;  5HM4 B;  3VVD A;  4EDP A;  1XOC A;  2H9B A;  1ZU0 A;  3TDJ A;  1BTJ A;  3OEN A;  2OJT A;  4QF9 A;  3HHG A;  3DEL B;  3N5L A;  5FHN A;  5EHS A;  4C0R A;  2XHD A;  1GV8 A;  1Y1M A;  3TOD A;  3MVW A;  3FJG A;  4LZ8 A;  4BDL A;  2F97 A;  5JTY A;  2V93 A;  1MH3 A;  2O1M A;  1N7X A;  1IXI A;  3G3G A;  2H4I A;  2ZMB A;  3V5A A;  3DP4 A;  1LST A;  5K2Y A;  3A3U A;  3USD A;  4GXS B;  1JET A;  2QRY A;  4N07 A;  1M5F A;  2H25 A;  2X7Q A;  1RYO A;  2O68 A;  1CE2 A;  4ZS9 A;  5JTY B;  4G68 C;  3G3I A;  3CRB A;  1MXU A;  3JYR A;  3KOT A;  4PP0 A;  4DLD A;  2ZYO A;  1GGG A;  4DCY A;  3TPA A;  3VFJ A;  3LC8 A;  4OFO A;  1B32 A;  3PMW A;  4ZZE A;  4AB5 A;  3N94 A;  3FV2 A;  4IB2 A;  1TXF A;  2F6G A;  2XX9 A;  4HCW A;  3BFU A;  3UN6 A;  3DLN A;  2ZYM A;  5H8F A;  1OVT A;  3TEL A;  1QVS A;  1B51 A;  1JQF A;  3OO6 A;  3Q26 A;  1Z7N E;  4R6Y A;  1H76 A;  4ISU A;  3FAS A;  2O6A A;  1A7L A;  4GD5 A;  1H44 A;  2ONK E;  2X26 A;  3ZKK A;  4JDF A;  2O51 A;  4ZE9 A;  4MLV A;  4KR5 A;  3CG3 A;  3QYT A;  1B3H A;  4YIC A;  4TQU Q;  1D3K A;  5H8F B;  3IOR A;  2F34 A;  3M3F A;  4YZZ A;  1ZIU A;  4Z7E A;  3QUF A;  1R9L A;  2I58 A;  5I59 B;  4FOR A;  3PUZ E;  3KN8 A;  1B58 A;  3IR1 A;  1DPE A;  3C35 A;  3LSW A;  5AA2 A;  3EN3 A;  4OVJ A;  2IA4 A;  2F7A A;  4KYD A;  4BDO A;  2O7U A;  1I69 A;  2E1S A;  5ELV A;  2F36 A;  3P7I A;  1P99 A;  2Z8E A;  3V89 B;  1O64 A;  1MH4 A;  4HS7 A;  2VHA A;  4EF2 A;  4NF4 B;  3TTN A;  2F6P A;  1II5 A;  1ELJ A;  4GL0 A;  4JBZ A;  3PPN A;  2F78 A;  3QUJ A;  1YTV A;  1SVX B;  2XD2 A;  5F7V A;  1QUL A;  3PD9 A;  3F11 A;  3IB0 A;  4KHZ E;  5ITP A;  1B05 A;  1OIB A;  1LAH E;  3O66 A;  2UVG A;  2DE3 A;  3QXM A;  4P0I A;  3A09 A;  3RUM A;  4PQJ A;  2ZXT A;  4FAJ A;  5H8N B;  4ZZA A;  4NWC A;  3T93 B;  3E4R A;  1N84 A;  2O84 X;  3QK6 A;  4F19 A;  1B7Z A;  2QL3 A;  3IO6 A;  1Y9U A;  5HPQ A;  3OO7 A;  5FTH A;  4ZE8 A;  3N6T A;  1Y3Q A;  2ZNT A;  4NF5 A;  2HCA A;  4OET A;  3VLU A;  3VVE A;  1LLS A;  4IO2 A;  4U1O A;  2RC7 A;  4OWD A;  5CBS A;  2OCU A;  2YLN A;  3G3F A;  1UQW A;  1MM7 A;  1AIV A;  3W9W A;  2RC9 A;  5B7D A;  3D4C A;  1ZTY A;  3KFM A;  3TFL A;  3OO9 A;  4R75 A;  1SD3 A;  4R9F A;  1N3X A;  1B5J A;  3MC2 A;  1SW5 A;  5ICT A;  4X1D A;  1ATG A;  3IL1 B;  3R7X A;  2VGQ A;  1DMB A;  1PC3 A;  3S9N C;  4ZED A;  5ICQ A;  2UXA A;  4DXU A;  3JZJ A;  3A3C A;  2OWT A;  3H6T A;  5CM6 A;  4BDQ A;  2PX1 A;  5KCJ A;  1ZMG A;  2Q2A A;  3B7D A;  4PE5 B;  1P1N A;  5CRY A;  1B46 A;  5DEX A;  5HBC A;  2NVU B;  3G3K A;  3VLW A;  4JWY A;  4EXK A;  1YCJ A;  1A8E A;  3ONM A;  1EH3 A;  3KSX A;  4KQP A;  1CB6 A;  1LCT A;  1IIT A;  3MAM A;  3KJT A;  4KFQ A;  5KCJ B;  4G77 A;  4QFP A;  4FEB A;  3K6X A;  1UIU A;  4U4S A;  5H8S A;  1D4N A;  4AQ4 A;  3O28 A;  1EZP A;  5I57 A;  3GLB A;  4IO4 A;  1FTK A;  3MVY A;  1OMP A;  1MDQ A;  5AA3 A;  3FAT A;  1OLA A;  4H5F A;  1QKB A;  1PDA A;  3WAE A;  3SEV A;  3IB1 A;  2FNC A;  3OXN A;  4IO3 A;  5I2N A;  4OEV A;  1MXV A;  3VXB A;  3H3G A;  2GFE A;  3OEK A;  5K2X A;  5BWJ A;  5AE4 A;  5CMC A;  2VD2 A;  3U8Q A;  3IK6 B;  5ITO A;  2V3U A;  1HSE A;  5DT6 A;  3ODB A;  2ESN A;  1PB8 A;  1FQD A;  1MPD A;  4KI0 E;  5I2N B;  3MP1 A;  2NWJ A;  1USY E;  5F1Q A;  1QKA A;  2ZYK A;  2I4C A;  2Q9T A;  1MQH A;  4R2B A;  4F3P A;  5DVF A;  2XXY A;  4XXU A;  3FD3 A;  3RT8 A;  3U1O A;  4MFI A;  3VV5 A;  2QJE A;  3IJO B;  5JK4 A;  1M5C A;  1DTG A;  2ANJ A;  4YB6 A;  2NUV A;  2Y7P A;  4WXJ A;  3Q29 A;  1AOV A;  1SI1 A;  3M3L A;  4H8I A;  4H8J A;  3ZSF A;  3RT6 B;  4U2R A;  4G8N A;  4I1D A;  3TQW A;  1HSJ A;  3H6V A;  1IEJ A;  4RK2 A;  4I8C A;  3K1P A;  4HW8 A;  2QS3 A;  2Z8D A;  4YB5 A;  1PBQ A;  1JVY A;  4ZEC A;  4XKP A;  3MZ1 A;  3H7M A;  2OK2 A;  2XXT A;  1N76 A;  2I3W A;  4PET A;  1Q1K A;  1JEV A;  2ZYN A;  4LVQ A;  4JWO A;  4OXV A;  1URG A;  1USY H;  3M8U A;  2Q2C A;  4F3B A;  2HAV A;  4FE8 A;  1MPC A;  4O3C A;  2Y84 A;  3SER A;  1L5T A;  2GRV A;  4JSO A;  3UOR A;  5I84 A;  4THI A;  3C34 A;  5BUU A;  2QS2 A;  3QAX A;  4WKM A;  2XXH A;  3RLF E;  1EZO A;  1MG1 A;  2R6G E;  3K6W A;  4LUB A;  2ZNU A;  4ECF A;  3PGF A;  1LFG A;  4DE8 A;  3TTR A;  3KOS A;  1US5 