3GLDA

Crystal structure of the major pilin from streptococcus pyogenes e117a mutant
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
294
structure length
294
Chain Sequence
GPGSATTVHGETVVNGAKLTVTKNLDLVNSNALIPNTDFTFKIEPDTTVNEDGNKFKGVALNTPMTKVTYTNSDKGGSNTKTAEFDFSEVTFEKPGVYYYKVTAEKIDKVPGVSYDTTSYTVQVHVLWNEEQQKPVATYIVGYKEGSKVPIQFKNSLDSTTLTVKKKVSGTGGDRSKDFNFGLTLKANQYYKASEKVMIEKTTKGGQAPVQTEASIDQLYHFTLKDGESIKVTNLPVGVDYVVTEDDYKSEKYTTNVEVSPQDGAVKNIAGNSTEQETSTDKDMTITFTNKKVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pilin
publication title Intramolecular isopeptide bonds give thermodynamic and proteolytic stability to the major pilin protein of Streptococcus pyogenes
rcsb
source organism Streptococcus pyogenes serotype m1
molecule tags Structural protein
total genus 64
structure length 294
sequence length 294
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12892 FctA Spy0128-like isopeptide containing domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1140 Mainly Beta Sandwich Immunoglobulin-like Collagen-binding surface protein Cna, B-type domain 3gldA02
2.60.40.3050 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3gldA01
3GLEA 2X9XA 2X9YA 3RPKA 2X9ZA 3GLDA 4BUGA 3KLQA 2XICA 2XIDA 2Y1VA 3B2MA 1D2OA 1D2PA 2X9WA 2XTLA
chains in the Genus database with same CATH superfamily
3QPXH 3P54A 1N3NA 1A9BA 1NC4A 3EH3B 2ROXA 2VM4A 3MRIA 3ROLA 3RWCA 3UGEA 5FDWA 1PKQE 5KW9L 3CFDB 5GHWL 3ALXA 4ZK8A 4BZYA 4P0DA 5JZ7D 1H8NA 1B4LA 4CMHC 3V10A 4F3FA 1Q0EA 1BVLA 2G3ZA 2HSIA 3S0PA 1U3ZA 1AVAA 2WZ0A 2XY1A 1HCFX 1YY8B 2BOLA 1ROWA 5AZUA 3V4VA 4IBVA 1OCRB 4XMLH 2FLMA 1PDKB 2YOAA 4MCYA 1AHWA 1T1ZB 3MRJA 3PGFL 1NINA 2FYVA 1WO2A 1S7WA 3RAJH 1YSOA 1KTLB 2R0WL 4Z7NB 