3GLBA

Crystal structure of the effector binding domain of a catm variant (r156h)
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
215
structure length
215
Chain Sequence
SQTLRIGYVSSLLYGLLPEIIYLFRQQNPEIHIELIECGTKDQINALKQGKIDLGFGRLKITDPAIRHIVLHKEQLKLAIHKHHHLNQFAATGVHLSQIIDEPMLLYPVSQKPNFATFIQSLFTELGLVPSKLTEIREIQLALGLVAAGEGVCIVPASAMDIGVKNLLYIPILDDDAYSPISLAVRNMDHSNYIPKILACVQEVFATHHIRPLIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inducer responses of BenM, a LysR-type transcriptional regulator from Acinetobacter baylyi ADP1.
pubmed doi rcsb
source organism Acinetobacter sp.
molecule tags Transcription
molecule keywords HTH-type transcriptional regulator catM
total genus 59
structure length 215
sequence length 215
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3glbA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3glbA02
4YB5A 3VLUA 3K6XA 4ND9A 4E0WA 5I56B 1Y20A 1GVCA 2E0SA 3C36A 3HN0A 4OESA 4PFWA 3VV5A 3ZKKA 1URDA 4EXKA 1GGGA 5KDTA 1N3XA 4G68B 3V89B 2H9BA 3Q27A 4WXJA 2XD2A 1B4HA 3H6WA 4HS7A 4ZEIA 3IJOB 1I69A 4E0XA 3FJGA 1MQGA 3LUYA 3V5AA 4LVQA 4AQ4A 1PB9A 2VHAA 4QSEA 3MZ1A 1B7HA 3PMWA 5B7DA 1B6HA 3FIRA 2Y7PA 1R1NA 2XX8A 3PPOA 4OQOA 3FV2A 3JZJA 3RNNA 5AA2D 1Y4CA 1SW1A 1SW4A 3ILUB 1A55A 3FVKA 3JV9A 3MQ9A 1B5JA 1F9BA 3H06B 1MXUA 4IY5A 4PFTA 1MQDA 5F7VA 2RINA 2ZMBA 4OXVA 3RY3A 2PYYA 3TPAA 3I3VA 2DWJA 1YCJA 2GH9A 2XXRA 3BKIB 4LZ7A 3PUVE 4YU0A 1J1NA 5F1QA 5CMCA 3VE1B 3L6GA 1PEBA 3E9XA 4GLIA 4GXAA 2F97A 3IR1A 4NTLA 1O64A 5EHMA 1IXIA 1MY4A 3VVEA 4QFNA 3T93B 2ANJA 5FHNA 4QFLA 4R73A 5LOMA 1LFHA 2UYFA 1XT8A 3TYHA 3UN6A 3IK6B 4O3AA 3FJ7A 3DP4A 5AE4A 1II5A 3DLNA 2DQVA 4DCXA 5H8QB 4KR5A 1RYOA 1XOCA 2DXRA 2WKYA 3CVGA 4NEDA 3TCHA 1SVXB 1N7XA 5ISUA 3RLFE 1DTGA 3K01A 1S9TA 4R6KA 1NH8A 4Z0IA 1MH3A 5AA1A 1B7ZA 4GOTA 3F11A 1LGBC 4IO6A 4IO3A 4F1UA 4JBZA 1JNFA 3FZVA 3SEYA 1MY3A 4F3PA 4FAJA 3R26A 2IA4A 4DXCA 5TP9B 3Q29A 5DYHA 1VE4A 4KPTA 1SYIA 1QUJA 2I0CA 5A5XA 2B3BA 3KJ7A 3N6UA 4G8MA 1N0TA 3IJXB 4P0GA 4LP2B 2V84A 3TTLA 1A8EA 1S7YA 1M5EA 4YKPA 1B51A 3FXRA 3OO6A 4AB6A 1VSOA 4ECFA 2X7QA 3A09A 4OERA 1XHYA 3KN7A 3PD8A 2F7BA 3G7WA 4JWYA 4OVJA 3P7IA 1FQEA 4QRZA 5DVJA 3MP6A 1UTBB 1PBPA 1B4ZA 4GRKA 1P1UA 4H67A 3H6TA 4R72A 4R6YA 1DOTA 3O6IA 4KQPA 4N6PA 1JETA 4R74A 4ESXA 4R75A 4XKPA 1MS7A 3LSLA 4KCDA 2ONKE 4THIA 3CSGA 3O6HA 4POXA 1D9YA 3M3LA 3G3FA 3OD7A 2O51A 4F18A 3OSRA 5H8HA 2OZZA 3TAJA 4DE8A 3EHUA 3A3CA 3IL1B 2OJTA 4OFOA 3KN3A 3CG1A 3VFJA 2FNCA 1GR2A 2XXVA 2O69A 4ONYA 5FHOA 3TTRA 4EF1A 4F2QA 3S9LC 4RPNA 2R71A 3KZGA 3VXCA 3C34A 3Q26A 4ELPA 3IB1A 4FE8A 4R6HA 3W9VA 1B32A 1OQGA 1URSA 2OBGA 2REJA 2V25A 4PFYA 1Z7ME 2NWJA 1LAXA 5TPAB 3SESA 3ZS6A 3MPKA 3K0VA 3PGFA 3ZKLA 1QVSA 2LAOA 1Y1MA 3O6GA 4G68C 4KYEA 3LC8A 1FQCA 3H3GA 1UTBA 3E13X 2H98A 4FORA 4JDFA 4WKMA 3PPRA 3VVDA 3CR9A 5DEXA 3PPPA 1YPNA 3G3GA 3PPNA 1IXCA 3MWBA 5TP9A 1JVYA 3E3KA 3ECRA 1FQDA 4LQ2A 3VLVA 3IOVA 5ICTA 3IOTA 1XC1A 4KFQA 3GBAA 1SD3A 3FD3A 5CM6A 4P0IA 1N7WA 4JSDA 3FVOA 2XD3A 2YPNA 4FIMA 2V3TA 2G93A 2PT1A 1DSNA 1MXWA 1DTZA 4R9GA 5KZTA 4K3FA 4NWCA 2QS3A 4F1VA 4X48A 5IKBA 4NF6B 1FQBA 4GWOA 2RKMA 4QSDA 4RYAA 3EF7A 3FXUA 2QJEA 4QFKA 4GVOA 1IITA 1LB8A 1Y3NA 2ZNTA 4H0WA 1IXGA 1USYH 1ELJA 5KCJA 4DLDA 1R6ZA 1B1XA 3FATA 4JXIA 1MY0A 4MLQA 2ONRA 3B6QA 4XKNA 3T9UA 4G2ZA 4U4XA 4IB2A 4BDQA 1B5IA 3GLBA 3I5OA 5H8HB 1ZU0A 3HV1A 1DPEA 3OXNA 3M3KA 1T0KA 5CMBA 5ELVA 1P1QA 2PVUA 3VVFA 3TELA 1MPDA 2QL3A 3KG2A 3OO8A 2D21A 4RK2A 3JYRA 4FECA 4GL8A 1HSEA 1LFIA 1FCKA 1MY2A 2UYEA 4M4GA 3ODBA 1FQAA 4O3BA 1CE2A 2AL5A 2F36A 2V3QA 2HQ0A 2Z8DA 1B3EA 1B05A 2Q8JA 3W15C 3FXQA 4OENA 1AL3A 3RTFB 1AOVA 3PV0E 2R9JA 2Y7WA 4GD5A 1A99A 5CRYA 1MY1A 4GFRA 1M5DA 5EHSA 4C1UA 2H4IA 1LBBA 3S9EA 1ZMGA 3BBRA 4OEUA 5CMMA 1MM7A 2A5TB 3MAMA 4NF4B 2I58A 1SYHA 1P1NA 1WDNA 3CSBA 4POWA 1H45A 2DWAA 4LZ5A 4ZEBA 2ZYMA 2QMWA 3LSXA 3OEKA 1US5A 4GL0A 2HAVA 2Q89A 1MQJA 1MQHA 3KOTA 4OTEA 1UIVA 4U21A 5B70A 1B3FA 1Y1ZA 1ZTYA 5I58A 2DXYA 4NWDA 3L6HA 3TTMA 2PX1A 1JEUA 3KBRA 1LB9A 3W9WA 1OVTA 2I4BA 2Y7KA 5DVFA 1I6BA 4ZZAA 1L5TA 3HHFA 3H03A 3CFLA 3TZAA 4F2OA 3V83A 1OQHA 1ZLQA 2V93A 4L17A 2H5YA 2I3VA 2I49A 3EHTA 3M3FA 4ZEKA 3VDFA 4F3SA 4Z7EA 3TODA 5AA4B 2ZYOA 4XTCQ 5FTHA 3HHGA 5I2KA 5JK4A 3PUZE 5KCJB 2QRYA 3HO7A 5AA3A 1A40A 4U1ZA 1SI1A 1XVXA 4NE4A 3RT8A 2ALUA 3QSLA 4MLVA 1NNPA 4NF8B 2DE3A 4F1YA 3MBPA 4I62A 1B3HA 1PC3A 3O66A 1FTLA 4YICA 5J1DA 3BFTA 3TCGA 1AMFA 3PUWE 3IOWA 2I3WA 3BFUA 5FTIA 4IO5A 1MH4A 3CRBA 3THIA 2AL4A 3RUMA 1H3DA 4QSCA 2E1SA 3G3KA 2ONSA 2THIA 4G68A 3MP1A 4X1DA 5CMKA 4ZDMA 5I59A 1WODA 4OFLA 4UA8A 5BUUA 1IEJA 5M2VA 1NH7A 4M1VA 2XXQA 3H6UA 4BDOA 3RN8A 5CBRA 4NF5A 3DP8A 4OEVA 1FTMA 2RC8A 1O7TA 2F7AA 3C31A 5HBCA 2CZLA 3TTKA 2I4CA 1N84A 4OMBA 1OLAA 3GXAA 4XKRA 1VR5A 3VLWA 2XXUA 4G77A 4FATA 2QS2A 4IO4A 4IY6A 1SBPA 1US4A 3IB0A 2VOZA 3MPLA 3UORA 1FTOA 1YTVA 3AXFA 3OSQA 4LA9A 4LQ5A 3TFLA 3TKDA 4AB5A 1FTKA 1BLFA 3QAXA 2Z8FA 2XX9A 1MXYA 1LAGE 1USYE 3R6UA 3TCFA 1H44A 4TOZA 2GHAA 4RK9A 1M5CA 3FVGA 3K4UA 2NXOA 4BLAA 3QUFA 2XXWA 2Z8EA 2RCAA 3K02A 3O2AA 1B3LA 4LATA 4R2FA 5I2NB 4R9FA 2O68A 3U94A 5A5XB 3PMVA 4ZEFA 5AA4A 2M8CA 1SDXA 5IAIA 2A5SA 2H99A 1PB8A 1O63A 1Q35A 3FUZA 3K6UA 5I2KB 4F29A 1B52A 1B2HA 1GTKA 3EPEA 3H4ZA 3PMXA 1B1HA 4YKJA 3CFXA 4IO2A 3S9MC 3OELA 4JB7A 1JW1A 1QUIA 2Y7RA 5CC2A 1MG1A 3DM0A 4H8JA 1R9LA 1H43A 4G8HA 4TLLB 5L9MA 3G3IA 4EDPA 4YMAA 3N5LA 3UIFA 1B46A 4F3GA 3KEIA 4H1XA 4Q8RA 1WVJA 3K2DA 4QFPA 4U23A 2W7YA 2RC7A 1MDQA 4RPOA 2A5TA 4U1OA 2I48A 1QKBA 4YB6A 5K2XA 1B0HA 2O84X 2Q2AA 5I59B 1BP5A 3MVWA 3B7DA 3HCQA 3IB2A 1AH5A 4KD5A 4OFJA 4YZZA 5JTYB 3TQLA 3MJNA 1SQYA 1CB6A 1B5HA 3B6WA 4ZECA 4KYSA 4ESWA 5HM4B 3MW0A 2D3IA 2UVHA 2VP1A 5I2NA 4ELRA 3U1OA 4Q5TA 4R2BA 3R7XA 4ELOA 1N3WA 4RNSA 1YAEA 2NUVA 4OZ9A 3C32A 2O7IA 4DXUA 2V3UA 1MRPA 4GXSB 5AA2A 1QJMA 4PE5B 4BDNA 4DDDA 1NNFA 1MQIA 4MBPA 4EQ9A 3U72A 2P2AA 1A54A 1Y4TA 2HEUA 2UXAA 3Q28A 1NKXA 4FEDA 1NNTA 3T9HB 3TQWA 1NNKA 1TFAA 3USDA 2I0BA 2ZNSA 3KSJA 3N6TA 4F22A 1P1OA 3T22A 5I57B 1RKMA 2P0SA 2DE4A 2O7UA 2X26A 3U93A 3H7MA 5L9OA 2Z22A 4N07A 1POY1 1R9QA 1MDP1 1MXXA 3ILTB 1LAHE 3N94A 4F3BA 3SETA 5I58B 2DVZA 1IXHA 4OYVA 3ONMA 4G4PA 4X1BA 2GRVA 3OENA 2DVCA 2XXYA 3TTNA 4DZ1A 5ITPA 4FJPA 2ABHA 3RGYA 2DWHA 2ZXTA 3O97A 4RJZA 4NF6A 2UVGA 1OLCA 1FW0A 3OMBA 4HTGA 2DWIA 4NF8A 4H5FA 3SEUA 4Q30B 3T96B 4NF4A 2ZNUA 2XXHA 3SEVA 5AA2B 1Z7NE 3SEXA 3D4CA 3E4RA 4BDLA 4QHQA 4G8NA 4U4SA 2Q88A 4WEPA 3S4UA 3O29A 4EQBA 3T9XB 4HW8A 1M5FA 2GFEA 4U22A 4ZE8A 3LBSA 3EN3A 1HSJA 4I9DA 5H8FB 1B9JA 4DXBA 4YMBA 3B6TA 1S50A 1QW0A 1DPPA 1M5BA 1MXZA 2Y84A 2DP8A 3CG3A 1LFGA 1P99A 4OHNA 2F8DA 1Y3PA 4WEDA 4ELQA 3PU5A 1BKAA 2HZLA 4IO7A 1LBCA 1OIBA 1TXFA 1ZKBA 1XS5A 2F6GA 3EHSA 4UACA 2HAUA 4H6DA 2OWTA 1A8FA 4PETA 3DELB 4QFOA 1D9VA 1FQFA 1EZ9A 2VD3A 3O28A 4NF5B 4OWDA 3FVNA 3RQTA 1TT1A 4DIGA 4HCWA 2DSFA 3OOAA 1OMPA 1TFDA 1UTHA 2Z23A 4RXLA 3MZ9A 3PUXE 3SEWA 3CIJA 5H8NB 3PD9A 5BWJA 5TU0A 3MC2A 3UK4A 1VFEA 3KJTA 2FYIA 4LZ8A 3DP6A 1JVXA 2R6GE 3TDJA 1B7UA 4PP0A 3G3HA 2F34A 3RT6B 1D4NA 1SI0A 2RF1A 3MVXA 1B3GA 3FV1A 4LONB 3WAFA 1SW2A 4F39A 4ZEDA 5I56A 1PB7A 3FJMA 3RPWA 2QS1A 4TLMB 2O6AA 2HZKA 2PBWA 4MH5A 5FHMA 5KDTB 2DYXA 3H6VA 2HFBA 2REGA 4MFIA 5DTBA 3HSTA 4IGTA 3S2VA 3SERA 1HSLA 4BDMA 4LUBA 3OO7A 2AIXA 2F7CA 4NMYA 3CFZA 1N76A 1D3KA 2OLBA 3GBBA 4KI0E 2ESNA 3MVZA 3K6VA 1Q1KA 3PPQA 2DOJA 1MPBA 1POTA 1JW5A 2XXPA 4PQJA 3UGWA 1Y9UA 4F31B 1KWHA 1TWYA 1ZBMA 2UVIA 2UVJA 3C9HA 2IEEA 3IO4A 3M8UA 2OWSA 4GF8A 4XIGQ 1B0LA 3IX1A 3MUQA 2VGQA 2HXWA 2XXXA 2B65A 3K1PA 4YKKA 3U8QA 1P1WA 1IUDA 4C0RA 1EU8A 4ISUA 2NVUB 2QSXA 5JTYA 2B3FA 4XXUA 1XVYA 3CI8A 2FA7A 2DS9A 1BIYA 1FTJA 2P1SA 1ANFA 4HCYA 3V8XB 3Q25A 5L8DA 1IQ7A 3MVYA 4N13A 2O1LA 2XXTA 3K1NA 4YKIA 4I1DA 1SW5A 2HCAA 2OK2A 1LCFA 3T9VA 4EQ7A 1EZPA 1QULA 4OETA 2RC9A 3C4MA 1A7LA 1N04A 5CI5A 2KLFA 1LLSA 3D4GA 3PUYE 3UP9A 3MP8A 3WAEA 1MPCA 4P11A 2F6PA 2QS4A 4JWOA 5I57A 3SDFA 3KSXA 3LR1A 3QYTA 2G29A 5CBSA 2QMXA 3TEPA 1ZJLA 4TQUQ 4EXLA 5HPQA 4F19A 2Q2CA 1QKAA 3GZGA 4KYDA 3VXBA 1EZOA 2XHDA 1NFTA 4GIZA 1DMBA 1GV8A 4I8CA 1QUKA 3EQ1A 4KCCA 3QUJA 1LSTA 4RY1A 3KN8A 5H8QA 1IIWA 3IOUA 1JQFA 3IO6A 1LCTA 2D5WA 1BTJA 1B40A 3MZBA 4H65A 4U2RA 2Y7IA 2XX7A 1PDAA 2BJJX 3FGSA 1MXVA 3OEMA 3QK6A 3TMGA 1IZ1A 1ZIUA 2I6EA 2X7PA 3QIMA 4RA1A 2F78A 3SKPA 1LAFE 4Q0CA 1I6AA 3KOSA 3O9PA 4GQOA 1MM6A 2AYSA 3C33A 3IORA 3KGCA 2ZYKA 4H5GA 4H8IA 4IGRA 4O3CA 3U92A 5JEIA 4C1TA 4MF3A 4XKQA 1EH3A 2NOOA 4JSOA 4YAHX 4DCYA 1OVBA 2RCBA 2GHBA 3FASA 3G3JA 5DEXB 2PMSA 4KHZE 1JEVA 5DT6A 5K2YA 5H8FA 3S9NC 1NL5A 3ZSFA 4BDRA 3A3UA 1JW4A 2O1MA 5DVIA 2ZYNA 3QXMA 1Y3QA 2F5XA 1H76A 1AIVA 2H25A 5ICQA 4JWXA 5EYFA 1VFDA 2OCUA 2VD2A 2YJPA 3I6VA 2DE2A 1NMUA 5TPAA 1UQWA 2XXIA 1UIUA 5L9SA 3LSWA 4X9TA 2YLNA 3RTWB 4EF2A 3TUSA 2Q9TA 1B58A 4ZE9A 1I6QA 1UTHB 4EUOA 5H8SA 1ATGA 3K00A 1PBQA 4QF9A 3C35A 4FEBA 2CMOA 3T66A 3HPIA 3IAZA 4PFUA 1RYXA 2QPQA 4ZS9A 3UA8A 3K1MA 3KFMA 1URGA 4YB7A 5H8NA 2F35A 5I84A 2PT2A 3K6WA 3LSFB 3N26A 4ZZEA 5ITOA 3OO9A