A;  1ZKB A;  3TTM A;  1MY1 A;  4I9D A;  5KZT A;  1Y3P A;  2PT2 A;  2B3F A;  3RNN A;  3KGC A;  4ONY A;  2O69 A;  4YAH X;  1B52 A;  2I0C A;  1JEU A;  4NMY A;  3L6G A;  3QSL A;  3AXF A;  5I2K A;  1ANF A;  4QSE A;  1LAG E;  4C1U A;  3VLV A;  4R6H A;  1S50 A;  3OOA A;  3IOW A;  4DXC A;  2XXW A;  2DWJ A;  3H6W A;  3KBR A;  3TAJ A;  4OTE A;  5TU0 A;  1XC1 A;  1US4 A;  3LR1 A;  2QSX A;  3O6G A;  3HV1 A;  1POY 1;  1MXX A;  3PPR A;  3MBP A;  5J1D A;  5DVI A;  5I2K B;  1JW4 A;  4I62 A;  1DPP A;  1PBP A;  3K6V A;  3C4M A;  3TMG A;  1MRP A;  4MF3 A;  3TQL A;  1RKM A;  1NFT A;  4R6K A;  3KN7 A;  3EPE A;  4H67 A;  5I59 A;  1IUD A;  3T9X B;  3TCF A;  1BP5 A;  4X1B A;  3DM0 A;  1B9J A;  3WAF A;  4OHN A;  1MY3 A;  2KLF A;  1IXC A;  2XXQ A;  3T66 A;  5AA2 D;  1I6Q A;  3U93 A;  4QFK A;  4RXL A;  5AA4 B;  4IGR A;  1FQC A;  1NNF A;  2Y7I A;  2HXW A;  4H65 A;  1IZ1 A;  2QS1 A;  3SDF A;  1SW1 A;  4XKQ A;  4F1U A;  3BBR A;  2P1S A;  4GF8 A;  2DXY A;  3OMB A;  3I6V A;  4YKK A;  3EF7 A;  4NF4 A;  4G8M A;  1A40 A;  3B6W A;  4NED A;  3U92 A;  3ECR A;  4QFL A;  1QUI A;  3Q25 A;  4G68 A;  1LAX A;  5CMK A;  1PB9 A;  2DS9 A;  1R1N A;  3K01 A;  2RC8 A;  2Z23 A;  5KDT B;  1PEB A;  2AL5 A;  5H8H A;  4HCY A;  4NF6 B;  1P1Q A;  1S7Y A;  5EHM A;  3FXR A;  2A5S A;  3JV9 A;  1N7W A;  4U4X A;  4LQ2 A;  3FUZ A;  5H8N A;  1B7U A;  4G68 B;  5L9O A;  4F1V A;  3MZ9 A;  2E0S A;  4M4G A;  2PMS A;  3MW0 A;  2REG A;  5H8H B;  3KEI A;  2DE4 A;  1AH5 A;  4Q30 B;  4FEC A;  3LBS A;  5FTI A;  4U21 A;  2IEE A;  2XXP A;  1Y4T A;  5CMB A;  2I4B A;  2PVU A;  3T9V A;  3LSL A;  1FTJ A;  1AL3 A;  4YKP A;  4QFO A;  2O1L A;  2XXR A;  2XD3 A;  1TWY A;  4TLM B;  5TPA B;  1YPN A;  2QMW A;  1MY4 A;  3SEY A;  4PFT A;  3TTL A;  4EQB A;  1WOD A;  2O7I A;  2DE2 A;  4YKI A;  1FQF A;  4BDN A;  1KWH A;  4E0W A;  3S9L C;  2HQ0 A;  4G8H A;  4OMB A;  3RTW B;  1NH8 A;  2H5Y A;  2DSF A;  1LB8 A;  4IO5 A;  4ZEF A;  2ZNS A;  4F39 A;  1MXY A;  3OEM A;  3S9E A;  4N6P A;  2D3I A;  3T96 B;  3PD8 A;  4RK9 A;  2Q8J A;  1MDP 1;  4F3G A;  1B4Z A;  3IOT A;  3TYH A;  1P1W A;  5A5X A;  1IXG A;  2P0S A;  1NNK A;  1QUJ A;  4JWX A;  1OLC A;  4DIG A;  1LFH A;  3CSB A;  1URD A;  2GHB A;  3CIJ A;  1MQG A;  5CMM A;  5TP9 B;  1S9T A; 
#chains in the Genus database with same CATH topology
 1Y20 A;  2I0B A;  4HE2 A;  3C36 A;  1HSL A;  1UTH B;  3ZKL A;  4H46 A;  3O29 A;  4GX3 A;  4P11 A;  5LOM A;  1MY0 A;  3CG1 A;  3PMV A;  4F29 A;  5A5X B;  4NWD A;  2RCB A;  4OVR A;  1RDZ A;  4O3A A;  5I3S A;  2FA7 A;  4PDD A;  3RN8 A;  2D5W A;  5IZZ A;  4ZEB A;  1K9Z A;  4F1Y A;  1H3D A;  3CFL A;  3GZG A;  5CI5 A;  4AB6 A;  2ZZX A;  3CHG A;  3FVN A;  3HPI A;  3C33 A;  3FJM A;  4ELR A;  1LBB A;  1D9Y A;  1LFI A;  2PBW A;  3VDF A;  4K3F A;  1XVY A;  4KYE A;  4LA9 A;  3THI A;  1NV6 A;  1URS A;  4GL8 A;  3I5O A;  4X9T A;  4N6K A;  2F7B A;  2I6E A;  2H99 A;  4PAK A;  4NGU A;  4G4P A;  3D4G A;  3GBB A;  3MJN A;  3OSR A;  1NI9 A;  1FQB A;  3G7W A;  2M8C A;  3LUZ A;  4ELP A;  2YPN A;  3O2A A;  1ZBM A;  5L9M A;  4KD5 A;  3O6I A;  3FVO A;  4QRZ A;  3N26 A;  3KZG A;  1POT A;  4PBH A;  3V83 A;  1DK4 A;  3PUX E;  1MM6 A;  1B5H A;  4P0G A;  5EQ9 A;  3C32 A;  1QW0 A;  2WBD A;  1FSA A;  3FV1 A;  3H4Z A;  3G3J A;  3FBP A;  1UTB A;  4KYS A;  1LAF E;  1AMF A;  4UA8 A;  1INP A;  2P2A A;  1WVJ A;  4JB7 A;  3IAZ A;  1FBF A;  1MPB A;  4I40 A;  2BJI A;  2XX8 A;  3E79 A;  2NOO A;  4DI4 B;  4MNP A;  2CZL A;  3O97 A;  1LBX A;  1JW1 A;  1FPG A;  2XXX A;  1TFA A;  1FJ9 A;  1UTB B;  3MPL A;  4GIZ A;  5LDZ A;  1FTO A;  1ZJL A;  1LB9 A;  4H1X A;  5EYF A;  3W15 C;  2QPQ A;  3N6U A;  4G61 A;  2A5T A;  2HAU A;  3UK4 A;  2HEU A;  3B50 A;  3VE1 B;  4IO6 A;  4GQO A;  1B3F A;  1EU8 A;  1IME A;  4I3Y A;  3OD7 A;  2V3Q A;  3PV0 E;  5IKB A;  4PFB A;  4R2F A;  1SBP A;  1VSO A;  3RTF B;  3BFT A;  5I58 A;  1UIV A;  1P1U A;  4LZ5 A;  5DYH A;  2XXK A;  3B6T A;  1KA0 A;  4KCC A;  4WED A;  3RPW A;  3FXQ A;  3MUQ A;  3LSF B;  3OSQ A;  4LP2 B;  2A5T B;  2ABH A;  1TT1 A;  3PPP A;  3OEL A;  1SYI A;  2G93 A;  3S2V A;  4OEU A;  2VD3 A;  2V4C A;  1H43 A;  1B3G A;  1FCK A;  1DSN A;  3O6H A;  1FPB A;  3MZB A;  1GTK A;  