3EG9A 1TENA 5E8DH 3PWUB 5CBEB 4Q6YA 1IGMH 4R26H 2DQIH 4RGMC 3TT1L 5J13B 1R3IH 4Q9RH 4MA1B 5INCB 3D5OF 1H5BC 3PWLA 1KT2A 4G43A 4ZD3L 1EFXD 1EAPA 4YFLF 2OMXB 3BPNB 1M1XB 2KDYA 3N5AA 2X88A 4XXCC 4YDZA 4I1NB 3V7MA 2I69A 3O4LD 3MX0B 4IM8A 2F54D 3MV7B 1EHAA 1MDAA 3FFCA 4R84A 1D5ZB 1ZTMA 4FP8H 4YDIL 4PGZA 1IC7H 4HVBA 3RY5A 3FNKA 1KBBA 4WNQB 4N25A 3WUZA 4HSQA 3RNQB 4DN4H 4NP9A 1E67A 3QW9A 1XF4B 3GMPB 15C8L 2ZX8A 1PX3A 4X7FC 2ARJA 2ICWI 2VDML 3OMNB 4L9DA 4BUHA 3MUGB 3T77B 3PAYA 2V5YA 1TTBA 2WCSA 4ZOAA 4CADB 3AREA 2D8KA 3TWCL 2P44B 3V95A 1MI5D 2UY7A 5BJTA 3QI9B 3QZMA 3PU7A 5E4EB 3RUGF 5JNYB 4A2FA 2GT9A 4LCWA 1UB5A 1LMKA 1GAFL 3QYMA 3KZ8A 2CPUA 4XZUA 3DDFA 3WHE1 3TPKA 4KMQA 3WEOA 4YIQB 4J4PD 3FHQA 3UTSE 2WLLA 5BOJA 2EUVA 2OR9H 3V4PH 4Z95H 1RZPA 1RUQL 2XPYA 4BWTA 2Y2YA 2FHCA 3II3A 3L1OH 3UTPD 3T71A 3NCCB 1XH3A 4CA4A 4KKNA 4KJYA 1X5YA 4NUPA 5A2JH 4ZUUA 5IROA 4X8JA 4LKXA 2ZOLA 5DRNB 5ABZA 5JW5A 4MYWB 2V2WB 3IDNB 4JY4A 5HHPA 5JA9A 3DVFA 5JXAL 1OGAA 1Z1WA 3WL9B 1E8WA 1P7KA 4BKTC 4U31A 2X1QA 4WUUB 3RGBA 2HVKB 1FQ9C 3GSQB 4FFZL 5D7IB 5JIPA 5FKPB 1FL5B 1TZHB 2JQMA 1XVSA 4PBDA 5KSBF 4G8GD 4A7TA 4OZFB 5HP5A 3GSXA 5IHWA 2DM7A 2F5AH 1YNLL 2X4RB 3BT2L 3RVVD 5DHDA 2AABH 2VO8A 4QCIA 4LT7A 1JZ4A 2X41A 2Z8SA 4N0RA 4KJWD 4KQ3L 2BMKB 2X0VA 1DQLH 1WZ1H 2R23A 4FG6D 3QJHA 5AZEH 1BXVA 1GZPB 1KWGA 1CGTA 2PUQT 1NGQH 5E08L 4YE0A 1FZJB 4TULH 4QHUA 1M53A 1FV1B 2AK1H 3DIDA 4ZMVA 4KUCD 1IGCL 4YHZH 1WITA 3GSRB 2IMMA 2FO8A 3RURA 4O2EA 2ESVD 4CGTA 2PR9A 2K7QA 5A2LH 3TP4A 4UQ3B 4MD4A 4V1DE 1KY6A 3D06A 4MSWA 4AZ8B 3PNRB 1C8QA 4OFIA 2J8UB 3H7BB 5CD5D 4N9GA 3NCMA 3CLEL 1HH6A 2PP8A 1DJXA 2CLVA 3L3IA 3P30L 1CXLA 4QLWA 5LWYL 4JHAH 4MQTB 1GRWA 3CFJB 1K6QH 1NICA 2BOCB 2GY7B 4BV1A 5C9JA 4JFHE 3TPUA 1HQRB 