3GLBA

Crystal structure of the effector binding domain of a catm variant (r156h)
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
215
structure length
215
Chain Sequence
SQTLRIGYVSSLLYGLLPEIIYLFRQQNPEIHIELIECGTKDQINALKQGKIDLGFGRLKITDPAIRHIVLHKEQLKLAIHKHHHLNQFAATGVHLSQIIDEPMLLYPVSQKPNFATFIQSLFTELGLVPSKLTEIREIQLALGLVAAGEGVCIVPASAMDIGVKNLLYIPILDDDAYSPISLAVRNMDHSNYIPKILACVQEVFATHHIRPLIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator catM
publication title Inducer responses of BenM, a LysR-type transcriptional regulator from Acinetobacter baylyi ADP1.
pubmed doi rcsb
source organism Acinetobacter sp.
molecule tags Transcription
total genus 59
structure length 215
sequence length 215
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3glbA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3glbA02
4PFWA 4EUOA 3VV5A 3HCQA 3SETA 1H76A 1PB7A 5ICTA 1S7YA 4WKMA 3ZSFA 3KN3A 1WODA 3GXAA 3U72A 4PFTA 4HW8A 1YPNA 5L9SA 1UTBA 3L6HA 2UVGA 5K2YA 4ZS9A 2QJEA 3HV1A 1JW4A 2OWSA 4GXAA 2W7YA 1XHYA 4R75A 2Q88A 1MXYA 3PPNA 1NH8A 3K6WA 2XXQA 1LAHE 4QFLA 2NVUB 3TTLA 4G2ZA 1XS5A 4OETA 4KFQA 5H8NA 1LB8A 3U94A 3TTKA 3MP6A 1GV8A 3UA8A 4YB5A 1J1NA 1LGBC 3UN6A 1QKAA 2X7PA 1UTBB 3SEVA 4BDMA 4YB6A 2AL4A 3EQ1A 2O1LA 4U23A 2OZZA 5CMCA 3K1NA 1SW5A 2Y7RA 1URGA 1FQAA 3K02A 3O66A 3TMGA 4LQ5A 4LONB 3TAJA 1RKMA 3HHFA 1MQIA 3CSGA 5H8NB 3O2AA 2O7IA 1A55A 3W9WA 1M5DA 1JQFA 3O6HA 2ONKE 3L6GA 1B58A 4F3BA 1B1HA 3PMXA 2F6PA 3DP8A 2DWAA 3K0VA 5HBCA 2GHAA 2A5TA 3S4UA 3H3GA 4FEBA 4LQ2A 2PMSA 1AIVA 3PPQA 2QS1A 2QRYA 2DE4A 1I6QA 3HPIA 5H8HA 4GL0A 1LAGE 3G3JA 1M5BA 3LSWA 3ONMA 1LBCA 4ELRA 4GL8A 2E1SA 4GFRA 1Y1MA 4Q8RA 1P1NA 4ISUA 3T9XB 2A5TB 5M2VA 1MRPA 2RCBA 4ND9A 1B3EA 3TODA 3Q26A 2GRVA 2NOOA 1FQEA 4OXVA 2DVZA 4IO4A 3EHSA 4G8HA 1JW5A 4F39A 3FJ7A 3MVWA 5H8HB 1Y3QA 2ZYMA 4DCYA 4YKIA 3MQ9A 4P0IA 4F29A 1SD3A 1LFIA 4I62A 4YZZA 3VXBA 2I6EA 2CZLA 3D4CA 4GQOA 3IB2A 3DELB 3WAFA 3B7DA 4OFJA 1SI1A 4IY5A 4WXJA 3U93A 4YB7A 1NNTA 1POY1 4FECA 1N7WA 3O97A 1N7XA 5EYFA 2R6GE 1XC1A 4ZECA 3HO7A 4BDOA 2OBGA 1KWHA 4DCXA 4BDLA 3U1OA 5I57A 1A8EA 1BTJA 1EU8A 1N0TA 3MC2A 4KYDA 2DQVA 1QUKA 1Z7NE 2RC7A 3DLNA 3EHTA 4JWXA 1IEJA 1VFEA 4H6DA 4DXBA 1S50A 3KFMA 1TT1A 1IIWA 2XXIA 3KG2A 1IUDA 4RXLA 2I58A 3RUMA 4XKNA 1MQGA 3SEXA 2PT2A 1B7UA 2Q8JA 3FZVA 2GFEA 1SW4A 3MZBA 4EXKA 4H65A 1MPDA 5I57B 4X1BA 1GVCA 2E0SA 4NF5A 1MM6A 2G93A 4ZEFA 4O3CA 3VLUA 2IA4A 2DYXA 4N07A 2V3QA 3K6UA 3N26A 1HSJA 1MXVA 2I0BA 4U1OA 2ALUA 3T9VA 5CBRA 2REGA 1OVBA 4F3SA 5H8QA 4PE5B 1F9BA 1AL3A 2V93A 4K3FA 1B7ZA 2HEUA 3OO7A 3SESA 1H43A 2Z22A 1SVXB 5KZTA 3O28A 5I2KA 1ZLQA 4NF5B 1LLSA 2Q2CA 5JK4A 1FTMA 3E4RA 3FV1A 3VVDA 1B40A 4UACA 3UORA 3OSRA 1URDA 4JXIA 4R74A 1B52A 5DTBA 5CC2A 2XXVA 3TFLA 1R9QA 1VSOA 4XXUA 4OFLA 5AA3A 2ZNUA 3FV2A 3HHGA 5DEXA 1GTKA 4F1YA 3OSQA 1TWYA 4JDFA 3PV0E 4R2BA 4BDRA 4F22A 1IQ7A 2G29A 3C33A 3O6IA 5BWJA 1LBBA 5I2KB 2IEEA 3QYTA 4R6KA 4YKPA 3UIFA 4QSCA 1NMUA 3H6WA 1B4ZA 4X9TA 3JYRA 4YAHX 2RC9A 2H98A 1WDNA 4R9GA 4AB5A 4FORA 1IITA 4LUBA 4F19A 4ECFA 3DP6A 2QS4A 1RYOA 2ONRA 3TELA 1LAFE 4GWOA 4RPNA 3H06B 1TFDA 3KJTA 4P11A 2D5WA 4HCYA 5DEXB 3V8XB 3FVGA 1USYE 4H1XA 1B0LA 3TZAA 2XX7A 2QS2A 1FTOA 2XXUA 3G3FA 1SDXA 3MUQA 2PYYA 4OTEA 3TCGA 4RPOA 2XXRA 2H4IA 5FHNA 4HS7A 2ZNTA 3PUYE 3W9VA 1MY1A 4NE4A 1VR5A 4GIZA 3IB0A 3FVOA 3WAEA 1PC3A 1MM7A 4TLLB 3B6QA 4NWDA 2I3WA 2P0SA 1NFTA 1S9TA 2XHDA 3OXNA 1JEVA 3FGSA 4EQBA 2AIXA 3CFLA 5DVFA 4RJZA 2Z8FA 4Z0IA 4MLQA 3TTRA 4U22A 1Z7ME 4LVQA 3KSJA 3QSLA 4X48A 1NKXA 1ZTYA 1B6HA 4BLAA 1IXHA 1FQFA 1QUJA 3H7MA 4NTLA 4KPTA 1YAEA 1N04A 1ELJA 4FAJA 5JTYA 3MW0A 3RLFE 3K01A 1SYHA 3TCFA 3FATA 3ODBA 1IXIA 3KGCA 4OEVA 4BDNA 3MVXA 3MPLA 1OIBA 3M3KA 4KYEA 1I6BA 4G8NA 1IXCA 1UIUA 3CSBA 3U8QA 3ECRA 3I6VA 4YKJA 3F11A 2B65A 5A5XA 5IAIA 2D21A 2DOJA 3H6TA 3IAZA 4WEDA 5I59B 1NL5A 3UP9A 4KR5A 2DE2A 4DXUA 2F5XA 1ZJLA 4RYAA 1HSLA 4OVJA 5AA2D 2V3TA 3N94A 3RY3A 1OQHA 1SQYA 1P99A 3AXFA 3O29A 3OO8A 4WEPA 1NH7A 3TTNA 3EF7A 1JETA 1ZIUA 4U1ZA 3SDFA 4XTCQ 5A5XB 3FXRA 4H5GA 3C4MA 4NF6A 3RGYA 3Q29A 4F2QA 1MH4A 5EHMA 3TDJA 1MQHA 4DXCA 3G3GA 3E9XA 1A54A 1AH5A 5B70A 1MY0A 4I9DA 1ZU0A 3LUYA 5F7VA 5I58A 3SKPA 3A09A 2RF1A 5I2NA 3GZGA 1H3DA 4LATA 4DZ1A 1QUIA 2PBWA 3FJMA 1Q1KA 2WKYA 4IB2A 3KZGA 4QSEA 3TUSA 1H45A 2I4CA 4H8JA 2DWIA 4NF6B 3GLBA 4ZEBA 3PMWA 2A5SA 4EXLA 4PP0A 1US5A 3G3IA 2XX9A 2F34A 5I58B 2VD2A 1LFHA 4M1VA 5I2NB 2F8DA 4YMBA 4JWYA 3IOUA 3M8UA 2AL5A 3T96B 3LSFB 5FTIA 3R7XA 4QFOA 3MBPA 4E0WA 2RINA 3IX1A 3H4ZA 4RA1A 1LB9A 1TXFA 2I0CA 4QRZA 4G68A 1B0HA 3IOVA 2UYEA 4POWA 3V89B 2ZXTA 2VHAA 3IL1B 1DPPA 4ELQA 1MQDA 3K6VA 3BKIB 4F1UA 1MPCA 2HZLA 3I3VA 3RNNA 1B46A 3TCHA 1FW0A 3LR1A 4IO5A 3BFTA 3PUXE 4YU0A 3MZ1A 3ZKKA 4R6HA 3R26A 3OELA 3USDA 3TEPA 2F6GA 4DDDA 4G68B 5AA4A 3OOAA 2REJA 2O6AA 4N13A 5ICQA 4R2FA 1UQWA 4ZE9A 2ZYNA 3ILUB 4IY6A 3QK6A 3PD9A 4LZ5A 1FCKA 4JWOA 5ITPA 5I56A 3OEKA 4P0GA 5B7DA 1DMBA 2NUVA 3KBRA 1FTLA 3C32A 3KOSA 3PMVA 2DVCA 4THIA 2AYSA 3IO6A 2R9JA 1MG1A 3TQWA 5AA4B 2O1MA 3PPRA 4KCCA 5CM6A 1B3GA 3A3UA 3CR9A 2QMWA 1N3XA 3UGWA 3IORA 1B3FA 1B05A 4ZDMA 4F31B 3MVZA 3N5LA 5I56B 2F7BA 4XIGQ 2GHBA 4H67A 2ZYKA 4GLIA 4U4SA 3KEIA 5HPQA 3G3KA 4KYSA 3OO6A 1FTJA 1PB8A 5L9OA 3FVKA 3PGFA 3ZS6A 2XXXA 3FASA 3FXUA 4EQ9A 1H44A 1OQGA 4R9FA 3CFXA 1B9JA 2F36A 1BP5A 4OMBA 3FJGA 3QAXA 1NNKA 4IGTA 1EZ9A 3OD7A 4DIGA 5H8QB 2UXAA 3KN8A 1N84A 1MS7A 1IXGA 5KCJA 4QHQA 3CFZA 5BUUA 3FUZA 1VE4A 3IK6B 1JEUA 2V84A 3VXCA 3M3LA 3JZJA 4QSDA 4H8IA 5DVJA 4GVOA 3R6UA 3C9HA 2P2AA 4OQOA 1YCJA 3Q28A 2PT1A 1IZ1A 2OLBA 3C31A 3QIMA 3VDFA 4ELPA 3SERA 1P1QA 5JEIA 5KCJB 1M5FA 3JV9A 1ANFA 4MBPA 1B3LA 1D9VA 2BJJX 2QMXA 1SW1A 4LA9A 1P1UA 1N3WA 2H99A 4G68C 5IKBA 1MDQA 5CMBA 4ESXA 1ZBMA 3FIRA 4HTGA 1NNPA 3MWBA 1MXUA 2ZNSA 4E0XA 4FJPA 4N6PA 1Y9UA 1ATGA 5I84A 1GGGA 1AOVA 3H6UA 1O7TA 1MH3A 4O3AA 2DSFA 4IO6A 4IO7A 1XVYA 2H9BA 5ITOA 4H5FA 3O9PA 5ISUA 2VP1A 3E3KA 5FHOA 1JVXA 4ZEKA 3RTWB 1POTA 3LBSA 1MQJA 3PPPA 5TP9A 4TOZA 1JNFA 3PUWE 2OJTA 4AB6A 1XVXA 2QL3A 2B3BA 2B3FA 2ABHA 3TTMA 4PFYA 3TPAA 3K2DA 2QSXA 5CRYA 1PDAA 4RNSA 4Z7EA 1T0KA 3VVFA 3DP4A 3CG1A 4EF2A 3KSXA 1DSNA 3U92A 4POXA 4ZE8A 3IJOB 4JB7A 3B6WA 5TP9B 4KI0E 2YPNA 2KLFA 4NEDA 3MP1A 4R6YA 4I8CA 1LSTA 2Y7IA 5ELVA 1MXZA 1DTZA 1B5IA 5JTYB 5DVIA 3B6TA 1USYH 4UA8A 1BLFA 1DTGA 1EH3A 2QS3A 1YTVA 5DT6A 1QW0A 2Z8EA 3T93B 1Q35A 1VFDA 3OENA 4U4XA 5CI5A 1A8FA 1GR2A 1JW1A 4FATA 2P1SA 4KCDA 3S9NC 2H25A 2FYIA 3W15C 1A40A 2QPQA 5CMMA 2XXHA 3CVGA 3K4UA 4Q0CA 3P7IA 2XXWA 5AE4A 3QXMA 1B5HA 3DM0A 4RK9A 5TPAA 3IOTA 3QUJA 4H0WA 1MY3A 2THIA 1O63A 3V5AA 4F18A 2NWJA 4EDPA 5HM4B 1NNFA 2XX8A 2PX1A 4QFPA 3PD8A 3T22A 4M4GA 4OERA 2RC8A 1Y4CA 2YLNA 4KD5A 2HAVA 1WVJA 1QULA 3VLWA 3O6GA 2YJPA 3CI8A 4MH5A 1R6ZA 2F7AA 3EN3A 2ZYOA 4QF9A 1RYXA 3N6UA 3RT8A 3MP8A 3TYHA 1PEBA 1XT8A 3LC8A 5K2XA 5TPAB 1I69A 2HFBA 3E13X 3PU5A 2O68A 4R73A 4C1TA 1XOCA 3RT6B 4GOTA 2F35A 2DXYA 5AA1A 4OZ9A 1SYIA 3G7WA 2X26A 2XXYA 1MXWA 1PBQA 5TU0A 2VOZA 4RY1A 1DOTA 1HSEA 3MZ9A 2UYFA 4JSOA 3THIA 2Y7KA 3OMBA 4L17A 5AA2A 3G3HA 4GRKA 3ZKLA 2D3IA 3IR1A 1JVYA 2Y7PA 2F78A 3K6XA 1MPBA 3RTFB 1AMFA 2HQ0A 4IGRA 1M5EA 4BDQA 2I48A 3K1MA 4G4PA 4U2RA 2CMOA 3BBRA 1A99A 5L8DA 1QVSA 3LSXA 4XKQA 4QFNA 3VE1B 1PB9A 4QFKA 4ONYA 4NMYA 1MY2A 3C34A 4NF4A 3FD3A 5AA2B 4OWDA 2FNCA 3H03A 3T66A 4KQPA 1B7HA 2Q2AA 2ANJA 1US4A 4DLDA 1Y3NA 3MJNA 4G8MA 4U21A 4ZZAA 3BFUA 3GBBA 4TQUQ 1QJMA 4EQ7A 1CE2A 3T9HB 1B2HA 3S9EA 1SBPA 3CIJA 4Q5TA 1UTHA 4NF8A 2R71A 1DPEA 4IO3A 1PBPA 5CBSA 3Q25A 1Y3PA 1M5CA 3HSTA 1FTKA 4NF4B 4LZ8A 3C35A 4F3GA 3GBAA 3C36A 4ELOA 4XKRA 4LZ7A 1L5TA 1FQBA 2I4BA 4PETA 1B5JA 3FVNA 3VLVA 3S9MC 2Q9TA 2DXRA 3VFJA 4F3PA 2HZKA 3Q27A 4TLMB 5J1DA 1II5A 4AQ4A 1B4HA 2Z23A 2OWTA 2Q89A 1R9LA 4R72A 2O84X 1R1NA 1BKAA 3SEUA 1OMPA 1B3HA 2OCUA 1UTHB 2XXTA 4NF8B 1LAXA 1N76A 4YMAA 5CMKA 1Y4TA 2XD2A 5KDTA 2XD3A 1D3KA 3KJ7A 2DWHA 4OHNA 4X1DA 1SW2A 3RPWA 2HCAA 4F1VA 4GD5A 2VD3A 4IO2A 3V83A 4FEDA 3MAMA 4G77A 3SEYA 3K00A 1FQDA 3EPEA 3LSLA 3HN0A 3MPKA 2ESNA 5H8FA 1B32A 2M8CA 1EZOA 3KN7A 4FIMA 2F97A 5KDTB 2VGQA 2ZMBA 2O69A 3IJXB 4JSDA 2OK2A 3PUZE 4JBZA 4KHZE 2I3VA 1LCFA 3T9UA 5EHSA 2NXOA 2Y84A 4YICA 1ZMGA 2XXPA 2DP8A 3PPOA 4GXSB 4OESA 3FXQA 1D9YA 4OYVA 1UIVA 4I1DA 3CRBA 3MVYA 5H8FB 1QKBA 4PQJA 4F2OA 1LCTA 2Z8DA 3ILTB 1OLCA 2V3UA 3H6VA 4ZEDA 2O7UA 1CB6A 2DE3A 3M3FA 1Y20A 4MLVA 4MFIA 1P1OA 3EHUA 2UVJA 5LOMA 4RK2A 3D4GA 1B1XA 2I49A 2DS9A 4OEUA 2RKMA 4NWCA 4HCWA 2O51A 4C1UA 5FHMA 3IO4A 2HXWA 3UK4A 1URSA 3I5OA 1OVTA 1ZKBA 3TQLA 3S9LC 3QUFA 3OO9A 2PVUA 4FE8A 4C0RA 4OENA 5H8SA 3TKDA 1SI0A 3CG3A 2V25A 5L9MA 2GH9A 5DYHA 2UVIA 4Q30B 1A7LA 1P1WA 3RN8A 3PUVE 3IB1A 2DWJA 2RCAA 4OFOA 4LP2B 1OLAA 4GF8A 2H5YA 2LAOA 1MDP1 4MF3A 2HAUA 4ESWA 4ZEIA 1D4NA 1MY4A 1I6AA 3OEMA 1B51A 2ONSA 3KOTA 1LFGA 1Y1ZA 3K1PA 3N6TA 3S2VA 4DE8A 5FTHA 1FQCA 3RQTA 1O64A 2FA7A 1TFAA 2Y7WA 4YKKA 3SEWA 1EZPA 3IOWA 3VVEA 2X7QA 1MXXA 3A3CA 4PFUA 5F1QA 4XKPA 1BIYA 4ZZEA 2F7CA 5I59A 4O3BA 4EF1A 2UVHA