3CR9 A;  4H0W A;  3L6H A;  3PUY E;  2Z22 A;  5I58 B;  1FW0 A;  4ZDM A;  5FHO A;  3PPO A;  2RKM A;  4PFR A;  2DVZ A;  3K2D A;  3GBA A;  1R9Q A;  4NE4 A;  4DZ1 A;  4RPN A;  1B1H A;  1B3L A;  2XA5 A;  2OZZ A;  4BDM A;  3NOH A;  2D21 A;  4N13 A;  3HO7 A;  4DDD A;  3RPL A;  3IOV A;  4IY6 A;  3K1M A;  4RNS A;  4MBP A;  3MYU A;  4N4U A;  4ELO A;  4OVQ A;  4PDH A;  1BIY A;  1GR2 A;  5IAI A;  2DP8 A;  4EF1 A;  5EYH A;  4QFN A;  2DQV A;  1B5I A;  4ZEK A;  3D1R A;  3RPL B;  3TEP A;  1OVB A;  1FPI A;  4LAT A;  2CMO A;  2Y7R A;  1NMU A;  2FYI A;  4KCD A;  4ZEI A;  3EQ1 A;  2L5V A;  4MHF A;  1YYZ A;  2YJP A;  2CZK A;  3MPK A;  1D9V A;  1NH7 A;  2ZZV A;  4GLI A;  2B4M A;  3TKD A;  2DYX A;  4GWO A;  2DDK A;  1FQE A;  1Y4C A;  3SEX A;  2QS4 A;  4ELQ A;  4IGT A;  5AA4 A;  3T9U A;  3HHF A;  4WEP A;  3HFU A;  5F24 A;  1DTZ A;  4H6D A;  1I6B A;  2ALU A;  2FBP A;  1B3E A;  2XXI A;  1B2H A;  4LON B;  5JEI A;  1EYI A;  3K6U A;  1H45 A;  3SKP A;  1J1N A;  2THI A;  4MEV A;  5CC2 A;  2GH9 A;  4R74 A;  4H5G A;  4FED A;  1DBZ A;  1TFD A;  1GVC A;  1BLF A;  1NNT A;  4POW A;  4DXB A;  2DOJ A;  1NV7 A;  4IY5 A;  4EQ9 A;  2V3T A;  1PB7 A;  4MIJ A;  2XXV A;  4ESW A;  4GRK A;  1A8F A;  4RYA A;  2AL4 A;  3IJX B;  4BDR A;  2VOZ A;  5I7I A;  3T1B A;  4OES A;  3LUY A;  1F9B A;  2MKZ A;  1NV0 A;  1FQA A;  5KDT A;  2LAO A;  1VE4 A;  5AA1 A;  2B65 A;  4OAN A;  4NF6 A;  2F35 A;  2UVJ A;  4RY1 A;  2OLB A;  3BIG A;  4ESX A;  4X8R A;  3U94 A;  2PT1 A;  3PMX A;  3OO8 A;  3IOU A;  2B3B A;  5L8D A;  2KQZ A;  4JVD A;  4NF8 A;  4FBP A;  3K0V A;  4F2O A;  4HE0 A;  2I49 A;  4PFY A;  4ND9 A;  1OQG A;  4L17 A;  2HZK A;  5L9S A;  1FPD A;  1YAE A;  2DWA A;  3FVK A;  1B40 A;  2WKY A;  2QMX A;  4LZ7 A;  2Q89 A;  5T3J A;  2UYF A;  1Y3N A;  3MVX A;  4TLL B;  3SET A;  4HE1 A;  4GOT A;  4F22 A;  3O9P A;  1JW5 A;  3FGS A;  2H98 A;  3EHU A;  3ILU B;  1RYX A;  4NF8 B;  4E0X A;  2HHM A;  3I3V A;  3DP6 A;  5AA2 B;  4OYV A;  3MWB A;  4PGN A;  4DCX A;  1RDX A;  4GWX A;  2UVH A;  3UA8 A;  2WBB A;  3E13 X;  4PFU A;  5TPA A;  1FBH A;  3ILT B;  4C1T A;  3HCQ A;  2NXO A;  3VXC A;  2RCA A;  5EYG A;  4U22 A;  1SYH A;  3PUV E;  1MY2 A;  2AIX A;  4OEN A;  3H06 B;  1XVX A;  3HST A;  5DVJ A;  1NNP A;  4M1V A;  3CFZ A;  3PU5 A;  1MXZ A;  1O7T A;  3SEU A;  1FBC A;  2OBG A;  4KPT A;  4GWS A;  1IQ7 A;  1A54 A;  3KJ7 A;  3UP9 A;  1FPJ A;  1LGB C;  2P3V A;  3HN0 A;  3CFX A;  5DTB A;  4YKJ A;  4OFJ A;  2X7P A;  3KG2 A;  4IO7 A;  1P1O A;  3KSJ A;  1VR5 A;  2CEY A;  2RF1 A;  2UYE A;  3TCG A;  4MH5 A;  4UAC A;  4IR8 A;  1A99 A;  1B0H A;  4OER A;  3M3K A;  3ZS6 A;  3PPQ A;  3RY3 A;  5TP9 A;  4FAT A;  4QHQ A;  2Q88 A;  5ET5 A;  4OZ9 A;  2Y7W A;  4LQ5 A;  4YMA A;  4F31 B;  4N8Y A;  1UTH A;  1Q35 A;  2ONS A;  4O8M A;  2R9J A;  3CSG A;  2FVZ A;  2KR0 A;  5I56 A;  3EHS A;  3U72 A;  2OX3 A;  3FZV A;  3MVZ A;  2VP1 A;  1MQI A;  5H8Q A;  3IO4 A;  4R9G A;  1IIW A;  3CVG A;  4XTC Q;  4RJZ A;  1BKA A;  1SW2 A;  3R26 A;  3TCH A;  1QGX A;  1MS7 A;  4Q0C A;  2HZL A;  1Q9D A;  4NF5 B;  4OQO A;  1FTL A;  1B4H A;  1Y1Z A;  4YU0 A;  4XIG Q;  4G2Z A;  3KC0 A;  3MP6 A;  4YB7 A;  1O63 A;  4EUO A;  2V25 A;  2Z8F A;  2G29 A;  3ROJ A;  1B6H A;  2HFB A;  4P47 A;  5FHM A;  3CI8 A;  4GXA A;  2OWS A;  2ONR A;  4RPO A;  4QSD A;  5I56 B;  3S9M C;  2F3D A;  5H8Q B;  3E9X A;  3GYY A;  1XHY A;  3TTK A;  2REJ A;  2DWH A;  3TZA A;  4KXP A;  3UIF A;  4U1Z A;  3RQT A;  2F8D A;  4GVO A;  1I6A A;  1DOT A;  4DI3 D;  4EQ7 A;  1IXH A;  2XX7 A;  1LCF A;  3T9H B;  5CBR A;  3MQ9 A;  3K00 A;  2CZH A;  3A29 A;  1N0T A;  5EQA A;  1B7H A;  1B1X A;  2DWI A;  3FJ7 A;  1QUK A;  1FTM A;  4OFL A;  3IX1 A;  4POX A;  4Q8R A;  1OQH A;  4R73 A;  4JSD A;  2XXU A;  1NUY A;  3Q27 A;  4PAI A;  1N3W A;  3Q28 A;  3IB2 A;  3LSX A;  4HTG A;  5DEX B;  2DVC A;  1M5D A;  2RIN A;  1SI0 A;  4R72 A;  1M5B A;  1XI6 A;  2W7Y A;  3UGW A;  4X48 A;  4YMB A;  4F18 A;  4O3B A;  1ZLQ A;  3H6U A;  4FIM A;  4XKR A;  2WYP A;  3TUS A;  3MP8 A;  3B6Q A;  1MXW A;  1XT8 A;  1Z7M E;  3EHT A;  1FPF A;  2GHA A;  3R6U A;  3GXA A;  5I57 B;  4TOZ A;  1FJ6 A;  1FBP A;  1VFD A;  3C9H A;  1EYK A;  1N04 A;  3KN3 A;  3FIR A;  1T0K