4PJEE 4YGVB 4POUB 2WMPA 1KTDB 2G3XA 3BSZL 3OMAB 2FJSA 3BAKA 4PH8A 2Y24A 3L4YA 4BH7A 4KFMA 3Q05A 3FK3A 2E3VA 1VERA 1VADA 3B2PA 4J3BA 3NABH 1X5IA 3MRBA 2IV8A 4R90H 2IV9A 3V4PA 3VJ6A 5I73C 4PRIB 4QDGA 5EUKA 2AQRA 2ATPB 1SQMA 1JGLL 1YEIH 3L3JB 2R59A 4Z77A 4XBGB 5BQ7B 1C1EH 5JPMA 4LOUC 3HI6L 3FOMB 4ZPVB 5AYQA 1IFHL 3HBZA 1NMBL 5DMIH 3O4LE 3I3BA 1KB5H 4L2YA 5KVGL 2UXGA 3HZYA 5T3XD 3QUMB 5AG9A 4RMSA 1I1AB 1V5JA 4G8EA 3KS0H 2GITA 2AW2A 3B34A 4FLOA 4PP1C 3VI3E 3RJDA 3QDMA 1DBAL 4JM2F 5D8JH 4H0HB 2BZ7A 4U1KB 2QZQA 2WZPA 2I32A 4GAYA 3WLWC 3FQXB 4UV4L 4M6MH 1ZVHA 4OVVA 1CF8H 3CXHK 5E9DD 1I8IB 1HDMB 3V6ZA 2DOCA 4HUKB 5CAYB 4DEPC 3ULUC 3VGFA 2Q3XA 1EUUA 5CN2A 5DUBB 3SPGA 3CWGA 4U0RC 5ACZB 3SOBL 1WJ3A 2E9IA 2A6JB 1J11A 5CIPH 4R7VA 1CL7I 4GAFB 3BXNB 5FF6A 4F7EA 1JDCA 3OKMB 5F0LB 4WTXA 4OCXL 4MA8H 1AGEB 2QSTA 1XH1A 4K8RC 3QUYD 3D50A 5B4MD 3SBWC 1ZANL 3WD5L 3TN0D 3T8XA 4M1GL 4RNRB 4FG0A 1IEAA 2WNXA 2XN2A 1PF3A 4S0SD 4WNJA 1EGJH 3OPZL 1NCIA 5HDBB 4K3EL 4FQ1H 3ZDYF 1WGVA 4P2CG 4GT0A 5F6HI 2Q8BL 5DI8A 1JZGA 1BPVA 5D4IA 4P2RB 2ZUTA 1WE5A 1AS8A 1I3UA 3LH8A 3QEHA 4RGOH 2FQGA 2RQ8A 4U1NA 3MBEB 4LHUD 5GGTL 2VLKD 3UBFA 4HUVB 2Y72A 1ETZB 5DO2C 1DJYA 3EOBA 3LN5A 2CIKB 1RCYA 1I3VA 2IIJA 5IHBA 4CSPA 4PVMA 3VXTA 4GYBA 2ZCHL 2NNCA 1O6VA 5CR8A 3VVWA 4BA0A 2H45A 1NCNA 5C0CB 1Y18A 2J3SA 1AP2A 1TCMA 3FTVA 2B77A 4KDWA 1UWEH 4TUOA 1BQHG 1JDDA 2IH9A 1QLFA 4D0CA 1ID5I 1IFRA 1KEMH 3ELQA 2Q1EA 2EYRA 3NCXA 1K4CA 4OVUA 1F58L 4PJ5D 3LIZH 4AQEA 3S3JA 1M71B 4GS7B 5AWNH 4WZ9A 2H6UA 4F2FA 3HS0A 3GBMH 3VTAA 4O2CB 5T1MB 3GI8L 2PABA 1YA5A 2GUOA 1JPFA 2ZOUA 1OM3H 3FF8A 3ARBB 4QYOB 5DF0A 3WHXA 3LZOA 1MFCL 4OFQA 4I18C 3JVGC 4FE9A 3T8VA 3F7PC 3HRZB 4W4OA 2HCZX 4BKLA 1D6EA 1AXSB 2EEXA 3OLEA 1SY6L 3HN8A 4N2AA 