chains in the Genus database with same CATH superfamily
4PFWA 4EUOA 3VV5A 4MCOA 3HCQA 3SETA 1H76A 1PB7A 5ICTA 1S7YA 4WKMA 3ZSFA 3KN3A 1WODA 3GXAA 3U72A 4PFTA 4HW8A 1YPNA 1DCUA 5L9SA 1UTBA 3L6HA 2UVGA 5K2YA 4HE0A 4PTKA 4ZS9A 2QJEA 4GX3A 3HV1A 1JW4A 2OWSA 4GXAA 2W7YA 1XHYA 4R75A 2B4MA 2Q88A 1MXYA 3PPNA 1NH8A 3K6WA 2XXQA 1LAHE 4QFLA 2NVUB 3TTLA 4G2ZA 1LBVA 1XS5A 2ZZWA 4OETA 4KFQA 5H8NA 4NHBA 1LB8A 4N91A 3U94A 4X04A 3TTKA 3MP6A 1GV8A 3UA8A 4YB5A 1J1NA 1LGBC 3UN6A 1QKAA 2X7PA 2QFLA 4MNIA 1UTBB 3SEVA 4BDMA 4YB6A 2AL4A 3EQ1A 2O1LA 4U23A 5EQAA 3U65A 2OZZA 5CMCA 4PAKA 4N4UA 3K1NA 1SW5A 2Y7RA 1FBDA 1URGA 1FQAA 4MNCA 2Y5LA 3K02A 3O66A 3TMGA 4LQ5A 4LONB 3TAJA 1RKMA 3HHFA 4H46A 4MMPA 1MQIA 3CSGA 5H8NB 3O2AA 2O7IA 1A55A 4PBQA 3W9WA 1M5DA 1JQFA 2XXKA 3O6HA 2ONKE 3L6GA 1B58A 4F3BA 1B1HA 3PMXA 5I7IA 2F6PA 3DP8A 2DWAA 3K0VA 5HBCA 2GHAA 2A5TA 3S4UA 3H3GA 4MAGA 4FEBA 5ET8A 4LQ2A 4N81A 4QBAA 2PMSA 1AIVA 3PPQA 2QS1A 2QRYA 2DE4A 1I6QA 3HPIA 5H8HA 4GL0A 1IMDA 1QGXA 1YZ0A 5EQ7A 1LAGE 3G3JA 4GWUA 1M5BA 5IGAA 1JP4A 3LSWA 3ONMA 1LBCA 4ELRA 4GL8A 2E1SA 4GFRA 1FPJA 1Y1MA 4Q8RA 1P1NA 1KZ8A 4HXVA 4ISUA 3T9XB 2A5TB 5M2VA 1MRPA 2RCBA 4ND9A 1B3EA 3TODA 3Q26A 2GRVA 2NOOA 1FQEA 4OXVA 2DVZA 4IO4A 3EHSA 4G8HA 1JW5A 4F39A 3FJ7A 3MVWA 5H8HB 4MHFA 1Y3QA 2ZYMA 4DCYA 4YKIA 3MQ9A 4P0IA 4KXPA 4F29A 1SD3A 4NAPA 2OWZA 1LFIA 4I62A 4YZZA 3VXBA 2I6EA 2CZLA 3D4CA 2KR0A 4GQOA 4IR8A 3IB2A 3DELB 3WAFA 3B7DA 4OFJA 5LDZA 1SI1A 4IY5A 4WXJA 3U93A 4YB7A 1FBFA 2QVRA 1NNTA 1POY1 4FECA 1N7WA 3O97A 1FPBA 1N7XA 2VPNA 5EYFA 2R6GE 1XC1A 4ZECA 3HO7A 3KC0A 4BDOA 2OBGA 1KWHA 4DCXA 1FSAA 1NV0A 4BDLA 3U1OA 5I57A 1A8EA 1BTJA 1EU8A 1N0TA 3MC2A 4PAFA 1KA1A 4KYDA 2DQVA 1QUKA 1Z7NE 2RC7A 3DLNA 3EHTA 4JWXA 1IEJA 1VFEA 4H6DA 4DXBA 1S50A 3KFMA 1TT1A 1IIWA 2XXIA 3KG2A 1IUDA 4RXLA 2I58A 3RUMA 4XKNA 1MQGA 3SEXA 2PT2A 1B7UA 2Q8JA 3FZVA 2GFEA 1SW4A 3MZBA 1LBXA 4EXKA 4H65A 1MPDA 2ZZXA 5I57B 4X1BA 1GVCA 4MEVA 2E0SA 2DDKA 4NF5A 2HHMA 1MM6A 2G93A 4PC9A 4ZEFA 4O3CA 3VLUA 2IA4A 1NV1A 2DYXA 4PFBA 4N07A 2V3QA 3K6UA 3N26A 1HSJA 1MXVA 2I0BA 2Y5KA 4U1OA 2ALUA 3T9VA 5CBRA 2REGA 1OVBA 4F3SA 5H8QA 4PE5B 3RYDA 1F9BA 1AL3A 2V93A 4K3FA 1B7ZA 2HEUA 3IFAA 3OO7A 3SESA 1H43A 2Z22A 1SVXB 5KZTA 3O28A 1G0IA 5I2KA 1ZLQA 4NF5B 1LLSA 2Q2CA 5JK4A 1FTMA 3E4RA 4N15A 3FV1A 3VVDA 1B40A 4NN3A 4UACA 3KBZA 3UORA 5ET6A 3OSRA 1URDA 4JXIA 4R74A 1B52A 5DTBA 5CC2A 5A5LA 2XXVA 3TFLA 1R9QA 1VSOA 4XXUA 4OFLA 5AA3A 2ZNUA 3FV2A 3HHGA 5DEXA 1GTKA 4F1YA 5EQ9A 3OSQA 1TWYA 4JDFA 3PV0E 4R2BA 4BDRA 4F22A 1IQ7A 1FPEA 2G29A 3C33A 3O6IA 5BWJA 1LBBA 5I2KB 4N6DA 2IEEA 4R6KA 3QYTA 1LBWA 4YKPA 3UIFA 4QSCA 1NMUA 3H6WA 1B4ZA 4X9TA 3JYRA 4YAHX 2RC9A 1FPKA 2H98A 1WDNA 4R9GA 4AB5A 4FORA 1IITA 4LUBA 4F19A 4ECFA 3DP6A 2QS4A 1RYOA 4DI4B 2ONRA 3TELA 1LAFE 4GWOA 4RPNA 3H06B 1TFDA 3KJTA 4P11A 5EQ8A 2D5WA 4HCYA 5DEXB 3V8XB 3FVGA 5FBPA 1USYE 4H1XA 1B0LA 3ROJA 3TZAA 1FJ9A 2XX7A 2QS2A 4GBWA 1FTOA 3EKIA 2XXUA 3G3FA 1SDXA 3MUQA 2PYYA 4OTEA 3TCGA 4RPOA 2XXRA 2H4IA 5FHNA 4OA4A 4HS7A 2ZNTA 3PUYE 3W9VA 2OX3A 1MY1A 4NE4A 1YYZA 1VR5A 4GIZA 3IB0A 3FVOA 1PC3A 3WAEA 1MM7A 4TLLB 1IMAA 3B6QA 4NWDA 2I3WA 3T1BA 2P0SA 1NFTA 2QVUA 1LBZA 1S9TA 2XHDA 3OXNA 1JEVA 4PBHA 2P3VA 4N6KA 3FGSA 4EQBA 2AIXA 1NUWA 3CFLA 5DVFA 4RJZA 2Z8FA 4Z0IA 4MLQA 3TTRA 4U22A 1Z7ME 4LVQA 3KSJA 3QSLA 4X48A 1NKXA 1ZTYA 4NX1A 1B6HA 4BLAA 3B8BA 1IXHA 1FQFA 1QUJA 3H7MA 4NTLA 4KPTA 1YAEA 1N04A 1ELJA 4FAJA 5JTYA 4OVQA 3MW0A 3RLFE 3K01A 1SYHA 3TCFA 3FATA 3ODBA 1IXIA 3KGCA 1D9QA 4OEVA 4BDNA 3MVXA 3MPLA 4PFIA 1OIBA 3M3KA 1FPDA 4KYEA 4I3EA 4PGPA 1I6BA 4G8NA 1FPFA 1IXCA 1UIUA 3CSBA 3U8QA 3D1RA 3ECRA 3I6VA 1EYJA 1SPIA 4HE2A 4YKJA 3F11A 5IZZA 2B65A 4NQ8A 5A5XA 2D21A 5IAIA 2DOJA 3H6TA 3IAZA 4WEDA 5I59B 1NL5A 3UP9A 4KR5A 2DE2A 4DXUA 2FIEA 2F5XA 1ZJLA 4RYAA 1HSLA 4OVJA 1NI9A 1K9ZA 2V4CA 5AA2D 2V3TA 3N94A 3RY3A 1OQHA 2FIXA 1SQYA 2R8TA 1P99A 2ZZVA 3AXFA 3O29A 3OO8A 4WEPA 1NH7A 3TTNA 3EF7A 1JETA 1ZIUA 4U1ZA 5T3JA 3SDFA 2FVZA 4XTCQ 5A5XB 3FXRA 4H5GA 3C4MA 4XFEA 4NF6A 3RGYA 3Q29A 4F2QA 1MH4A 5EHMA 3TDJA 1MQHA 4PFRA 4DXCA 3G3GA 3E9XA 1A54A 1AH5A 5B70A 1MY0A 4I9DA 1ZU0A 3LUYA 5F7VA 5I58A 3SKPA 3A09A 2RF1A 5I2NA 1FRPA 3GZGA 4JVCA 1H3DA 4LATA 3FBPA 3B50A 4DZ1A 3KC1A 1QUIA 1KA0A 1NV7A 2PBWA 3FJMA 1Q1KA 2WKYA 4IB2A 4GX4A 3KZGA 4QSEA 3TUSA 4MNPA 1H45A 2I4CA 4H8JA 2DWIA 4NF6B 3GLBA 2XA5A 4ZEBA 3PMWA 2A5SA 4EXLA 4PP0A 1US5A 3G3IA 2XX9A 2F34A 5I58B 2VD2A 1IMCA 1LFHA 4M1VA 5I2NB 4N8GA 4GWWA 2MKZA 2F8DA 4YMBA 4NF0A 4JWYA 3IOUA 4MJOA 3M8UA 2AL5A 3T96B 3LSFB 5FTIA 3R7XA 4QFOA 3MBPA 4E0WA 2RINA 3IX1A 3H4ZA 4RA1A 4OVSA 1LB9A 1TXFA 2I0CA 4QRZA 4G68A 1B0HA 3IOVA 2UYEA 4POWA 4GWZA 3V89B 4PAIA 2ZXTA 2Q74A 3ISPA 2VHAA 3IL1B 1DPPA 4ELQA 1MQDA 3K6VA 3BKIB 4F1UA 1MPCA 2HZLA 3I3VA 3RNNA 1B46A 5EYGA 3TCHA 1FW0A 3LR1A 3LV0A 3BFTA 3PUXE 4IO5A 4YU0A 3MZ1A 3ZKKA 5DW8A 4R6HA 3R26A 3OELA 3USDA 3TEPA 2F6GA 4DDDA 4G68B 5AA4A 3OOAA 2REJA 2O6AA 4N13A 2WYPA 5ICQA 4R2FA 1UQWA 5F24A 4ZE9A 2ZYNA 3ILUB 4IY6A 3QK6A 3PD9A 2XWOA 4LZ5A 1FCKA 4JWOA 2WBBA 5ITPA 5I56A 3OEKA 4P0GA 5B7DA 1DMBA 2NUVA 1NV4A 3KBRA 1FTLA 3C32A 2XWKA 3KOSA 3PMVA 2DVCA 4THIA 2AYSA 3IO6A 2R9JA 1MG1A 3TQWA 5AA4B 2O1MA 3PPRA 4KCCA 5CM6A 1B3GA 3A3UA 3CR9A 2QMWA 1N3XA 3UGWA 3IORA 2P3NA 1B3FA 1B05A 4ZDMA 4F31B 3MVZA 3N5LA 5I56B 2F7BA 2FBPA 4XIGQ 4G61A 2BJIA 2GHBA 4H67A 1FBPA 2ZYKA 4GLIA 4I40A 4U4SA 5I5PA 3KEIA 2VT5A 5HPQA 3G3KA 4KYSA 3OO6A 1FTJA 1PB8A 5L9OA 3FVKA 4PDHA 3PGFA 3ZS6A 2XXXA 1RDYA 3FASA 3FXUA 1EYKA 4EQ9A 1FBHA 1H44A 1OQGA 4R9FA 3CFXA 1B9JA 2F36A 4O7IA 1BP5A 4OMBA 4LN5A 3FJGA 3QAXA 1NNKA 4IGTA 1EZ9A 3OD7A 4XF5A 5ESYA 4OVRA 4X8RA 4DIGA 5H8QB 2UXAA 4P1EA 3KN8A 1N84A 1MS7A 1IXGA 5KCJA 4QHQA 3CFZA 5BUUA 3FUZA 1VE4A 3IK6B 1JEUA 2V84A 3VXCA 3M3LA 3JZJA 4QSDA 4H8IA 4UABA 5DVJA 4GVOA 3R6UA 3C9HA 2P2AA 4OQOA 1YCJA 3Q28A 2PT1A 1INPA 1IZ1A 1VDWA 2OLBA 1DBZA 3C31A 3QIMA 3VDFA 4ELPA 3SERA 1P1QA 5JEIA 1BK4A 5KCJB 2VPOA 1M5FA 3JV9A 1ANFA 4MBPA 1B3LA 1D9VA 2BJJX 2QMXA 2B4LA 4OVPA 5IM2A 1SW1A 2PCRA 4LA9A 1IMFA 1P1UA 1N3WA 2H99A 4G68C 5IKBA 1MDQA 5CMBA 4ESXA 1ZBMA 3FIRA 4HTGA 3MYUA 1NNPA 2CZKA 3MWBA 1MXUA 2ZNSA 4E0XA 2Q8MA 2WYKA 4FJPA 4N6PA 1Y9UA 1ATGA 5I84A 1GGGA 1AOVA 3H6UA 1O7TA 1MH3A 2PFYA 4O3AA 2DSFA 4IO6A 4IO7A 1XVYA 2H9BA 5ITOA 4I3YA 4H5FA 3O9PA 1FPLA 5ISUA 2VP1A 3E3KA 5FHOA 1JVXA 4ZEKA 3RTWB 1POTA 4P3LA 3LBSA 1MQJA 3PPPA 1LBYA 5TP9A 4N8YA 4TOZA 1JNFA 3PUWE 2OJTA 4AB6A 1XVXA 4XEQA 2QL3A 2B3BA 3HFUA 2B3FA 3QMFA 2ABHA 3TTMA 4PFYA 3TPAA 3K2DA 2QSXA 5CRYA 1PDAA 4RNSA 4Z7EA 1T0KA 3VVFA 3DP4A 3CG1A 4EF2A 3KSXA 4P8BA 1DSNA 3U92A 1LEVA 4POXA 4FBPA 4ZE8A 3IJOB 4JB7A 3B6WA 5TP9B 4KI0E 2YPNA 2KLFA 4PF6A 4NEDA 3MP1A 4R6YA 4I8CA 1LSTA 2HPGA 2Y7IA 1NUXA 2JJKA 5ELVA 1MXZA 1DTZA 1B5IA 5JTYB 5DVIA 3B6TA 1USYH 3A29A 3CHGA 4UA8A 1BLFA 1DTGA 1EH3A 2QS3A 1YTVA 5DT6A 1QW0A 2Z8EA 3T93B 1IMEA 1Q35A 1VFDA 1IMBA 3OENA 4U4XA 5CI5A 2KQZA 1A8FA 1GR2A 1JW1A 4FATA 2P1SA 4KCDA 3S9NC 2PFZA 1YXIA 2H25A 2FYIA 3W15C 1A40A 2QPQA 5CMMA 2XXHA 3CVGA 4PGNA 3K4UA 4Q0CA 3P7IA 3IFCA 2XXWA 5AE4A 3QXMA 5IZ1A 1Q9DA 1B5HA 2WEFA 3DM0A 4RK9A 5TPAA 3IOTA 3QUJA 4H0WA 1MY3A 2THIA 1O63A 3V5AA 4F18A 2NWJA 4EDPA 3SZPA 4GWSA 5HM4B 1NNFA 2XX8A 2PX1A 4QFPA 3PD8A 3T22A 4M4GA 1FTAA 4OERA 1NV5A 2RC8A 4QXDA 1Y4CA 2YLNA 4KD5A 2HAVA 1WVJA 4P56A 1QULA 3VLWA 5IZ3A 3O6GA 4N17A 2CZHA 2YJPA 3BIGA 3CI8A 4MH5A 1R6ZA 2F7AA 3EN3A 4GWYA 2ZYOA 4QF9A 1RYXA 3N6UA 3RT8A 3MP8A 4PE3A 3TYHA 1PEBA 1XT8A 3LC8A 5K2XA 5TPAB 1I69A 4AS5A 4O7MA 2HFBA 3E13X 3PU5A 2O68A 4R73A 4C1TA 1XOCA 3RT6B 4GOTA 2F35A 2DXYA 5AA1A 4OZ9A 3LUZA 1SYIA 3G7WA 2X26A 4HE1A 2XXYA 1NV3A 1FBCA 1MXWA 1PBQA 2WBDA 5TU0A 2VOZA 5IZ3B 5ET7A 4RY1A 1DOTA 1HSEA 3MZ9A 2UYFA 4JSOA 3THIA 2Y7KA 3OMBA 4L17A 5AA2A 