chains in the Genus database with same CATH superfamily
3VLUA 2KR0A 1GVCA 3C36A 3ISPA 3HN0A 2Y5KA 3ZKKA 4EXKA 1GGGA 1N3XA 2H9BA 3Q27A 2XD2A 1B4HA 3FJGA 3LUYA 4LVQA 5B7DA 2XX8A 4OQOA 3FV2A 3RNNA 1A55A 2ZMBA 3TPAA 4OA4A 1J1NA 4NTLA 1PEBA 2F97A 5EHMA 1K9YA 1MY4A 2ANJA 5FHNA 4QFLA 4R73A 1LFHA 2UYFA 4PDHA 3UN6A 3IK6B 5AE4A 3DP4A 2QVRA 1LBYA 1RYOA 4PAKA 4NG7A 4R6KA 1NH8A 4GOTA 4IO6A 1JNFA 4FAJA 3R26A 5TP9B 3Q29A 2I0CA 4HE1A 3KJ7A 4G8MA 2V84A 3FXRA 4AB6A 1VSOA 4EDPA 5DVJA 1UTBB 1B4ZA 1FBFA 4R6YA 1DOTA 4N6PA 1KA1A 1MS7A 4KCDA 2O51A 1IMCA 3A3CA 3VFJA 2XXVA 4ONYA 3TTRA 4F2QA 5IZ3A 4ELPA 3C34A 4LN5A 1OQGA 2OBGA 1FJ9A 4PFYA 1LAXA 5TPAB 3SESA 2FIXA 3PGFA 2QFLA 3LC8A 1UTBA 3E13X 2H98A 4FORA 2JJKA 3PPRA 3CR9A 2GQ1A 1IXCA 1JVYA 3ECRA 3IOVA 3IOTA 4KFQA 4JSDA 2G93A 1DSNA 1NUYA 1NV6A 4K3FA 4I3EA 3BIGA 1FQBA 2XA5A 4GVOA 4H0WA 1LBXA 1IXGA 4DLDA 3UK4A 4MLQA 1FPFA 1MY0A 2ONRA 3B6QA 4XKNA 4G2ZA 3I5OA 1ZU0A 3OXNA 2PFZA 5ELVA 2PVUA 3TELA 2QL3A 4P47A 1FCKA 1FQAA 4O3BA 5FBPA 2HQ0A 2HPGA 2B4LA 1B05A 1FBGA 5CRYA 3KC1A 5EHSA 1M5DA 2A5TB 3MAMA 1WDNA 1NUWA 4POWA 2QMWA 1MQJA 1UIVA 2DXYA 3TTMA 1JEUA 3KBRA 1OVTA 4L17A 4NGUA 3M3FA 3TODA 5I2KA 3PUZE 3HO7A 1A40A 3QSLA 1NNPA 4F1YA 4I62A 4YICA 1FTLA 3TCGA 1AMFA 3PUWE 4JVIA 5FTIA 3THIA 3T1BA 2AL4A 2THIA 3RYDA 1IEJA 1FBPA 4BDOA 4QBAA 2CZLA 2I4CA 1N84A 1OLAA 2P3VA 2QVVA 1VR5A 4G77A 4FATA 2QS2A 4IY6A 4LA9A 3TFLA 3FBPA 2HXRA 3QAXA 2XX9A 1MXYA 1USYE 3R6UA 4GWUA 2GHAA 3K02A 5A5XB 3PMVA 1SDXA 3FUZA 4H45A 3K6UA 4YKJA 3CFXA 5CC2A 4TLLB 5LTCA 1B46A 3KEIA 4Q8RA 1WVJA 5ESYA 4YB6A 1B0HA 2Q2AA 5I59B 3MVWA 3HCQA 4YZZA 3RPLB 2VP1A 1RDYA 2CZKA 4BDNA 4DDDA 4MBPA 4EQ9A 3U72A 1NNTA 3TQWA 1TFAA 2ZNSA 3N6TA 2Q8MA 1P1OA 3T22A 5I57B 1RKMA 3U93A 2O7UA 3S9MC 4N91A 3ILTB 2DVZA 3ONMA 4G4PA 3TTNA 2XXYA 4RJZA 1FRPA 2XXHA 1FBCA 4BDLA 4QHQA 4WEPA 3T9XB 4HW8A 4ZE8A 1B9JA 4YMBA 1S50A 1DPPA 2DP8A 4ELQA 1LFGA 4OHNA 1LBCA 2F6GA 4UACA 3EHSA 4QFOA 1D9VA 1FQFA 1EZ9A 2VD3A 1TT1A 4HCWA 2DSFA 1TFDA 2Z23A 3TDJA 4PP0A 4PFIA 1D4NA 1LBVA 3MVXA 5I56A 1PB7A 3FJMA 2HZKA 1NUZA 4MFIA 5DTBA 3HSTA 1SPIA 2KQZA 4LUBA 4MNIA 2FBPA 4P9KA 3PPQA 2UVJA 4XIGQ 4XEQA 3RPLA 3K1PA 4C0RA 1QGXA 5JTYA 1FPJA 4XXUA 2DS9A 1BIYA 4OVQA 3V8XB 3MVYA 4GWYA 2OK2A 4EQ7A 2KLFA 1LLSA 3D4GA 3WAEA 2R8TA 2CZIA 3SDFA 3TEPA 4F19A 1BK4A 2Q2CA 3QUJA 5H8QA 3IO6A 3QK6A 3TMGA 1MXVA 1MM6A 3KGCA 1NV4A 4C1TA 1EH3A 4DCYA 4PTKA 5DEXB 5DT6A 3ZSFA 5DVIA 5ICQA 5EYFA 4JWXA 2VD2A 2OCUA 3I6VA 4X9TA 1B58A 4NF0A 1I6QA 1UTHB 1DBZA 1ATGA 3K00A 4PFUA 3UA8A 5I84A 4YB7A 5H8NA 2F35A 3LSFB 4E0WA 1Y20A 2E0SA 5KDTA 4WXJA 3H6WA 4HE2A 4AQ4A 1PB9A 2VHAA 1B7HA 1JP4A 4PDDA 1FBHA 1KA0A 5AA2D 1SW4A 1Y4CA 3ILUB 3FVKA 1F9BA 5F7VA 3H06B 1MXUA 4IY5A 3RY3A 3I3VA 2DWJA 3VE1B 3L6GA 4GLIA 1IXIA 3VVEA 1YYZA 5LOMA 3TYHA 2WX9A 2WEFA 1NV0A 4O3AA 1II5A 2DQVA 5IM2A 5H8QB 2XWOA 4KR5A 1XOCA 3CVGA 5EQ9A 2CZHA 1N7XA 5ISUA 1DTGA 3K01A 1XI6A 4F1UA 4F3PA 4DXCA 2IA4A 5DYHA 1EYJA 5A5XA 1SYIA 1QUJA 2MKZA 2B3BA 1A8EA 1M5EA 3LUZA 1B51A 2X7QA 3A09A 1XHYA 3KN7A 3PD8A 4OVJA 3G7WA 1FQEA 3MP6A 4R72A 1PBPA 4H67A 3H6TA 4MNPA 5CBSA 4KQPA 4R74A 4R75A 1FSAA 4QXDA 4PF6A 5F24A 2ONKE 4THIA 4POXA 1D9YA 1Q9DA 3G3FA 3OD7A 1IMAA 3IL1B 2FNCA 4DI4B 4RPNA 1URSA 1NV5A 2V25A 3K0VA 4G61A 4KYEA 1YXIA 4JDFA 3VVDA 1YPNA 3PPNA 3MWBA 3E3KA 4OVPA 1XC1A 3FD3A 3FVOA 2YPNA 1DTZA 4R9GA 4NWCA 4NF6B 4GWOA 4QSDA 4QFKA 1NUXA 1ELJA 5KCJA 1R6ZA 4JXIA 2Y5LA 4IB2A 4BDQA 3GLBA 3HV1A 3M3KA 1P1QA 2F3BA 1MPDA 3KG2A 4RK2A 4FECA 4X04A 3ODBA 1CE2A 1B3EA 4OENA 2R9JA 1MY1A 1LBBA 5CMMA 1SYHA 1P1NA 3OEKA 4OTEA 2Q89A 3KOTA 1FTAA 1Y1ZA 2PX1A 1LB9A 2I4BA 3HHFA 3H03A 3V83A 1OQHA 2I49A 2I3VA 4ZEKA 2WBBA 2ZYOA 4XTCQ 5JK4A 2L5VA 1FPKA 5AA3A 4MLVA 4NF8B 1LBZA 1PC3A 3O66A 3IOWA 1RDXA 4IO5A 3CRBA 3RUMA 1H3DA 4QSCA 2E1SA 3G3KA 4G68A 3MSTA 4OFLA 2XXQA 5I7IA 2V4CA 4NF5A 4OMBA 5EQAA 2XXUA 1SBPA 3IB0A 2VOZA 3AXFA 4UABA 3TKDA 2CEYA 1LAGE 4RK9A 3K4UA 2Z8EA 3O2AA 1B3LA 3U94A 4ZEFA 5AA4A 2M8CA 2H99A 4F29A 1B52A 1GTKA 3OELA 4JB7A 1R9LA 1H43A 3ROJA 4H1XA 2RC7A 1MDQA 2A5TA 2I48A 1QKBA 2O84X 1BP5A 3B7DA 4JVCA 1AH5A 3TQLA 1SQYA 1B5HA 3B6WA 3MW0A 2D3IA 3GYYA 3U1OA 1N3WA 1YAEA 2O7IA 4PE5B 1Y4TA 2UXAA 4FEDA 1NKXA 3USDA 5L9OA 1MDP1 1MXXA 4F3BA 1IXHA 4OYVA 2GRVA 2ABHA 1OLCA 1FW0A 2DWIA 4NF8A 4Q30B 2VT5A 4N4UA 2ZNUA 4OVRA 3SEVA 5AA2B 4U4SA 1M5FA 1QW0A 4X1BA 1MXZA 2FIEA 3CG3A 2F8DA 1Y3PA 4WEDA 2HZLA 4IO7A 4H46A 1XS5A 2OWTA 1A8FA 4DIGA 4P3LA 4RXLA 3MZ9A 3PUXE 3SEWA 3CIJA 4I3YA 1VFEA 3KJTA 4LZ8A 1JVXA 2F34A 2RF1A 3FV1A 5LDZA 4ZEDA 4TLMB 3H6VA 2HFBA 3OO7A 4NMYA 4IR8A 1FBEA 1N76A 2OLBA 3GBBA 4KI0E 3FXBA 3LV0A 2ESNA 3K6VA 4MEVA 2XXPA 3UGWA 3C9HA 2OWSA 3E78A 3IX1A 3U8QA 1IUDA 2QSXA 1FTJA 4HCYA 2HHMA 4N13A 4YKIA 2XXTA 4OANA 1SW5A 1LCFA 1QULA 3MP8A 1MPCA 5I57A 2G29A 4EXLA 4PBHA 1QKAA 2XHDA 4GIZA 1DMBA 4I8CA 4PFBA 3EQ1A 1JQFA 1B40A 4H65A 4U2RA 2XX7A 2F78A 1LAFE 3C33A 2ZYKA 4H5GA 4MNCA 1NV3A 4KHZE 1KZ8A 1INPA 4MX6A 2QVUA 3A3UA 3QXMA 2F5XA 4NHBA 2PCRA 2DE2A 5L9SA 2XXIA 1UIUA 3LSWA 2YLNA 4HXVA 4ZE9A 4FEBA 3K1MA 3KFMA 3K6WA 3OO9A 4YB5A 3K6XA 5I56B 4OESA 3VV5A 1URDA 2WBDA 4ZEIA 1MQGA 3V5AA 3B8BA 3MZ1A 3PMWA 1B6HA 3FIRA 2Y7PA 4NQ8A 1SW1A 3MQ9A 4PFTA 4RYAA 2RINA 4OXVA 2PYYA 2GH9A 2XXRA 3PUVE 5F1QA 5CMCA 4GXAA 3T93B 3FJ7A 3DLNA 4DCXA 1EYKA 2BJIA 4Z0IA 5AA1A 4PCDA 3SEYA 1MY3A 4I40A 5T3JA 5A5LA 1VE4A 4KPTA 1N0TA 3IJXB 1DK4A 1S7YA 2VPNA 4YKPA 4MHFA 4ECFA 4N8YA 3P7IA 1FPEA 4GRKA 1P1UA 3O6IA 4XKPA 3LSLA 3CSGA 4N15A 2OZZA 3TAJA 3EHUA 4OFOA 3CG1A 1GR2A 5FHOA 3S9LC 3KZGA 3VXCA 3Q26A 3IB1A 4FE8A 4R6HA 2NWJA 1Z7ME 3MPKA 2Q74A 1QVSA 4NX1A 5DEXA 3PPPA 3G3GA 1FQDA 4LQ2A 3VLVA 5ICTA 4OVSA 1SD3A 5IZZA 1N7WA 2XD3A 4FIMA 2QS3A 4X48A 3PTYA 2RKMA 2B4MA 3FXUA 2QJEA 1IITA 2ZNTA 1USYH 4GWZA 5H8HB 4PBQA 1DPEA 3VVFA 1RDZA 3JYRA 4GL8A 1LFIA 4M4GA 2UYEA 4GX6A 2AL5A 2F36A 2Z8DA 3W15C 3RTFB 1AOVA 4PGPA 3PV0E 4C1UA 4GFRA 2H4IA 3S9EA 4NF4B 2I58A 3CSBA 2DWAA 4LZ5A 2ZYMA 3LSXA 4U21A 2HAVA 5B70A 3IFCA 1B3FA 1ZTYA 5I58A 4NWDA 3W9WA 2FVZA 5DVFA 4ZZAA 1L5TA 1ZLQA 4XF5A 4F3SA 3EHTA 3VDFA 5AA4B 4Z7EA 3HHGA 3NOHA 2QRYA 4PF8A 4U1ZA 1XVXA 2DDKA 2DE3A 3MBPA 1B3HA 3BFTA 3QMFA 2XWVA 2ONSA 4X1DA 5CMKA 4ZDMA 5I59A 1WODA 1EYIA 4UA8A 5M2VA 1NH7A 3RN8A 2PFYA 3DP8A 4OEVA 1FTMA 1O7TA 3C31A 3GXAA 3VLWA 3UORA 1US4A 1FTOA 4GWXA 4AB5A 1FTKA 3TCFA 1H44A 4P1EA 4TOZA 3QUFA 2XXWA 5I2NB 4LATA 4R9FA 2O68A 5IAIA 2A5SA 1PB8A 1O63A 1Q35A 5I2KB 3H4ZA 1B2HA 1B1HA 2Y7RA 5L9MA 3G3IA 4YMAA 3K2DA 5AA2A 2W7YA 1FPGA 4RPOA 4U1OA 5K2XA 1D9QA 4OFJA 5I3SA 5JTYB 1CB6A 3E79A 1IMDA 4ZECA 4KYSA 5I2NA 3A29A 5I5PA 4R2BA 4ELOA 4RNSA 2NUVA 3C32A 2V3UA 1MRPA 1MQIA 2HEUA 3Q28A 5ET7A 2I0BA 4F22A 2P0SA 2DE4A 2X26A 4PAIA 2Z22A 1LAHE 1G0IA 4N6KA 2DVCA 4FJPA 3RGYA 2DWHA 2UVGA 3OMBA 3T96B 4H5FA 5ET5A 1Z7NE 2Q88A 4EQBA 2GFEA 4U22A 5H8FB 3EN3A 4I9DA 4DXBA 3B6TA 3S4UA 3PU5A 1BKAA 4KXPA 1ZKBA 2HAUA 4JVDA 4H6DA 4PETA 3DELB 3D1RA 4PGNA 4FBPA 4NF5B 3FVNA 3RQTA 3OOAA 5H8NB 3PD9A 5BWJA 5TU0A 2FYIA 1G0HA 1SW2A 2O6AA 2REGA 3S2VA 3SERA 1HSLA 4N81A 2AIXA 4MIJA 1D3KA 3MVZA 1NI9A 2DOJA 1MPBA 1POTA 1JW5A 4PQJA 1TWYA 3IO4A 2IEEA 4GF8A 3MUQA 2VGQA 4MAGA 4NN3A 2HXWA 2XXXA 4YKKA 1P1WA 1EU8A 4N17A 1XVYA 3CI8A 2P1SA 3U65A 1ANFA 1CNQA 2OX3A 3Q25A 5L8DA 1IQ7A 2CEXA 2O1LA 2HCAA 3T9VA 2OWZA 1EZPA 2RC9A 3C4MA 1A7LA 1N04A 5CI5A 4P11A 2F6PA 2QS4A 4JWOA 3KSXA 3QYTA 2QMXA 1ZJLA 4TQUQ 3VXBA 4KYDA 3EKIA 1EZOA 1NFTA 1GV8A 4KCCA 3KN8A 1IIWA 2D5WA 1BTJA 2XWKA 2Y7IA 3OEMA 3SZPA 2FHYA 4RA1A 3QIMA 4Q0CA 4GQOA 3O9PA 5CBRA 2ZZWA 3IORA 1FPBA 4XKQA 4YAHX 3G3JA 2GHBA 1JEVA 1NL5A 2O1MA 2ZYNA 1H76A 1AIVA 1VFDA 5TPAA 1NMUA 3HFUA 1UQWA 3TUSA 2Q9TA 4O94A 4EUOA 1PBQA 4QF9A 3C35A 2CMOA 3HPIA 1URGA 2PT2A 1FPIA 3N26A 5ITOA 4MCOA 4ND9A 1NV2A 4PFWA 