4FFTA 3QAZB 4NZTL 4M6NH 3BIBX 4AQ1A 1MQ8A 3Q6GL 5D2NA 5I75B 5ENWB 1K3IA 4R83A 1A6WH 1L6PA 5EF0A 4C83A 4R7LA 1I1RA 3QJZA 3BHBB 2LU4A 3HS8A 4MCZA 4NPKA 3CBRA 2OFQA 4HPHA 3FTXA 1EGJA 3O6KH 4NCC2 5KZCD 3NJGA 3OAWA 4GEJA 4GKLA 3ZKXB 5IMOB 3C5JB 3VXPA 1TQCB 2E9BA 1AZUA 3EO0B 1NEZA 3MRNB 5ALBH 5GS2D 4P23C 2BVYA 3B37A 5T3XE 4PS4L 5DJYA 5B3JE 3UJJL 1BOGA 3AS1A 2YXMA 1KV7A 3NVQA 3AACA 4P3DB 3SDCA 2ZUWA 2JV6A 3O2WH 3SBQA 3B2UC 1H6FA 4TYUA 2IOIA 4KI5C 2R56L 5I9QB 2LVEA 3PJNA 2WXLA 2ZXQA 4PJCF 5H8DA 3E3QC 4KNQA 2FEDD 2BHZA 2ZKHL 3MV9B 3DC0A 1HILB 2ZCKL 5D1ZD 4P5SA 4OZHE 3MRMA 5D7LA 4YPJA 3LDBB 1JHKH 2ZKWA 2VDKL 3K6OA 4J3OC 2X6UA 3S3SA 3H2QA 3QAQA 2CIIB 5EIVA 2GTZB 3EBIA 5JYMA 3KYOB 2D2CC 2EDRA 4W6WB 2JSFA 4NJAL 5PAZA 1CFBA 4ZYKA 3VE0A 3QUXC 3D87B 5IW1B 1QR4A 1M6OB 3LQAC 4LVOB 4Z8FL 5ICYA 2H6OA 2Q9OA 2RMNA 1BAWA 4XNUL 2FD6L 4NWTH 3LNGA 5HHOD 3IU3B 4S2SB 4DKDC 4HPYH 3BGMA 4K7PY 1HOEA 3HG1B 1Z5HA 4MB5A 4NCC1 4YR6A 3DRQB 1F86A 2XC8A 5DD1L 4U1GB 2Z31A 4EI6B 4EN3A 3WIHH 4MAUL 4JG1H 1H9VA 1XGYL 3WY2A 1BXUA 4HD9A 3QORD 2DEWX 4AW7A 4NQSB 2VLKE 4HYTB 4PY7A 4KUZL 4OJCA 3CZUB 4N90E 1B4JL 2OX5A 1X7TA 3D12B 5H94A 1P5UA 2CLRA 4WTZA 3HC2A 5K59E 1CDCA 5F7FA 5CKAA 4IS6A 3BWZA 4WW2C 1RULL 4MS8D 5A2AA 3BZFB 5IGXL 1UACL 1TNMA 5LGHL 1K8DB 4DAGH 5F21B 4B3EA 3LZNA 1DVSA 2M8XA 5C0AE 5HYIA 1Z5LB 1NMAL 4FXGB 5CILH 2FTAA 3MACH 3UG3A 3E7JA 4EKXA 4HUUA 4R5TA 2WAHA 4FQCH 3FUDA 2KZ1B 3ARYA 2AGJL 4KROC 4V11A 4PJ5E 4F7CB 1CVRA 4DERA 2X6BA 3ZK0A 1WS8A 3QEGH 3W56A 5E8EB 4AYFB 4ANWA 2GUYA 3CNKA 4BFKA 4P4KC 2DD8H 1O0VA 1GIGH 1JPST 5KSUA 1CLOL 2QSVA 3D18A 2O5YH 1U3HD 4UINH 2WBJC 2XN9A 5FYLL 3HZKB 1DBBH 4DGUA 5HI3D 4FI7A 4ES8A 1D9KA 4OFVA 4Y4FD 5GGVH 4APXA 2IH3B 1GTFA 4HD5A 4LLWA 4X6CA 2P5WB 4IJ3C 2E6JA 