A;  1NV2 A;  4JXI A;  1FTA A;  4EXL A;  3C31 A;  3V8X B;  3RGY A;  2BJJ X;  1NKX A;  4QSC A;  2F7C A;  4MX6 A;  3G3H A;  4F2Q A;  1EZ9 A;  1M5E A;  1MQJ A;  2V84 A;  3FVG A;  1LBW A;  4XKN A;  4QBA A;  5IZ3 B;  3K02 A;  1B0L A;  2PFZ A;  1MQD A;  1JVX A;  2Y7K A;  1IMB A;  1VFE A;  4RA1 A;  1NV5 A;  3PUW E;  3FXU A;  3IFC A;  2AYS A;  2R8T A;  4FJP A;  3SEW A;  1QJM A;  1WDN A;  2F5X A;  3T22 A;  2FHY A;  3SES A;  5M2V A;  1SQY A;  4Z0I A;  4PC9 A;  5ISU A;  2I3V A;  1SDX A;  4MLQ A;  1XS5 A;  2R71 A;  3QIM A;  4GFR A;  1SW4 A;  2UVI A;  5B70 A;  1R6Z A;  4U23 A;  3H03 A;  4NTL A;  1FPL A;  4PFW A;  4P1L A;  1IMC A;  4BLA A;  1NL5 A;  2DXR A;  3DP8 A;  1A55 A;  2PYY A;  3E3K A;  4N17 A;  3K1N A;  2I48 A;  1D9Q A;  3BKI B;  3W9V A;  3S4U A;  4F3S A;  1JNF A;  1LBC A;  4Q5T A;  3K4U A;  3VVF A;  5HM4 B;  2Y5K A;  3VVD A;  4EDP A;  1XOC A;  2H9B A;  1ZU0 A;  2CEX A;  5J16 A;  3TDJ A;  1BTJ A;  3OEN A;  2OJT A;  4GX6 A;  4QF9 A;  4OVP A;  3HHG A;  3DEL B;  3N5L A;  2Q8M A;  2CZI A;  4N6D A;  5FHN A;  5EHS A;  4C0R A;  2XHD A;  1GV8 A;  1Y1M A;  3TOD A;  3MVW A;  3FJG A;  4LZ8 A;  4BDL A;  2F97 A;  5JTY A;  3U65 A;  2V93 A;  1MH3 A;  2O1M A;  1N7X A;  1IXI A;  3G3G A;  2H4I A;  2ZMB A;  3V5A A;  4GBV A;  4OVS A;  3DP4 A;  1LST A;  5K2Y A;  3A3U A;  3USD A;  4GXS B;  1JET A;  2QRY A;  4N07 A;  1M5F A;  2H25 A;  2X7Q A;  1LBY A;  1RYO A;  2O68 A;  3B8B A;  1CE2 A;  4ZS9 A;  5JTY B;  1NUZ A;  4G68 C;  3G3I A;  4P1E A;  3CRB A;  1MXU A;  3JYR A;  3KOT A;  4PP0 A;  4DLD A;  2ZYO A;  1GGG A;  4DCY A;  3IFA A;  3TPA A;  1FPE A;  3VFJ A;  3LC8 A;  4OFO A;  1B32 A;  3PMW A;  4N81 A;  4ZZE A;  4AB5 A;  3N94 A;  3FV2 A;  4IB2 A;  1TXF A;  2F6G A;  3E78 A;  2XX9 A;  4HCW A;  3BFU A;  3UN6 A;  3DLN A;  2ZYM A;  5H8F A;  1OVT A;  3TEL A;  2XWV A;  1QVS A;  4OVT A;  2QVU A;  1B51 A;  1JQF A;  3OO6 A;  3Q26 A;  1Z7N E;  2PFY A;  1NV4 A;  4R6Y A;  1IMD A;  1H76 A;  4ISU A;  4NF0 A;  3FAS A;  4JVI A;  2O6A A;  1A7L A;  4GD5 A;  1H44 A;  2ONK E;  2X26 A;  3ZKK A;  4JDF A;  2GQ1 A;  2O51 A;  4ZE9 A;  4MLV A;  4KR5 A;  3CG3 A;  3QYT A;  1B3H A;  2FIX A;  4YIC A;  4TQU Q;  1D3K A;  5H8F B;  3IOR A;  2F34 A;  3M3F A;  4YZZ A;  1ZIU A;  4Z7E A;  3QUF A;  1R9L A;  2I58 A;  5IM2 A;  5I59 B;  4FOR A;  3PUZ E;  3KN8 A;  2HXR A;  1B58 A;  3IR1 A;  1EYJ A;  4AS5 A;  1DPE A;  4GX4 A;  3C35 A;  3LSW A;  5AA2 A;  3EN3 A;  4OVJ A;  2IA4 A;  2F7A A;  4KYD A;  4BDO A;  2O7U A;  1I69 A;  2E1S A;  5ELV A;  2F36 A;  3P7I A;  2PCR A;  4PTK A;  1P99 A;  2Z8E A;  3V89 B;  1BK4 A;  1O64 A;  1MH4 A;  4HS7 A;  4MNC A;  1DCU A;  2VHA A;  4EF2 A;  4NF4 B;  3TTN A;  2F6P A;  1II5 A;  1FBD A;  1ELJ A;  4GL0 A;  4JBZ A;  3PPN A;  2F78 A;  2WEF A;  1NV1 A;  3QUJ A;  1YTV A;  1SVX B;  2XD2 A;  5F7V A;  1QUL A;  3PD9 A;  3F11 A;  3IB0 A;  2WYK A;  4KHZ E;  5ITP A;  1B05 A;  1OIB A;  1LAH E;  3ISP A;  3O66 A;  2UVG A;  2DE3 A;  4MCO A;  3QXM A;  4P0I A;  3A09 A;  3RUM A;  5LTC A;  4PQJ A;  2ZXT A;  4FAJ A;  5H8N B;  2P3N A;  4ZZA A;  4NWC A;  5EQ7 A;  3T93 B;  3E4R A;  5IZ1 A;  1N84 A;  1LBZ A;  2O84 X;  3QK6 A;  4F19 A;  4P8B A;  1YXI A;  1B7Z A;  2QL3 A;  3IO6 A;  1Y9U A;  5HPQ A;  3OO7 A;  5FTH A;  4ZE8 A;  3N6T A;  1Y3Q A;  2ZNT A;  4NF5 A;  2HCA A;  4OET A;  3VLU A;  3VVE A;  4PF6 A;  1LLS A;  1LEV A;  4IO2 A;  4U1O A;  2RC7 A;  4OWD A;  5CBS A;  2OCU A;  1KZ8 A;  2YLN A;  3G3F A;  1UQW A;  1MM7 A;  1AIV A;  3W9W A;  2RC9 A;  5B7D A;  3D4C A;  4H45 A;  1ZTY A;  3KFM A;  3T0J A;  3OO9 A;  3TFL A;  2FIE A;  4R75 A;  1SD3 A;  4MNI A;  4R9F A;  1N3X A;  1B5J A;  3MC2 A;  1SW5 A;  5ICT A;  4LN5 A;  4X1D A;  1ATG A;  3IL1 B;  5ESY A;  3R7X A;  2VGQ A;  3EKI A;  1DMB A;  1PC3 A;  3S9N C;  4ZED A;  5ICQ A;  2UXA A;  4X04 A;  4DXU A;  3JZJ A;  3A3C A;  2OWT A;  3H6T A;  5CM6 A;  4BDQ A;  2PX1 A;  2QVV A;  5KCJ A;  1G0H A;  1ZMG A;  2Q2A A;  4GWW A;  3B7D A;  4PE5 B;  1IMF A;  1P1N A;  5CRY A;  1B46 A;  5DEX A;  1FRP A;  5HBC A;  4N8G A;  2NVU B;  3G3K A;  3VLW A;  4JWY A;  4PE3 A;  4EXK A;  1YCJ A;  1A8E A;  4GWY A;  3ONM A;  1EH3 A;  1CNQ A;  3KSX A;  3KC1 A;  4KQP A;  1CB6 A;  1LCT A;  1IIT A;  3MAM A;  