4G68B 3V89B 4HS7A 3IJOB 1I69A 4E0XA 4QSEA 1R1NA 3PPOA 3JZJA 3JV9A 1B5JA 1MQDA 3IFAA 5J16A 1YCJA 3BKIB 4LZ7A 4YU0A 3E9XA 3IR1A 1O64A 4QFNA 1XT8A 4PE3A 5EQ8A 4AS4A 3TCHA 2DXRA 2WKYA 4NEDA 1SVXB 3RLFE 1S9TA 1MH3A 1B7ZA 3F11A 1LGBC 4IO3A 4JBZA 3FZVA 4MJOA 3N6UA 4P0GA 4LP2B 3TTLA 3OO6A 4OERA 2F7BA 4JWYA 4QRZA 4ESXA 1JETA 2XXKA 3O6HA 3M3LA 4F18A 3OSRA 5H8HA 4DE8A 4PFRA 2OJTA 3KN3A 4EF1A 2O69A 1K9ZA 2R71A 3W9VA 1B32A 2REJA 3ZS6A 1NV7A 3ZKLA 2LAOA 1Y1MA 3O6GA 4G68C 1FQCA 3H3GA 4WKMA 4GBVA 4GBWA 4O7MA 5TP9A 1IMBA 3GBAA 4O8MA 5CM6A 4P0IA 4GX4A 2V3TA 2PT1A 1MXWA 1IMEA 5KZTA 4P8BA 4F1VA 5IKBA 3EF7A 1LB8A 1Y3NA 3FATA 1B1XA 3T9UA 4U4XA 1B5IA 1T0KA 5CMBA 3OO8A 2D21A 1HSEA 1MY2A 2WYKA 2V3QA 2Q8JA 3FXQA 1AL3A 2Y7WA 4GD5A 1A99A 1ZMGA 3BBRA 4OEUA 1MM7A 1FBDA 4ZEBA 1H45A 1LBWA 1US5A 4GL0A 1MQHA 4GX3A 3L6HA 2Y7KA 1I6BA 2ZZXA 4F2OA 3CFLA 3TZAA 2V93A 2H5YA 5FTHA 1YZ0A 5KCJB 1SI1A 4NE4A 3RT8A 2ALUA 5J1DA 2I3WA 3BFUA 1MH4A 5IGAA 5EYHA 3MP1A 1LEVA 5BUUA 4X8RA 2ZZVA 4M1VA 3H6UA 2RC8A 2F7AA 3TTKA 5HBCA 2F3DA 4XKRA 5EQ7A 4IO4A 3MPLA 1YTVA 3OSQA 4LQ5A 1BLFA 2Z8FA 1M5CA 3FVGA 2NXOA 4BLAA 2RCAA 4R2FA 3CHGA 4HE0A 3EPEA 3PMXA 4IO2A 2XWIA 1JW1A 1QUIA 1FPLA 1MG1A 3B50A 3DM0A 4G8HA 4H8JA 3BIHA 3N5LA 3UIFA 4F3GA 3KC0A 4QFPA 4U23A 4F39A 1IMFA 3IB2A 4KD5A 4P56A 3MJNA 4ESWA 5HM4B 2UVHA 4ELRA 4Q5TA 3T0JA 3R7XA 4N6DA 4OZ9A 4DXUA 4GXSB 1AWBA 1QJMA 1NNFA 4MMPA 2P2AA 1A54A 2WYPA 3T9HB 1NNKA 4P1LA 3KSJA 4NAPA 3H7MA 4OVTA 4N07A 1POY1 1R9QA 3N94A 5I58B 1FJ6A 3SETA 3OENA 4DZ1A 5ITPA 2P3NA 2ZXTA 3O97A 4NF6A 4HTGA 3SEUA 4NF4A 5EYGA 3SEXA 3D4CA 3E4RA 4G8NA 3O29A 3LBSA 1HSJA 1VDWA 1M5BA 2Y84A 5ET8A 1P99A 1OIBA 1TXFA 5DW8A 4GWSA 2VPOA 1NV1A 3O28A 4OWDA 1OMPA 1UTHA 3MC2A 4DI3D 3DP6A 2R6GE 1B7UA 3G3HA 3RT6B 1SI0A 3WAFA 1B3GA 4LONB 4PAFA 3RPWA 2QS1A 2PBWA 5FHMA 4MH5A 5KDTB 2DYXA 5ET6A 4IGTA 4BDMA 2F7CA 3CFZA 1Q1KA 1Y9UA 4F31B 1KWHA 3KBZA 1ZBMA 2UVIA 3M8UA 4AS5A 1B0LA 2B65A 5IZ1A 4ISUA 2NVUB 2B3FA 2FA7A 3K1NA 4I1DA 4O7IA 4OETA 4PC9A 3PUYE 3UP9A 1FPDA 3LR1A 5HPQA 4XFEA 3GZGA 4N8GA 1QUKA 1LSTA 4RY1A 3IOUA 1LCTA 3MZBA 1PDAA 2BJJX 3FGSA 1IZ1A 1ZIUA 2I6EA 2X7PA 3SKPA 1DCUA 1I6AA 3KOSA 4H8IA 4O3CA 2AYSA 5JEIA 4IGRA 3U92A 4MF3A 2NOOA 4JSOA 1OVBA 2RCBA 3FASA 2PMSA 5K2YA 5H8FA 3S9NC 4BDRA 1JW4A 1Y3QA 2H25A 2YJPA 5IZ3B 4GWWA 3RTWB 4EF2A 5H8SA 3MYUA 3T66A 3IAZA 1RYXA 2QPQA 4ZS9A 4ZZEA
chains in the Genus database with same CATH topology
4YB5A 3VLUA 3K6XA 4ND9A 4E0WA 5I56B 1Y20A 1GVCA 2E0SA 3C36A 3HN0A 4OESA 4PFWA 3VV5A 3ZKKA 1URDA 4EXKA 1GGGA 5KDTA 1N3XA 4G68B 3V89B 2H9BA 3Q27A 4WXJA 2XD2A 1B4HA 3H6WA 4HS7A 4ZEIA 3IJOB 1I69A 4E0XA 3FJGA 1MQGA 3LUYA 3V5AA 4LVQA 4AQ4A 1PB9A 2VHAA 4QSEA 3MZ1A 1B7HA 3PMWA 5B7DA 1B6HA 3FIRA 2Y7PA 1R1NA 2XX8A 3PPOA 4OQOA 3FV2A 3JZJA 3RNNA 5AA2D 1Y4CA 1SW1A 1SW4A 3ILUB 1A55A 3FVKA 3JV9A 3MQ9A 1B5JA 1F9BA 3H06B 1MXUA 4IY5A 4PFTA 1MQDA 5F7VA 2RINA 2ZMBA 4OXVA 3RY3A 2PYYA 3TPAA 3I3VA 2DWJA 1YCJA 2GH9A 2XXRA 3BKIB 4LZ7A 3PUVE 4YU0A 1J1NA 5F1QA 5CMCA 3VE1B 3L6GA 1PEBA 3E9XA 4GLIA 4GXAA 2F97A 3IR1A 4NTLA 1O64A 5EHMA 1IXIA 1MY4A 3VVEA 4QFNA 3T93B 2ANJA 5FHNA 4QFLA 4R73A 5LOMA 1LFHA 2UYFA 1XT8A 3TYHA 3UN6A 3IK6B 4O3AA 3FJ7A 3DP4A 5AE4A 1II5A 3DLNA 2DQVA 4DCXA 5H8QB 4KR5A 1RYOA 1XOCA 2DXRA 2WKYA 3CVGA 4NEDA 3TCHA 1SVXB 1N7XA 5ISUA 3RLFE 1DTGA 3K01A 1S9TA 4R6KA 1NH8A 4Z0IA 1MH3A 5AA1A 1B7ZA 4GOTA 3F11A 1LGBC 4IO6A 4IO3A 4F1UA 4JBZA 1JNFA 3FZVA 3SEYA 1MY3A 4F3PA 4FAJA 3R26A 2IA4A 4DXCA 5TP9B 3Q29A 5DYHA 1VE4A 4KPTA 1SYIA 1QUJA 2I0CA 5A5XA 2B3BA 3KJ7A 3N6UA 4G8MA 1N0TA 3IJXB 4P0GA 4LP2B 2V84A 3TTLA 1A8EA 1S7YA 1M5EA 4YKPA 1B51A 3FXRA 3OO6A 4AB6A 1VSOA 4ECFA 2X7QA 3A09A 4OERA 1XHYA 3KN7A 3PD8A 2F7BA 3G7WA 4JWYA 4OVJA 3P7IA 1FQEA 4QRZA 5DVJA 3MP6A 1UTBB 1PBPA 1B4ZA 4GRKA 1P1UA 4H67A 3H6TA 4R72A 4R6YA 1DOTA 3O6IA 4KQPA 4N6PA 1JETA 4R74A 4ESXA 4R75A 4XKPA 1MS7A 3LSLA 4KCDA 2ONKE 4THIA 3CSGA 3O6HA 4POXA 1D9YA 3M3LA 3G3FA 3OD7A 2O51A 4F18A 3OSRA 5H8HA 2OZZA 3TAJA 4DE8A 3EHUA 3A3CA 3IL1B 2OJTA 4OFOA 3KN3A 3CG1A 3VFJA 2FNCA 1GR2A 2XXVA 2O69A 4ONYA 5FHOA 3TTRA 4EF1A 4F2QA 3S9LC 4RPNA 2R71A 3KZGA 3VXCA 3C34A 3Q26A 4ELPA 3IB1A 4FE8A 4R6HA 3W9VA 1B32A 1OQGA 1URSA 2OBGA 2REJA 2V25A 4PFYA 1Z7ME 2NWJA 1LAXA 5TPAB 3SESA 3ZS6A 3MPKA 3K0VA 3PGFA 3ZKLA 1QVSA 2LAOA 1Y1MA 3O6GA 4G68C 4KYEA 3LC8A 1FQCA 3H3GA 1UTBA 3E13X 2H98A 4FORA 4JDFA 4WKMA 3PPRA 3VVDA 3CR9A 5DEXA 3PPPA 1YPNA 3G3GA 3PPNA 1IXCA 3MWBA 5TP9A 1JVYA 3E3KA 3ECRA 1FQDA 4LQ2A 3VLVA 3IOVA 5ICTA 3IOTA 1XC1A 4KFQA 3GBAA 1SD3A 3FD3A 5CM6A 4P0IA 1N7WA 4JSDA 3FVOA 2XD3A 2YPNA 4FIMA 2V3TA 2G93A 2PT1A 1DSNA 1MXWA 1DTZA 4R9GA 5KZTA 4K3FA 4NWCA 2QS3A 4F1VA 4X48A 5IKBA 4NF6B 1FQBA 4GWOA 2RKMA 4QSDA 4RYAA 3EF7A 3FXUA 2QJEA 4QFKA 4GVOA 1IITA 1LB8A 1Y3NA 2ZNTA 4H0WA 1IXGA 1USYH 1ELJA 5KCJA 4DLDA 1R6ZA 1B1XA 3FATA 4JXIA 1MY0A 4MLQA 2ONRA 3B6QA 4XKNA 3T9UA 4G2ZA 4U4XA 4IB2A 4BDQA 1B5IA 3GLBA 3I5OA 5H8HB 1ZU0A 3HV1A 1DPEA 3OXNA 3M3KA 1T0KA 5CMBA 5ELVA 1P1QA 2PVUA 3VVFA 3TELA 1MPDA 2QL3A 3KG2A 3OO8A 2D21A 4RK2A 3JYRA 4FECA 4GL8A 1HSEA 1LFIA 1FCKA 1MY2A 2UYEA 4M4GA 3ODBA 1FQAA 4O3BA 1CE2A 2AL5A 2F36A 2V3QA 2HQ0A 2Z8DA 1B3EA 1B05A 2Q8JA 3W15C 3FXQA 4OENA 1AL3A 3RTFB 1AOVA 3PV0E 2R9JA 2Y7WA 4GD5A 1A99A 5CRYA 1MY1A 4GFRA 1M5DA 5EHSA 4C1UA 2H4IA 1LBBA 3S9EA 1ZMGA 3BBRA 4OEUA 5CMMA 1MM7A 2A5TB 3MAMA 4NF4B 2I58A 1SYHA 1P1NA 1WDNA 3CSBA 4POWA 1H45A 2DWAA 4LZ5A 4ZEBA 2ZYMA 2QMWA 3LSXA 3OEKA 1US5A 4GL0A 2HAVA 2Q89A 1MQJA 1MQHA 3KOTA 4OTEA 1UIVA 4U21A 5B70A 1B3FA 1Y1ZA 1ZTYA 5I58A 2DXYA 4NWDA 3L6HA 3TTMA 2PX1A 1JEUA 3KBRA 1LB9A 3W9WA 1OVTA 2I4BA 2Y7KA 5DVFA 1I6BA 4ZZAA 1L5TA 3HHFA 3H03A 3CFLA 3TZAA 4F2OA 3V83A 1OQHA 1ZLQA 2V93A 4L17A 2H5YA 2I3VA 2I49A 3EHTA 3M3FA 4ZEKA 3VDFA 4F3SA 4Z7EA 3TODA 5AA4B 2ZYOA 4XTCQ 5FTHA 3HHGA 5I2KA 5JK4A 3PUZE 5KCJB 2QRYA 3HO7A 5AA3A 1A40A 4U1ZA 1SI1A 1XVXA 4NE4A 3RT8A 2ALUA 3QSLA 4MLVA 1NNPA 4NF8B 2DE3A 4F1YA 3MBPA 4I62A 1B3HA 1PC3A 3O66A 1FTLA 4YICA 5J1DA 3BFTA 3TCGA 1AMFA 3PUWE 3IOWA 2I3WA 3BFUA 5FTIA 4IO5A 1MH4A 3CRBA 3THIA 2AL4A 3RUMA 1H3DA 4QSCA 2E1SA 3G3KA 2ONSA 2THIA 4G68A 3MP1A 4X1DA 5CMKA 4ZDMA 5I59A 1WODA 4OFLA 4UA8A 5BUUA 1IEJA 5M2VA 1NH7A 4M1VA 2XXQA 3H6UA 4BDOA 3RN8A 5CBRA 4NF5A 3DP8A 4OEVA 1FTMA 2RC8A 1O7TA 2F7AA 3C31A 5HBCA 2CZLA 3TTKA 2I4CA 1N84A 4OMBA 1OLAA 3GXAA 4XKRA 1VR5A 3VLWA 2XXUA 4G77A 4FATA 2QS2A 4IO4A 4IY6A 1SBPA 1US4A 3IB0A 2VOZA 3MPLA 3UORA 1FTOA 1YTVA 3AXFA 3OSQA 4LA9A 4LQ5A 3TFLA 3TKDA 4AB5A 1FTKA 1BLFA 3QAXA 2Z8FA 2XX9A 1MXYA 1LAGE 1USYE 3R6UA 3TCFA 1H44A 4TOZA 2GHAA 4RK9A 1M5CA 3FVGA 3K4UA 2NXOA 4BLAA 3QUFA 2XXWA 2Z8EA 2RCAA 3K02A 3O2AA 1B3LA 4LATA 4R2FA 5I2NB 4R9FA 2O68A 3U94A 5A5XB 3PMVA 4ZEFA 5AA4A 2M8CA 1SDXA 5IAIA 2A5SA 2H99A 1PB8A 1O63A 1Q35A 3FUZA 3K6UA 5I2KB 4F29A 1B52A 1B2HA 1GTKA 3EPEA 3H4ZA 3PMXA 1B1HA 4YKJA 3CFXA 4IO2A 3S9MC 3OELA 4JB7A 1JW1A 1QUIA 2Y7RA 5CC2A 1MG1A 3DM0A 4H8JA 1R9LA 1H43A 4G8HA 4TLLB 5L9MA 3G3IA 4EDPA 4YMAA 3N5LA 3UIFA 1B46A 4F3GA 3KEIA 4H1XA 4Q8RA 1WVJA 3K2DA 4QFPA 4U23A 2W7YA 2RC7A 1MDQA 4RPOA 2A5TA 4U1OA 2I48A 1QKBA 4YB6A 5K2XA 1B0HA 2O84X 2Q2AA 5I59B 1BP5A 3MVWA 3B7DA 3HCQA 3IB2A 1AH5A 4KD5A 4OFJA 4YZZA 5JTYB 3TQLA 3MJNA 1SQYA 1CB6A 1B5HA 3B6WA 4ZECA 4KYSA 4ESWA 5HM4B 3MW0A 2D3IA 2UVHA 2VP1A 5I2NA 4ELRA 3U1OA 4Q5TA 4R2BA 3R7XA 4ELOA 1N3WA 4RNSA 1YAEA 2NUVA 4OZ9A 3C32A 2O7IA 4DXUA 2V3UA 1MRPA 4GXSB 5AA2A 1QJMA 4PE5B 4BDNA 4DDDA 1NNFA 1MQIA 4MBPA 4EQ9A 3U72A 2P2AA 1A54A 1Y4TA 2HEUA 2UXAA 3Q28A 1NKXA 4FEDA 1NNTA 3T9HB 3TQWA 1NNKA 1TFAA 3USDA 2I0BA 2ZNSA 3KSJA 3N6TA 4F22A 1P1OA 3T22A 5I57B 1RKMA 2P0SA 2DE4A 2O7UA 2X26A 3U93A 3H7MA 5L9OA 2Z22A 4N07A 1POY1 1R9QA 1MDP1 1MXXA 3ILTB 1LAHE 3N94A 4F3BA 3SETA 5I58B 2DVZA 1IXHA 4OYVA 3ONMA 4G4PA 4X1BA 2GRVA 3OENA 2DVCA 2XXYA 3TTNA 4DZ1A 5ITPA 4FJPA 2ABHA 3RGYA 2DWHA 2ZXTA 3O97A 4RJZA 4NF6A 2UVGA 1OLCA 1FW0A 3OMBA 4HTGA 2DWIA 4NF8A 4H5FA 3SEUA 4Q30B 3T96B 4NF4A 2ZNUA 2XXHA 3SEVA 5AA2B 1Z7NE 3SEXA 3D4CA 3E4RA 4BDLA 4QHQA 4G8NA 4U4SA 2Q88A 4WEPA 3S4UA 3O29A 4EQBA 3T9XB 4HW8A 1M5FA 2GFEA 4U22A 4ZE8A 3LBSA 3EN3A 1HSJA 4I9DA 5H8FB 1B9JA 4DXBA 4YMBA 3B6TA 1S50A 1QW0A 1DPPA 1M5BA 1MXZA 2Y84A 2DP8A 3CG3A 1LFGA 1P99A 4OHNA 2F8DA 1Y3PA 4WEDA 4ELQA 3PU5A 1BKAA 2HZLA 4IO7A 1LBCA 1OIBA 1TXFA 1ZKBA 1XS5A 2F6GA 3EHSA 4UACA 2HAUA 4H6DA 2OWTA 1A8FA 4PETA 3DELB 4QFOA 1D9VA 1FQFA 1EZ9A 2VD3A 3O28A 4NF5B 