4JDEB 3S2AA 5CF3A 2YRZA 4NZFA 2YLKA 3CZNA 3Q48A 4KJPD 4NO2B 3VB9A 1Z3RA 3FYIB 1XF2A 4RA3A 1VZIA 3ILQC 1CE6A 5IVXF 2WXRA 3CH8A 4GRWE 2H0PA 2BW4A 3FT1A 3GKZA 3VFWA 1I31A 3CDGA 3E8UH 1AZNA 3ZDZB 4O02H 5I71C 3TASA 5L2JB 2IDFA 1ETB1 1YPZF 5J6SA 2C3GA 2F53A 3WIHA 1LO3L 2V9UA 3UO1L 1AO7B 5C8JB 2UWEA 2C3VB 3RNKA 2I24N 3KPNA 1NCGA 4P49A 4CDGC 1KJ2L 1MDTA 4NAMA 1ZGLA 4M1CD 3HCVB 2XFXB 1LK2B 4LRIC 1HWWA 2JIXB 1Y07A 5DXWA 1K8IA 3IS1X 2Y7SA 4GG6F 3TC9A 4EN2A 3WN6A 2B16A 1CK0H 5D1QD 3RX7A 1RU9H 5JOEA 1JGVH 2VDPB 2QPUA 5KVFE 5KN5B 2BSRB 1R46A 4HBQA 1UZ6E 5F44A 1UT1A 3BJLA 4N2IA 2FR4B 2PXYB 1FL3B 3BQUA 3MRPB 2Y07H 1KTJA 3S96B 3FFOA 3G5ZB 4F8NA 3RZCD 4PWFA 1K5NA 3DBXA 3P4MB 3I9GL 4FCAA 1X3DA 4WSKA 4IK6A 5CEYB 1G5GA 4AGLA 4JY6B 3FQTA 1LE9A 2D4DA 2O30A 3NFNA 1IAKA 3VFMB 3IE9A 4DW2H 4S1RH 5D5MB 3QWQB 4Y4HD 4PBVC 1IM9A 4FN0A 3OBAA 2J25A 4MHHG 3ULUH 3MNZB 4XB8A 4I3SH 3I6SA 2VL4A 3RWGB 7FABH 1VKXB 5HHOE 2YSTA 4OIFA 1CFQA 4ZQTA 4R2GD 1CL7L 1SFDA 3FSAA 3QXTA 4PJGB 2W0PA 5DD5H 3WKQA 1HAUA 1IM3A 3NIFF 3QIWB 2ZAHA 3SDAD 1JGUH 4FTVA 3B5GA 4ZFOA 4NO0A 2OYMA 3CSTA 4UUJA 2Y22A 2YN5A 4OSUH 4DP5X 4L4TA 1A7NH 2Y23A 4XVTL 3U46A 2HX9A 1YUHB 4RGND 2AQ2A 2H1XA 5I19L 3AS3A 1EZVX 4P2QA 3LZPA 1BIHA 1CXFA 1XQ4A 4PRPD 5KUMA 4RZCA 3F58L 2N7SA 5HYJA 3KPOA 5B22A 4KHXH 5D2LA 3BYYA 4QHNA 2A3TA 1O6SA 2P52A 3Q1SH 1E2WA 4GUPB 2P26A 4M6OH 4GG8B 4WENB 4M7JH 1A6ZB 1N7ML 1MRDL 1JZFA 3QZWA 4HJSA 5EU7E 5IB2B 4FFYA 1S7SB 4XVOA 5JHDD 3EF4A 4UTBL 4OLXL 4WWKB 4NSKB 3RY6C 3MRLB 4ALAC 3W81A 4CVXB 4FJ6A 4KK8D 2QQLL 3FAXA 2HT4D 2Y3AA 4MX7B 1AZBA 4PR5A 2XTJB 2PTUA 4JE0A 1CU4H 2Y7QA 3RIAF 2CDGB 2F74B 3LKPB 1NFDB 5AQ0A 4QXGL 4XOCA 2ALWA 4JFSA 4OGXH 2QSCL 3KEDA 1TU2B 3G6AA 1FVEB 5B1BB 4W9IC 3QARA 4LLQA 3OKNA 5H37A 1H6EA 