3KJT A;  4KFQ A;  5KCJ B;  4G77 A;  4QFP A;  3FXB A;  4I3E A;  4FEB A;  3K6X A;  1UIU A;  4U4S A;  4NQ8 A;  5H8S A;  1D4N A;  4AQ4 A;  3O28 A;  1EZP A;  5I57 A;  3GLB A;  1SPI A;  4IO4 A;  4PCD A;  1FTK A;  3MVY A;  1OMP A;  1RDY A;  1MDQ A;  5AA3 A;  4UAB A;  3FAT A;  1OLA A;  4H5F A;  1QKB A;  1PDA A;  3WAE A;  3SEV A;  3IB1 A;  2FNC A;  3OXN A;  4IO3 A;  4PGP A;  5I2N A;  5I5P A;  4OEV A;  3KBZ A;  1MXV A;  3VXB A;  3H3G A;  5IZ3 A;  2GFE A;  3OEK A;  5K2X A;  5BWJ A;  5AE4 A;  5CMC A;  4NN3 A;  2VD2 A;  3U8Q A;  3IK6 B;  5ITO A;  2V3U A;  1HSE A;  5DT6 A;  3ODB A;  2ESN A;  1PB8 A;  1FQD A;  1FBE A;  1MPD A;  4KI0 E;  3MST A;  5I2N B;  3MP1 A;  5EQ8 A;  2NWJ A;  1USY E;  5F1Q A;  1QKA A;  2ZYK A;  2I4C A;  2Q9T A;  1MQH A;  4R2B A;  4F3P A;  5DVF A;  2XXY A;  4NHB A;  4XXU A;  3FD3 A;  3RT8 A;  3BIH A;  3U1O A;  3QMF A;  4MFI A;  5ET7 A;  3VV5 A;  2WX9 A;  2QJE A;  3IJO B;  5JK4 A;  1M5C A;  1DTG A;  1YZ0 A;  2ANJ A;  4GWZ A;  4YB6 A;  2NUV A;  2Y7P A;  4WXJ A;  3Q29 A;  1AOV A;  1SI1 A;  3M3L A;  4MJO A;  4H8I A;  4H8J A;  4GWU A;  3ZSF A;  1JP4 A;  3RT6 B;  4U2R A;  1FPK A;  4G8N A;  4I1D A;  3TQW A;  1HSJ A;  3H6V A;  1IEJ A;  4RK2 A;  4I8C A;  3K1P A;  4HW8 A;  2QS3 A;  2Z8D A;  4YB5 A;  1PBQ A;  1JVY A;  4ZEC A;  4XKP A;  3MZ1 A;  3H7M A;  1FBG A;  2OK2 A;  4N91 A;  2XXT A;  1N76 A;  2I3W A;  4P9K A;  1NUW A;  4PET A;  4P3L A;  1Q1K A;  1JEV A;  2ZYN A;  4LVQ A;  4JWO A;  4OXV A;  1URG A;  1USY H;  3M8U A;  2Q2C A;  4F3B A;  2HAV A;  4FE8 A;  1MPC A;  4O3C A;  2Y84 A;  3SER A;  1L5T A;  2GRV A;  4JSO A;  3UOR A;  5I84 A;  4THI A;  4PAF A;  3C34 A;  5BUU A;  2QS2 A;  3QAX A;  4WKM A;  2XXH A;  3RLF E;  4XFE A;  1EZO A;  1MG1 A;  2R6G E;  3K6W A;  4LUB A;  2ZNU A;  1NUX A;  4ECF A;  3PGF A;  1LFG A;  4AS4 A;  4NX1 A;  4DE8 A;  3TTR A;  3KOS A;  1US5 A;  1ZKB A;  3TTM A;  1MY1 A;  4I9D A;  5KZT A;  1Y3P A;  2PT2 A;  2B3F A;  4MMP A;  3RNN A;  3KGC A;  4ONY A;  2O69 A;  4YAH X;  1B52 A;  2I0C A;  1JEU A;  4NMY A;  3L6G A;  3QSL A;  3AXF A;  5I2K A;  1ANF A;  4O7I A;  4QSE A;  1NV3 A;  4NG7 A;  1LAG E;  4C1U A;  3VLV A;  4R6H A;  1S50 A;  3OOA A;  3IOW A;  4DXC A;  2XXW A;  2DWJ A;  3H6W A;  3KBR A;  3TAJ A;  4OTE A;  5TU0 A;  4NAP A;  1XC1 A;  1US4 A;  2Q74 A;  3LR1 A;  2QSX A;  2JJK A;  2XWK A;  3O6G A;  3HV1 A;  2XWO A;  1POY 1;  1MXX A;  3PPR A;  3MBP A;  5J1D A;  5DVI A;  4GBW A;  5I2K B;  1JW4 A;  4I62 A;  1DPP A;  1PBP A;  3K6V A;  3C4M A;  2VPN A;  3TMG A;  1MRP A;  4MF3 A;  3TQL A;  1RKM A;  1NFT A;  4R6K A;  3KN7 A;  3EPE A;  4H67 A;  5I59 A;  1IUD A;  3T9X B;  3TCF A;  1BP5 A;  4X1B A;  3DM0 A;  1B9J A;  3WAF A;  4OHN A;  1MY3 A;  2QVR A;  2KLF A;  1IXC A;  2XXQ A;  3T66 A;  5AA2 D;  1I6Q A;  3U93 A;  4P56 A;  2F3B A;  4QFK A;  4RXL A;  5AA4 B;  4IGR A;  1FQC A;  1NNF A;  2Y7I A;  2HXW A;  4H65 A;  1IZ1 A;  2QS1 A;  4O94 A;  3SDF A;  2VPO A;  1SW1 A;  1IMA A;  1G0I A;  4XKQ A;  4F1U A;  3BBR A;  3RYD A;  1AWB A;  2P1S A;  5ET6 A;  4GF8 A;  2DXY A;  2ZZW A;  3OMB A;  3I6V A;  4YKK A;  3EF7 A;  4NF4 A;  4G8M A;  1A40 A;  4PBQ A;  4QXD A;  3B6W A;  2HPG A;  4NED A;  3U92 A;  3ECR A;  4QFL A;  4N15 A;  1QUI A;  3Q25 A;  4G68 A;  5DW8 A;  1LAX A;  5IGA A;  5CMK A;  1PB9 A;  2DS9 A;  1R1N A;  3K01 A;  2RC8 A;  2Z23 A;  5KDT B;  5A5L A;  4OA4 A;  1K9Y A;  1PEB A;  2AL5 A;  5H8H A;  4HCY A;  4NF6 B;  1P1Q A;  1S7Y A;  5EHM A;  3FXR A;  2A5S A;  3JV9 A;  1N7W A;  4U4X A;  4LQ2 A;  5ET8 A;  3FUZ A;  5H8N A;  1B7U A;  4G68 B;  5L9O A;  4F1V A;  3PTY A;  3MZ9 A;  2E0S A;  4M4G A;  2PMS A;  3MW0 A;  2REG A;  5H8H B;  3KEI A;  4XF5 A;  2DE4 A;  1AH5 A;  4Q30 B;  4FEC A;  4PFI A;  3LBS A;  5FTI A;  4HXV A;  4U21 A;  4PF8 A;  2IEE A;  2VT5 A;  2XXP A;  1Y4T A;  5CMB A;  2I4B A;  2PVU A;  3T9V A;  3LSL A;  1FTJ A;  2OWZ A;  1AL3 A;  4YKP A;  4QFO A;  2O1L A;  2XXR A;  2XD3 A;  1TWY A;  2XWI A;  4TLM B;  5TPA B;  1YPN A;  2QMW A;  1MY4 A;  3SEY A;  4PFT A;  3SZP A;  3TTL A;  4EQB A;  1WOD A;  4MAG A;  2O7I A;  2DE2 A;  1VDW A;  4YKI A;  1FQF A;  4XEQ A;  4BDN A;  1KWH A;  4E0W A;  3S9L C;  2HQ0 A;  4G8H A;  1LBV A;  4OMB A;  3RTW B;  1NH8 A;  2H5Y A;  2DSF A;  1LB8 A;  3LV0 A;  4IO5 A;  4ZEF A;  2ZNS A;  4F39 A;  1MXY A;  3OEM A;  2Y5L A;  3S9E A;  4N6P A;  4JVC A;  2D3I A;  3T96 B;  3PD8 A;  4RK9 A;  2Q8J A;  4O7M A;  5FBP A;  1MDP 1;  4F3G A;  1B4Z A;  3IOT A;  3TYH A;  1P1W A;  5A5X A;  1IXG A;  2P0S A;  1NNK A;  2QFL A;  1QUJ A;  4JWX A;  1OLC A;  4DIG A;  1LFH A;  3CSB A;  2B4L A;  1KA1 A;  1URD A;  2GHB A;  3CIJ A;  1MQG A;  5CMM A;  5TP9 B;  1S9T A; 