4OWDA 3FVNA 3RQTA 1TT1A 4DIGA 4HCWA 2DSFA 3OOAA 1OMPA 1TFDA 1UTHA 2Z23A 4RXLA 3MZ9A 3PUXE 3SEWA 3CIJA 5H8NB 3PD9A 5BWJA 5TU0A 3MC2A 3UK4A 1VFEA 3KJTA 2FYIA 4LZ8A 3DP6A 1JVXA 2R6GE 3TDJA 1B7UA 4PP0A 3G3HA 2F34A 3RT6B 1D4NA 1SI0A 2RF1A 3MVXA 1B3GA 3FV1A 4LONB 3WAFA 1SW2A 4F39A 4ZEDA 5I56A 1PB7A 3FJMA 3RPWA 2QS1A 4TLMB 2O6AA 2HZKA 2PBWA 4MH5A 5FHMA 5KDTB 2DYXA 3H6VA 2HFBA 2REGA 4MFIA 5DTBA 3HSTA 4IGTA 3S2VA 3SERA 1HSLA 4BDMA 4LUBA 3OO7A 2AIXA 2F7CA 4NMYA 3CFZA 1N76A 1D3KA 2OLBA 3GBBA 4KI0E 2ESNA 3MVZA 3K6VA 1Q1KA 3PPQA 2DOJA 1MPBA 1POTA 1JW5A 2XXPA 4PQJA 3UGWA 1Y9UA 4F31B 1KWHA 1TWYA 1ZBMA 2UVIA 2UVJA 3C9HA 2IEEA 3IO4A 3M8UA 2OWSA 4GF8A 4XIGQ 1B0LA 3IX1A 3MUQA 2VGQA 2HXWA 2XXXA 2B65A 3K1PA 4YKKA 3U8QA 1P1WA 1IUDA 4C0RA 1EU8A 4ISUA 2NVUB 2QSXA 5JTYA 2B3FA 4XXUA 1XVYA 3CI8A 2FA7A 2DS9A 1BIYA 1FTJA 2P1SA 1ANFA 4HCYA 3V8XB 3Q25A 5L8DA 1IQ7A 3MVYA 4N13A 2O1LA 2XXTA 3K1NA 4YKIA 4I1DA 1SW5A 2HCAA 2OK2A 1LCFA 3T9VA 4EQ7A 1EZPA 1QULA 4OETA 2RC9A 3C4MA 1A7LA 1N04A 5CI5A 2KLFA 1LLSA 3D4GA 3PUYE 3UP9A 3MP8A 3WAEA 1MPCA 4P11A 2F6PA 2QS4A 4JWOA 5I57A 3SDFA 3KSXA 3LR1A 3QYTA 2G29A 5CBSA 2QMXA 3TEPA 1ZJLA 4TQUQ 4EXLA 5HPQA 4F19A 2Q2CA 1QKAA 3GZGA 4KYDA 3VXBA 1EZOA 2XHDA 1NFTA 4GIZA 1DMBA 1GV8A 4I8CA 1QUKA 3EQ1A 4KCCA 3QUJA 1LSTA 4RY1A 3KN8A 5H8QA 1IIWA 3IOUA 1JQFA 3IO6A 1LCTA 2D5WA 1BTJA 1B40A 3MZBA 4H65A 4U2RA 2Y7IA 2XX7A 1PDAA 2BJJX 3FGSA 1MXVA 3OEMA 3QK6A 3TMGA 1IZ1A 1ZIUA 2I6EA 2X7PA 3QIMA 4RA1A 2F78A 3SKPA 1LAFE 4Q0CA 1I6AA 3KOSA 3O9PA 4GQOA 1MM6A 2AYSA 3C33A 3IORA 3KGCA 2ZYKA 4H5GA 4H8IA 4IGRA 4O3CA 3U92A 5JEIA 4C1TA 4MF3A 4XKQA 1EH3A 2NOOA 4JSOA 4YAHX 4DCYA 1OVBA 2RCBA 2GHBA 3FASA 3G3JA 5DEXB 2PMSA 4KHZE 1JEVA 5DT6A 5K2YA 5H8FA 3S9NC 1NL5A 3ZSFA 4BDRA 3A3UA 1JW4A 2O1MA 5DVIA 2ZYNA 3QXMA 1Y3QA 2F5XA 1H76A 1AIVA 2H25A 5ICQA 4JWXA 5EYFA 1VFDA 2OCUA 2VD2A 2YJPA 3I6VA 2DE2A 1NMUA 5TPAA 1UQWA 2XXIA 1UIUA 5L9SA 3LSWA 4X9TA 2YLNA 3RTWB 4EF2A 3TUSA 2Q9TA 1B58A 4ZE9A 1I6QA 1UTHB 4EUOA 5H8SA 1ATGA 3K00A 1PBQA 4QF9A 3C35A 4FEBA 2CMOA 3T66A 3HPIA 3IAZA 4PFUA 1RYXA 2QPQA 4ZS9A 3UA8A 3K1MA 3KFMA 1URGA 4YB7A 5H8NA 2F35A 5I84A 2PT2A 3K6WA 3LSFB 3N26A 4ZZEA 5ITOA 3OO9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YB5 A;  3VLU A;  3K6X A;  4ND9 A;  4E0W A;  5I56 B;  1Y20 A;  1GVC A;  2E0S A;  3C36 A;  3HN0 A;  4OES A;  4PFW A;  3VV5 A;  3ZKK A;  1URD A;  4EXK A;  1GGG A;  5KDT A;  1N3X A;  4G68 B;  3V89 B;  2H9B A;  3Q27 A;  4WXJ A;  2XD2 A;  1B4H A;  3H6W A;  4HS7 A;  4ZEI A;  3IJO B;  1I69 A;  4E0X A;  3FJG A;  1MQG A;  3LUY A;  3V5A A;  4LVQ A;  4AQ4 A;  1PB9 A;  2VHA A;  4QSE A;  3MZ1 A;  1B7H A;  3PMW A;  5B7D A;  1B6H A;  3FIR A;  2Y7P A;  1R1N A;  2XX8 A;  3PPO A;  4OQO A;  3FV2 A;  3JZJ A;  3RNN A;  5AA2 D;  1Y4C A;  1SW1 A;  1SW4 A;  3ILU B;  1A55 A;  3FVK A;  3JV9 A;  3MQ9 A;  1B5J A;  1F9B A;  3H06 B;  1MXU A;  4IY5 A;  4PFT A;  1MQD A;  5F7V A;  2RIN A;  2ZMB A;  4OXV A;  3RY3 A;  2PYY A;  3TPA A;  3I3V A;  2DWJ A;  1YCJ A;  2GH9 A;  2XXR A;  3BKI B;  4LZ7 A;  3PUV E;  4YU0 A;  1J1N A;  5F1Q A;  5CMC A;  3VE1 B;  3L6G A;  1PEB A;  3E9X A;  4GLI A;  4GXA A;  2F97 A;  3IR1 A;  4NTL A;  1O64 A;  5EHM A;  1IXI A;  1MY4 A;  3VVE A;  4QFN A;  3T93 B;  2ANJ A;  5FHN A;  4QFL A;  4R73 A;  5LOM A;  1LFH A;  2UYF A;  1XT8 A;  3TYH A;  3UN6 A;  3IK6 B;  4O3A A;  3FJ7 A;  3DP4 A;  5AE4 A;  1II5 A;  3DLN A;  2DQV A;  4DCX A;  5H8Q B;  4KR5 A;  1RYO A;  1XOC A;  2DXR A;  2WKY A;  3CVG A;  4NED A;  3TCH A;  1SVX B;  1N7X A;  5ISU A;  3RLF E;  1DTG A;  3K01 A;  1S9T A;  4R6K A;  1NH8 A;  4Z0I A;  1MH3 A;  5AA1 A;  1B7Z A;  4GOT A;  3F11 A;  1LGB C;  4IO6 A;  4IO3 A;  4F1U A;  4JBZ A;  1JNF A;  3FZV A;  3SEY A;  1MY3 A;  4F3P A;  4FAJ A;  3R26 A;  2IA4 A;  4DXC A;  5TP9 B;  3Q29 A;  5DYH A;  1VE4 A;  4KPT A;  1SYI A;  1QUJ A;  2I0C A;  5A5X A;  2B3B A;  3KJ7 A;  3N6U A;  4G8M A;  1N0T A;  3IJX B;  4P0G A;  4LP2 B;  2V84 A;  3TTL A;  1A8E A;  1S7Y A;  1M5E A;  4YKP A;  1B51 A;  3FXR A;  3OO6 A;  4AB6 A;  1VSO A;  4ECF A;  2X7Q A;  3A09 A;  4OER A;  1XHY A;  3KN7 A;  3PD8 A;  2F7B A;  3G7W A;  4JWY A;  4OVJ A;  3P7I A;  1FQE A;  4QRZ A;  5DVJ A;  3MP6 A;  1UTB B;  1PBP A;  1B4Z A;  4GRK A;  1P1U A;  4H67 A;  3H6T A;  4R72 A;  4R6Y A;  1DOT A;  3O6I A;  4KQP A;  4N6P A;  1JET A;  4R74 A;  4ESX A;  4R75 A;  4XKP A;  1MS7 A;  3LSL A;  4KCD A;  2ONK E;  4THI A;  3CSG A;  3O6H A;  4POX A;  1D9Y A;  3M3L A;  3G3F A;  3OD7 A;  2O51 A;  4F18 A;  3OSR A;  5H8H A;  2OZZ A;  3TAJ A;  4DE8 A;  3EHU A;  3A3C A;  3IL1 B;  2OJT A;  4OFO A;  3KN3 A;  3CG1 A;  3VFJ A;  2FNC A;  1GR2 A;  2XXV A;  2O69 A;  4ONY A;  5FHO A;  3TTR A;  4EF1 A;  4F2Q A;  3S9L C;  4RPN A;  2R71 A;  3KZG A;  3VXC A;  3C34 A;  3Q26 A;  4ELP A;  3IB1 A;  4FE8 A;  4R6H A;  3W9V A;  1B32 A;  1OQG A;  1URS A;  2OBG A;  2REJ A;  2V25 A;  4PFY A;  1Z7M E;  2NWJ A;  1LAX A;  5TPA B;  3SES A;  3ZS6 A;  3MPK A;  3K0V A;  3PGF A;  3ZKL A;  1QVS A;  2LAO A;  1Y1M A;  3O6G A;  4G68 C;  4KYE A;  3LC8 A;  1FQC A;  3H3G A;  1UTB A;  3E13 X;  2H98 A;  4FOR A;  4JDF A;  4WKM A;  3PPR A;  3VVD A;  3CR9 A;  5DEX A;  3PPP A;  1YPN A;  3G3G A;  3PPN A;  1IXC A;  3MWB A;  5TP9 A;  1JVY A;  3E3K A;  3ECR A;  1FQD A;  4LQ2 A;  3VLV A;  3IOV A;  5ICT A;  3IOT A;  1XC1 A;  4KFQ A;  3GBA A;  1SD3 A;  3FD3 A;  5CM6 A;  4P0I A;  1N7W A;  4JSD A;  3FVO A;  2XD3 A;  2YPN A;  4FIM A;  2V3T A;  2G93 A;  2PT1 A;  1DSN A;  1MXW A;  1DTZ A;  4R9G A;  5KZT A;  4K3F A;  4NWC A;  2QS3 A;  4F1V A;  4X48 A;  5IKB A;  4NF6 B;  1FQB A;  4GWO A;  2RKM A;  4QSD A;  4RYA A;  3EF7 A;  3FXU A;  2QJE A;  4QFK A;  4GVO A;  1IIT A;  1LB8 A;  1Y3N A;  2ZNT A;  4H0W A;  1IXG A;  1USY H;  1ELJ A;  5KCJ A;  4DLD A;  1R6Z A;  1B1X A;  3FAT A;  4JXI A;  1MY0 A;  4MLQ A;  2ONR A;  3B6Q A;  4XKN A;  3T9U A;  4G2Z A;  4U4X A;  4IB2 A;  4BDQ A;  1B5I A;  3GLB A;  3I5O A;  5H8H B;  1ZU0 A;  3HV1 A;  1DPE A;  3OXN A;  3M3K A;  1T0K A;  5CMB A;  5ELV A;  1P1Q A;  2PVU A;  3VVF A;  3TEL A;  1MPD A;  2QL3 A;  3KG2 A;  3OO8 A;  2D21 A;  4RK2 A;  3JYR A;  4FEC A;  4GL8 A;  1HSE A;  1LFI A;  1FCK A;  1MY2 A;  2UYE A;  4M4G A;  3ODB A;  1FQA A;  4O3B A;  1CE2 A;  2AL5 A;  2F36 A;  2V3Q A;  2HQ0 A;  2Z8D A;  1B3E A;  1B05 A;  2Q8J A;  3W15 C;  3FXQ A;  4OEN A;  1AL3 A;  3RTF B;  1AOV A;  3PV0 E;  2R9J A;  2Y7W A;  4GD5 A;  1A99 A;  5CRY A;  1MY1 A;  4GFR A;  1M5D A;  5EHS A;  4C1U A;  2H4I A;  1LBB A;  3S9E A;  1ZMG A;  3BBR A;  4OEU A;  5CMM A;  1MM7 A;  2A5T B;  3MAM A;  4NF4 B;  2I58 A;  1SYH A;  1P1N A;  1WDN A;  3CSB A;  4POW A;  1H45 A;  2DWA A;  4LZ5 A;  4ZEB A;  2ZYM A;  2QMW A;  3LSX A;  3OEK A;  1US5 A;  4GL0 A;  2HAV A;  2Q89 A;  1MQJ A;  1MQH A;  3KOT A;  4OTE A;  1UIV A;  4U21 A;  5B70 A;  1B3F A;  1Y1Z A;  1ZTY A;  5I58 A;  2DXY A;  4NWD A;  3L6H A;  3TTM A;  2PX1 A;  1JEU A;  3KBR A;  1LB9 A;  3W9W A;  1OVT A;  2I4B A;  2Y7K A;  5DVF A;  1I6B A;  4ZZA A;  1L5T A;  3HHF A;  3H03 A;  3CFL A;  3TZA A;  4F2O A;  3V83 A;  1OQH A;  1ZLQ A;  2V93 A;  4L17 A;  2H5Y A;  2I3V A;  2I49 A;  3EHT A;  3M3F A;  4ZEK A;  3VDF A;  4F3S A;  4Z7E A;  3TOD A;  5AA4 B;  2ZYO A;  4XTC Q;  5FTH A;  3HHG A;  5I2K A;  5JK4 A;  3PUZ E;  5KCJ B;  2QRY A;  3HO7 A;  5AA3 A;  1A40 A;  4U1Z A;  1SI1 A;  1XVX A;  4NE4 A;  3RT8 A;  2ALU A;  3QSL A;  4MLV A;  1NNP A;  4NF8 B;  2DE3 A;  4F1Y A;  3MBP A;  4I62 A;  1B3H A;  1PC3 A;  3O66 A;  1FTL A;  4YIC A;  5J1D A;  3BFT A;  3TCG A;  1AMF A;  3PUW E;  3IOW A;  2I3W A;  3BFU A;  5FTI A;  4IO5 A;  1MH4 A;  3CRB A;  3THI A;  2AL4 A;  3RUM A;  1H3D A;  4QSC A;  2E1S A;  3G3K A;  2ONS A;  2THI A;  4G68 A;  3MP1 A;  4X1D A;  5CMK A;  4ZDM A;  5I59 A;  1WOD A;  4OFL A;  4UA8 A;  5BUU A;  1IEJ A;  5M2V A;  1NH7 A;  4M1V A;  2XXQ A;  3H6U A;  4BDO A;  3RN8 A;  5CBR A;  4NF5 A;  3DP8 A;  4OEV A;  1FTM A;  2RC8 A;  1O7T A;  2F7A A;  3C31 A;  5HBC A;  2CZL A;  3TTK A;  2I4C A;  1N84 A;  4OMB A;  1OLA A;  3GXA A;  4XKR A;  1VR5 A;  3VLW A;  2XXU A;  4G77 A;  4FAT A;  2QS2 A;  4IO4 A;  4IY6 A;  1SBP A;  1US4 A;  3IB0 A;  2VOZ A;  3MPL A;  3UOR A;  1FTO A;  1YTV A;  3AXF A;  3OSQ A;  4LA9 A;  4LQ5 A;  3TFL A;  3TKD A;  4AB5 A;  1FTK A;  1BLF A;  3QAX A;  2Z8F A;  2XX9 A;  1MXY A;  1LAG E;  1USY E;  3R6U