3G3HA 4GRKA 3ZKLA 2D3IA 2L5VA 3IR1A 1JVYA 2Y7PA 2F78A 2F3DA 3K6XA 1FPIA 1MPBA 3RTFB 1AMFA 2HQ0A 4IGRA 1XI6A 1M5EA 4BDQA 2I48A 3K1MA 4G4PA 5J16A 4U2RA 2CMOA 2F3BA 3BBRA 1A99A 5L8DA 1QVSA 2CEYA 3LSXA 2CZIA 3PTYA 4XKQA 4QFNA 4OANA 3VE1B 1PB9A 4QFKA 4ONYA 4NMYA 1MY2A 3C34A 4NF4A 3FD3A 5AA2B 4OWDA 2FNCA 3H03A 3T66A 4KQPA 1B7HA 2Q2AA 2ANJA 1US4A 1Y3NA 3MJNA 4DLDA 1CNQA 4G8MA 4U21A 4ZZAA 3BFUA 3GBBA 4TQUQ 3NOHA 1QJMA 4EQ7A 1CE2A 3T9HB 1B2HA 3S9EA 1NV2A 1SBPA 4NGUA 3CIJA 3E78A 4Q5TA 1UTHA 4NF8A 2R71A 4OVTA 1DPEA 4IO3A 1PBPA 5CBSA 3Q25A 1Y3PA 1M5CA 3HSTA 3FXBA 1FTKA 4NF4B 4LZ8A 3C35A 4F3GA 3GBAA 3C36A 4ELOA 4XKRA 4LZ7A 1L5TA 1FQBA 2I4BA 4PETA 1B5JA 4PF8A 3FVNA 2CEXA 3VLVA 3S9MC 2Q9TA 2DXRA 3VFJA 4F3PA 2HZKA 3Q27A 4TLMB 5J1DA 2QVVA 1II5A 3GYYA 2XWIA 4AQ4A 1B4HA 2Z23A 2OWTA 2Q89A 1R9LA 4R72A 2O84X 1R1NA 1BKAA 3SEUA 1OMPA 1B3HA 2OCUA 1UTHB 2XXTA 4NF8B 1LAXA 3MSTA 1N76A 4YMAA 4JVIA 5CMKA 1Y4TA 2XD2A 1NUYA 5KDTA 2XD3A 1D3KA 3KJ7A 2DWHA 4OHNA 4X1DA 1SW2A 3RPWA 2HCAA 4F1VA 4O94A 4GD5A 2VD3A 4IO2A 3V83A 4FEDA 1NUZA 3MAMA 4G77A 3SEYA 3K00A 1FQDA 3EPEA 3LSLA 3HN0A 3MPKA 4GWXA 2ESNA 5H8FA 1B32A 2M8CA 1EZOA 3KN7A 3RPLA 4FIMA 2F97A 5EYHA 3BIHA 5KDTB 2VGQA 2ZMBA 2O69A 3IJXB 4JSDA 2OK2A 3PUZE 4JBZA 4KHZE 2I3VA 1LCFA 3T9UA 5EHSA 2NXOA 2Y84A 4GX6A 4YICA 1ZMGA 2XXPA 2DP8A 3PPOA 4GXSB 4OESA 4DI3D 3FXQA 1D9YA 4PCDA 1EYIA 4OYVA 1UIVA 4I1DA 3CRBA 3MVYA 1RDZA 5H8FB 1QKBA 4PQJA 4F2OA 1LCTA 3RPLB 2Z8DA 3ILTB 1FJ6A 1OLCA 2V3UA 3H6VA 4H45A 4ZEDA 2O7UA 4O8MA 1CB6A 2DE3A 1DK4A 3M3FA 1Y20A 4MLVA 4MFIA 3T0JA 1P1OA 4JVDA 3EHUA 2UVJA 5LOMA 4RK2A 4MIJA 3D4GA 1B1XA 2I49A 2DS9A 4OEUA 2RKMA 4NWCA 4HCWA 2O51A 4C1UA 2GQ1A 5FHMA 1FBEA 3IO4A 2HXWA 3UK4A 1URSA 3I5OA 1OVTA 1ZKBA 3TQLA 2HXRA 3S9LC 3QUFA 5ET5A 4P9KA 4PDDA 3OO9A 2PVUA 4FE8A 4C0RA 4OENA 5H8SA 2WX9A 3TKDA 1SI0A 3CG3A 2V25A 5LTCA 5L9MA 4NG7A 2GH9A 1FPGA 5DYHA 2UVIA 4Q30B 1A7LA 1P1WA 3RN8A 3PUVE 3IB1A 2DWJA 2RCAA 4OFOA 4LP2B 1OLAA 4GF8A 2FHYA 2H5YA 2LAOA 1MDP1 1NV6A 1RDXA 2XWVA 4MF3A 2HAUA 4ESWA 4GBVA 4ZEIA 1D4NA 1MY4A 1I6AA 3OEMA 4P1LA 1B51A 2ONSA 3KOTA 1LFGA 3E79A 1Y1ZA 3K1PA 3N6TA 3S2VA 4DE8A 5FTHA 1FQCA 3RQTA 1O64A 2FA7A 4AS4A 1TFAA 2Y7WA 4YKKA 3SEWA 1K9YA 1EZPA 5I3SA 3IOWA 4P47A 3VVEA 1G0HA 1FBGA 2X7QA 4MX6A 1MXXA 3A3CA 4PFUA 5F1QA 4XKPA 1BIYA 4ZZEA 2F7CA 5I59A 1AWBA 4O3BA 4EF1A 2UVHA
chains in the Genus database with same CATH topology
4PFWA 4EUOA 3VV5A 3HCQA 3SETA 1H76A 1PB7A 5ICTA 1S7YA 4WKMA 3ZSFA 3KN3A 1WODA 3GXAA 3U72A 4PFTA 4HW8A 1YPNA 5L9SA 1UTBA 3L6HA 2UVGA 5K2YA 4ZS9A 2QJEA 3HV1A 1JW4A 2OWSA 4GXAA 2W7YA 1XHYA 4R75A 2Q88A 1MXYA 3PPNA 1NH8A 3K6WA 2XXQA 1LAHE 4QFLA 2NVUB 3TTLA 4G2ZA 1XS5A 4OETA 4KFQA 5H8NA 1LB8A 3U94A 3TTKA 3MP6A 1GV8A 3UA8A 4YB5A 1J1NA 1LGBC 3UN6A 1QKAA 2X7PA 1UTBB 3SEVA 4BDMA 4YB6A 2AL4A 3EQ1A 2O1LA 4U23A 2OZZA 5CMCA 3K1NA 1SW5A 2Y7RA 1URGA 1FQAA 3K02A 3O66A 3TMGA 4LQ5A 4LONB 3TAJA 1RKMA 3HHFA 1MQIA 3CSGA 5H8NB 3O2AA 2O7IA 1A55A 3W9WA 1M5DA 1JQFA 3O6HA 2ONKE 3L6GA 1B58A 4F3BA 1B1HA 3PMXA 2F6PA 3DP8A 2DWAA 3K0VA 5HBCA 2GHAA 2A5TA 3S4UA 3H3GA 4FEBA 4LQ2A 2PMSA 1AIVA 3PPQA 2QS1A 2QRYA 2DE4A 1I6QA 3HPIA 5H8HA 4GL0A 1LAGE 3G3JA 1M5BA 3LSWA 3ONMA 1LBCA 4ELRA 4GL8A 2E1SA 4GFRA 1Y1MA 4Q8RA 1P1NA 4ISUA 3T9XB 2A5TB 5M2VA 1MRPA 2RCBA 4ND9A 1B3EA 3TODA 3Q26A 2GRVA 2NOOA 1FQEA 4OXVA 2DVZA 4IO4A 3EHSA 4G8HA 1JW5A 4F39A 3FJ7A 3MVWA 5H8HB 1Y3QA 2ZYMA 4DCYA 4YKIA 3MQ9A 4P0IA 4F29A 1SD3A 1LFIA 4I62A 4YZZA 3VXBA 2I6EA 2CZLA 3D4CA 4GQOA 3IB2A 3DELB 3WAFA 3B7DA 4OFJA 1SI1A 4IY5A 4WXJA 3U93A 4YB7A 1NNTA 1POY1 4FECA 1N7WA 3O97A 1N7XA 5EYFA 2R6GE 1XC1A 4ZECA 3HO7A 4BDOA 2OBGA 1KWHA 4DCXA 4BDLA 3U1OA 5I57A 1A8EA 1BTJA 1EU8A 1N0TA 3MC2A 4KYDA 2DQVA 1QUKA 1Z7NE 2RC7A 3DLNA 3EHTA 4JWXA 1IEJA 1VFEA 4H6DA 4DXBA 1S50A 3KFMA 1TT1A 1IIWA 2XXIA 3KG2A 1IUDA 4RXLA 2I58A 3RUMA 4XKNA 1MQGA 3SEXA 2PT2A 1B7UA 2Q8JA 3FZVA 2GFEA 1SW4A 3MZBA 4EXKA 4H65A 1MPDA 5I57B 4X1BA 1GVCA 2E0SA 4NF5A 1MM6A 2G93A 4ZEFA 4O3CA 3VLUA 2IA4A 2DYXA 4N07A 2V3QA 3K6UA 3N26A 1HSJA 1MXVA 2I0BA 4U1OA 2ALUA 3T9VA 5CBRA 2REGA 1OVBA 4F3SA 5H8QA 4PE5B 1F9BA 1AL3A 2V93A 4K3FA 1B7ZA 2HEUA 3OO7A 3SESA 1H43A 2Z22A 1SVXB 5KZTA 3O28A 5I2KA 1ZLQA 4NF5B 1LLSA 2Q2CA 5JK4A 1FTMA 3E4RA 3FV1A 3VVDA 1B40A 4UACA 3UORA 3OSRA 1URDA 4JXIA 4R74A 1B52A 5DTBA 5CC2A 2XXVA 3TFLA 1R9QA 1VSOA 4XXUA 4OFLA 5AA3A 2ZNUA 3FV2A 3HHGA 5DEXA 1GTKA 4F1YA 3OSQA 1TWYA 4JDFA 3PV0E 4R2BA 4BDRA 4F22A 1IQ7A 2G29A 3C33A 3O6IA 5BWJA 1LBBA 5I2KB 2IEEA 3QYTA 4R6KA 4YKPA 3UIFA 4QSCA 1NMUA 3H6WA 1B4ZA 4X9TA 3JYRA 4YAHX 2RC9A 2H98A 1WDNA 4R9GA 4AB5A 4FORA 1IITA 4LUBA 4F19A 4ECFA 3DP6A 2QS4A 1RYOA 2ONRA 3TELA 1LAFE 4GWOA 4RPNA 3H06B 1TFDA 3KJTA 4P11A 2D5WA 4HCYA 5DEXB 3V8XB 3FVGA 1USYE 4H1XA 1B0LA 3TZAA 2XX7A 2QS2A 1FTOA 2XXUA 3G3FA 1SDXA 3MUQA 2PYYA 4OTEA 3TCGA 4RPOA 2XXRA 2H4IA 5FHNA 4HS7A 2ZNTA 3PUYE 3W9VA 1MY1A 4NE4A 1VR5A 4GIZA 3IB0A 3FVOA 3WAEA 1PC3A 1MM7A 4TLLB 3B6QA 4NWDA 2I3WA 2P0SA 1NFTA 1S9TA 2XHDA 3OXNA 1JEVA 3FGSA 4EQBA 2AIXA 3CFLA 5DVFA 4RJZA 2Z8FA 4Z0IA 4MLQA 3TTRA 4U22A 1Z7ME 4LVQA 3KSJA 3QSLA 4X48A 1NKXA 1ZTYA 1B6HA 4BLAA 1IXHA 1FQFA 1QUJA 3H7MA 4NTLA 4KPTA 1YAEA 1N04A 1ELJA 4FAJA 5JTYA 3MW0A 3RLFE 3K01A 1SYHA 3TCFA 3FATA 3ODBA 1IXIA 3KGCA 4OEVA 4BDNA 3MVXA 3MPLA 1OIBA 3M3KA 4KYEA 1I6BA 4G8NA 1IXCA 1UIUA 3CSBA 3U8QA 3ECRA 3I6VA 4YKJA 3F11A 2B65A 5A5XA 5IAIA 2D21A 2DOJA 3H6TA 3IAZA 4WEDA 5I59B 1NL5A 3UP9A 4KR5A 2DE2A 4DXUA 2F5XA 1ZJLA 4RYAA 1HSLA 4OVJA 5AA2D 2V3TA 3N94A 3RY3A 1OQHA 1SQYA 1P99A 3AXFA 3O29A 3OO8A 4WEPA 1NH7A 3TTNA 3EF7A 1JETA 1ZIUA 4U1ZA 3SDFA 4XTCQ 5A5XB 3FXRA 4H5GA 3C4MA 4NF6A 3RGYA 3Q29A 4F2QA 1MH4A 5EHMA 3TDJA 1MQHA 4DXCA 3G3GA 3E9XA 1A54A 1AH5A 5B70A 1MY0A 4I9DA 1ZU0A 3LUYA 5F7VA 5I58A 3SKPA 3A09A 2RF1A 5I2NA 3GZGA 1H3DA 4LATA 4DZ1A 1QUIA 2PBWA 3FJMA 1Q1KA 2WKYA 4IB2A 3KZGA 4QSEA 3TUSA 1H45A 2I4CA 4H8JA 2DWIA 4NF6B 3GLBA 4ZEBA 3PMWA 2A5SA 4EXLA 4PP0A 1US5A 3G3IA 2XX9A 2F34A 5I58B 2VD2A 1LFHA 4M1VA 5I2NB 2F8DA 4YMBA 4JWYA 3IOUA 3M8UA 2AL5A 3T96B 3LSFB 5FTIA 3R7XA 4QFOA 3MBPA 4E0WA 2RINA 3IX1A 3H4ZA 4RA1A 1LB9A 1TXFA 2I0CA 4QRZA 4G68A 1B0HA 3IOVA 2UYEA 4POWA 3V89B 2ZXTA 2VHAA 3IL1B 1DPPA 4ELQA 1MQDA 3K6VA 3BKIB 4F1UA 1MPCA 2HZLA 3I3VA 3RNNA 1B46A 3TCHA 1FW0A 3LR1A 4IO5A 3BFTA 3PUXE 4YU0A 3MZ1A 3ZKKA 4R6HA 3R26A 3OELA 3USDA 3TEPA 2F6GA 4DDDA 4G68B 5AA4A 3OOAA 2REJA 2O6AA 4N13A 5ICQA 4R2FA 1UQWA 4ZE9A 2ZYNA 3ILUB 4IY6A 3QK6A 3PD9A 4LZ5A 1FCKA 4JWOA 5ITPA 5I56A 3OEKA 4P0GA 5B7DA 1DMBA 2NUVA 3KBRA 1FTLA 3C32A 3KOSA 3PMVA 2DVCA 4THIA 2AYSA 3IO6A 2R9JA 1MG1A 3TQWA 5AA4B 2O1MA 3PPRA 4KCCA 5CM6A 1B3GA 3A3UA 3CR9A 2QMWA 1N3XA 3UGWA 3IORA 1B3FA 1B05A 4ZDMA 4F31B 3MVZA 3N5LA 5I56B 2F7BA 4XIGQ 2GHBA 4H67A 2ZYKA 4GLIA 4U4SA 3KEIA 5HPQA 3G3KA 4KYSA 3OO6A 1FTJA 1PB8A 5L9OA 3FVKA 3PGFA 3ZS6A 2XXXA 3FASA 3FXUA 4EQ9A 1H44A 1OQGA 4R9FA 3CFXA 1B9JA 2F36A 1BP5A 4OMBA 3FJGA 3QAXA 1NNKA 4IGTA 1EZ9A 3OD7A 4DIGA 5H8QB 2UXAA 3KN8A 1N84A 1MS7A 1IXGA 5KCJA 4QHQA 3CFZA 5BUUA 3FUZA 1VE4A 3IK6B 1JEUA 2V84A 3VXCA 3M3LA 3JZJA 4QSDA 4H8IA 5DVJA 4GVOA 3R6UA 3C9HA 2P2AA 4OQOA 1YCJA 3Q28A 2PT1A 1IZ1A 2OLBA 3C31A 3QIMA 3VDFA 4ELPA 3SERA 1P1QA 5JEIA 5KCJB 1M5FA 3JV9A 1ANFA 4MBPA 1B3LA 1D9VA 2BJJX 2QMXA 1SW1A 4LA9A 1P1UA 1N3WA 2H99A 4G68C 5IKBA 1MDQA 5CMBA 4ESXA 1ZBMA 3FIRA 4HTGA 1NNPA 3MWBA 1MXUA 2ZNSA 4E0XA 4FJPA 4N6PA 1Y9UA 1ATGA 5I84A 1GGGA 1AOVA 3H6UA 1O7TA 1MH3A 4O3AA 2DSFA 4IO6A 4IO7A 1XVYA 2H9BA 5ITOA 4H5FA 3O9PA 5ISUA 2VP1A 3E3KA 5FHOA 1JVXA 4ZEKA 3RTWB 1POTA 3LBSA 1MQJA 3PPPA 5TP9A 4TOZA 1JNFA 3PUWE 2OJTA 4AB6A 1XVXA 2QL3A 2B3BA 2B3FA 2ABHA 3TTMA 4PFYA 3TPAA 3K2DA 2QSXA 5CRYA 1PDAA 4RNSA 4Z7EA 1T0KA 3VVFA 3DP4A 3CG1A 4EF2A 3KSXA 1DSNA 3U92A 4POXA 4ZE8A 3IJOB 4JB7A 3B6WA 5TP9B 4KI0E 2YPNA 2KLFA 4NEDA 3MP1A 4R6YA 4I8CA 1LSTA 2Y7IA 5ELVA 1MXZA 1DTZA 1B5IA 5JTYB 5DVIA 3B6TA 1USYH 4UA8A 1BLFA 1DTGA 1EH3A 2QS3A 1YTVA 5DT6A 1QW0A 2Z8EA 3T93B 1Q35A 1VFDA 3OENA 4U4XA 5CI5A 1A8FA 1GR2A 1JW1A 4FATA 2P1SA 4KCDA 3S9NC 2H25A 2FYIA 3W15C 1A40A 2QPQA 5CMMA 2XXHA 3CVGA 3K4UA 4Q0CA 3P7IA 2XXWA 5AE4A 3QXMA 1B5HA 3DM0A 4RK9A 5TPAA 3IOTA 3QUJA 4H0WA 1MY3A 2THIA 1O63A 3V5AA 4F18A 2NWJA 4EDPA 5HM4B 1NNFA 2XX8A 2PX1A 4QFPA 3PD8A 3T22A 4M4GA 4OERA 2RC8A 1Y4CA 2YLNA 4KD5A 2HAVA 1WVJA 1QULA 3VLWA 3O6GA 2YJPA 3CI8A 4MH5A 1R6ZA 2F7AA 3EN3A 2ZYOA 4QF9A 1RYXA 3N6UA 3RT8A 3MP8A 