#chains in the Genus database with same CATH homology
 1Y20 A;  2I0B A;  3C36 A;  1HSL A;  1UTH B;  3ZKL A;  3O29 A;  4P11 A;  5LOM A;  1MY0 A;  3CG1 A;  3PMV A;  4F29 A;  5A5X B;  4NWD A;  2RCB A;  4O3A A;  2FA7 A;  3RN8 A;  2D5W A;  4ZEB A;  4F1Y A;  1H3D A;  3CFL A;  3GZG A;  5CI5 A;  4AB6 A;  3FVN A;  3HPI A;  3C33 A;  3FJM A;  4ELR A;  1LBB A;  1D9Y A;  1LFI A;  2PBW A;  3VDF A;  4K3F A;  1XVY A;  4KYE A;  4LA9 A;  3THI A;  1URS A;  4GL8 A;  3I5O A;  4X9T A;  2F7B A;  2I6E A;  2H99 A;  4G4P A;  3D4G A;  3GBB A;  3MJN A;  3OSR A;  1FQB A;  3G7W A;  2M8C A;  4ELP A;  2YPN A;  3O2A A;  1ZBM A;  5L9M A;  4KD5 A;  3O6I A;  3FVO A;  4QRZ A;  3N26 A;  3KZG A;  1POT A;  3V83 A;  3PUX E;  1MM6 A;  1B5H A;  4P0G A;  3C32 A;  1QW0 A;  3FV1 A;  3H4Z A;  3G3J A;  1UTB A;  4KYS A;  1LAF E;  1AMF A;  4UA8 A;  2P2A A;  1WVJ A;  4JB7 A;  3IAZ A;  1MPB A;  2XX8 A;  2NOO A;  2CZL A;  3O97 A;  1JW1 A;  2XXX A;  1TFA A;  1UTB B;  3MPL A;  4GIZ A;  1FTO A;  1ZJL A;  1LB9 A;  4H1X A;  5EYF A;  3W15 C;  2QPQ A;  3N6U A;  2A5T A;  2HAU A;  3UK4 A;  2HEU A;  3VE1 B;  4IO6 A;  4GQO A;  1B3F A;  1EU8 A;  3OD7 A;  2V3Q A;  3PV0 E;  5IKB A;  4R2F A;  1SBP A;  1VSO A;  3RTF B;  3BFT A;  5I58 A;  1UIV A;  1P1U A;  4LZ5 A;  5DYH A;  3B6T A;  4KCC A;  4WED A;  3RPW A;  3FXQ A;  3MUQ A;  3LSF B;  3OSQ A;  4LP2 B;  2A5T B;  2ABH A;  1TT1 A;  3PPP A;  3OEL A;  1SYI A;  2G93 A;  3S2V A;  4OEU A;  2VD3 A;  1H43 A;  1B3G A;  1FCK A;  1DSN A;  3O6H A;  3MZB A;  1GTK A;  3CR9 A;  4H0W A;  3L6H A;  3PUY E;  2Z22 A;  5I58 B;  1FW0 A;  4ZDM A;  5FHO A;  3PPO A;  2RKM A;  2DVZ A;  3K2D A;  3GBA A;  1R9Q A;  4NE4 A;  4DZ1 A;  4RPN A;  1B1H A;  1B3L A;  2OZZ A;  4BDM A;  2D21 A;  4N13 A;  3HO7 A;  4DDD A;  3IOV A;  4IY6 A;  3K1M A;  4RNS A;  4MBP A;  4ELO A;  1BIY A;  1GR2 A;  5IAI A;  2DP8 A;  4EF1 A;  4QFN A;  2DQV A;  1B5I A;  4ZEK A;  3TEP A;  1OVB A;  4LAT A;  2CMO A;  2Y7R A;  1NMU A;  2FYI A;  4KCD A;  4ZEI A;  3EQ1 A;  2YJP A;  3MPK A;  1D9V A;  1NH7 A;  4GLI A;  3TKD A;  2DYX A;  4GWO A;  1FQE A;  1Y4C A;  3SEX A;  2QS4 A;  4ELQ A;  4IGT A;  5AA4 A;  3T9U A;  3HHF A;  4WEP A;  1DTZ A;  4H6D A;  1I6B A;  2ALU A;  1B3E A;  2XXI A;  1B2H A;  4LON B;  5JEI A;  3K6U A;  1H45 A;  3SKP A;  1J1N A;  2THI A;  5CC2 A;  2GH9 A;  4R74 A;  4H5G A;  4FED A;  1TFD A;  1GVC A;  1BLF A;  1NNT A;  4POW A;  4DXB A;  2DOJ A;  4IY5 A;  4EQ9 A;  2V3T A;  1PB7 A;  2XXV A;  4ESW A;  4GRK A;  1A8F A;  4RYA A;  2AL4 A;  3IJX B;  4BDR A;  2VOZ A;  4OES A;  3LUY A;  1F9B A;  1FQA A;  5KDT A;  2LAO A;  1VE4 A;  5AA1 A;  2B65 A;  4NF6 A;  2F35 A;  2UVJ A;  4RY1 A;  2OLB A;  4ESX A;  3U94 A;  2PT1 A;  3PMX A;  3OO8 A;  3IOU A;  2B3B A;  5L8D A;  4NF8 A;  3K0V A;  4F2O A;  2I49 A;  4PFY A;  4ND9 A;  1OQG A;  4L17 A;  2HZK A;  5L9S A;  1YAE A;  2DWA A;  3FVK A;  1B40 A;  2WKY A;  2QMX A;  4LZ7 A;  2Q89 A;  2UYF A;  1Y3N A;  3MVX A;  4TLL B;  3SET A;  4GOT A;  4F22 A;  3O9P A;  1JW5 A;  3FGS A;  2H98 A;  3EHU A;  3ILU B;  1RYX A;  4NF8 B;  4E0X A;  3I3V A;  3DP6 A;  5AA2 B;  4OYV A;  3MWB A;  4DCX A;  2UVH A;  3UA8 A;  3E13 X;  4PFU A;  5TPA A;  3ILT B;  4C1T A;  3HCQ A;  2NXO A;  3VXC A;  2RCA A;  4U22 A;  1SYH A;  3PUV E;  1MY2 A;  2AIX A;  4OEN A;  3H06 B;  1XVX A;  3HST A;  5DVJ A;  1NNP A;  4M1V A;  3CFZ A;  3PU5 A;  1MXZ A;  1O7T A;  3SEU A;  2OBG A;  4KPT A;  1IQ7 A;  1A54 A;  3KJ7 A;  3UP9 A;  1LGB C;  3HN0 A;  3CFX A;  5DTB A;  4YKJ A;  4OFJ A;  2X7P A;  3KG2 A;  4IO7 A;  1P1O A;  3KSJ A;  1VR5 A;  2RF1 A;  2UYE A;  3TCG A;  4MH5 A;  4UAC A;  1A99 A;  1B0H A;  4OER A;  3M3K A;  3ZS6 A;  3PPQ A;  3RY3 A;  5TP9 A;  4FAT A;  4QHQ A;  2Q88 A;  4OZ9 A;  2Y7W A;  4LQ5 A;  4YMA A;  4F31 B;  1UTH A;  1Q35 