A;  3TCF A;  1H44 A;  4TOZ A;  2GHA A;  4RK9 A;  1M5C A;  3FVG A;  3K4U A;  2NXO A;  4BLA A;  3QUF A;  2XXW A;  2Z8E A;  2RCA A;  3K02 A;  3O2A A;  1B3L A;  4LAT A;  4R2F A;  5I2N B;  4R9F A;  2O68 A;  3U94 A;  5A5X B;  3PMV A;  4ZEF A;  5AA4 A;  2M8C A;  1SDX A;  5IAI A;  2A5S A;  2H99 A;  1PB8 A;  1O63 A;  1Q35 A;  3FUZ A;  3K6U A;  5I2K B;  4F29 A;  1B52 A;  1B2H A;  1GTK A;  3EPE A;  3H4Z A;  3PMX A;  1B1H A;  4YKJ A;  3CFX A;  4IO2 A;  3S9M C;  3OEL A;  4JB7 A;  1JW1 A;  1QUI A;  2Y7R A;  5CC2 A;  1MG1 A;  3DM0 A;  4H8J A;  1R9L A;  1H43 A;  4G8H A;  4TLL B;  5L9M A;  3G3I A;  4EDP A;  4YMA A;  3N5L A;  3UIF A;  1B46 A;  4F3G A;  3KEI A;  4H1X A;  4Q8R A;  1WVJ A;  3K2D A;  4QFP A;  4U23 A;  2W7Y A;  2RC7 A;  1MDQ A;  4RPO A;  2A5T A;  4U1O A;  2I48 A;  1QKB A;  4YB6 A;  5K2X A;  1B0H A;  2O84 X;  2Q2A A;  5I59 B;  1BP5 A;  3MVW A;  3B7D A;  3HCQ A;  3IB2 A;  1AH5 A;  4KD5 A;  4OFJ A;  4YZZ A;  5JTY B;  3TQL A;  3MJN A;  1SQY A;  1CB6 A;  1B5H A;  3B6W A;  4ZEC A;  4KYS A;  4ESW A;  5HM4 B;  3MW0 A;  2D3I A;  2UVH A;  2VP1 A;  5I2N A;  4ELR A;  3U1O A;  4Q5T A;  4R2B A;  3R7X A;  4ELO A;  1N3W A;  4RNS A;  1YAE A;  2NUV A;  4OZ9 A;  3C32 A;  2O7I A;  4DXU A;  2V3U A;  1MRP A;  4GXS B;  5AA2 A;  1QJM A;  4PE5 B;  4BDN A;  4DDD A;  1NNF A;  1MQI A;  4MBP A;  4EQ9 A;  3U72 A;  2P2A A;  1A54 A;  1Y4T A;  2HEU A;  2UXA A;  3Q28 A;  1NKX A;  4FED A;  1NNT A;  3T9H B;  3TQW A;  1NNK A;  1TFA A;  3USD A;  2I0B A;  2ZNS A;  3KSJ A;  3N6T A;  4F22 A;  1P1O A;  3T22 A;  5I57 B;  1RKM A;  2P0S A;  2DE4 A;  2O7U A;  2X26 A;  3U93 A;  3H7M A;  5L9O A;  2Z22 A;  4N07 A;  1POY 1;  1R9Q A;  1MDP 1;  1MXX A;  3ILT B;  1LAH E;  3N94 A;  4F3B A;  3SET A;  5I58 B;  2DVZ A;  1IXH A;  4OYV A;  3ONM A;  4G4P A;  4X1B A;  2GRV A;  3OEN A;  2DVC A;  2XXY A;  3TTN A;  4DZ1 A;  5ITP A;  4FJP A;  2ABH A;  3RGY A;  2DWH A;  2ZXT A;  3O97 A;  4RJZ A;  4NF6 A;  2UVG A;  1OLC A;  1FW0 A;  3OMB A;  4HTG A;  2DWI A;  4NF8 A;  4H5F A;  3SEU A;  4Q30 B;  3T96 B;  4NF4 A;  2ZNU A;  2XXH A;  3SEV A;  5AA2 B;  1Z7N E;  3SEX A;  3D4C A;  3E4R A;  4BDL A;  4QHQ A;  4G8N A;  4U4S A;  2Q88 A;  4WEP A;  3S4U A;  3O29 A;  4EQB A;  3T9X B;  4HW8 A;  1M5F A;  2GFE A;  4U22 A;  4ZE8 A;  3LBS A;  3EN3 A;  1HSJ A;  4I9D A;  5H8F B;  1B9J A;  4DXB A;  4YMB A;  3B6T A;  1S50 A;  1QW0 A;  1DPP A;  1M5B A;  1MXZ A;  2Y84 A;  2DP8 A;  3CG3 A;  1LFG A;  1P99 A;  4OHN A;  2F8D A;  1Y3P A;  4WED A;  4ELQ A;  3PU5 A;  1BKA A;  2HZL A;  4IO7 A;  1LBC A;  1OIB A;  1TXF A;  1ZKB A;  1XS5 A;  2F6G A;  3EHS A;  4UAC A;  2HAU A;  4H6D A;  2OWT A;  1A8F A;  4PET A;  3DEL B;  4QFO A;  1D9V A;  1FQF A;  1EZ9 A;  2VD3 A;  3O28 A;  4NF5 B;  4OWD A;  3FVN A;  3RQT A;  1TT1 A;  4DIG A;  4HCW A;  2DSF A;  3OOA A;  1OMP A;  1TFD A;  1UTH A;  2Z23 A;  4RXL A;  3MZ9 A;  3PUX E;  3SEW A;  3CIJ A;  5H8N B;  3PD9 A;  5BWJ A;  5TU0 A;  3MC2 A;  3UK4 A;  1VFE A;  3KJT A;  2FYI A;  4LZ8 A;  3DP6 A;  1JVX A;  2R6G E;  3TDJ A;  1B7U A;  4PP0 A;  3G3H A;  2F34 A;  3RT6 B;  1D4N A;  1SI0 A;  2RF1 A;  3MVX A;  1B3G A;  3FV1 A;  4LON B;  3WAF A;  1SW2 A;  4F39 A;  4ZED A;  5I56 A;  1PB7 A;  3FJM A;  3RPW A;  2QS1 A;  4TLM B;  2O6A A;  2HZK A;  2PBW A;  4MH5 A;  5FHM A;  5KDT B;  2DYX A;  3H6V A;  2HFB A;  2REG A;  4MFI A;  5DTB A;  3HST A;  4IGT A;  3S2V A;  3SER A;  1HSL A;  4BDM A;  4LUB A;  3OO7 A;  2AIX A;  2F7C A;  4NMY A;  3CFZ A;  1N76 A;  1D3K A;  2OLB A;  3GBB A;  4KI0 E;  2ESN A;  3MVZ A;  3K6V A;  1Q1K A;  3PPQ A;  2DOJ A;  1MPB A;  1POT A;  1JW5 A;  2XXP A;  4PQJ A;  3UGW A;  1Y9U A;  4F31 B;  1KWH A;  1TWY A;  1ZBM A;  2UVI A;  2UVJ A;  3C9H A;  2IEE A;  3IO4 A;  3M8U A;  2OWS A;  4GF8 A;  4XIG Q;  1B0L A;  3IX1 A;  3MUQ A;  2VGQ A;  2HXW A;  2XXX A;  2B65 A;  3K1P A;  4YKK A;  3U8Q A;  1P1W A;  1IUD A;  4C0R A;  1EU8 A;  4ISU A;  2NVU B;  2QSX A;  5JTY A;  2B3F A;  4XXU A;  1XVY A;  3CI8 A;  2FA7 A;  2DS9 A;  1BIY A;  1FTJ A;  2P1S A;  1ANF A;  4HCY A;  3V8X B;  3Q25 A;  5L8D A;  1IQ7 A;  3MVY A;  4N13 A;  2O1L A;  2XXT A;  3K1N A;  4YKI A;  4I1D A;  1SW5 A;  2HCA A;  2OK2 A;  1LCF A;  3T9V A;  4EQ7 A;  1EZP A;  1QUL A;  4OET A;  2RC9 A;  3C4M A;  1A7L A;  1N04 A;  5CI5 A;  2KLF A;  1LLS A;  3D4G A;  3PUY E;  3UP9 A;  3MP8 A;  3WAE A;  1MPC A;  4P11 A;  2F6P A;  2QS4 A;  4JWO A;  5I57 A;  3SDF A;  3KSX A;  3LR1 A;  3QYT A;  2G29 A;  5CBS A;  2QMX A;  3TEP A;  1ZJL A;  4TQU Q;  4EXL A;  5HPQ A;  4F19 A;  2Q2C A;  1QKA A;  3GZG A;  4KYD A;  3VXB A;  1EZO A;  2XHD A;  1NFT A;  4GIZ A;  1DMB A;  1GV8 A;  4I8C A;  1QUK A;  3EQ1 A;  4KCC A;  3QUJ A;  1LST A;  4RY1 A;  3KN8 A;  5H8Q A;  1IIW A;  3IOU A;  1JQF A;  3IO6 A;  1LCT A;  2D5W A;  1BTJ A;  1B40 A;  3MZB A;  4H65 A;  4U2R A;  2Y7I A;  2XX7 A;  1PDA A;  2BJJ X;  3FGS A;  1MXV A;  3OEM A;  3QK6 A;  3TMG A;  1IZ1 A;  1ZIU A;  2I6E A;  2X7P A;  3QIM A;  4RA1 A;  2F78 A;  3SKP A;  1LAF E;  4Q0C A;  1I6A A;  3KOS A;  3O9P A;  4GQO A;  1MM6 A;  2AYS A;  3C33 A;  3IOR A;  3KGC A;  2ZYK A;  4H5G A;  4H8I A;  4IGR A;  4O3C A;  3U92 A;  5JEI A;  4C1T A;  4MF3 A;  4XKQ A;  1EH3 A;  2NOO A;  4JSO A;  4YAH X;  4DCY A;  1OVB A;  2RCB A;  2GHB A;  3FAS A;  3G3J A;  5DEX B;  2PMS A;  4KHZ E;  1JEV A;  5DT6 A;  5K2Y A;  5H8F A;  3S9N C;  1NL5 A;  3ZSF A;  4BDR A;  3A3U A;  1JW4 A;  2O1M A;  5DVI A;  2ZYN A;  3QXM A;  1Y3Q A;  2F5X A;  1H76 A;  1AIV A;  2H25 A;  5ICQ A;  4JWX A;  5EYF A;  1VFD A;  2OCU A;  2VD2 A;  2YJP A;  3I6V A;  2DE2 A;  1NMU A;  5TPA A;  1UQW A;  2XXI A;  1UIU A;  5L9S A;  3LSW A;  4X9T A;  2YLN A;  3RTW B;  4EF2 A;  3TUS A;  2Q9T A;  1B58 A;  4ZE9 A;  1I6Q A;  1UTH B;  4EUO A;  5H8S A;  1ATG A;  3K00 A;  1PBQ A;  4QF9 A;  3C35 A;  4FEB A;  2CMO A;  3T66 A;  3HPI A;  3IAZ A;  4PFU A;  1RYX A;  2QPQ A;  4ZS9 A;  3UA8 A;  3K1M A;  3KFM A;  1URG A;  4YB7 A;  5H8N A;  2F35 A;  5I84 A;  2PT2 A;  3K6W A;  3LSF B;  3N26 A;  4ZZE A;  5ITO A;  3OO9 A; 
#chains in the Genus database with same CATH topology
 3VLU A;  2KR0 A;  1GVC A;  3C36 A;  3ISP A;  3HN0 A;  2Y5K A;  3ZKK A;  4EXK A;  1GGG A;  1N3X A;  2H9B A;  3Q27 A;  2XD2 A;  1B4H A;  3FJG A;  3LUY A;  4LVQ A;  5B7D A;  2XX8 A;  4OQO A;  3FV2 A;  3RNN A;  1A55 A;  2ZMB A;  3TPA A;  4OA4 A;  1J1N A;  4NTL A;  1PEB A;  2F97 A;  5EHM A;  1K9Y A;  1MY4 A;  2ANJ A;  5FHN A;  4QFL A;  4R73 A;  1LFH A;  2UYF A;  4PDH A;  3UN6 A;  3IK6 B;  5AE4 A;  3DP4 A;  2QVR A;  1LBY A;  1RYO A;  4PAK A;  4NG7 A;  4R6K A;  1NH8 A;  4GOT A;  4IO6 A;  1JNF A;  4FAJ A;  3R26 A;  5TP9 B;  3Q29 A;  2I0C A;  4HE1 A;  3KJ7 A;  4G8M A;  2V84 A;  3FXR A;  4AB6 A;  1VSO A;  4EDP A;  5DVJ A;  1UTB B;  1B4Z A;  1FBF A;  4R6Y A;  1DOT A;  4N6P A;  1KA1 A;  1MS7 A;  4KCD A;  2O51 A;  1IMC A;  3A3C A;  3VFJ A;  2XXV A;  4ONY A;  3TTR A;  4F2Q A;  5IZ3 A;  4ELP A;  3C34 A;  4LN5 A;  1OQG A;  2OBG A;  1FJ9 A;  4PFY A;  1LAX A;  5TPA B;  3SES A;  2FIX A;  3PGF A;  2QFL A;  3LC8 A;  1UTB A;  3E13 X;  2H98 A;  4FOR A;  2JJK A;  3PPR A;  3CR9 A;  2GQ1 A;  1IXC A;  1JVY A;  3ECR A;  3IOV A;  3IOT A;  4KFQ A;  4JSD A;  2G93 A;  1DSN A;  1NUY A;  1NV6 A;  4K3F A;  4I3E A;  3BIG A;  1FQB A;  2XA5 A;  4GVO A;  4H0W A;  1LBX A;  1IXG A;  4DLD A;  3UK4 A;  4MLQ A;  1FPF A;  1MY0 A;  2ONR A;  3B6Q A;  4XKN A;  4G2Z A;  3I5O A;  1ZU0 A;  3OXN A;  2PFZ A;  5ELV A;  2PVU A;  3TEL A;  2QL3 A;  4P47 A;  1FCK A;  1FQA A;  4O3B A;  5FBP A;  2HQ0 A;  2HPG A;  2B4L A;  1B05 A;  1FBG A;  5CRY A;  3KC1 A;  5EHS A;  1M5D A;  2A5T B;  3MAM A;  1WDN A;  1NUW A;  4POW A;  2QMW A;  1MQJ A;  1UIV A;  2DXY A;  3TTM A;  1JEU A;  3KBR A;  1OVT A;  4L17 A;  4NGU A;  3M3F A;  3TOD A;  5I2K A;  3PUZ E;  3HO7 A;  1A40 A;  3QSL A;  1NNP A;  4F1Y A;  4I62 A;  4YIC A;  1FTL A;  3TCG A;  1AMF A;  3PUW E;  4JVI A;  5FTI A;  3THI A;  3T1B A;  2AL4 A;  2THI A;  3RYD A;  1IEJ A;  1FBP A;  4BDO A;  4QBA A;  2CZL A;  2I4C A;  1N84 A;  1OLA A;  2P3V A;  2QVV A;  1VR5 A;  4G77 A;  4FAT A;  2QS2 A;  4IY6 A;  4LA9 A;  3TFL A;  3FBP A;  2HXR A;  3QAX A;  2XX9 A;  1MXY A;  1USY E;  3R6U A;  4GWU A;  2GHA A;  3K02 A;  5A5X B;  3PMV A;  1SDX A;  3FUZ A;  4H45 A;  3K6U A;  4YKJ A;  3CFX A;  5CC2 A;  4TLL B;  5LTC A;  1B46 A;  3KEI A;  