3TYHA 1PEBA 1XT8A 3LC8A 5K2XA 5TPAB 1I69A 2HFBA 3E13X 3PU5A 2O68A 4R73A 4C1TA 1XOCA 3RT6B 4GOTA 2F35A 2DXYA 5AA1A 4OZ9A 1SYIA 3G7WA 2X26A 2XXYA 1MXWA 1PBQA 5TU0A 2VOZA 4RY1A 1DOTA 1HSEA 3MZ9A 2UYFA 4JSOA 3THIA 2Y7KA 3OMBA 4L17A 5AA2A 3G3HA 4GRKA 3ZKLA 2D3IA 3IR1A 1JVYA 2Y7PA 2F78A 3K6XA 1MPBA 3RTFB 1AMFA 2HQ0A 4IGRA 1M5EA 4BDQA 2I48A 3K1MA 4G4PA 4U2RA 2CMOA 3BBRA 1A99A 5L8DA 1QVSA 3LSXA 4XKQA 4QFNA 3VE1B 1PB9A 4QFKA 4ONYA 4NMYA 1MY2A 3C34A 4NF4A 3FD3A 5AA2B 4OWDA 2FNCA 3H03A 3T66A 4KQPA 1B7HA 2Q2AA 2ANJA 1US4A 4DLDA 1Y3NA 3MJNA 4G8MA 4U21A 4ZZAA 3BFUA 3GBBA 4TQUQ 1QJMA 4EQ7A 1CE2A 3T9HB 1B2HA 3S9EA 1SBPA 3CIJA 4Q5TA 1UTHA 4NF8A 2R71A 1DPEA 4IO3A 1PBPA 5CBSA 3Q25A 1Y3PA 1M5CA 3HSTA 1FTKA 4NF4B 4LZ8A 3C35A 4F3GA 3GBAA 3C36A 4ELOA 4XKRA 4LZ7A 1L5TA 1FQBA 2I4BA 4PETA 1B5JA 3FVNA 3VLVA 3S9MC 2Q9TA 2DXRA 3VFJA 4F3PA 2HZKA 3Q27A 4TLMB 5J1DA 1II5A 4AQ4A 1B4HA 2Z23A 2OWTA 2Q89A 1R9LA 4R72A 2O84X 1R1NA 1BKAA 3SEUA 1OMPA 1B3HA 2OCUA 1UTHB 2XXTA 4NF8B 1LAXA 1N76A 4YMAA 5CMKA 1Y4TA 2XD2A 5KDTA 2XD3A 1D3KA 3KJ7A 2DWHA 4OHNA 4X1DA 1SW2A 3RPWA 2HCAA 4F1VA 4GD5A 2VD3A 4IO2A 3V83A 4FEDA 3MAMA 4G77A 3SEYA 3K00A 1FQDA 3EPEA 3LSLA 3HN0A 3MPKA 2ESNA 5H8FA 1B32A 2M8CA 1EZOA 3KN7A 4FIMA 2F97A 5KDTB 2VGQA 2ZMBA 2O69A 3IJXB 4JSDA 2OK2A 3PUZE 4JBZA 4KHZE 2I3VA 1LCFA 3T9UA 5EHSA 2NXOA 2Y84A 4YICA 1ZMGA 2XXPA 2DP8A 3PPOA 4GXSB 4OESA 3FXQA 1D9YA 4OYVA 1UIVA 4I1DA 3CRBA 3MVYA 5H8FB 1QKBA 4PQJA 4F2OA 1LCTA 2Z8DA 3ILTB 1OLCA 2V3UA 3H6VA 4ZEDA 2O7UA 1CB6A 2DE3A 3M3FA 1Y20A 4MLVA 4MFIA 1P1OA 3EHUA 2UVJA 5LOMA 4RK2A 3D4GA 1B1XA 2I49A 2DS9A 4OEUA 2RKMA 4NWCA 4HCWA 2O51A 4C1UA 5FHMA 3IO4A 2HXWA 3UK4A 1URSA 3I5OA 1OVTA 1ZKBA 3TQLA 3S9LC 3QUFA 3OO9A 2PVUA 4FE8A 4C0RA 4OENA 5H8SA 3TKDA 1SI0A 3CG3A 2V25A 5L9MA 2GH9A 5DYHA 2UVIA 4Q30B 1A7LA 1P1WA 3RN8A 3PUVE 3IB1A 2DWJA 2RCAA 4OFOA 4LP2B 1OLAA 4GF8A 2H5YA 2LAOA 1MDP1 4MF3A 2HAUA 4ESWA 4ZEIA 1D4NA 1MY4A 1I6AA 3OEMA 1B51A 2ONSA 3KOTA 1LFGA 1Y1ZA 3K1PA 3N6TA 3S2VA 4DE8A 5FTHA 1FQCA 3RQTA 1O64A 2FA7A 1TFAA 2Y7WA 4YKKA 3SEWA 1EZPA 3IOWA 3VVEA 2X7QA 1MXXA 3A3CA 4PFUA 5F1QA 4XKPA 1BIYA 4ZZEA 2F7CA 5I59A 4O3BA 4EF1A 2UVHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PFW A;  4EUO A;  3VV5 A;  3HCQ A;  3SET A;  1H76 A;  1PB7 A;  5ICT A;  1S7Y A;  4WKM A;  3ZSF A;  3KN3 A;  1WOD A;  3GXA A;  3U72 A;  4PFT A;  4HW8 A;  1YPN A;  5L9S A;  1UTB A;  3L6H A;  2UVG A;  5K2Y A;  4ZS9 A;  2QJE A;  3HV1 A;  1JW4 A;  2OWS A;  4GXA A;  2W7Y A;  1XHY A;  4R75 A;  2Q88 A;  1MXY A;  3PPN A;  1NH8 A;  3K6W A;  2XXQ A;  1LAH E;  4QFL A;  2NVU B;  3TTL A;  4G2Z A;  1XS5 A;  4OET A;  4KFQ A;  5H8N A;  1LB8 A;  3U94 A;  3TTK A;  3MP6 A;  1GV8 A;  3UA8 A;  4YB5 A;  1J1N A;  1LGB C;  3UN6 A;  1QKA A;  2X7P A;  1UTB B;  3SEV A;  4BDM A;  4YB6 A;  2AL4 A;  3EQ1 A;  2O1L A;  4U23 A;  2OZZ A;  5CMC A;  3K1N A;  1SW5 A;  2Y7R A;  1URG A;  1FQA A;  3K02 A;  3O66 A;  3TMG A;  4LQ5 A;  4LON B;  3TAJ A;  1RKM A;  3HHF A;  1MQI A;  3CSG A;  5H8N B;  3O2A A;  2O7I A;  1A55 A;  3W9W A;  1M5D A;  1JQF A;  3O6H A;  2ONK E;  3L6G A;  1B58 A;  4F3B A;  1B1H A;  3PMX A;  2F6P A;  3DP8 A;  2DWA A;  3K0V A;  5HBC A;  2GHA A;  2A5T A;  3S4U A;  3H3G A;  4FEB A;  4LQ2 A;  2PMS A;  1AIV A;  3PPQ A;  2QS1 A;  2QRY A;  2DE4 A;  1I6Q A;  3HPI A;  5H8H A;  4GL0 A;  1LAG E;  3G3J A;  1M5B A;  3LSW A;  3ONM A;  1LBC A;  4ELR A;  4GL8 A;  2E1S A;  4GFR A;  1Y1M A;  4Q8R A;  1P1N A;  4ISU A;  3T9X B;  2A5T B;  5M2V A;  1MRP A;  2RCB A;  4ND9 A;  1B3E A;  3TOD A;  3Q26 A;  2GRV A;  2NOO A;  1FQE A;  4OXV A;  2DVZ A;  4IO4 A;  3EHS A;  4G8H A;  1JW5 A;  4F39 A;  3FJ7 A;  3MVW A;  5H8H B;  1Y3Q A;  2ZYM A;  4DCY A;  4YKI A;  3MQ9 A;  4P0I A;  4F29 A;  1SD3 A;  1LFI A;  4I62 A;  4YZZ A;  3VXB A;  2I6E A;  2CZL A;  3D4C A;  4GQO A;  3IB2 A;  3DEL B;  3WAF A;  3B7D A;  4OFJ A;  1SI1 A;  4IY5 A;  4WXJ A;  3U93 A;  4YB7 A;  1NNT A;  1POY 1;  4FEC A;  1N7W A;  3O97 A;  1N7X A;  5EYF A;  2R6G E;  1XC1 A;  4ZEC A;  3HO7 A;  4BDO A;  2OBG A;  1KWH A;  4DCX A;  4BDL A;  3U1O A;  5I57 A;  1A8E A;  1BTJ A;  1EU8 A;  1N0T A;  3MC2 A;  4KYD A;  2DQV A;  1QUK A;  1Z7N E;  2RC7 A;  3DLN A;  3EHT A;  4JWX A;  1IEJ A;  1VFE A;  4H6D A;  4DXB A;  1S50 A;  3KFM A;  1TT1 A;  1IIW A;  2XXI A;  3KG2 A;  1IUD A;  4RXL A;  2I58 A;  3RUM A;  4XKN A;  1MQG A;  3SEX A;  2PT2 A;  1B7U A;  2Q8J A;  3FZV A;  2GFE A;  1SW4 A;  3MZB A;  4EXK A;  4H65 A;  1MPD A;  5I57 B;  4X1B A;  1GVC A;  2E0S A;  4NF5 A;  1MM6 A;  2G93 A;  4ZEF A;  4O3C A;  3VLU A;  2IA4 A;  2DYX A;  4N07 A;  2V3Q A;  3K6U A;  3N26 A;  1HSJ A;  1MXV A;  2I0B A;  4U1O A;  2ALU A;  3T9V A;  5CBR A;  2REG A;  1OVB A;  4F3S A;  5H8Q A;  4PE5 B;  1F9B A;  1AL3 A;  2V93 A;  4K3F A;  1B7Z A;  2HEU A;  3OO7 A;  3SES A;  1H43 A;  2Z22 A;  1SVX B;  5KZT A;  3O28 A;  5I2K A;  1ZLQ A;  4NF5 B;  1LLS A;  2Q2C A;  5JK4 A;  1FTM A;  3E4R A;  3FV1 A;  3VVD A;  1B40 A;  4UAC A;  3UOR A;  3OSR A;  1URD A;  4JXI A;  4R74 A;  1B52 A;  5DTB A;  5CC2 A;  2XXV A;  3TFL A;  1R9Q A;  1VSO A;  4XXU A;  4OFL A;  5AA3 A;  2ZNU A;  3FV2 A;  3HHG A;  5DEX A;  1GTK A;  4F1Y A;  3OSQ A;  1TWY A;  4JDF A;  3PV0 E;  4R2B A;  4BDR A;  4F22 A;  1IQ7 A;  2G29 A;  3C33 A;  3O6I A;  5BWJ A;  1LBB A;  5I2K B;  2IEE A;  3QYT A;  4R6K A;  4YKP A;  3UIF A;  4QSC A;  1NMU A;  3H6W A;  1B4Z A;  4X9T A;  3JYR A;  4YAH X;  2RC9 A;  2H98 A;  1WDN A;  4R9G A;  4AB5 A;  4FOR A;  1IIT A;  4LUB A;  4F19 A;  4ECF A;  3DP6 A;  2QS4 A;  1RYO A;  2ONR A;  3TEL A;  1LAF E;  4GWO A;  4RPN A;  3H06 B;  1TFD A;  3KJT A;  4P11 A;  2D5W A;  4HCY A;  5DEX B;  3V8X B;  3FVG A;  1USY E;  4H1X A;  1B0L A;  3TZA A;  2XX7 A;  2QS2 A;  1FTO A;  2XXU A;  3G3F A;  1SDX A;  3MUQ A;  2PYY A;  4OTE A;  3TCG A;  4RPO A;  2XXR A;  2H4I A;  5FHN A;  4HS7 A;  2ZNT A;  3PUY E;  3W9V A;  1MY1 A;  4NE4 A;  1VR5 A;  4GIZ A;  3IB0 A;  3FVO A;  3WAE A;  1PC3 A;  1MM7 A;  4TLL B;  3B6Q A;  4NWD A;  2I3W A;  2P0S A;  1NFT A;  1S9T A;  2XHD A;  3OXN A;  1JEV A;  3FGS A;  4EQB A;  2AIX A;  3CFL A;  5DVF A;  4RJZ A;  2Z8F A;  4Z0I A;  4MLQ A;  3TTR A;  4U22 A;  1Z7M E;  4LVQ A;  3KSJ A;  3QSL A;  4X48 A;  1NKX A;  1ZTY A;  1B6H A;  4BLA A;  1IXH A;  1FQF A;  1QUJ A;  3H7M A;  4NTL A;  4KPT A;  1YAE A;  1N04 A;  1ELJ A;  4FAJ A;  5JTY A;  3MW0 A;  3RLF E;  3K01 A;  1SYH A;  3TCF A;  3FAT A;  3ODB A;  1IXI A;  3KGC A;  4OEV A;  4BDN A;  3MVX A;  3MPL A;  1OIB A;  3M3K A;  4KYE A;  1I6B A;  4G8N A;  1IXC A;  1UIU A;  3CSB A;  3U8Q A;  3ECR A;  3I6V A;  4YKJ A;  3F11 A;  2B65 A;  5A5X A;  5IAI A;  2D21 A;  2DOJ A;  3H6T A;  3IAZ A;  4WED A;  5I59 B;  1NL5 A;  3UP9 A;  4KR5 A;  2DE2 A;  4DXU A;  2F5X A;  1ZJL A;  4RYA A;  1HSL A;  4OVJ A;  5AA2 D;  2V3T A;  3N94 A;  3RY3 A;  1OQH A;  1SQY A;  1P99 A;  3AXF A;  3O29 A;  3OO8 A;  4WEP A;  1NH7 A;  3TTN A;  3EF7 A;  1JET A;  1ZIU A;  4U1Z A;  3SDF A;  4XTC Q;  5A5X B;  3FXR A;  4H5G A;  3C4M A;  4NF6 A;  3RGY A;  3Q29 A;  4F2Q A;  1MH4 A;  5EHM A;  3TDJ A;  1MQH A;  4DXC A;  3G3G A;  3E9X A;  1A54 A;  1AH5 A;  5B70 A;  1MY0 A;  4I9D A;  1ZU0 A;  3LUY A;  5F7V A;  5I58 A;  3SKP A;  3A09 A;  2RF1 A;  5I2N A;  3GZG A;  1H3D A;  4LAT A;  4DZ1 A;  1QUI A;  2PBW A;  3FJM A;  1Q1K A;  2WKY A;  4IB2 A;  3KZG A;  4QSE A;  3TUS A;  1H45 A;  2I4C A;  4H8J A;  2DWI A;  4NF6 B;  3GLB A;  4ZEB A;  3PMW A;  2A5S A;  4EXL A;  4PP0 A;  1US5 A;  3G3I A;  2XX9 A;  2F34 A;  5I58 B;  2VD2 A;  1LFH A;  4M1V A;  5I2N B;  2F8D A;  4YMB A;  4JWY A;  3IOU A;  3M8U A;  2AL5 A;  3T96 B;  3LSF B;  5FTI A;  3R7X A;  4QFO A;  3MBP A;  4E0W A;  2RIN A;  3IX1 A;  3H4Z A;  4RA1 A;  1LB9 A;  1TXF A;  2I0C A;  4QRZ A;  4G68 A;  1B0H A;  3IOV A;  2UYE A;  4POW A;  3V89 B;  2ZXT A;  2VHA A;  3IL1 B;  1DPP A;  4ELQ A;  1MQD A;  3K6V A;  3BKI B;  4F1U A;  1MPC A;  2HZL A;  3I3V A;  3RNN A;  1B46 A;  3TCH A;  1FW0 A;  3LR1 A;  4IO5 A;  3BFT A;  3PUX E;  4YU0 A;  3MZ1 A;  3ZKK A;  4R6H A;  3R26 A;  3OEL A;  3USD A;  3TEP A;  2F6G A;  4DDD A;  4G68 B;  5AA4 A;  3OOA A;  2REJ A;  2O6A A;  4N13 A;  5ICQ A;  4R2F A;  1UQW A;  4ZE9 A;  2ZYN A;  3ILU B;  4IY6 A;  3QK6 A;  3PD9 A;  4LZ5 A;  1FCK A;  4JWO A;  5ITP A;  5I56 A;  3OEK A;  4P0G A;  5B7D A;  1DMB A;  2NUV A;  3KBR A;  