A;  2ONS A;  2R9J A;  3CSG A;  5I56 A;  3EHS A;  3U72 A;  3FZV A;  3MVZ A;  2VP1 A;  1MQI A;  5H8Q A;  3IO4 A;  4R9G A;  1IIW A;  3CVG A;  4XTC Q;  4RJZ A;  1BKA A;  1SW2 A;  3R26 A;  3TCH A;  1MS7 A;  4Q0C A;  2HZL A;  4NF5 B;  4OQO A;  1FTL A;  1B4H A;  1Y1Z A;  4YU0 A;  4XIG Q;  4G2Z A;  3MP6 A;  4YB7 A;  1O63 A;  4EUO A;  2V25 A;  2Z8F A;  2G29 A;  1B6H A;  2HFB A;  5FHM A;  3CI8 A;  4GXA A;  2OWS A;  2ONR A;  4RPO A;  4QSD A;  5I56 B;  3S9M C;  5H8Q B;  3E9X A;  1XHY A;  3TTK A;  2REJ A;  2DWH A;  3TZA A;  3UIF A;  4U1Z A;  3RQT A;  2F8D A;  4GVO A;  1I6A A;  1DOT A;  4EQ7 A;  1IXH A;  2XX7 A;  1LCF A;  3T9H B;  5CBR A;  3MQ9 A;  3K00 A;  1N0T A;  1B7H A;  1B1X A;  2DWI A;  3FJ7 A;  1QUK A;  1FTM A;  4OFL A;  3IX1 A;  4POX A;  4Q8R A;  1OQH A;  4R73 A;  4JSD A;  2XXU A;  3Q27 A;  1N3W A;  3Q28 A;  3IB2 A;  3LSX A;  4HTG A;  5DEX B;  2DVC A;  1M5D A;  2RIN A;  1SI0 A;  4R72 A;  1M5B A;  2W7Y A;  3UGW A;  4X48 A;  4YMB A;  4F18 A;  4O3B A;  1ZLQ A;  3H6U A;  4FIM A;  4XKR A;  3TUS A;  3MP8 A;  3B6Q A;  1MXW A;  1XT8 A;  1Z7M E;  3EHT A;  2GHA A;  3R6U A;  3GXA A;  5I57 B;  4TOZ A;  1VFD A;  3C9H A;  1N04 A;  3KN3 A;  3FIR A;  1T0K A;  4JXI A;  4EXL A;  3C31 A;  3V8X B;  3RGY A;  2BJJ X;  1NKX A;  4QSC A;  2F7C A;  3G3H A;  4F2Q A;  1EZ9 A;  1M5E A;  1MQJ A;  2V84 A;  3FVG A;  4XKN A;  3K02 A;  1B0L A;  1MQD A;  1JVX A;  2Y7K A;  1VFE A;  4RA1 A;  3PUW E;  3FXU A;  2AYS A;  4FJP A;  3SEW A;  1QJM A;  1WDN A;  2F5X A;  3T22 A;  3SES A;  5M2V A;  1SQY A;  4Z0I A;  5ISU A;  2I3V A;  1SDX A;  1XS5 A;  4MLQ A;  2R71 A;  3QIM A;  4GFR A;  1SW4 A;  2UVI A;  5B70 A;  1R6Z A;  4U23 A;  3H03 A;  4NTL A;  4PFW A;  4BLA A;  1NL5 A;  2DXR A;  3DP8 A;  1A55 A;  2PYY A;  3E3K A;  3K1N A;  2I48 A;  3BKI B;  3W9V A;  3S4U A;  4F3S A;  1JNF A;  1LBC A;  4Q5T A;  3K4U A;  3VVF A;  5HM4 B;  3VVD A;  4EDP A;  1XOC A;  2H9B A;  1ZU0 A;  3TDJ A;  1BTJ A;  3OEN A;  2OJT A;  4QF9 A;  3HHG A;  3DEL B;  3N5L A;  5FHN A;  5EHS A;  4C0R A;  2XHD A;  1GV8 A;  1Y1M A;  3TOD A;  3MVW A;  3FJG A;  4LZ8 A;  4BDL A;  2F97 A;  5JTY A;  2V93 A;  1MH3 A;  2O1M A;  1N7X A;  1IXI A;  3G3G A;  2H4I A;  2ZMB A;  3V5A A;  3DP4 A;  1LST A;  5K2Y A;  3A3U A;  3USD A;  4GXS B;  1JET A;  2QRY A;  4N07 A;  1M5F A;  2H25 A;  2X7Q A;  1RYO A;  2O68 A;  1CE2 A;  4ZS9 A;  5JTY B;  4G68 C;  3G3I A;  3CRB A;  1MXU A;  3JYR A;  3KOT A;  4PP0 A;  4DLD A;  2ZYO A;  1GGG A;  4DCY A;  3TPA A;  3VFJ A;  3LC8 A;  4OFO A;  1B32 A;  3PMW A;  4ZZE A;  4AB5 A;  3N94 A;  3FV2 A;  4IB2 A;  1TXF A;  2F6G A;  2XX9 A;  4HCW A;  3BFU A;  3UN6 A;  3DLN A;  2ZYM A;  5H8F A;  1OVT A;  3TEL A;  1QVS A;  1B51 A;  1JQF A;  3OO6 A;  3Q26 A;  1Z7N E;  4R6Y A;  1H76 A;  4ISU A;  3FAS A;  2O6A A;  1A7L A;  4GD5 A;  1H44 A;  2ONK E;  2X26 A;  3ZKK A;  4JDF A;  2O51 A;  4ZE9 A;  4MLV A;  4KR5 A;  3CG3 A;  3QYT A;  1B3H A;  4YIC A;  4TQU Q;  1D3K A;  5H8F B;  3IOR A;  2F34 A;  3M3F A;  4YZZ A;  1ZIU A;  4Z7E A;  3QUF A;  1R9L A;  2I58 A;  5I59 B;  4FOR A;  3PUZ E;  3KN8 A;  1B58 A;  3IR1 A;  1DPE A;  3C35 A;  3LSW A;  5AA2 A;  3EN3 A;  4OVJ A;  2IA4 A;  2F7A A;  4KYD A;  4BDO A;  2O7U A;  1I69 A;  2E1S A;  5ELV A;  2F36 A;  3P7I A;  1P99 A;  2Z8E A;  3V89 B;  1O64 A;  1MH4 A;  4HS7 A;  2VHA A;  4EF2 A;  4NF4 B;  3TTN A;  2F6P A;  1II5 A;  1ELJ A;  4GL0 A;  4JBZ A;  3PPN A;  2F78 A;  3QUJ A;  1YTV A;  1SVX B;  2XD2 A;  5F7V A;  1QUL A;  3PD9 A;  3F11 A;  3IB0 A;  4KHZ E;  5ITP A;  1B05 A;  1OIB A;  1LAH E;  3O66 A;  2UVG A;  2DE3 A;  3QXM A;  4P0I A;  3A09 A;  3RUM A;  4PQJ A;  2ZXT A;  4FAJ A;  5H8N B;  4ZZA A;  4NWC A;  3T93 B;  3E4R A;  1N84 A;  2O84 X;  3QK6 A;  4F19 A;  1B7Z A;  2QL3 A;  3IO6 A;  1Y9U A;  5HPQ A;  3OO7 A;  5FTH A;  4ZE8 A;  3N6T A;  1Y3Q A;  2ZNT A;  4NF5 A;  2HCA A;  4OET A;  3VLU A;  3VVE A;  1LLS A;  4IO2 A;  4U1O A;  2RC7 A;  4OWD A;  5CBS A;  2OCU A;  2YLN A;  3G3F A;  1UQW A;  1MM7 A;  1AIV A;  3W9W A;  2RC9 A;  5B7D A;  3D4C A;  1ZTY A;  3KFM A;  3TFL A;  3OO9 A;  4R75 A;  1SD3 A;  4R9F A;  1N3X A;  1B5J A;  3MC2 A;  1SW5 A;  5ICT A;  4X1D A;  1ATG A;  3IL1 B;  3R7X A;  2VGQ A;  1DMB A;  1PC3 A;  