4PUBH 2C1OA 4TOYL 3EJZC 3ZZ1A 1KY7A 4FLHA 3P3TA 1B0RB 2I7OA 2BVQB 1XB8A 2VDQL 1XIWA 4WHTB 3BCDA 4ORZC 1T6VN 3TH4T 3ULVD 4XPAH 3WNMA 2DQCH 1OVZA 2WLIA 1C08B 1CGWA 3F04A 4X98B 1F90L 4X4YB 3T2PA 1KNOA 4ELKB 1TEYA 4N1CA 1ASOA 2R0LH 1SXZA 4UV7L 4NM8H 5E51A 6PAZA 3Q01A 1Q4NX 2YAFA 1RJZB 4YNYA 4NC1C 2DMBA 2MOQA 2OMYB 4G6KL 2RTTA 1MHPL 2R7EA 3L4VA 8PAZA 3ZL1A 5CCGE 4ODVH 3K4AA 2J8OA 4XPBL 2EADA 4ZTEA 1ZLSL 3WJMB 3SDYH 3MNWB 1NIAA 5GGSA 2E56A 2K0RA 3FC8A 3PHQB 2MNJB 2DIBA 2F7QA 4MJID 3UPCA 4D9LH 4DN3H 5KSAC 2ZG3A 3L6FA 1BJ8A 4OJFH 1D5MB 1HQ4A 4HC1H 4QTIH 2GJRA 2IH1A 2BDNL 4UIMB 4HUWB 2VDOB 5I1EL 2J1XA 4DGYH 2OTUA 2P46B 3P11L 4Y8AA 3QEUA 3N1QC 4YK4B 1BZQK 3QHZL 4M48L 2BLFA 1BX2A 1E43A 5D1QE 3UABA 1R5IA 2BNRB 2Q76B 2COQA 4MQSB 2PYEE 2WWKO 1S7QB 4LCCC 4NENB 3RIFK 4LBEB 5EIQA 1NDMA 5E1QA 1HYSD 3W11D 5C07D 2R1XA 2Z7ZA 4KI1A 2ZX5A 4HEPA 5I1IL 3DURA 2J4WH 4MMXB 2LU5A 3H2WA 4XBEH 5T5FA 4I0PB 4KKBD 3TGXA 4WDIB 4IIZA 3MOBL 3K2MC 1AOHA 1DFBH 3TYFB 1NSNL 1QFWM 1XWVA 3LN4B 1AKPA 3UTQA 1H3GA 2DBLL 3VGGA 1K72A 5D93B 4YOKA 2ALAA 2UYLB 5EOCL 3M1BA 1AZVA 3FYEB 1LO2H 1NOLA 4U05A 4J3OH 3K5RA 1FGNL 2AQ1A 1MQKH 2B7DT 4IKKA 1CTNA 5AYUL 4WVRA 3UGUA 4JFPB 2DYPA 4M8QB 1LEGB 2D2OA 1CR9H 2X4OA 2KT6A 1M7IA 3MLYH 1OAYH 4HWZA 2EEAA 1T03L 4CVZB 4PVBA 2Y5QA 5J57B 1PMYA 3Q2VA 5T1LB 5FS5A 4GQQA 3LQAH 5DJAA 4LLYB 2R29L 1OT4A 4G5ZL 1CLVA 1BD2A 1ETJA 4BQ8A 3NPZB 4IRZH 1YYML 1ZV5A 2MHAA 4D8PB 1HEJC 3GBNH 5TJWK 4MDJB 1T2JA 1KIRB 32C2A 3G6JA 3ARDD 3D2TA 3JVGA 2EIBA 5EUOA 2H6PA 1RVFL 3C75A 4PYGA 3UACA 2OMWA 4NBXB 5BUAA 1D2PA 4E41B 5IQ7L 2J21A 1J0ZA 2NY4B 5JHDE 5KW9H 1QSEE 2MIZA 5GHWH 5LN4A 5JIKA 5I0ZA 3A4DA 5HYSB 1J8HB 3OXRB 3KDMA 4QJ5B 4NN5C 4HC1A 4IGBD 4W93A 3U4BL 1NEZG 4ZAKA 2DQHL 4BA8A 3L3OC 3ZE0B 