4Q8R A;  1WVJ A;  5ESY A;  4YB6 A;  1B0H A;  2Q2A A;  5I59 B;  3MVW A;  3HCQ A;  4YZZ A;  3RPL B;  2VP1 A;  1RDY A;  2CZK A;  4BDN A;  4DDD A;  4MBP A;  4EQ9 A;  3U72 A;  1NNT A;  3TQW A;  1TFA A;  2ZNS A;  3N6T A;  2Q8M A;  1P1O A;  3T22 A;  5I57 B;  1RKM A;  3U93 A;  2O7U A;  3S9M C;  4N91 A;  3ILT B;  2DVZ A;  3ONM A;  4G4P A;  3TTN A;  2XXY A;  4RJZ A;  1FRP A;  2XXH A;  1FBC A;  4BDL A;  4QHQ A;  4WEP A;  3T9X B;  4HW8 A;  4ZE8 A;  1B9J A;  4YMB A;  1S50 A;  1DPP A;  2DP8 A;  4ELQ A;  1LFG A;  4OHN A;  1LBC A;  2F6G A;  4UAC A;  3EHS A;  4QFO A;  1D9V A;  1FQF A;  1EZ9 A;  2VD3 A;  1TT1 A;  4HCW A;  2DSF A;  1TFD A;  2Z23 A;  3TDJ A;  4PP0 A;  4PFI A;  1D4N A;  1LBV A;  3MVX A;  5I56 A;  1PB7 A;  3FJM A;  2HZK A;  1NUZ A;  4MFI A;  5DTB A;  3HST A;  1SPI A;  2KQZ A;  4LUB A;  4MNI A;  2FBP A;  4P9K A;  3PPQ A;  2UVJ A;  4XIG Q;  4XEQ A;  3RPL A;  3K1P A;  4C0R A;  1QGX A;  5JTY A;  1FPJ A;  4XXU A;  2DS9 A;  1BIY A;  4OVQ A;  3V8X B;  3MVY A;  4GWY A;  2OK2 A;  4EQ7 A;  2KLF A;  1LLS A;  3D4G A;  3WAE A;  2R8T A;  2CZI A;  3SDF A;  3TEP A;  4F19 A;  1BK4 A;  2Q2C A;  3QUJ A;  5H8Q A;  3IO6 A;  3QK6 A;  3TMG A;  1MXV A;  1MM6 A;  3KGC A;  1NV4 A;  4C1T A;  1EH3 A;  4DCY A;  4PTK A;  5DEX B;  5DT6 A;  3ZSF A;  5DVI A;  5ICQ A;  5EYF A;  4JWX A;  2VD2 A;  2OCU A;  3I6V A;  4X9T A;  1B58 A;  4NF0 A;  1I6Q A;  1UTH B;  1DBZ A;  1ATG A;  3K00 A;  4PFU A;  3UA8 A;  5I84 A;  4YB7 A;  5H8N A;  2F35 A;  3LSF B;  4E0W A;  1Y20 A;  2E0S A;  5KDT A;  4WXJ A;  3H6W A;  4HE2 A;  4AQ4 A;  1PB9 A;  2VHA A;  1B7H A;  1JP4 A;  4PDD A;  1FBH A;  1KA0 A;  5AA2 D;  1SW4 A;  1Y4C A;  3ILU B;  3FVK A;  1F9B A;  5F7V A;  3H06 B;  1MXU A;  4IY5 A;  3RY3 A;  3I3V A;  2DWJ A;  3VE1 B;  3L6G A;  4GLI A;  1IXI A;  3VVE A;  1YYZ A;  5LOM A;  3TYH A;  2WX9 A;  2WEF A;  1NV0 A;  4O3A A;  1II5 A;  2DQV A;  5IM2 A;  5H8Q B;  2XWO A;  4KR5 A;  1XOC A;  3CVG A;  5EQ9 A;  2CZH A;  1N7X A;  5ISU A;  1DTG A;  3K01 A;  1XI6 A;  4F1U A;  4F3P A;  4DXC A;  2IA4 A;  5DYH A;  1EYJ A;  5A5X A;  1SYI A;  1QUJ A;  2MKZ A;  2B3B A;  1A8E A;  1M5E A;  3LUZ A;  1B51 A;  2X7Q A;  3A09 A;  1XHY A;  3KN7 A;  3PD8 A;  4OVJ A;  3G7W A;  1FQE A;  3MP6 A;  4R72 A;  1PBP A;  4H67 A;  3H6T A;  4MNP A;  5CBS A;  4KQP A;  4R74 A;  4R75 A;  1FSA A;  4QXD A;  4PF6 A;  5F24 A;  2ONK E;  4THI A;  4POX A;  1D9Y A;  1Q9D A;  3G3F A;  3OD7 A;  1IMA A;  3IL1 B;  2FNC A;  4DI4 B;  4RPN A;  1URS A;  1NV5 A;  2V25 A;  3K0V A;  4G61 A;  4KYE A;  1YXI A;  4JDF A;  3VVD A;  1YPN A;  3PPN A;  3MWB A;  3E3K A;  4OVP A;  1XC1 A;  3FD3 A;  3FVO A;  2YPN A;  1DTZ A;  4R9G A;  4NWC A;  4NF6 B;  4GWO A;  4QSD A;  4QFK A;  1NUX A;  1ELJ A;  5KCJ A;  1R6Z A;  4JXI A;  2Y5L A;  4IB2 A;  4BDQ A;  3GLB A;  3HV1 A;  3M3K A;  1P1Q A;  2F3B A;  1MPD A;  3KG2 A;  4RK2 A;  4FEC A;  4X04 A;  3ODB A;  1CE2 A;  1B3E A;  4OEN A;  2R9J A;  1MY1 A;  1LBB A;  5CMM A;  1SYH A;  1P1N A;  3OEK A;  4OTE A;  2Q89 A;  3KOT A;  1FTA A;  1Y1Z A;  2PX1 A;  1LB9 A;  2I4B A;  3HHF A;  3H03 A;  3V83 A;  1OQH A;  2I49 A;  2I3V A;  4ZEK A;  2WBB A;  2ZYO A;  4XTC Q;  5JK4 A;  2L5V A;  1FPK A;  5AA3 A;  4MLV A;  4NF8 B;  1LBZ A;  1PC3 A;  3O66 A;  3IOW A;  1RDX A;  4IO5 A;  3CRB A;  3RUM A;  1H3D A;  4QSC A;  2E1S A;  3G3K A;  4G68 A;  3MST A;  4OFL A;  2XXQ A;  5I7I A;  2V4C A;  4NF5 A;  4OMB A;  5EQA A;  2XXU A;  1SBP A;  3IB0 A;  2VOZ A;  3AXF A;  4UAB A;  3TKD A;  2CEY A;  1LAG E;  4RK9 A;  3K4U A;  2Z8E A;  3O2A A;  1B3L A;  3U94 A;  4ZEF A;  5AA4 A;  2M8C A;  2H99 A;  4F29 A;  1B52 A;  1GTK A;  3OEL A;  4JB7 A;  1R9L A;  1H43 A;  3ROJ A;  4H1X A;  2RC7 A;  1MDQ A;  2A5T A;  2I48 A;  1QKB A;  2O84 X;  1BP5 A;  3B7D A;  4JVC A;  1AH5 A;  3TQL A;  1SQY A;  1B5H A;  3B6W A;  3MW0 A;  2D3I A;  3GYY A;  3U1O A;  1N3W A;  1YAE A;  2O7I A;  4PE5 B;  1Y4T A;  2UXA A;  4FED A;  1NKX A;  3USD A;  5L9O A;  1MDP 1;  1MXX A;  4F3B A;  1IXH A;  4OYV A;  2GRV A;  2ABH A;  1OLC A;  1FW0 A;  2DWI A;  4NF8 A;  4Q30 B;  2VT5 A;  4N4U A;  2ZNU A;  4OVR A;  3SEV A;  5AA2 B;  4U4S A;  1M5F A;  1QW0 A;  4X1B A;  1MXZ A;  2FIE A;  3CG3 A;  2F8D A;  1Y3P A;  4WED A;  2HZL A;  4IO7 A;  4H46 A;  1XS5 A;  2OWT A;  1A8F A;  4DIG A;  4P3L A;  4RXL A;  3MZ9 A;  3PUX E;  3SEW A;  3CIJ A;  4I3Y A;  1VFE A;  3KJT A;  4LZ8 A;  1JVX A;  2F34 A;  2RF1 A;  3FV1 A;  5LDZ A;  4ZED A;  4TLM B;  3H6V A;  2HFB A;  3OO7 A;  4NMY A;  4IR8 A;  1FBE A;  1N76 A;  2OLB A;  3GBB A;  4KI0 E;  3FXB A;  3LV0 A;  2ESN A;  3K6V A;  4MEV A;  2XXP A;  3UGW A;  3C9H A;  2OWS A;  3E78 A;  3IX1 A;  3U8Q A;  1IUD A;  2QSX A;  1FTJ A;  4HCY A;  2HHM A;  4N13 A;  4YKI A;  2XXT A;  4OAN A;  1SW5 A;  1LCF A;  1QUL A;  3MP8 A;  1MPC A;  5I57 A;  2G29 A;  4EXL A;  4PBH A;  1QKA A;  2XHD A;  4GIZ A;  1DMB A;  4I8C A;  4PFB A;  3EQ1 A;  1JQF A;  1B40 A;  4H65 A;  4U2R A;  2XX7 A;  2F78 A;  1LAF E;  3C33 A;  2ZYK A;  4H5G A;  4MNC A;  1NV3 A;  4KHZ E;  1KZ8 A;  1INP A;  4MX6 A;  2QVU A;  3A3U A;  3QXM A;  2F5X A;  4NHB A;  2PCR A;  2DE2 A;  5L9S A;  2XXI A;  1UIU A;  3LSW A;  2YLN A;  4HXV A;  4ZE9 A;  4FEB A;  3K1M A;  3KFM A;  3K6W A;  3OO9 A;  4YB5 A;  3K6X A;  5I56 B;  4OES A;  3VV5 A;  1URD A;  2WBD A;  4ZEI A;  1MQG A;  3V5A A;  3B8B A;  3MZ1 A;  3PMW A;  1B6H A;  3FIR A;  2Y7P A;  4NQ8 A;  1SW1 A;  3MQ9 A;  4PFT A;  4RYA A;  2RIN A;  4OXV A;  2PYY A;  2GH9 A;  2XXR A;  3PUV E;  5F1Q A;  5CMC A;  4GXA A;  3T93 B;  3FJ7 A;  3DLN A;  4DCX A;  1EYK A;  2BJI A;  4Z0I A;  5AA1 A;  4PCD A;  3SEY A;  1MY3 A;  4I40 A;  5T3J A;  5A5L A;  1VE4 A;  4KPT A;  1N0T A;  3IJX B;  1DK4 A;  1S7Y A;  2VPN A;  4YKP A;  4MHF A;  4ECF A;  4N8Y A;  3P7I A;  1FPE A;  4GRK A;  1P1U A;  3O6I A;  4XKP A;  3LSL A;  3CSG A;  4N15 A;  2OZZ A;  3TAJ A;  3EHU A;  4OFO A;  3CG1 A;  1GR2 A;  5FHO A;  3S9L C;  3KZG A;  3VXC A;  3Q26 A;  3IB1 A;  4FE8 A;  4R6H A;  2NWJ A;  1Z7M E;  3MPK A;  2Q74 A;  1QVS A;  4NX1 A;  5DEX A;  3PPP A;  3G3G A;  1FQD A;  4LQ2 A;  3VLV A;  5ICT A;  4OVS A;  1SD3 A;  5IZZ A;  1N7W A;  2XD3 A;  4FIM A;  2QS3 A;  4X48 A;  3PTY A;  2RKM A;  2B4M A;  3FXU A;  2QJE A;  1IIT A;  2ZNT A;  1USY H;  4GWZ A;  5H8H B;  4PBQ A;  1DPE A;  3VVF A;  1RDZ A;  3JYR A;  4GL8 A;  1LFI A;  4M4G A;  2UYE A;  4GX6 A;  2AL5 A;  2F36 A;  2Z8D A;  3W15 C;  3RTF B;  1AOV A;  4PGP A;  3PV0 E;  4C1U A;  4GFR A;  2H4I A;  3S9E A;  4NF4 B;  2I58 A;  3CSB A;  2DWA A;  4LZ5 A;  2ZYM A;  3LSX A;  4U21 A;  2HAV A;  5B70 A;  3IFC A;  1B3F A;  1ZTY A;  5I58 A;  4NWD A;  3W9W A;  2FVZ A;  5DVF A;  4ZZA A;  1L5T A;  1ZLQ A;  4XF5 A;  4F3S A;  3EHT A;  3VDF A;  5AA4 B;  4Z7E A;  3HHG A;  3NOH A;  2QRY A;  4PF8 A;  4U1Z A;  1XVX A;  2DDK A;  2DE3 A;  3MBP A;  1B3H A;  3BFT A;  3QMF A;  2XWV A;  2ONS A;  4X1D A;  5CMK A;  4ZDM A;  5I59 A;  1WOD A;  1EYI A;  4UA8 A;  5M2V A;  1NH7 A;  3RN8 A;  2PFY A;  3DP8 A;  4OEV A;  1FTM A;  1O7T A;  3C31 A;  3GXA A;  3VLW A;  3UOR A;  1US4 A;  1FTO A;  4GWX A;  4AB5 A;  1FTK A;  3TCF A;  1H44 A;  4P1E A;  4TOZ A;  3QUF A;  2XXW A;  5I2N B;  4LAT A;  4R9F A;  2O68 A;  5IAI A;  2A5S A;  1PB8 A;  1O63 A;  1Q35 A;  5I2K B;  3H4Z A;  1B2H A;  1B1H A;  2Y7R A;  5L9M A;  3G3I A;  4YMA A;  3K2D A;  5AA2 A;  2W7Y A;  1FPG A;  4RPO A;  4U1O A;  5K2X A;  1D9Q A;  4OFJ A;  5I3S A;  5JTY B;  1CB6 A;  3E79 A;  1IMD A;  4ZEC A;  4KYS A;  5I2N A;  3A29 A;  5I5P A;  4R2B A;  4ELO A;  4RNS A;  2NUV A;  3C32 A;  2V3U A;  1MRP A;  1MQI A;  2HEU A;  3Q28 A;  5ET7 A;  2I0B A;  4F22 A;  2P0S A;  2DE4 A;  2X26 A;  4PAI A;  2Z22 A;  1LAH E;  1G0I A;  4N6K A;  2DVC A;  4FJP A;  3RGY A;  2DWH A;  2UVG A;  3OMB A;  3T96 B;  4H5F A;  5ET5 A;  1Z7N E;  2Q88 A;  4EQB A;  2GFE A;  4U22 A;  5H8F B;  3EN3 A;  4I9D A;  4DXB A;  3B6T A;  3S4U A;  3PU5 A;  1BKA A;  4KXP A;  1ZKB A;  2HAU A;  4JVD A;  4H6D A;  4PET A;  3DEL B;  3D1R A;  4PGN A;  4FBP A;  4NF5 B;  3FVN A;  3RQT A;  3OOA A;  5H8N B;  3PD9 A;  5BWJ A;  5TU0 A;  2FYI A;  1G0H A;  1SW2 A;  2O6A A;  2REG A;  3S2V A;  3SER A;  1HSL A;  4N81 A;  2AIX A;  4MIJ A;  1D3K A;  3MVZ A;  1NI9 A;  2DOJ A;  1MPB A;  1POT A;  1JW5 A;  4PQJ A;  1TWY A;  3IO4 A;  2IEE A;  4GF8 A;  3MUQ A;  2VGQ A;  4MAG A;  4NN3 A;  2HXW A;  2XXX A;  4YKK