1FTL A;  3C32 A;  3KOS A;  3PMV A;  2DVC A;  4THI A;  2AYS A;  3IO6 A;  2R9J A;  1MG1 A;  3TQW A;  5AA4 B;  2O1M A;  3PPR A;  4KCC A;  5CM6 A;  1B3G A;  3A3U A;  3CR9 A;  2QMW A;  1N3X A;  3UGW A;  3IOR A;  1B3F A;  1B05 A;  4ZDM A;  4F31 B;  3MVZ A;  3N5L A;  5I56 B;  2F7B A;  4XIG Q;  2GHB A;  4H67 A;  2ZYK A;  4GLI A;  4U4S A;  3KEI A;  5HPQ A;  3G3K A;  4KYS A;  3OO6 A;  1FTJ A;  1PB8 A;  5L9O A;  3FVK A;  3PGF A;  3ZS6 A;  2XXX A;  3FAS A;  3FXU A;  4EQ9 A;  1H44 A;  1OQG A;  4R9F A;  3CFX A;  1B9J A;  2F36 A;  1BP5 A;  4OMB A;  3FJG A;  3QAX A;  1NNK A;  4IGT A;  1EZ9 A;  3OD7 A;  4DIG A;  5H8Q B;  2UXA A;  3KN8 A;  1N84 A;  1MS7 A;  1IXG A;  5KCJ A;  4QHQ A;  3CFZ A;  5BUU A;  3FUZ A;  1VE4 A;  3IK6 B;  1JEU A;  2V84 A;  3VXC A;  3M3L A;  3JZJ A;  4QSD A;  4H8I A;  5DVJ A;  4GVO A;  3R6U A;  3C9H A;  2P2A A;  4OQO A;  1YCJ A;  3Q28 A;  2PT1 A;  1IZ1 A;  2OLB A;  3C31 A;  3QIM A;  3VDF A;  4ELP A;  3SER A;  1P1Q A;  5JEI A;  5KCJ B;  1M5F A;  3JV9 A;  1ANF A;  4MBP A;  1B3L A;  1D9V A;  2BJJ X;  2QMX A;  1SW1 A;  4LA9 A;  1P1U A;  1N3W A;  2H99 A;  4G68 C;  5IKB A;  1MDQ A;  5CMB A;  4ESX A;  1ZBM A;  3FIR A;  4HTG A;  1NNP A;  3MWB A;  1MXU A;  2ZNS A;  4E0X A;  4FJP A;  4N6P A;  1Y9U A;  1ATG A;  5I84 A;  1GGG A;  1AOV A;  3H6U A;  1O7T A;  1MH3 A;  4O3A A;  2DSF A;  4IO6 A;  4IO7 A;  1XVY A;  2H9B A;  5ITO A;  4H5F A;  3O9P A;  5ISU A;  2VP1 A;  3E3K A;  5FHO A;  1JVX A;  4ZEK A;  3RTW B;  1POT A;  3LBS A;  1MQJ A;  3PPP A;  5TP9 A;  4TOZ A;  1JNF A;  3PUW E;  2OJT A;  4AB6 A;  1XVX A;  2QL3 A;  2B3B A;  2B3F A;  2ABH A;  3TTM A;  4PFY A;  3TPA A;  3K2D A;  2QSX A;  5CRY A;  1PDA A;  4RNS A;  4Z7E A;  1T0K A;  3VVF A;  3DP4 A;  3CG1 A;  4EF2 A;  3KSX A;  1DSN A;  3U92 A;  4POX A;  4ZE8 A;  3IJO B;  4JB7 A;  3B6W A;  5TP9 B;  4KI0 E;  2YPN A;  2KLF A;  4NED A;  3MP1 A;  4R6Y A;  4I8C A;  1LST A;  2Y7I A;  5ELV A;  1MXZ A;  1DTZ A;  1B5I A;  5JTY B;  5DVI A;  3B6T A;  1USY H;  4UA8 A;  1BLF A;  1DTG A;  1EH3 A;  2QS3 A;  1YTV A;  5DT6 A;  1QW0 A;  2Z8E A;  3T93 B;  1Q35 A;  1VFD A;  3OEN A;  4U4X A;  5CI5 A;  1A8F A;  1GR2 A;  1JW1 A;  4FAT A;  2P1S A;  4KCD A;  3S9N C;  2H25 A;  2FYI A;  3W15 C;  1A40 A;  2QPQ A;  5CMM A;  2XXH A;  3CVG A;  3K4U A;  4Q0C A;  3P7I A;  2XXW A;  5AE4 A;  3QXM A;  1B5H A;  3DM0 A;  4RK9 A;  5TPA A;  3IOT A;  3QUJ A;  4H0W A;  1MY3 A;  2THI A;  1O63 A;  3V5A A;  4F18 A;  2NWJ A;  4EDP A;  5HM4 B;  1NNF A;  2XX8 A;  2PX1 A;  4QFP A;  3PD8 A;  3T22 A;  4M4G A;  4OER A;  2RC8 A;  1Y4C A;  2YLN A;  4KD5 A;  2HAV A;  1WVJ A;  1QUL A;  3VLW A;  3O6G A;  2YJP A;  3CI8 A;  4MH5 A;  1R6Z A;  2F7A A;  3EN3 A;  2ZYO A;  4QF9 A;  1RYX A;  3N6U A;  3RT8 A;  3MP8 A;  3TYH A;  1PEB A;  1XT8 A;  3LC8 A;  5K2X A;  5TPA B;  1I69 A;  2HFB A;  3E13 X;  3PU5 A;  2O68 A;  4R73 A;  4C1T A;  1XOC A;  3RT6 B;  4GOT A;  2F35 A;  2DXY A;  5AA1 A;  4OZ9 A;  1SYI A;  3G7W A;  2X26 A;  2XXY A;  1MXW A;  1PBQ A;  5TU0 A;  2VOZ A;  4RY1 A;  1DOT A;  1HSE A;  3MZ9 A;  2UYF A;  4JSO A;  3THI A;  2Y7K A;  3OMB A;  4L17 A;  5AA2 A;  3G3H A;  4GRK A;  3ZKL A;  2D3I A;  3IR1 A;  1JVY A;  2Y7P A;  2F78 A;  3K6X A;  1MPB A;  3RTF B;  1AMF A;  2HQ0 A;  4IGR A;  1M5E A;  4BDQ A;  2I48 A;  3K1M A;  4G4P A;  4U2R A;  2CMO A;  3BBR A;  1A99 A;  5L8D A;  1QVS A;  3LSX A;  4XKQ A;  4QFN A;  3VE1 B;  1PB9 A;  4QFK A;  4ONY A;  4NMY A;  1MY2 A;  3C34 A;  4NF4 A;  3FD3 A;  5AA2 B;  4OWD A;  2FNC A;  3H03 A;  3T66 A;  4KQP A;  1B7H A;  2Q2A A;  2ANJ A;  1US4 A;  4DLD A;  1Y3N A;  3MJN A;  4G8M A;  4U21 A;  4ZZA A;  3BFU A;  3GBB A;  4TQU Q;  1QJM A;  4EQ7 A;  1CE2 A;  3T9H B;  1B2H A;  3S9E A;  1SBP A;  3CIJ A;  4Q5T A;  1UTH A;  4NF8 A;  2R71 A;  1DPE A;  4IO3 A;  1PBP A;  5CBS A;  3Q25 A;  1Y3P A;  1M5C A;  3HST A;  1FTK A;  4NF4 B;  4LZ8 A;  3C35 A;  4F3G A;  3GBA A;  3C36 A;  4ELO A;  4XKR A;  4LZ7 A;  1L5T A;  1FQB A;  2I4B A;  4PET A;  1B5J A;  3FVN A;  3VLV A;  3S9M C;  2Q9T A;  2DXR A;  3VFJ A;  4F3P A;  2HZK A;  3Q27 A;  4TLM B;  5J1D A;  1II5 A;  4AQ4 A;  1B4H A;  2Z23 A;  2OWT A;  2Q89 A;  1R9L A;  4R72 A;  2O84 X;  1R1N A;  1BKA A;  3SEU A;  1OMP A;  1B3H A;  2OCU A;  1UTH B;  2XXT A;  4NF8 B;  1LAX A;  1N76 A;  4YMA A;  5CMK A;  1Y4T A;  2XD2 A;  5KDT A;  2XD3 A;  1D3K A;  3KJ7 A;  2DWH A;  4OHN A;  4X1D A;  1SW2 A;  3RPW A;  2HCA A;  4F1V A;  4GD5 A;  2VD3 A;  4IO2 A;  3V83 A;  4FED A;  3MAM A;  4G77 A;  3SEY A;  3K00 A;  1FQD A;  3EPE A;  3LSL A;  3HN0 A;  3MPK A;  2ESN A;  5H8F A;  1B32 A;  2M8C A;  1EZO A;  3KN7 A;  4FIM A;  2F97 A;  5KDT B;  2VGQ A;  2ZMB A;  2O69 A;  3IJX B;  4JSD A;  2OK2 A;  3PUZ E;  4JBZ A;  4KHZ E;  2I3V A;  1LCF A;  3T9U A;  5EHS A;  2NXO A;  2Y84 A;  4YIC A;  1ZMG A;  2XXP A;  2DP8 A;  3PPO A;  4GXS B;  4OES A;  3FXQ A;  1D9Y A;  4OYV A;  1UIV A;  4I1D A;  3CRB A;  3MVY A;  5H8F B;  1QKB A;  4PQJ A;  4F2O A;  1LCT A;  2Z8D A;  3ILT B;  1OLC A;  2V3U A;  3H6V A;  4ZED A;  2O7U A;  1CB6 A;  2DE3 A;  3M3F A;  1Y20 A;  4MLV A;  4MFI A;  1P1O A;  3EHU A;  2UVJ A;  5LOM A;  4RK2 A;  3D4G A;  1B1X A;  2I49 A;  2DS9 A;  4OEU A;  2RKM A;  4NWC A;  4HCW A;  2O51 A;  4C1U A;  5FHM A;  3IO4 A;  2HXW A;  3UK4 A;  1URS A;  3I5O A;  1OVT A;  1ZKB A;  3TQL A;  3S9L C;  3QUF A;  3OO9 A;  2PVU A;  4FE8 A;  4C0R A;  4OEN A;  5H8S A;  3TKD A;  1SI0 A;  3CG3 A;  2V25 A;  5L9M A;  2GH9 A;  5DYH A;  2UVI A;  4Q30 B;  1A7L A;  1P1W A;  3RN8 A;  3PUV E;  3IB1 A;  2DWJ A;  2RCA A;  4OFO A;  4LP2 B;  1OLA A;  4GF8 A;  2H5Y A;  2LAO A;  1MDP 1;  4MF3 A;  2HAU A;  4ESW A;  4ZEI A;  1D4N A;  1MY4 A;  1I6A A;  3OEM A;  1B51 A;  2ONS A;  3KOT A;  1LFG A;  1Y1Z A;  3K1P A;  3N6T A;  3S2V A;  4DE8 A;  5FTH A;  1FQC A;  3RQT A;  1O64 A;  2FA7 A;  1TFA A;  2Y7W A;  4YKK A;  3SEW A;  1EZP A;  3IOW A;  3VVE A;  2X7Q A;  1MXX A;  3A3C A;  4PFU A;  5F1Q A;  4XKP A;  1BIY A;  4ZZE A;  2F7C A;  5I59 A;  4O3B A;  4EF1 A;  2UVH A; 
#chains in the Genus database with same CATH topology
 4PFW A;  4EUO A;  3VV5 A;  4MCO A;  3HCQ A;  3SET A;  1H76 A;  1PB7 A;  5ICT A;  1S7Y A;  4WKM A;  3ZSF A;  3KN3 A;  1WOD A;  3GXA A;  3U72 A;  4PFT A;  4HW8 A;  1YPN A;  1DCU A;  5L9S A;  1UTB A;  3L6H A;  2UVG A;  5K2Y A;  4HE0 A;  4PTK A;  4ZS9 A;  2QJE A;  4GX3 A;  3HV1 A;  1JW4 A;  2OWS A;  4GXA A;  2W7Y A;  1XHY A;  4R75 A;  2B4M A;  2Q88 A;  1MXY A;  3PPN A;  1NH8 A;  3K6W A;  2XXQ A;  1LAH E;  4QFL A;  2NVU B;  3TTL A;  4G2Z A;  1LBV A;  1XS5 A;  2ZZW A;  4OET A;  4KFQ A;  5H8N A;  4NHB A;  1LB8 A;  4N91 A;  3U94 A;  4X04 A;  3TTK A;  3MP6 A;  1GV8 A;  3UA8 A;  4YB5 A;  1J1N A;  1LGB C;  3UN6 A;  1QKA A;  2X7P A;  2QFL A;  4MNI A;  1UTB B;  3SEV A;  4BDM A;  4YB6 A;  2AL4 A;  3EQ1 A;  2O1L A;  4U23 A;  5EQA A;  3U65 A;  2OZZ A;  5CMC A;  4PAK A;  4N4U A;  3K1N A;  1SW5 A;  2Y7R A;  1FBD A;  1URG A;  1FQA A;  4MNC A;  2Y5L A;  3K02 A;  3O66 A;  3TMG A;  4LQ5 A;  4LON B;  3TAJ A;  1RKM A;  3HHF A;  4H46 A;  4MMP A;  1MQI A;  3CSG A;  5H8N B;  3O2A A;  2O7I A;  1A55 A;  4PBQ A;  3W9W A;  1M5D A;  1JQF A;  2XXK A;  3O6H A;  2ONK E;  3L6G A;  1B58 A;  4F3B A;  1B1H A;  3PMX A;  5I7I A;  2F6P A;  3DP8 A;  2DWA A;  3K0V A;  5HBC A;  2GHA A;  2A5T A;  3S4U A;  3H3G A;  4MAG A;  4FEB A;  5ET8 A;  4LQ2 A;  4N81 A;  4QBA A;  2PMS A;  1AIV A;  3PPQ A;  2QS1 A;  2QRY A;  2DE4 A;  1I6Q A;  3HPI A;  5H8H A;  4GL0 A;  1IMD A;  1QGX A;  1YZ0 A;  5EQ7 A;  1LAG E;  3G3J A;  4GWU A;  1M5B A;  5IGA A;  1JP4 A;  3LSW A;  3ONM A;  1LBC A;  4ELR A;  4GL8 A;  2E1S A;  4GFR A;  1FPJ A;  1Y1M A;  4Q8R A;  1P1N A;  1KZ8 A;  4HXV A;  4ISU A;  3T9X B;  2A5T B;  5M2V A;  1MRP A;  2RCB A;  4ND9 A;  1B3E A;  3TOD A;  3Q26 A;  2GRV A;  2NOO A;  1FQE A;  4OXV A;  2DVZ A;  4IO4 A;  3EHS A;  4G8H A;  1JW5 A;  4F39 A;  3FJ7 A;  3MVW A;  5H8H B;  4MHF A;  1Y3Q A;  2ZYM A;  4DCY A;  4YKI A;  3MQ9 A;  4P0I A;  4KXP A;  4F29 A;  1SD3 A;  4NAP A;  2OWZ A;  1LFI A;  4I62 A;  4YZZ A;  3VXB A;  2I6E A;  2CZL A;  3D4C A;  2KR0 A;  4GQO A;  4IR8 A;  3IB2 A;  3DEL B;  3WAF A;  3B7D A;  4OFJ A;  5LDZ A;  1SI1 A;  4IY5 A;  4WXJ A;  3U93 A;  4YB7 A;  1FBF A;  2QVR A;  1NNT A;  1POY 1;  4FEC A;  1N7W A;  3O97 A;  1FPB A;  1N7X A;  2VPN A;  5EYF A;  