3S9N C;  4ZED A;  5ICQ A;  2UXA A;  4DXU A;  3JZJ A;  3A3C A;  2OWT A;  3H6T A;  5CM6 A;  4BDQ A;  2PX1 A;  5KCJ A;  1ZMG A;  2Q2A A;  3B7D A;  4PE5 B;  1P1N A;  5CRY A;  1B46 A;  5DEX A;  5HBC A;  2NVU B;  3G3K A;  3VLW A;  4JWY A;  4EXK A;  1YCJ A;  1A8E A;  3ONM A;  1EH3 A;  3KSX A;  4KQP A;  1CB6 A;  1LCT A;  1IIT A;  3MAM A;  3KJT A;  4KFQ A;  5KCJ B;  4G77 A;  4QFP A;  4FEB A;  3K6X A;  1UIU A;  4U4S A;  5H8S A;  1D4N A;  4AQ4 A;  3O28 A;  1EZP A;  5I57 A;  3GLB A;  4IO4 A;  1FTK A;  3MVY A;  1OMP A;  1MDQ A;  5AA3 A;  3FAT A;  1OLA A;  4H5F A;  1QKB A;  1PDA A;  3WAE A;  3SEV A;  3IB1 A;  2FNC A;  3OXN A;  4IO3 A;  5I2N A;  4OEV A;  1MXV A;  3VXB A;  3H3G A;  2GFE A;  3OEK A;  5K2X A;  5BWJ A;  5AE4 A;  5CMC A;  2VD2 A;  3U8Q A;  3IK6 B;  5ITO A;  2V3U A;  1HSE A;  5DT6 A;  3ODB A;  2ESN A;  1PB8 A;  1FQD A;  1MPD A;  4KI0 E;  5I2N B;  3MP1 A;  2NWJ A;  1USY E;  5F1Q A;  1QKA A;  2ZYK A;  2I4C A;  2Q9T A;  1MQH A;  4R2B A;  4F3P A;  5DVF A;  2XXY A;  4XXU A;  3FD3 A;  3RT8 A;  3U1O A;  4MFI A;  3VV5 A;  2QJE A;  3IJO B;  5JK4 A;  1M5C A;  1DTG A;  2ANJ A;  4YB6 A;  2NUV A;  2Y7P A;  4WXJ A;  3Q29 A;  1AOV A;  1SI1 A;  3M3L A;  4H8I A;  4H8J A;  3ZSF A;  3RT6 B;  4U2R A;  4G8N A;  4I1D A;  3TQW A;  1HSJ A;  3H6V A;  1IEJ A;  4RK2 A;  4I8C A;  3K1P A;  4HW8 A;  2QS3 A;  2Z8D A;  4YB5 A;  1PBQ A;  1JVY A;  4ZEC A;  4XKP A;  3MZ1 A;  3H7M A;  2OK2 A;  2XXT A;  1N76 A;  2I3W A;  4PET A;  1Q1K A;  1JEV A;  2ZYN A;  4LVQ A;  4JWO A;  4OXV A;  1URG A;  1USY H;  3M8U A;  2Q2C A;  4F3B A;  2HAV A;  4FE8 A;  1MPC A;  4O3C A;  2Y84 A;  3SER A;  1L5T A;  2GRV A;  4JSO A;  3UOR A;  5I84 A;  4THI A;  3C34 A;  5BUU A;  2QS2 A;  3QAX A;  4WKM A;  2XXH A;  3RLF E;  1EZO A;  1MG1 A;  2R6G E;  3K6W A;  4LUB A;  2ZNU A;  4ECF A;  3PGF A;  1LFG A;  4DE8 A;  3TTR A;  3KOS A;  1US5 A;  1ZKB A;  3TTM A;  1MY1 A;  4I9D A;  5KZT A;  1Y3P A;  2PT2 A;  2B3F A;  3RNN A;  3KGC A;  4ONY A;  2O69 A;  4YAH X;  1B52 A;  2I0C A;  1JEU A;  4NMY A;  3L6G A;  3QSL A;  3AXF A;  5I2K A;  1ANF A;  4QSE A;  1LAG E;  4C1U A;  3VLV A;  4R6H A;  1S50 A;  3OOA A;  3IOW A;  4DXC A;  2XXW A;  2DWJ A;  3H6W A;  3KBR A;  3TAJ A;  4OTE A;  5TU0 A;  1XC1 A;  1US4 A;  3LR1 A;  2QSX A;  3O6G A;  3HV1 A;  1POY 1;  1MXX A;  3PPR A;  3MBP A;  5J1D A;  5DVI A;  5I2K B;  1JW4 A;  4I62 A;  1DPP A;  1PBP A;  3K6V A;  3C4M A;  3TMG A;  1MRP A;  4MF3 A;  3TQL A;  1RKM A;  1NFT A;  4R6K A;  3KN7 A;  3EPE A;  4H67 A;  5I59 A;  1IUD A;  3T9X B;  3TCF A;  1BP5 A;  4X1B A;  3DM0 A;  1B9J A;  3WAF A;  4OHN A;  1MY3 A;  2KLF A;  1IXC A;  2XXQ A;  3T66 A;  5AA2 D;  1I6Q A;  3U93 A;  4QFK A;  4RXL A;  5AA4 B;  4IGR A;  1FQC A;  1NNF A;  2Y7I A;  2HXW A;  4H65 A;  1IZ1 A;  2QS1 A;  3SDF A;  1SW1 A;  4XKQ A;  4F1U A;  3BBR A;  2P1S A;  4GF8 A;  2DXY A;  3OMB A;  3I6V A;  4YKK A;  3EF7 A;  4NF4 A;  4G8M A;  1A40 A;  3B6W A;  4NED A;  3U92 A;  3ECR A;  4QFL A;  1QUI A;  3Q25 A;  4G68 A;  1LAX A;  5CMK A;  1PB9 A;  2DS9 A;  1R1N A;  3K01 A;  2RC8 A;  2Z23 A;  5KDT B;  1PEB A;  2AL5 A;  5H8H A;  4HCY A;  4NF6 B;  1P1Q A;  1S7Y A;  5EHM A;  3FXR A;  2A5S A;  3JV9 A;  1N7W A;  4U4X A;  4LQ2 A;  3FUZ A;  5H8N A;  1B7U A;  4G68 B;  5L9O A;  4F1V A;  3MZ9 A;  2E0S A;  4M4G A;  2PMS A;  3MW0 A;  2REG A;  5H8H B;  3KEI A;  2DE4 A;  1AH5 A;  4Q30 B;  4FEC A;  3LBS A;  5FTI A;  4U21 A;  2IEE A;  2XXP A;  1Y4T A;  5CMB A;  2I4B A;  2PVU A;  3T9V A;  3LSL A;  1FTJ A;  1AL3 A;  4YKP A;  4QFO A;  2O1L A;  2XXR A;  2XD3 A;  1TWY A;  4TLM B;  5TPA B;  1YPN A;  2QMW A;  1MY4 A;  3SEY A;  4PFT A;  3TTL A;  4EQB A;  1WOD A;  2O7I A;  2DE2 A;  4YKI A;  1FQF A;  4BDN A;  1KWH A;  4E0W A;  3S9L C;  2HQ0 A;  4G8H A;  4OMB A;  3RTW B;  1NH8 A;  2H5Y A;  2DSF A;  1LB8 A;  4IO5 A;  4ZEF A;  2ZNS A;  4F39 A;  1MXY A;  3OEM A;  3S9E A;  4N6P A;  2D3I A;  3T96 B;  3PD8 A;  4RK9 A;  2Q8J A;  1MDP 1;  4F3G A;  1B4Z A;  3IOT A;  3TYH A;  1P1W A;  5A5X A;  1IXG A;  2P0S A;  1NNK A;  1QUJ A;  4JWX A;  1OLC A;  4DIG A;  1LFH A;  3CSB A;  1URD A;  2GHB A;  3CIJ A;  1MQG A;  5CMM A;  5TP9 B;  1S9T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...