A;  1P1W A;  1EU8 A;  4N17 A;  1XVY A;  3CI8 A;  2P1S A;  3U65 A;  1ANF A;  1CNQ A;  2OX3 A;  3Q25 A;  5L8D A;  1IQ7 A;  2CEX A;  2O1L A;  2HCA A;  3T9V A;  2OWZ A;  1EZP A;  2RC9 A;  3C4M A;  1A7L A;  1N04 A;  5CI5 A;  4P11 A;  2F6P A;  2QS4 A;  4JWO A;  3KSX A;  3QYT A;  2QMX A;  1ZJL A;  4TQU Q;  3VXB A;  4KYD A;  3EKI A;  1EZO A;  1NFT A;  1GV8 A;  4KCC A;  3KN8 A;  1IIW A;  2D5W A;  1BTJ A;  2XWK A;  2Y7I A;  3OEM A;  3SZP A;  2FHY A;  4RA1 A;  3QIM A;  4Q0C A;  4GQO A;  3O9P A;  5CBR A;  2ZZW A;  3IOR A;  1FPB A;  4XKQ A;  4YAH X;  3G3J A;  2GHB A;  1JEV A;  1NL5 A;  2O1M A;  2ZYN A;  1H76 A;  1AIV A;  1VFD A;  5TPA A;  1NMU A;  3HFU A;  1UQW A;  3TUS A;  2Q9T A;  4O94 A;  4EUO A;  1PBQ A;  4QF9 A;  3C35 A;  2CMO A;  3HPI A;  1URG A;  2PT2 A;  1FPI A;  3N26 A;  5ITO A;  4MCO A;  4ND9 A;  1NV2 A;  4PFW A;  4G68 B;  3V89 B;  4HS7 A;  3IJO B;  1I69 A;  4E0X A;  4QSE A;  1R1N A;  3PPO A;  3JZJ A;  3JV9 A;  1B5J A;  1MQD A;  3IFA A;  5J16 A;  1YCJ A;  3BKI B;  4LZ7 A;  4YU0 A;  3E9X A;  3IR1 A;  1O64 A;  4QFN A;  1XT8 A;  4PE3 A;  5EQ8 A;  4AS4 A;  3TCH A;  2DXR A;  2WKY A;  4NED A;  1SVX B;  3RLF E;  1S9T A;  1MH3 A;  1B7Z A;  3F11 A;  1LGB C;  4IO3 A;  4JBZ A;  3FZV A;  4MJO A;  3N6U A;  4P0G A;  4LP2 B;  3TTL A;  3OO6 A;  4OER A;  2F7B A;  4JWY A;  4QRZ A;  4ESX A;  1JET A;  2XXK A;  3O6H A;  3M3L A;  4F18 A;  3OSR A;  5H8H A;  4DE8 A;  4PFR A;  2OJT A;  3KN3 A;  4EF1 A;  2O69 A;  1K9Z A;  2R71 A;  3W9V A;  1B32 A;  2REJ A;  3ZS6 A;  1NV7 A;  3ZKL A;  2LAO A;  1Y1M A;  3O6G A;  4G68 C;  1FQC A;  3H3G A;  4WKM A;  4GBV A;  4GBW A;  4O7M A;  5TP9 A;  1IMB A;  3GBA A;  4O8M A;  5CM6 A;  4P0I A;  4GX4 A;  2V3T A;  2PT1 A;  1MXW A;  1IME A;  5KZT A;  4P8B A;  4F1V A;  5IKB A;  3EF7 A;  1LB8 A;  1Y3N A;  3FAT A;  1B1X A;  3T9U A;  4U4X A;  1B5I A;  1T0K A;  5CMB A;  3OO8 A;  2D21 A;  1HSE A;  1MY2 A;  2WYK A;  2V3Q A;  2Q8J A;  3FXQ A;  1AL3 A;  2Y7W A;  4GD5 A;  1A99 A;  1ZMG A;  3BBR A;  4OEU A;  1MM7 A;  1FBD A;  4ZEB A;  1H45 A;  1LBW A;  1US5 A;  4GL0 A;  1MQH A;  4GX3 A;  3L6H A;  2Y7K A;  1I6B A;  2ZZX A;  4F2O A;  3CFL A;  3TZA A;  2V93 A;  2H5Y A;  5FTH A;  1YZ0 A;  5KCJ B;  1SI1 A;  4NE4 A;  3RT8 A;  2ALU A;  5J1D A;  2I3W A;  3BFU A;  1MH4 A;  5IGA A;  5EYH A;  3MP1 A;  1LEV A;  5BUU A;  4X8R A;  2ZZV A;  4M1V A;  3H6U A;  2RC8 A;  2F7A A;  3TTK A;  5HBC A;  2F3D A;  4XKR A;  5EQ7 A;  4IO4 A;  3MPL A;  1YTV A;  3OSQ A;  4LQ5 A;  1BLF A;  2Z8F A;  1M5C A;  3FVG A;  2NXO A;  4BLA A;  2RCA A;  4R2F A;  3CHG A;  4HE0 A;  3EPE A;  3PMX A;  4IO2 A;  2XWI A;  1JW1 A;  1QUI A;  1FPL A;  1MG1 A;  3B50 A;  3DM0 A;  4G8H A;  4H8J A;  3BIH A;  3N5L A;  3UIF A;  4F3G A;  3KC0 A;  4QFP A;  4U23 A;  4F39 A;  1IMF A;  3IB2 A;  4KD5 A;  4P56 A;  3MJN A;  4ESW A;  5HM4 B;  2UVH A;  4ELR A;  4Q5T A;  3T0J A;  3R7X A;  4N6D A;  4OZ9 A;  4DXU A;  4GXS B;  1AWB A;  1QJM A;  1NNF A;  4MMP A;  2P2A A;  1A54 A;  2WYP A;  3T9H B;  1NNK A;  4P1L A;  3KSJ A;  4NAP A;  3H7M A;  4OVT A;  4N07 A;  1POY 1;  1R9Q A;  3N94 A;  5I58 B;  1FJ6 A;  3SET A;  3OEN A;  4DZ1 A;  5ITP A;  2P3N A;  2ZXT A;  3O97 A;  4NF6 A;  4HTG A;  3SEU A;  4NF4 A;  5EYG A;  3SEX A;  3D4C A;  3E4R A;  4G8N A;  3O29 A;  3LBS A;  1HSJ A;  1VDW A;  1M5B A;  2Y84 A;  5ET8 A;  1P99 A;  1OIB A;  1TXF A;  5DW8 A;  4GWS A;  2VPO A;  1NV1 A;  3O28 A;  4OWD A;  1OMP A;  1UTH A;  3MC2 A;  4DI3 D;  3DP6 A;  2R6G E;  1B7U A;  3G3H A;  3RT6 B;  1SI0 A;  3WAF A;  1B3G A;  4LON B;  4PAF A;  3RPW A;  2QS1 A;  2PBW A;  5FHM A;  4MH5 A;  5KDT B;  2DYX A;  5ET6 A;  4IGT A;  4BDM A;  2F7C A;  3CFZ A;  1Q1K A;  1Y9U A;  4F31 B;  1KWH A;  3KBZ A;  1ZBM A;  2UVI A;  3M8U A;  4AS5 A;  1B0L A;  2B65 A;  5IZ1 A;  4ISU A;  2NVU B;  2B3F A;  2FA7 A;  3K1N A;  4I1D A;  4O7I A;  4OET A;  4PC9 A;  3PUY E;  3UP9 A;  1FPD A;  3LR1 A;  5HPQ A;  4XFE A;  3GZG A;  4N8G A;  1QUK A;  1LST A;  4RY1 A;  3IOU A;  1LCT A;  3MZB A;  1PDA A;  2BJJ X;  3FGS A;  1IZ1 A;  1ZIU A;  2I6E A;  2X7P A;  3SKP A;  1DCU A;  1I6A A;  3KOS A;  4H8I A;  4O3C A;  2AYS A;  5JEI A;  4IGR A;  3U92 A;  4MF3 A;  2NOO A;  4JSO A;  1OVB A;  2RCB A;  3FAS A;  2PMS A;  5K2Y A;  5H8F A;  3S9N C;  4BDR A;  1JW4 A;  1Y3Q A;  2H25 A;  2YJP A;  5IZ3 B;  4GWW A;  3RTW B;  4EF2 A;  5H8S A;  3MYU A;  3T66 A;  3IAZ A;  1RYX A;  2QPQ A;  4ZS9 A;  4ZZE A; 
#chains in the Genus database with same CATH homology
 4YB5 A;  3VLU A;  3K6X A;  4ND9 A;  4E0W A;  5I56 B;  1Y20 A;  1GVC A;  2E0S A;  3C36 A;  3HN0 A;  4OES A;  4PFW A;  3VV5 A;  3ZKK A;  1URD A;  4EXK A;  1GGG A;  5KDT A;  1N3X A;  4G68 B;  3V89 B;  2H9B A;  3Q27 A;  4WXJ A;  2XD2 A;  1B4H A;  3H6W A;  4HS7 A;  4ZEI A;  3IJO B;  1I69 A;  4E0X A;  3FJG A;  1MQG A;  3LUY A;  3V5A A;  4LVQ A;  4AQ4 A;  1PB9 A;  2VHA A;  4QSE A;  3MZ1 A;  1B7H A;  3PMW A;  5B7D A;  1B6H A;  3FIR A;  2Y7P A;  1R1N A;  2XX8 A;  3PPO A;  4OQO A;  3FV2 A;  3JZJ A;  3RNN A;  5AA2 D;  1Y4C A;  1SW1 A;  1SW4 A;  3ILU B;  1A55 A;  3FVK A;  3JV9 A;  3MQ9 A;  1B5J A;  1F9B A;  3H06 B;  1MXU A;  4IY5 A;  4PFT A;  1MQD A;  5F7V A;  2RIN A;  2ZMB A;  4OXV A;  3RY3 A;  2PYY A;  3TPA A;  3I3V A;  2DWJ A;  1YCJ A;  2GH9 A;  2XXR A;  3BKI B;  4LZ7 A;  3PUV E;  4YU0 A;  1J1N A;  5F1Q A;  5CMC A;  3VE1 B;  3L6G A;  1PEB A;  3E9X A;  4GLI A;  4GXA A;  2F97 A;  3IR1 A;  4NTL A;  1O64 A;  5EHM A;  1IXI A;  1MY4 A;  3VVE A;  4QFN A;  3T93 B;  2ANJ A;  5FHN A;  4QFL A;  4R73 A;  5LOM A;  1LFH A;  2UYF A;  1XT8 A;  3TYH A;  3UN6 A;  3IK6 B;  4O3A A;  3FJ7 A;  3DP4 A;  5AE4 A;  1II5 A;  3DLN A;  2DQV A;  4DCX A;  5H8Q B;  4KR5 A;  1RYO A;  1XOC A;  2DXR A;  2WKY A;  3CVG A;  4NED A;  3TCH A;  1SVX B;  1N7X A;  5ISU A;  3RLF E;  1DTG A;  3K01 A;  1S9T A;  4R6K A;  1NH8 A;  4Z0I A;  1MH3 A;  5AA1 A;  1B7Z A;  4GOT A;  3F11 A;  1LGB C;  4IO6 A;  4IO3 A;  4F1U A;  4JBZ A;  1JNF A;  3FZV A;  3SEY A;  1MY3 A;  4F3P A;  4FAJ A;  3R26 A;  2IA4 A;  4DXC A;  5TP9 B;  3Q29 A;  5DYH A;  1VE4 A;  4KPT A;  1SYI A;  1QUJ A;  2I0C A;  5A5X A;  2B3B A;  3KJ7 A;  3N6U A;  4G8M A;  1N0T A;  3IJX B;  4P0G A;  4LP2 B;  2V84 A;  3TTL A;  1A8E A;  1S7Y A;  1M5E A;  4YKP A;  1B51 A;  3FXR A;  3OO6 A;  4AB6 A;  1VSO A;  4ECF A;  2X7Q A;  3A09 A;  4OER A;  1XHY A;  3KN7 A;  3PD8 A;  2F7B A;  3G7W A;  4JWY A;  4OVJ A;  3P7I A;  1FQE A;  4QRZ A;  5DVJ A;  3MP6 A;  1UTB B;  1PBP A;  1B4Z A;  4GRK A;  1P1U A;  4H67 A;  3H6T A;  4R72 A;  4R6Y A;  1DOT A;  3O6I A;  4KQP A;  4N6P A;  1JET A;  4R74 A;  4ESX A;  4R75 A;  4XKP A;  1MS7 A;  3LSL A;  4KCD A;  2ONK E;  4THI A;  3CSG A;  3O6H A;  4POX A;  1D9Y A;  3M3L A;  3G3F A;  3OD7 A;  2O51 A;  4F18 A;  3OSR A;  5H8H A;  2OZZ A;  3TAJ A;  4DE8 A;  3EHU A;  3A3C A;  3IL1 B;  2OJT A;  4OFO A;  3KN3 A;  3CG1 A;  3VFJ A;  2FNC A;  1GR2 A;  2XXV A;  2O69 A;  4ONY A;  5FHO A;  3TTR A;  4EF1 A;  4F2Q A;  3S9L C;  4RPN A;  2R71 A;  3KZG A;  3VXC A;  3C34 A;  3Q26 A;  4ELP A;  3IB1 A;  4FE8 A;  4R6H A;  3W9V A;  1B32 A;  1OQG A;  1URS A;  2OBG A;  2REJ A;  2V25 A;  4PFY A;  1Z7M E;  2NWJ A;  1LAX A;  5TPA B;  3SES A;  3ZS6 A;  3MPK A;  3K0V A;  3PGF A;  3ZKL A;  1QVS A;  2LAO A;  1Y1M A;  3O6G A;  4G68 C;  4KYE A;  3LC8 A;  1FQC A;  3H3G A;  1UTB A;  3E13 X;  2H98 A;  4FOR A;  4JDF A;  4WKM A;  3PPR A;  3VVD A;  3CR9 A;  5DEX A;  3PPP A;  1YPN A;  3G3G A;  3PPN A;  1IXC A;  3MWB A;  5TP9 A;  1JVY A;  3E3K A;  3ECR A;  1FQD A;  4LQ2 A;  3VLV A;  3IOV A;  5ICT A;  3IOT A;  1XC1 A;  4KFQ A;  3GBA A;  1SD3 A;  3FD3 A;  5CM6 A;  4P0I A;  1N7W A;  4JSD A;  3FVO A;  2XD3 A;  2YPN A;  4FIM A;  2V3T A;  2G93 A;  2PT1 A;  1DSN A;  1MXW A;  1DTZ A;  4R9G A;  5KZT A;  4K3F A;  4NWC A;  2QS3 A;  4F1V A;  4X48 A;  5IKB A;  4NF6 B;  1FQB A;  4GWO A;  2RKM A;  4QSD A;  4RYA A;  3EF7 A;  3FXU A;  2QJE A;  4QFK A;  4GVO A;  1IIT A;  1LB8 A;  1Y3N A;  2ZNT A;  4H0W A;  1IXG A;  1USY H;  1ELJ A;  5KCJ A;  4DLD A;  1R6Z A;  1B1X A;  3FAT A;  4JXI A;  1MY0 A;  4MLQ A;  2ONR A;  3B6Q A;  4XKN A;  3T9U A;  4G2Z A;  4U4X A;  4IB2 A;  4BDQ A;  1B5I A;  3GLB A;  3I5O A;  5H8H B;  1ZU0 A;  3HV1 A;  1DPE A;  3OXN A;  3M3K A;  1T0K A;  5CMB A;  5ELV A;  1P1Q A;  2PVU A;  3VVF A;  3TEL A;  1MPD A;  2QL3 A;  3KG2 A;  