2R6G E;  1XC1 A;  4ZEC A;  3HO7 A;  3KC0 A;  4BDO A;  2OBG A;  1KWH A;  4DCX A;  1FSA A;  1NV0 A;  4BDL A;  3U1O A;  5I57 A;  1A8E A;  1BTJ A;  1EU8 A;  1N0T A;  3MC2 A;  4PAF A;  1KA1 A;  4KYD A;  2DQV A;  1QUK A;  1Z7N E;  2RC7 A;  3DLN A;  3EHT A;  4JWX A;  1IEJ A;  1VFE A;  4H6D A;  4DXB A;  1S50 A;  3KFM A;  1TT1 A;  1IIW A;  2XXI A;  3KG2 A;  1IUD A;  4RXL A;  2I58 A;  3RUM A;  4XKN A;  1MQG A;  3SEX A;  2PT2 A;  1B7U A;  2Q8J A;  3FZV A;  2GFE A;  1SW4 A;  3MZB A;  1LBX A;  4EXK A;  4H65 A;  1MPD A;  2ZZX A;  5I57 B;  4X1B A;  1GVC A;  4MEV A;  2E0S A;  2DDK A;  4NF5 A;  2HHM A;  1MM6 A;  2G93 A;  4PC9 A;  4ZEF A;  4O3C A;  3VLU A;  2IA4 A;  1NV1 A;  2DYX A;  4PFB A;  4N07 A;  2V3Q A;  3K6U A;  3N26 A;  1HSJ A;  1MXV A;  2I0B A;  2Y5K A;  4U1O A;  2ALU A;  3T9V A;  5CBR A;  2REG A;  1OVB A;  4F3S A;  5H8Q A;  4PE5 B;  3RYD A;  1F9B A;  1AL3 A;  2V93 A;  4K3F A;  1B7Z A;  2HEU A;  3IFA A;  3OO7 A;  3SES A;  1H43 A;  2Z22 A;  1SVX B;  5KZT A;  3O28 A;  1G0I A;  5I2K A;  1ZLQ A;  4NF5 B;  1LLS A;  2Q2C A;  5JK4 A;  1FTM A;  3E4R A;  4N15 A;  3FV1 A;  3VVD A;  1B40 A;  4NN3 A;  4UAC A;  3KBZ A;  3UOR A;  5ET6 A;  3OSR A;  1URD A;  4JXI A;  4R74 A;  1B52 A;  5DTB A;  5CC2 A;  5A5L A;  2XXV A;  3TFL A;  1R9Q A;  1VSO A;  4XXU A;  4OFL A;  5AA3 A;  2ZNU A;  3FV2 A;  3HHG A;  5DEX A;  1GTK A;  4F1Y A;  5EQ9 A;  3OSQ A;  1TWY A;  4JDF A;  3PV0 E;  4R2B A;  4BDR A;  4F22 A;  1IQ7 A;  1FPE A;  2G29 A;  3C33 A;  3O6I A;  5BWJ A;  1LBB A;  5I2K B;  4N6D A;  2IEE A;  4R6K A;  3QYT A;  1LBW A;  4YKP A;  3UIF A;  4QSC A;  1NMU A;  3H6W A;  1B4Z A;  4X9T A;  3JYR A;  4YAH X;  2RC9 A;  1FPK A;  2H98 A;  1WDN A;  4R9G A;  4AB5 A;  4FOR A;  1IIT A;  4LUB A;  4F19 A;  4ECF A;  3DP6 A;  2QS4 A;  1RYO A;  4DI4 B;  2ONR A;  3TEL A;  1LAF E;  4GWO A;  4RPN A;  3H06 B;  1TFD A;  3KJT A;  4P11 A;  5EQ8 A;  2D5W A;  4HCY A;  5DEX B;  3V8X B;  3FVG A;  5FBP A;  1USY E;  4H1X A;  1B0L A;  3ROJ A;  3TZA A;  1FJ9 A;  2XX7 A;  2QS2 A;  4GBW A;  1FTO A;  3EKI A;  2XXU A;  3G3F A;  1SDX A;  3MUQ A;  2PYY A;  4OTE A;  3TCG A;  4RPO A;  2XXR A;  2H4I A;  5FHN A;  4OA4 A;  4HS7 A;  2ZNT A;  3PUY E;  3W9V A;  2OX3 A;  1MY1 A;  4NE4 A;  1YYZ A;  1VR5 A;  4GIZ A;  3IB0 A;  3FVO A;  1PC3 A;  3WAE A;  1MM7 A;  4TLL B;  1IMA A;  3B6Q A;  4NWD A;  2I3W A;  3T1B A;  2P0S A;  1NFT A;  2QVU A;  1LBZ A;  1S9T A;  2XHD A;  3OXN A;  1JEV A;  4PBH A;  2P3V A;  4N6K A;  3FGS A;  4EQB A;  2AIX A;  1NUW A;  3CFL A;  5DVF A;  4RJZ A;  2Z8F A;  4Z0I A;  4MLQ A;  3TTR A;  4U22 A;  1Z7M E;  4LVQ A;  3KSJ A;  3QSL A;  4X48 A;  1NKX A;  1ZTY A;  4NX1 A;  1B6H A;  4BLA A;  3B8B A;  1IXH A;  1FQF A;  1QUJ A;  3H7M A;  4NTL A;  4KPT A;  1YAE A;  1N04 A;  1ELJ A;  4FAJ A;  5JTY A;  4OVQ A;  3MW0 A;  3RLF E;  3K01 A;  1SYH A;  3TCF A;  3FAT A;  3ODB A;  1IXI A;  3KGC A;  1D9Q A;  4OEV A;  4BDN A;  3MVX A;  3MPL A;  4PFI A;  1OIB A;  3M3K A;  1FPD A;  4KYE A;  4I3E A;  4PGP A;  1I6B A;  4G8N A;  1FPF A;  1IXC A;  1UIU A;  3CSB A;  3U8Q A;  3D1R A;  3ECR A;  3I6V A;  1EYJ A;  1SPI A;  4HE2 A;  4YKJ A;  3F11 A;  5IZZ A;  2B65 A;  4NQ8 A;  5A5X A;  2D21 A;  5IAI A;  2DOJ A;  3H6T A;  3IAZ A;  4WED A;  5I59 B;  1NL5 A;  3UP9 A;  4KR5 A;  2DE2 A;  4DXU A;  2FIE A;  2F5X A;  1ZJL A;  4RYA A;  1HSL A;  4OVJ A;  1NI9 A;  1K9Z A;  2V4C A;  5AA2 D;  2V3T A;  3N94 A;  3RY3 A;  1OQH A;  2FIX A;  1SQY A;  2R8T A;  1P99 A;  2ZZV A;  3AXF A;  3O29 A;  3OO8 A;  4WEP A;  1NH7 A;  3TTN A;  3EF7 A;  1JET A;  1ZIU A;  4U1Z A;  5T3J A;  3SDF A;  2FVZ A;  4XTC Q;  5A5X B;  3FXR A;  4H5G A;  3C4M A;  4XFE A;  4NF6 A;  3RGY A;  3Q29 A;  4F2Q A;  1MH4 A;  5EHM A;  3TDJ A;  1MQH A;  4PFR A;  4DXC A;  3G3G A;  3E9X A;  1A54 A;  1AH5 A;  5B70 A;  1MY0 A;  4I9D A;  1ZU0 A;  3LUY A;  5F7V A;  5I58 A;  3SKP A;  3A09 A;  2RF1 A;  5I2N A;  1FRP A;  3GZG A;  4JVC A;  1H3D A;  4LAT A;  3FBP A;  3B50 A;  4DZ1 A;  3KC1 A;  1QUI A;  1KA0 A;  1NV7 A;  2PBW A;  3FJM A;  1Q1K A;  2WKY A;  4IB2 A;  4GX4 A;  3KZG A;  4QSE A;  3TUS A;  4MNP A;  1H45 A;  2I4C A;  4H8J A;  2DWI A;  4NF6 B;  3GLB A;  2XA5 A;  4ZEB A;  3PMW A;  2A5S A;  4EXL A;  4PP0 A;  1US5 A;  3G3I A;  2XX9 A;  2F34 A;  5I58 B;  2VD2 A;  1IMC A;  1LFH A;  4M1V A;  5I2N B;  4N8G A;  4GWW A;  2MKZ A;  2F8D A;  4YMB A;  4NF0 A;  4JWY A;  3IOU A;  4MJO A;  3M8U A;  2AL5 A;  3T96 B;  3LSF B;  5FTI A;  3R7X A;  4QFO A;  3MBP A;  4E0W A;  2RIN A;  3IX1 A;  3H4Z A;  4RA1 A;  4OVS A;  1LB9 A;  1TXF A;  2I0C A;  4QRZ A;  4G68 A;  1B0H A;  3IOV A;  2UYE A;  4POW A;  4GWZ A;  3V89 B;  4PAI A;  2ZXT A;  2Q74 A;  3ISP A;  2VHA A;  3IL1 B;  1DPP A;  4ELQ A;  1MQD A;  3K6V A;  3BKI B;  4F1U A;  1MPC A;  2HZL A;  3I3V A;  3RNN A;  1B46 A;  5EYG A;  3TCH A;  1FW0 A;  3LR1 A;  3LV0 A;  3BFT A;  3PUX E;  4IO5 A;  4YU0 A;  3MZ1 A;  3ZKK A;  5DW8 A;  4R6H A;  3R26 A;  3OEL A;  3USD A;  3TEP A;  2F6G A;  4DDD A;  4G68 B;  5AA4 A;  3OOA A;  2REJ A;  2O6A A;  4N13 A;  2WYP A;  5ICQ A;  4R2F A;  1UQW A;  5F24 A;  4ZE9 A;  2ZYN A;  3ILU B;  4IY6 A;  3QK6 A;  3PD9 A;  2XWO A;  4LZ5 A;  1FCK A;  4JWO A;  2WBB A;  5ITP A;  5I56 A;  3OEK A;  4P0G A;  5B7D A;  1DMB A;  2NUV A;  1NV4 A;  3KBR A;  1FTL A;  3C32 A;  2XWK A;  3KOS A;  3PMV A;  2DVC A;  4THI A;  2AYS A;  3IO6 A;  2R9J A;  1MG1 A;  3TQW A;  5AA4 B;  2O1M A;  3PPR A;  4KCC A;  5CM6 A;  1B3G A;  3A3U A;  3CR9 A;  2QMW A;  1N3X A;  3UGW A;  3IOR A;  2P3N A;  1B3F A;  1B05 A;  4ZDM A;  4F31 B;  3MVZ A;  3N5L A;  5I56 B;  2F7B A;  2FBP A;  4XIG Q;  4G61 A;  2BJI A;  2GHB A;  4H67 A;  1FBP A;  2ZYK A;  4GLI A;  4I40 A;  4U4S A;  5I5P A;  3KEI A;  2VT5 A;  5HPQ A;  3G3K A;  4KYS A;  3OO6 A;  1FTJ A;  1PB8 A;  5L9O A;  3FVK A;  4PDH A;  3PGF A;  3ZS6 A;  2XXX A;  1RDY A;  3FAS A;  3FXU A;  1EYK A;  4EQ9 A;  1FBH A;  1H44 A;  1OQG A;  4R9F A;  3CFX A;  1B9J A;  2F36 A;  4O7I A;  1BP5 A;  4OMB A;  4LN5 A;  3FJG A;  3QAX A;  1NNK A;  4IGT A;  1EZ9 A;  3OD7 A;  4XF5 A;  5ESY A;  4OVR A;  4X8R A;  4DIG A;  5H8Q B;  2UXA A;  4P1E A;  3KN8 A;  1N84 A;  1MS7 A;  1IXG A;  5KCJ A;  4QHQ A;  3CFZ A;  5BUU A;  3FUZ A;  1VE4 A;  3IK6 B;  1JEU A;  2V84 A;  3VXC A;  3M3L A;  3JZJ A;  4QSD A;  4H8I A;  4UAB A;  5DVJ A;  4GVO A;  3R6U A;  3C9H A;  2P2A A;  4OQO A;  1YCJ A;  3Q28 A;  2PT1 A;  1INP A;  1IZ1 A;  1VDW A;  2OLB A;  1DBZ A;  3C31 A;  3QIM A;  3VDF A;  4ELP A;  3SER A;  1P1Q A;  5JEI A;  1BK4 A;  5KCJ B;  2VPO A;  1M5F A;  3JV9 A;  1ANF A;  4MBP A;  1B3L A;  1D9V A;  2BJJ X;  2QMX A;  2B4L A;  4OVP A;  5IM2 A;  1SW1 A;  2PCR A;  4LA9 A;  1IMF A;  1P1U A;  1N3W A;  2H99 A;  4G68 C;  5IKB A;  1MDQ A;  5CMB A;  4ESX A;  1ZBM A;  3FIR A;  4HTG A;  3MYU A;  1NNP A;  2CZK A;  3MWB A;  1MXU A;  2ZNS A;  4E0X A;  2Q8M A;  2WYK A;  4FJP A;  4N6P A;  1Y9U A;  1ATG A;  5I84 A;  1GGG A;  1AOV A;  3H6U A;  1O7T A;  1MH3 A;  2PFY A;  4O3A A;  2DSF A;  4IO6 A;  4IO7 A;  1XVY A;  2H9B A;  5ITO A;  4I3Y A;  4H5F A;  3O9P A;  1FPL A;  5ISU A;  2VP1 A;  3E3K A;  5FHO A;  1JVX A;  4ZEK A;  3RTW B;  1POT A;  4P3L A;  3LBS A;  1MQJ A;  3PPP A;  1LBY A;  5TP9 A;  4N8Y A;  4TOZ A;  1JNF A;  3PUW E;  2OJT A;  4AB6 A;  1XVX A;  4XEQ A;  2QL3 A;  2B3B A;  3HFU A;  2B3F A;  3QMF A;  2ABH A;  3TTM A;  4PFY A;  3TPA A;  3K2D A;  2QSX A;  5CRY A;  1PDA A;  4RNS A;  4Z7E A;  1T0K A;  3VVF A;  3DP4 A;  3CG1 A;  4EF2 A;  3KSX A;  4P8B A;  1DSN A;  3U92 A;  1LEV A;  4POX A;  4FBP A;  4ZE8 A;  3IJO B;  4JB7 A;  3B6W A;  5TP9 B;  4KI0 E;  2YPN A;  2KLF A;  4PF6 A;  4NED A;  3MP1 A;  4R6Y A;  4I8C A;  1LST A;  2HPG A;  2Y7I A;  1NUX A;  2JJK A;  5ELV A;  1MXZ A;  1DTZ A;  1B5I A;  5JTY B;  5DVI A;  3B6T A;  1USY H;  3A29 A;  3CHG A;  4UA8 A;  1BLF A;  1DTG A;  1EH3 A;  2QS3 A;  1YTV A;  5DT6 A;  1QW0 A;  2Z8E A;  3T93 B;  1IME A;  1Q35 A;  1VFD A;  1IMB A;  3OEN A;  4U4X A;  5CI5 A;  2KQZ A;  1A8F A;  1GR2 A;  1JW1 A;  4FAT A;  2P1S A;  4KCD A;  3S9N C;  2PFZ A;  1YXI A;  2H25 A;  2FYI A;  3W15 C;  1A40 A;  2QPQ A;  5CMM A;  2XXH A;  3CVG A;  4PGN A;  3K4U A;  4Q0C A;  3P7I A;  3IFC A;  2XXW A;  5AE4 A;  3QXM A;  5IZ1 A;  1Q9D A;  1B5H A;  2WEF A;  3DM0 A;  4RK9 A;  5TPA A;  3IOT A;  3QUJ A;  4H0W A;  1MY3 A;  2THI A;  1O63 A;  3V5A A;  4F18 A;  2NWJ A;  4EDP A;  3SZP A;  4GWS A;  5HM4 B;  1NNF A;  2XX8 A;  2PX1 A;  4QFP A;  3PD8 A;  3T22 A;  4M4G A;  1FTA A;  4OER A;  1NV5 A;  2RC8 A;  4QXD A;  1Y4C A;  2YLN A;  4KD5 A;  2HAV A;  1WVJ A;  4P56 A;  1QUL A;  3VLW A;  5IZ3 A;  3O6G A;  4N17 A;  2CZH A;  2YJP A;  3BIG A;  3CI8 A;  4MH5 A;  1R6Z A;  2F7A A;  3EN3 A;  4GWY A;  2ZYO A;  4QF9 A;  1RYX A;  3N6U A;  3RT8 A;  3MP8 A;  4PE3 A;  3TYH A;  1PEB A;  1XT8 A;  3LC8 A;  5K2X A;  5TPA B;  1I69 A;  4AS5 A;  4O7M A;  2HFB A;  3E13 X;  3PU5 A;  2O68 A;  4R73 A;  4C1T A;  1XOC A;  3RT6 B;  4GOT A;  2F35 A;  2DXY A;  5AA1 A;  4OZ9 A;  3LUZ A;  1SYI A;  3G7W A;  2X26 A;  4HE1 A;  2XXY A;  1NV3 A;  1FBC A;  1MXW A;  1PBQ A;  2WBD A;  5TU0 A;  2VOZ A;  5IZ3 B;  5ET7 A;  4RY1 A;  1DOT A;  1HSE A;  3MZ9 A;  2UYF A;  4JSO A;  3THI A;  2Y7K A;  3OMB A;  4L17 A;  5AA2 A;  3G3H A;  4GRK A;  3ZKL A;  2D3I A;  2L5V A;  3IR1 A;  1JVY A;  2Y7P A;  2F78 A;  2F3D A;  3K6X A;  1FPI A;  1MPB A;  3RTF B;  1AMF A;  2HQ0 A;  4IGR A;  1XI6 A;  1M5E A;  4BDQ A;  2I48 A;  3K1M A;  4G4P A;  5J16 A;  4U2R A;  2CMO A;  2F3B A;  3BBR A;  1A99 A;  5L8D A;  1QVS A;  2CEY A;  3LSX A;  2CZI A;  3PTY A;  4XKQ A;  4QFN A;  4OAN A;  3VE1 B;  1PB9 A;  4QFK A;  4ONY A;  4NMY A;  1MY2 A;  3C34 A;  4NF4 A;  3FD3 A;  5AA2 B;  4OWD A;  2FNC A;  3H03 A;  3T66 A;  4KQP A;  1B7H A;  2Q2A A;  2ANJ A;  1US4 A;  1Y3N A;  3MJN A;  4DLD A;  1CNQ A;  4G8M A;  4U21 A;  4ZZA A;  3BFU A;  3GBB A;  4TQU Q;  3NOH A;  1QJM A;  4EQ7 A;  1CE2 A;  3T9H B;  1B2H A;  3S9E A;  1NV2 A;  1SBP A;  4NGU A;  3CIJ A;  3E78 A;  4Q5T A;  1UTH A;  4NF8 A;  2R71 A;  4OVT A;  1DPE A;  4IO3 A;  1PBP A;  5CBS A;  3Q25 A;  1Y3P A;  1M5C A;  3HST A;  3FXB A;  1FTK A;  4NF4 B;  4LZ8 A;  3C35 A;  4F3G A;  3GBA A;  3C36 A;  4ELO A;  4XKR A;  4LZ7 A;  1L5T A;  1FQB A;  2I4B A;  4PET A;  1B5J A;  4PF8 A;  3FVN A;  2CEX A;  3VLV A;  3S9M C;  2Q9T A;  2DXR A;  3VFJ A;  4F3P A;  2HZK A;  3Q27 A;  4TLM B;  5J1D A;  2QVV A;  1II5 A;  3GYY A;  2XWI A;  4AQ4 A;  1B4H A;  2Z23 A;  2OWT A;  2Q89 A;  1R9L A;  4R72 A;  2O84 X;  1R1N A;  1BKA A;  3SEU A;  1OMP A;  1B3H A;  2OCU A;  1UTH B;  2XXT A;  4NF8 B;  1LAX A;  3MST A;  1N76 A;  4YMA A;  4JVI A;  5CMK A;  1Y4T A;  2XD2 A;  1NUY A;  5KDT A;  2XD3 A;  1D3K A;  3KJ7 A;  2DWH A;  4OHN A;  4X1D A;  1SW2 A;  3RPW A;  2HCA A;  4F1V A;  4O94 A;  4GD5 A;  2VD3 A;  4IO2 A;  3V83 A;  4FED A;  1NUZ A;  3MAM A;  4G77 A;  3SEY A;  3K00 A;  1FQD A;  3EPE A;  3LSL A;  3HN0 A;  3MPK A;  4GWX A;  2ESN A;  5H8F A;  1B32 A;  2M8C A;  1EZO A;  3KN7 A;  3RPL A;  4FIM A;  2F97 A;  5EYH A;  3BIH A;  5KDT B;  2VGQ A;  2ZMB A;  2O69 A;  3IJX B;  4JSD A;  2OK2 A;  3PUZ E;  4JBZ A;  4KHZ E;  2I3V A;  1LCF A;  3T9U A;  5EHS A;  2NXO A;  2Y84 A;  4GX6 A;  4YIC A;  1ZMG A;  2XXP A;  2DP8 A;  3PPO A;  4GXS B;  4OES A;  4DI3 D;  3FXQ A;  1D9Y A;  4PCD A;  1EYI A;  4OYV A;  1UIV A;  4I1D A;  3CRB A;  3MVY A;  1RDZ A;  5H8F B;  1QKB A;  4PQJ A;  4F2O A;  1LCT A;  3RPL B;  2Z8D A;  3ILT B;  1FJ6 A;  1OLC A;  2V3U A;  3H6V A;  4H45 A;  4ZED A;  2O7U A;  4O8M A;  1CB6 A;  2DE3 A;  1DK4 A;  3M3F A;  1Y20 A;  4MLV A;  4MFI A;  3T0J A;  1P1O A;  4JVD A;  3EHU A;  2UVJ A;  5LOM A;  4RK2 A;  4MIJ A;  3D4G A;  1B1X A;  2I49 A;  2DS9 A;  4OEU A;  2RKM A;  4NWC A;  4HCW A;  2O51 A;  4C1U A;  2GQ1 A;  5FHM A;  1FBE A;  3IO4 A;  2HXW A;  3UK4 A;  1URS A;  3I5O A;  1OVT A;  1ZKB A;  3TQL A;  2HXR A;  3S9L C;  3QUF A;  5ET5 A;  4P9K A;  4PDD A;  3OO9 A;  2PVU A;  4FE8 A;  4C0R A;  4OEN A;  5H8S A;  2WX9 A;  3TKD A;  1SI0 A;  3CG3 A;  2V25 A;  5LTC A;  5L9M A;  4NG7 A;  2GH9 A;  1FPG A;  5DYH A;  2UVI A;  4Q30 B;  1A7L A;  1P1W A;  3RN8 A;  3PUV E;  3IB1 A;  2DWJ A;  2RCA A;  4OFO A;  4LP2 B;  1OLA A;  4GF8 A;  2FHY A;  2H5Y A;  2LAO A;  1MDP 1;  1NV6 A;  1RDX A;  2XWV A;  4MF3 A;  2HAU A;  4ESW A;  4GBV A;  4ZEI A;  1D4N A;  1MY4 A;  1I6A A;  3OEM A;  4P1L A;  1B51 A;  2ONS A;  3KOT A;  1LFG A;  3E79 A;  1Y1Z A;  3K1P A;  3N6T A;  3S2V A;  4DE8 A;  5FTH A;  1FQC A;  3RQT A;  1O64 A;  2FA7 A;  4AS4 A;  1TFA A;  2Y7W A;  4YKK A;  3SEW A;  1K9Y A;  1EZP A;  5I3S A;  3IOW A;  4P47 A;  3VVE A;  1G0H A;  1FBG A;  2X7Q A;  4MX6 A;  1MXX A;  3A3C A;  4PFU A;  5F1Q A;  4XKP A;  1BIY A;  4ZZE A;  2F7C A;  5I59 A;  1AWB A;  4O3B A;  4EF1 A;  2UVH A; 
#chains in the Genus database with same CATH homology
 4PFW A;  4EUO A;  3VV5 A;  3HCQ A;  3SET A;  1H76 A;  1PB7 A;  5ICT A;  1S7Y A;  4WKM A;  3ZSF A;  3KN3 A;  1WOD A;  3GXA A;  3U72 A;  4PFT A;  4HW8 A;  1YPN A;  5L9S A;  1UTB A;  3L6H A;  2UVG A;  5K2Y A;  4ZS9 A;  2QJE A;  3HV1 A;  1JW4 A;  2OWS A;  4GXA A;  2W7Y A;  1XHY A;  4R75 A;  2Q88 A;  1MXY A;  3PPN A;  1NH8 A;  3K6W A;  2XXQ A;  1LAH E;  4QFL A;  2NVU B;  3TTL A;  4G2Z A;  1XS5 A;  4OET A;  4KFQ A;  5H8N A;  1LB8 A;  3U94 A;  3TTK A;  3MP6 A;  1GV8 A;  3UA8 A;  4YB5 A;  1J1N A;  1LGB C;  3UN6 A;  1QKA A;  2X7P A;  1UTB B;  3SEV A;  4BDM A;  4YB6 A;  2AL4 A;  3EQ1 A;  2O1L A;  4U23 A;  2OZZ A;  5CMC A;  3K1N A;  1SW5 A;  2Y7R A;  1URG A;  1FQA A;  3K02 A;  3O66 A;  3TMG A;  4LQ5 A;  4LON B;  3TAJ A;  1RKM A;  3HHF A;  1MQI A;  3CSG A;  5H8N B;  3O2A A;  2O7I A;  1A55 A;  3W9W A;  1M5D A;  1JQF A;  3O6H A;  2ONK E;  3L6G A;  1B58 A;  4F3B A;  1B1H A;  3PMX A;  2F6P A;  3DP8 A;  2DWA A;  3K0V A;  5HBC A;  2GHA A;  2A5T A;  3S4U A;  3H3G A;  4FEB A;  4LQ2 A;  2PMS A;  1AIV A;  3PPQ A;  2QS1 A;  2QRY A;  2DE4 A;  1I6Q A;  3HPI A;  5H8H A;  4GL0 A;  1LAG E;  3G3J A;  1M5B A;  3LSW A;  3ONM A;  1LBC A;  4ELR A;  4GL8 A;  2E1S A;  4GFR A;  1Y1M A;  4Q8R A;  1P1N A;  4ISU A;  3T9X B;  2A5T B;  5M2V A;  1MRP A;  2RCB A;  4ND9 A;  1B3E A;  3TOD A;  3Q26 A;  2GRV A;  2NOO A;  1FQE A;  4OXV A;  2DVZ A;  4IO4 A;  3EHS A;  4G8H A;  1JW5 A;  4F39 A;  3FJ7 A;  3MVW A;  5H8H B;  1Y3Q A;  2ZYM A;  4DCY A;  4YKI A;  3MQ9 A;  4P0I A;  4F29 A;  1SD3 A;  1LFI A;  4I62 A;  4YZZ A;  3VXB A;  2I6E A;  2CZL A;  3D4C A;  4GQO A;  3IB2 A;  3DEL B;  3WAF A;  3B7D A;  4OFJ A;  1SI1 A;  4IY5 A;  4WXJ A;  3U93 A;  4YB7 A;  1NNT A;  1POY 1;  4FEC A;  1N7W A;  3O97 A;  1N7X A;  5EYF A;  2R6G E;  1XC1 A;  4ZEC A;  3HO7 A;  4BDO A;  2OBG A;  1KWH A;  4DCX A;  4BDL A;  3U1O A;  5I57 A;  1A8E A;  1BTJ A;  1EU8 A;  1N0T A;  3MC2 A;  4KYD A;  2DQV A;  1QUK A;  1Z7N E;  2RC7 A;  3DLN A;  3EHT A;  4JWX A;  1IEJ A;  1VFE A;  4H6D A;  4DXB A;  1S50 A;  3KFM A;  1TT1 A;  1IIW A;  2XXI A;  3KG2 A;  1IUD A;  4RXL A;  2I58 A;  3RUM A;  4XKN A;  1MQG A;  3SEX A;  2PT2 A;  1B7U A;  2Q8J A;  3FZV A;  2GFE A;  1SW4 A;  3MZB A;  4EXK A;  4H65 A;  1MPD A;  5I57 B;  4X1B A;  1GVC A;  2E0S A;  4NF5 A;  1MM6 A;  2G93 A;  4ZEF A;  4O3C A;  3VLU A;  2IA4 A;  2DYX A;  4N07 A;  2V3Q A;  3K6U A;  3N26 A;  1HSJ A;  1MXV A;  2I0B A;  4U1O A;  2ALU A;  3T9V A;  5CBR A;  2REG A;  1OVB A;  4F3S A;  5H8Q A;  4PE5 B;  1F9B A;  1AL3 A;  2V93 A;  4K3F A;  1B7Z A;  2HEU A;  3OO7 A;  3SES A;  1H43 A;  2Z22 A;  1SVX B;  5KZT A;  3O28 A;  5I2K A;  1ZLQ A;  4NF5 B;  1LLS A;  2Q2C A;  5JK4 A;  1FTM A;  3E4R A;  3FV1 A;  3VVD A;  1B40 A;  4UAC A;  3UOR A;  3OSR A;  1URD A;  4JXI A;  4R74 A;  1B52 A;  5DTB A;  5CC2 A;  2XXV A;  3TFL A;  1R9Q A;  1VSO A;  4XXU A;  4OFL A;  5AA3 A;  2ZNU A;  3FV2 A;  3HHG A;  5DEX A;  1GTK A;  4F1Y A;  3OSQ A;  1TWY A;  4JDF A;  3PV0 E;  4R2B A;  4BDR A;  4F22 A;  1IQ7 A;  2G29 A;  3C33 A;  3O6I A;  5BWJ A;  1LBB A;  5I2K B;  2IEE A;  3QYT A;  4R6K A;  4YKP A;  3UIF A;  4QSC A;  1NMU A;  3H6W A;  1B4Z A;  4X9T A;  3JYR A;  4YAH X;  2RC9 A;  2H98 A;  1WDN A;  4R9G A;  4AB5 A;  4FOR A;  1IIT A;  4LUB A;  4F19 A;  4ECF A;  3DP6 A;  2QS4 A;  1RYO A;  2ONR A;  3TEL A;  1LAF E;  4GWO A;  4RPN A;  3H06 B;  1TFD A;  3KJT A;  4P11 A;  2D5W A;  4HCY A;  5DEX B;  3V8X B;  3FVG A;  1USY E;  4H1X A;  1B0L A;  3TZA A;  2XX7 A;  2QS2 A;  1FTO A;  2XXU A;  3G3F A;  1SDX A;  3MUQ A;  2PYY A;  4OTE A;  3TCG A;  4RPO A;  2XXR A;  2H4I A;  5FHN A;  4HS7 A;  2ZNT A;  3PUY E;  3W9V A;  1MY1 A;  4NE4 A;  1VR5 A;  4GIZ A;  3IB0 A;  3FVO A;  3WAE A;  1PC3 A;  1MM7 A;  4TLL B;  3B6Q A;  4NWD A;  2I3W A;  2P0S A;  1NFT A;  1S9T A;  2XHD A;  3OXN A;  1JEV A;  3FGS