3OO8 A;  2D21 A;  4RK2 A;  3JYR A;  4FEC A;  4GL8 A;  1HSE A;  1LFI A;  1FCK A;  1MY2 A;  2UYE A;  4M4G A;  3ODB A;  1FQA A;  4O3B A;  1CE2 A;  2AL5 A;  2F36 A;  2V3Q A;  2HQ0 A;  2Z8D A;  1B3E A;  1B05 A;  2Q8J A;  3W15 C;  3FXQ A;  4OEN A;  1AL3 A;  3RTF B;  1AOV A;  3PV0 E;  2R9J A;  2Y7W A;  4GD5 A;  1A99 A;  5CRY A;  1MY1 A;  4GFR A;  1M5D A;  5EHS A;  4C1U A;  2H4I A;  1LBB A;  3S9E A;  1ZMG A;  3BBR A;  4OEU A;  5CMM A;  1MM7 A;  2A5T B;  3MAM A;  4NF4 B;  2I58 A;  1SYH A;  1P1N A;  1WDN A;  3CSB A;  4POW A;  1H45 A;  2DWA A;  4LZ5 A;  4ZEB A;  2ZYM A;  2QMW A;  3LSX A;  3OEK A;  1US5 A;  4GL0 A;  2HAV A;  2Q89 A;  1MQJ A;  1MQH A;  3KOT A;  4OTE A;  1UIV A;  4U21 A;  5B70 A;  1B3F A;  1Y1Z A;  1ZTY A;  5I58 A;  2DXY A;  4NWD A;  3L6H A;  3TTM A;  2PX1 A;  1JEU A;  3KBR A;  1LB9 A;  3W9W A;  1OVT A;  2I4B A;  2Y7K A;  5DVF A;  1I6B A;  4ZZA A;  1L5T A;  3HHF A;  3H03 A;  3CFL A;  3TZA A;  4F2O A;  3V83 A;  1OQH A;  1ZLQ A;  2V93 A;  4L17 A;  2H5Y A;  2I3V A;  2I49 A;  3EHT A;  3M3F A;  4ZEK A;  3VDF A;  4F3S A;  4Z7E A;  3TOD A;  5AA4 B;  2ZYO A;  4XTC Q;  5FTH A;  3HHG A;  5I2K A;  5JK4 A;  3PUZ E;  5KCJ B;  2QRY A;  3HO7 A;  5AA3 A;  1A40 A;  4U1Z A;  1SI1 A;  1XVX A;  4NE4 A;  3RT8 A;  2ALU A;  3QSL A;  4MLV A;  1NNP A;  4NF8 B;  2DE3 A;  4F1Y A;  3MBP A;  4I62 A;  1B3H A;  1PC3 A;  3O66 A;  1FTL A;  4YIC A;  5J1D A;  3BFT A;  3TCG A;  1AMF A;  3PUW E;  3IOW A;  2I3W A;  3BFU A;  5FTI A;  4IO5 A;  1MH4 A;  3CRB A;  3THI A;  2AL4 A;  3RUM A;  1H3D A;  4QSC A;  2E1S A;  3G3K A;  2ONS A;  2THI A;  4G68 A;  3MP1 A;  4X1D A;  5CMK A;  4ZDM A;  5I59 A;  1WOD A;  4OFL A;  4UA8 A;  5BUU A;  1IEJ A;  5M2V A;  1NH7 A;  4M1V A;  2XXQ A;  3H6U A;  4BDO A;  3RN8 A;  5CBR A;  4NF5 A;  3DP8 A;  4OEV A;  1FTM A;  2RC8 A;  1O7T A;  2F7A A;  3C31 A;  5HBC A;  2CZL A;  3TTK A;  2I4C A;  1N84 A;  4OMB A;  1OLA A;  3GXA A;  4XKR A;  1VR5 A;  3VLW A;  2XXU A;  4G77 A;  4FAT A;  2QS2 A;  4IO4 A;  4IY6 A;  1SBP A;  1US4 A;  3IB0 A;  2VOZ A;  3MPL A;  3UOR A;  1FTO A;  1YTV A;  3AXF A;  3OSQ A;  4LA9 A;  4LQ5 A;  3TFL A;  3TKD A;  4AB5 A;  1FTK A;  1BLF A;  3QAX A;  2Z8F A;  2XX9 A;  1MXY A;  1LAG E;  1USY E;  3R6U A;  3TCF A;  1H44 A;  4TOZ A;  2GHA A;  4RK9 A;  1M5C A;  3FVG A;  3K4U A;  2NXO A;  4BLA A;  3QUF A;  2XXW A;  2Z8E A;  2RCA A;  3K02 A;  3O2A A;  1B3L A;  4LAT A;  4R2F A;  5I2N B;  4R9F A;  2O68 A;  3U94 A;  5A5X B;  3PMV A;  4ZEF A;  5AA4 A;  2M8C A;  1SDX A;  5IAI A;  2A5S A;  2H99 A;  1PB8 A;  1O63 A;  1Q35 A;  3FUZ A;  3K6U A;  5I2K B;  4F29 A;  1B52 A;  1B2H A;  1GTK A;  3EPE A;  3H4Z A;  3PMX A;  1B1H A;  4YKJ A;  3CFX A;  4IO2 A;  3S9M C;  3OEL A;  4JB7 A;  1JW1 A;  1QUI A;  2Y7R A;  5CC2 A;  1MG1 A;  3DM0 A;  4H8J A;  1R9L A;  1H43 A;  4G8H A;  4TLL B;  5L9M A;  3G3I A;  4EDP A;  4YMA A;  3N5L A;  3UIF A;  1B46 A;  4F3G A;  3KEI A;  4H1X A;  4Q8R A;  1WVJ A;  3K2D A;  4QFP A;  4U23 A;  2W7Y A;  2RC7 A;  1MDQ A;  4RPO A;  2A5T A;  4U1O A;  2I48 A;  1QKB A;  4YB6 A;  5K2X A;  1B0H A;  2O84 X;  2Q2A A;  5I59 B;  1BP5 A;  3MVW A;  3B7D A;  3HCQ A;  3IB2 A;  1AH5 A;  4KD5 A;  4OFJ A;  4YZZ A;  5JTY B;  3TQL A;  3MJN A;  1SQY A;  1CB6 A;  1B5H A;  3B6W A;  4ZEC A;  4KYS A;  4ESW A;  5HM4 B;  3MW0 A;  2D3I A;  2UVH A;  2VP1 A;  5I2N A;  4ELR A;  3U1O A;  4Q5T A;  4R2B A;  3R7X A;  4ELO A;  1N3W A;  4RNS A;  1YAE A;  2NUV A;  4OZ9 A;  3C32 A;  2O7I A;  4DXU A;  2V3U A;  1MRP A;  4GXS B;  5AA2 A;  1QJM A;  4PE5 B;  4BDN A;  4DDD A;  1NNF A;  1MQI A;  4MBP A;  4EQ9 A;  3U72 A;  2P2A A;  1A54 A;  1Y4T A;  2HEU A;  2UXA A;  3Q28 A;  1NKX A;  4FED A;  1NNT A;  3T9H B;  3TQW A;  1NNK A;  1TFA A;  3USD A;  2I0B A;  2ZNS A;  3KSJ A;  3N6T A;  4F22 A;  1P1O A;  3T22 A;  5I57 B;  1RKM A;  2P0S A;  2DE4 A;  2O7U A;  2X26 A;  3U93 A;  3H7M A;  5L9O A;  2Z22 A;  4N07 A;  1POY 1;  1R9Q A;  1MDP 1;  1MXX A;  3ILT B;  1LAH E;  3N94 A;  4F3B A;  3SET A;  5I58 B;  2DVZ A;  1IXH A;  4OYV A;  3ONM A;  4G4P A;  4X1B A;  2GRV A;  3OEN A;  2DVC A;  2XXY A;  3TTN A;  4DZ1 A;  5ITP A;  4FJP A;  2ABH A;  3RGY A;  2DWH A;  2ZXT A;  3O97 A;  4RJZ A;  4NF6 A;  2UVG A;  1OLC A;  1FW0 A;  3OMB A;  4HTG A;  2DWI A;  4NF8 A;  4H5F A;  3SEU A;  4Q30 B;  3T96 B;  4NF4 A;  2ZNU A;  2XXH A;  3SEV A;  5AA2 B;  1Z7N E;  3SEX A;  3D4C A;  3E4R A;  4BDL A;  4QHQ A;  4G8N A;  4U4S A;  2Q88 A;  4WEP A;  3S4U A;  3O29 A;  4EQB A;  3T9X B;  4HW8 A;  1M5F A;  2GFE A;  4U22 A;  4ZE8 A;  3LBS A;  3EN3 A;  1HSJ A;  4I9D A;  5H8F B;  1B9J A;  4DXB A;  4YMB A;  3B6T A;  1S50 A;  1QW0 A;  1DPP A;  1M5B A;  1MXZ A;  2Y84 A;  2DP8 A;  3CG3 A;  1LFG A;  1P99 A;  4OHN A;  2F8D A;  1Y3P A;  4WED A;  4ELQ A;  3PU5 A;  1BKA A;  2HZL A;  4IO7 A;  1LBC A;  1OIB A;  1TXF A;  1ZKB A;  1XS5 A;  2F6G A;  3EHS A;  4UAC A;  2HAU A;  4H6D A;  2OWT A;  1A8F A;  4PET A;  3DEL B;  4QFO A;  1D9V A;  1FQF A;  1EZ9 A;  2VD3 A;  3O28 A;  4NF5 B;  4OWD A;  3FVN A;  3RQT A;  1TT1 A;  4DIG A;  4HCW A;  2DSF A;  3OOA A;  1OMP A;  1TFD A;  1UTH A;  2Z23 A;  4RXL A;  3MZ9 A;  3PUX E;  3SEW A;  3CIJ A;  5H8N B;  3PD9 A;  5BWJ A;  5TU0 A;  3MC2 A;  3UK4 A;  1VFE A;  3KJT A;  2FYI A;  4LZ8 A;  3DP6 A;  1JVX A;  2R6G E;  3TDJ A;  1B7U A;  4PP0 A;  3G3H A;  2F34 A;  3RT6 B;  1D4N A;  1SI0 A;  2RF1 A;  3MVX A;  1B3G A;  3FV1 A;  4LON B;  3WAF A;  1SW2 A;  4F39 A;  4ZED A;  5I56 A;  1PB7 A;  3FJM A;  3RPW A;  2QS1 A;  4TLM B;  2O6A A;  2HZK A;  2PBW A;  4MH5 A;  5FHM A;  5KDT B;  2DYX A;  3H6V A;  2HFB A;  2REG A;  4MFI A;  5DTB A;  3HST A;  4IGT A;  3S2V A;  3SER A;  1HSL A;  4BDM A;  4LUB A;  3OO7 A;  2AIX A;  2F7C A;  4NMY A;  3CFZ A;  1N76 A;  1D3K A;  2OLB A;  3GBB A;  4KI0 E;  2ESN A;  3MVZ A;  3K6V A;  1Q1K A;  3PPQ A;  2DOJ A;  1MPB A;  1POT A;  1JW5 A;  2XXP A;  4PQJ A;  3UGW A;  1Y9U A;  4F31 B;  1KWH A;  1TWY A;  1ZBM A;  2UVI A;  2UVJ A;  3C9H A;  2IEE A;  3IO4 A;  3M8U A;  2OWS A;  4GF8 A;  4XIG Q;  1B0L A;  3IX1 A;  3MUQ A;  2VGQ A;  2HXW A;  2XXX A;  2B65 A;  3K1P A;  4YKK A;  3U8Q A;  1P1W A;  1IUD A;  4C0R A;  1EU8 A;  4ISU A;  2NVU B;  2QSX A;  5JTY A;  2B3F A;  4XXU A;  1XVY A;  3CI8 A;  2FA7 A;  2DS9 A;  1BIY A;  1FTJ A;  2P1S A;  1ANF A;  4HCY A;  3V8X B;  3Q25 A;  5L8D A;  1IQ7 A;  3MVY A;  4N13 A;  2O1L A;  2XXT A;  3K1N A;  4YKI A;  4I1D A;  1SW5 A;  2HCA A;  2OK2 A;  1LCF A;  3T9V A;  4EQ7 A;  1EZP A;  1QUL A;  4OET A;  2RC9 A;  3C4M A;  1A7L A;  1N04 A;  5CI5 A;  2KLF A;  1LLS A;  3D4G A;  3PUY E;  3UP9 A;  3MP8 A;  3WAE A;  1MPC A;  4P11 A;  2F6P A;  2QS4 A;  4JWO A;  5I57 A;  3SDF A;  3KSX A;  3LR1 A;  3QYT A;  2G29 A;  5CBS A;  2QMX A;  3TEP A;  1ZJL A;  4TQU Q;  4EXL A;  5HPQ A;  4F19 A;  2Q2C A;  1QKA A;  3GZG A;  4KYD A;  3VXB A;  1EZO A;  2XHD A;  1NFT A;  4GIZ A;  1DMB A;  1GV8 A;  4I8C A;  1QUK A;  3EQ1 A;  4KCC A;  3QUJ A;  1LST A;  4RY1 A;  3KN8 A;  5H8Q A;  1IIW A;  3IOU A;  1JQF A;  3IO6 A;  1LCT A;  2D5W A;  1BTJ A;  1B40 A;  3MZB A;  4H65 A;  4U2R A;  2Y7I A;  2XX7 A;  1PDA A;  2BJJ X;  3FGS A;  1MXV A;  3OEM A;  3QK6 A;  3TMG A;  1IZ1 A;  1ZIU A;  2I6E A;  2X7P A;  3QIM A;  4RA1 A;  2F78 A;  3SKP A;  1LAF E;  4Q0C A;  1I6A A;  3KOS A;  3O9P A;  4GQO A;  1MM6 A;  2AYS A;  3C33 A;  3IOR A;  3KGC A;  2ZYK A;  4H5G A;  4H8I A;  4IGR A;  4O3C A;  3U92 A;  5JEI A;  4C1T A;  4MF3 A;  4XKQ A;  1EH3 A;  2NOO A;  4JSO A;  4YAH X;  4DCY A;  1OVB A;  2RCB A;  2GHB A;  3FAS A;  3G3J A;  5DEX B;  2PMS A;  4KHZ E;  1JEV A;  5DT6 A;  5K2Y A;  5H8F A;  3S9N C;  1NL5 A;  3ZSF A;  4BDR A;  3A3U A;  1JW4 A;  2O1M A;  5DVI A;  2ZYN A;  3QXM A;  1Y3Q A;  2F5X A;  1H76 A;  1AIV A;  2H25 A;  5ICQ A;  4JWX A;  5EYF A;  1VFD A;  2OCU A;  2VD2 A;  2YJP A;  3I6V A;  2DE2 A;  1NMU A;  5TPA A;  1UQW A;  2XXI A;  1UIU A;  5L9S A;  3LSW A;  4X9T A;  2YLN A;  3RTW B;  4EF2 A;  3TUS A;  2Q9T A;  1B58 A;  4ZE9 A;  1I6Q A;  1UTH B;  4EUO A;  5H8S A;  1ATG A;  3K00 A;  1PBQ A;  4QF9 A;  3C35 A;  4FEB A;  2CMO A;  3T66 A;  3HPI A;  3IAZ A;  4PFU A;  1RYX A;  2QPQ A;  4ZS9 A;  3UA8 A;  3K1M A;  3KFM A;  1URG A;  4YB7 A;  5H8N A;  2F35 A;  5I84 A;  2PT2 A;  3K6W A;  3LSF B;  3N26 A;  4ZZE A;  5ITO A;  3OO9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...