A;  4EQB A;  2AIX A;  3CFL A;  5DVF A;  4RJZ A;  2Z8F A;  4Z0I A;  4MLQ A;  3TTR A;  4U22 A;  1Z7M E;  4LVQ A;  3KSJ A;  3QSL A;  4X48 A;  1NKX A;  1ZTY A;  1B6H A;  4BLA A;  1IXH A;  1FQF A;  1QUJ A;  3H7M A;  4NTL A;  4KPT A;  1YAE A;  1N04 A;  1ELJ A;  4FAJ A;  5JTY A;  3MW0 A;  3RLF E;  3K01 A;  1SYH A;  3TCF A;  3FAT A;  3ODB A;  1IXI A;  3KGC A;  4OEV A;  4BDN A;  3MVX A;  3MPL A;  1OIB A;  3M3K A;  4KYE A;  1I6B A;  4G8N A;  1IXC A;  1UIU A;  3CSB A;  3U8Q A;  3ECR A;  3I6V A;  4YKJ A;  3F11 A;  2B65 A;  5A5X A;  5IAI A;  2D21 A;  2DOJ A;  3H6T A;  3IAZ A;  4WED A;  5I59 B;  1NL5 A;  3UP9 A;  4KR5 A;  2DE2 A;  4DXU A;  2F5X A;  1ZJL A;  4RYA A;  1HSL A;  4OVJ A;  5AA2 D;  2V3T A;  3N94 A;  3RY3 A;  1OQH A;  1SQY A;  1P99 A;  3AXF A;  3O29 A;  3OO8 A;  4WEP A;  1NH7 A;  3TTN A;  3EF7 A;  1JET A;  1ZIU A;  4U1Z A;  3SDF A;  4XTC Q;  5A5X B;  3FXR A;  4H5G A;  3C4M A;  4NF6 A;  3RGY A;  3Q29 A;  4F2Q A;  1MH4 A;  5EHM A;  3TDJ A;  1MQH A;  4DXC A;  3G3G A;  3E9X A;  1A54 A;  1AH5 A;  5B70 A;  1MY0 A;  4I9D A;  1ZU0 A;  3LUY A;  5F7V A;  5I58 A;  3SKP A;  3A09 A;  2RF1 A;  5I2N A;  3GZG A;  1H3D A;  4LAT A;  4DZ1 A;  1QUI A;  2PBW A;  3FJM A;  1Q1K A;  2WKY A;  4IB2 A;  3KZG A;  4QSE A;  3TUS A;  1H45 A;  2I4C A;  4H8J A;  2DWI A;  4NF6 B;  3GLB A;  4ZEB A;  3PMW A;  2A5S A;  4EXL A;  4PP0 A;  1US5 A;  3G3I A;  2XX9 A;  2F34 A;  5I58 B;  2VD2 A;  1LFH A;  4M1V A;  5I2N B;  2F8D A;  4YMB A;  4JWY A;  3IOU A;  3M8U A;  2AL5 A;  3T96 B;  3LSF B;  5FTI A;  3R7X A;  4QFO A;  3MBP A;  4E0W A;  2RIN A;  3IX1 A;  3H4Z A;  4RA1 A;  1LB9 A;  1TXF A;  2I0C A;  4QRZ A;  4G68 A;  1B0H A;  3IOV A;  2UYE A;  4POW A;  3V89 B;  2ZXT A;  2VHA A;  3IL1 B;  1DPP A;  4ELQ A;  1MQD A;  3K6V A;  3BKI B;  4F1U A;  1MPC A;  2HZL A;  3I3V A;  3RNN A;  1B46 A;  3TCH A;  1FW0 A;  3LR1 A;  4IO5 A;  3BFT A;  3PUX E;  4YU0 A;  3MZ1 A;  3ZKK A;  4R6H A;  3R26 A;  3OEL A;  3USD A;  3TEP A;  2F6G A;  4DDD A;  4G68 B;  5AA4 A;  3OOA A;  2REJ A;  2O6A A;  4N13 A;  5ICQ A;  4R2F A;  1UQW A;  4ZE9 A;  2ZYN A;  3ILU B;  4IY6 A;  3QK6 A;  3PD9 A;  4LZ5 A;  1FCK A;  4JWO A;  5ITP A;  5I56 A;  3OEK A;  4P0G A;  5B7D A;  1DMB A;  2NUV A;  3KBR A;  1FTL A;  3C32 A;  3KOS A;  3PMV A;  2DVC A;  4THI A;  2AYS A;  3IO6 A;  2R9J A;  1MG1 A;  3TQW A;  5AA4 B;  2O1M A;  3PPR A;  4KCC A;  5CM6 A;  1B3G A;  3A3U A;  3CR9 A;  2QMW A;  1N3X A;  3UGW A;  3IOR A;  1B3F A;  1B05 A;  4ZDM A;  4F31 B;  3MVZ A;  3N5L A;  5I56 B;  2F7B A;  4XIG Q;  2GHB A;  4H67 A;  2ZYK A;  4GLI A;  4U4S A;  3KEI A;  5HPQ A;  3G3K A;  4KYS A;  3OO6 A;  1FTJ A;  1PB8 A;  5L9O A;  3FVK A;  3PGF A;  3ZS6 A;  2XXX A;  3FAS A;  3FXU A;  4EQ9 A;  1H44 A;  1OQG A;  4R9F A;  3CFX A;  1B9J A;  2F36 A;  1BP5 A;  4OMB A;  3FJG A;  3QAX A;  1NNK A;  4IGT A;  1EZ9 A;  3OD7 A;  4DIG A;  5H8Q B;  2UXA A;  3KN8 A;  1N84 A;  1MS7 A;  1IXG A;  5KCJ A;  4QHQ A;  3CFZ A;  5BUU A;  3FUZ A;  1VE4 A;  3IK6 B;  1JEU A;  2V84 A;  3VXC A;  3M3L A;  3JZJ A;  4QSD A;  4H8I A;  5DVJ A;  4GVO A;  3R6U A;  3C9H A;  2P2A A;  4OQO A;  1YCJ A;  3Q28 A;  2PT1 A;  1IZ1 A;  2OLB A;  3C31 A;  3QIM A;  3VDF A;  4ELP A;  3SER A;  1P1Q A;  5JEI A;  5KCJ B;  1M5F A;  3JV9 A;  1ANF A;  4MBP A;  1B3L A;  1D9V A;  2BJJ X;  2QMX A;  1SW1 A;  4LA9 A;  1P1U A;  1N3W A;  2H99 A;  4G68 C;  5IKB A;  1MDQ A;  5CMB A;  4ESX A;  1ZBM A;  3FIR A;  4HTG A;  1NNP A;  3MWB A;  1MXU A;  2ZNS A;  4E0X A;  4FJP A;  4N6P A;  1Y9U A;  1ATG A;  5I84 A;  1GGG A;  1AOV A;  3H6U A;  1O7T A;  1MH3 A;  4O3A A;  2DSF A;  4IO6 A;  4IO7 A;  1XVY A;  2H9B A;  5ITO A;  4H5F A;  3O9P A;  5ISU A;  2VP1 A;  3E3K A;  5FHO A;  1JVX A;  4ZEK A;  3RTW B;  1POT A;  3LBS A;  1MQJ A;  3PPP A;  5TP9 A;  4TOZ A;  1JNF A;  3PUW E;  2OJT A;  4AB6 A;  1XVX A;  2QL3 A;  2B3B A;  2B3F A;  2ABH A;  3TTM A;  4PFY A;  3TPA A;  3K2D A;  2QSX A;  5CRY A;  1PDA A;  4RNS A;  4Z7E A;  1T0K A;  3VVF A;  3DP4 A;  3CG1 A;  4EF2 A;  3KSX A;  1DSN A;  3U92 A;  4POX A;  4ZE8 A;  3IJO B;  4JB7 A;  3B6W A;  5TP9 B;  4KI0 E;  2YPN A;  2KLF A;  4NED A;  3MP1 A;  4R6Y A;  4I8C A;  1LST A;  2Y7I A;  5ELV A;  1MXZ A;  1DTZ A;  1B5I A;  5JTY B;  5DVI A;  3B6T A;  1USY H;  4UA8 A;  1BLF A;  1DTG A;  1EH3 A;  2QS3 A;  1YTV A;  5DT6 A;  1QW0 A;  2Z8E A;  3T93 B;  1Q35 A;  1VFD A;  3OEN A;  4U4X A;  5CI5 A;  1A8F A;  1GR2 A;  1JW1 A;  4FAT A;  2P1S A;  4KCD A;  3S9N C;  2H25 A;  2FYI A;  3W15 C;  1A40 A;  2QPQ A;  5CMM A;  2XXH A;  3CVG A;  3K4U A;  4Q0C A;  3P7I A;  2XXW A;  5AE4 A;  3QXM A;  1B5H A;  3DM0 A;  4RK9 A;  5TPA A;  3IOT A;  3QUJ A;  4H0W A;  1MY3 A;  2THI A;  1O63 A;  3V5A A;  4F18 A;  2NWJ A;  4EDP A;  5HM4 B;  1NNF A;  2XX8 A;  2PX1 A;  4QFP A;  3PD8 A;  3T22 A;  4M4G A;  4OER A;  2RC8 A;  1Y4C A;  2YLN A;  4KD5 A;  2HAV A;  1WVJ A;  1QUL A;  3VLW A;  3O6G A;  2YJP A;  3CI8 A;  4MH5 A;  1R6Z A;  2F7A A;  3EN3 A;  2ZYO A;  4QF9 A;  1RYX A;  3N6U A;  3RT8 A;  3MP8 A;  3TYH A;  1PEB A;  1XT8 A;  3LC8 A;  5K2X A;  5TPA B;  1I69 A;  2HFB A;  3E13 X;  3PU5 A;  2O68 A;  4R73 A;  4C1T A;  1XOC A;  3RT6 B;  4GOT A;  2F35 A;  2DXY A;  5AA1 A;  4OZ9 A;  1SYI A;  3G7W A;  2X26 A;  2XXY A;  1MXW A;  1PBQ A;  5TU0 A;  2VOZ A;  4RY1 A;  1DOT A;  1HSE A;  3MZ9 A;  2UYF A;  4JSO A;  3THI A;  2Y7K A;  3OMB A;  4L17 A;  5AA2 A;  3G3H A;  4GRK A;  3ZKL A;  2D3I A;  3IR1 A;  1JVY A;  2Y7P A;  2F78 A;  3K6X A;  1MPB A;  3RTF B;  1AMF A;  2HQ0 A;  4IGR A;  1M5E A;  4BDQ A;  2I48 A;  3K1M A;  4G4P A;  4U2R A;  2CMO A;  3BBR A;  1A99 A;  5L8D A;  1QVS A;  3LSX A;  4XKQ A;  4QFN A;  3VE1 B;  1PB9 A;  4QFK A;  4ONY A;  4NMY A;  1MY2 A;  3C34 A;  4NF4 A;  3FD3 A;  5AA2 B;  4OWD A;  2FNC A;  3H03 A;  3T66 A;  4KQP A;  1B7H A;  2Q2A A;  2ANJ A;  1US4 A;  4DLD A;  1Y3N A;  3MJN A;  4G8M A;  4U21 A;  4ZZA A;  3BFU A;  3GBB A;  4TQU Q;  1QJM A;  4EQ7 A;  1CE2 A;  3T9H B;  1B2H A;  3S9E A;  1SBP A;  3CIJ A;  4Q5T A;  1UTH A;  4NF8 A;  2R71 A;  1DPE A;  4IO3 A;  1PBP A;  5CBS A;  3Q25 A;  1Y3P A;  1M5C A;  3HST A;  1FTK A;  4NF4 B;  4LZ8 A;  3C35 A;  4F3G A;  3GBA A;  3C36 A;  4ELO A;  4XKR A;  4LZ7 A;  1L5T A;  1FQB A;  2I4B A;  4PET A;  1B5J A;  3FVN A;  3VLV A;  3S9M C;  2Q9T A;  2DXR A;  3VFJ A;  4F3P A;  2HZK A;  3Q27 A;  4TLM B;  5J1D A;  1II5 A;  4AQ4 A;  1B4H A;  2Z23 A;  2OWT A;  2Q89 A;  1R9L A;  4R72 A;  2O84 X;  1R1N A;  1BKA A;  3SEU A;  1OMP A;  1B3H A;  2OCU A;  1UTH B;  2XXT A;  4NF8 B;  1LAX A;  1N76 A;  4YMA A;  5CMK A;  1Y4T A;  2XD2 A;  5KDT A;  2XD3 A;  1D3K A;  3KJ7 A;  2DWH A;  4OHN A;  4X1D A;  1SW2 A;  3RPW A;  2HCA A;  4F1V A;  4GD5 A;  2VD3 A;  4IO2 A;  3V83 A;  4FED A;  3MAM A;  4G77 A;  3SEY A;  3K00 A;  1FQD A;  3EPE A;  3LSL A;  3HN0 A;  3MPK A;  2ESN A;  5H8F A;  1B32 A;  2M8C A;  1EZO A;  3KN7 A;  4FIM A;  2F97 A;  5KDT B;  2VGQ A;  2ZMB A;  2O69 A;  3IJX B;  4JSD A;  2OK2 A;  3PUZ E;  4JBZ A;  4KHZ E;  2I3V A;  1LCF A;  3T9U A;  5EHS A;  2NXO A;  2Y84 A;  4YIC A;  1ZMG A;  2XXP A;  2DP8 A;  3PPO A;  4GXS B;  4OES A;  3FXQ A;  1D9Y A;  4OYV A;  1UIV A;  4I1D A;  3CRB A;  3MVY A;  5H8F B;  1QKB A;  4PQJ A;  4F2O A;  1LCT A;  2Z8D A;  3ILT B;  1OLC A;  2V3U A;  3H6V A;  4ZED A;  2O7U A;  1CB6 A;  2DE3 A;  3M3F A;  1Y20 A;  4MLV A;  4MFI A;  1P1O A;  3EHU A;  2UVJ A;  5LOM A;  4RK2 A;  3D4G A;  1B1X A;  2I49 A;  2DS9 A;  4OEU A;  2RKM A;  4NWC A;  4HCW A;  2O51 A;  4C1U A;  5FHM A;  3IO4 A;  2HXW A;  3UK4 A;  1URS A;  3I5O A;  1OVT A;  1ZKB A;  3TQL A;  3S9L C;  3QUF A;  3OO9 A;  2PVU A;  4FE8 A;  4C0R A;  4OEN A;  5H8S A;  3TKD A;  1SI0 A;  3CG3 A;  2V25 A;  5L9M A;  2GH9 A;  5DYH A;  2UVI A;  4Q30 B;  1A7L A;  1P1W A;  3RN8 A;  3PUV E;  3IB1 A;  2DWJ A;  2RCA A;  4OFO A;  4LP2 B;  1OLA A;  4GF8 A;  2H5Y A;  2LAO A;  1MDP 1;  4MF3 A;  2HAU A;  4ESW A;  4ZEI A;  1D4N A;  1MY4 A;  1I6A A;  3OEM A;  1B51 A;  2ONS A;  3KOT A;  1LFG A;  1Y1Z A;  3K1P A;  3N6T A;  3S2V A;  4DE8 A;  5FTH A;  1FQC A;  3RQT A;  1O64 A;  2FA7 A;  1TFA A;  2Y7W A;  4YKK A;  3SEW A;  1EZP A;  3IOW A;  3VVE A;  2X7Q A;  1MXX A;  3A3C A;  4PFU A;  5F1Q A;  4XKP A;  1BIY A;  4ZZE A;  2F7C A;  5I59 A;  4O3B A;  4EF1 A;  2UVH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...