3S5LA 4E9VA 1QWHA 1TNNA 3C5ZB 3KLDA 1FRGL 3BD4A 3I75B 5ETUB 3NGBB 2O26U 4XXWC 4B9GA 3QIUB 1P7QB 3PGFH 5JHLL 1N8ZB 3BWUC 3SY0A 5FHBH 2CGZA 1T89A 3KJ6L 2R0WH 4RAVB 5G4OA 1VFAB 3SBRA 2NXZB 4P23A 3TT1H 4YZFE 4K23L 5C0GB 3FW6A 5ECGA 2QKIA 2PMZA 4RSVA 2AXHA 3ULVE 2CO7B 5E4IA 1UXSA 4V2BA 1VGEL 2GG1A 4PJFB 3DPBA 4EIBA 1QSZA 2JI2A 1XF5B 2O61A 4N87A 4PG9B 5KVMC 4XOBA 3LHAA 3VFOB 1HIML 4YEEA 1CQYA 5JORA 2N0KA 3FRPB 2GEEA 1V3MA 4ZXBD 4RH4A 5JO5B 3TBTA 5JDSB 2OTPA 5ICXA 4RRPA 1WDAA 5DHVH 1W9XA 1SRDA 3A24A 5GGRA 4QRPB 15C8H 3APCA 4QOKD 4LK4A 2CWRA 1EEZA 2ICEB 2Q10A 1OGPA 4A7GA 3ZRCC 1BQ5A 3QEQB 4ZFQA 2LLLA 2QGBA 2VXTL 4N2KA 2NNRA 3ZRFC 2J43A 3QUGA 3TWCH 4LU5H 4BFBD 2K7PA 2NX5D 3FT2B 2WBWB 3J27A 4ZMXA 5L88L 2F68X 4MXVF 4S0TD 3VM7A 3DVNA 5TGBB 2X2UA 1WICA 5EOTA 2DW5A 4R4BB 2HG5A 3WNLA 3E2HC 3N42F 3SE3C 5TQ0L 3PWPA 4WTZG 3V7AE 4DKFL 1NAMA 4KFZC 4MZIA 4R7NA 1RUQH 3PWNA 1CG9A 1BQUA 4BXSV 2EDKA 2V3EA 2X4UA 3AZUA 2J44A 2DPKA 1W0YT 5F6IB 4ELME 1PZBA 1U3JA 2FUQA 3OGCB 3UCQA 5BRZB 1WK0A 4E0RA 2XKSA 1Q0YL 1F97A 2E7CA 4PWHA 3WXWL 1U93A 3EYFA 4YX2L 5JXAH 4WW2A 3L3GB 2DI9A 2YLHA 3MMEB 5GZNA 2Y69B 4AGOA 2BP0B 3H0TB 4FFZH 4NQTA 3HZMA 3LCYA 3MZTA 2Y3NA 3BDBA 1AGBA 1DDHA 4GAJL 4HJGA 1MVUA 4QRAA 4GSQA 4JM2D 1YNLH 2AEQH 1ZA3A 2QMJA 1T0PB 3BT2H 4Y16C 3SQBB 5MHSD 3SODB 4KMLB 2ITFA 3D3VA 3W0WA 4KQ3H 2BY2A 1HZLA 3U4EA 4K15A 2X28A 3P2BA 2WP3T 3HA0A 5E08H 3GIVA 1FH2A 4H26A 4ZS7L 5JW3L 4ODUB 3VD2A 1C8PA 1IGCH 1H8SA 4F8QA 4AOFA 3OLIA 3RUGE 1UA6L 1AS7A 2EAEA 5G55A 5K9KA 2NDGA 4PV8B 2J88L 3UAAA 4ACTA 2JI3A 1H6TA 5DJ6B 1GC1L 3JV4B 1TG8A 1CDIA 1Q9OB 2FB4L 4CVWA 3AQXA 3P30H 1RZJL 2NY1D 3I6LD 1PKOA 5LWYH 3L16A 4E5XB 2KS0A 4D0DB 2DV6A 4BFGA 2YXVA 5FWQA 2EVJA 4JZOB 4KXZH 4MMZC 2VXUL 2H5UA 2NCEA 3Q9PA 4KBPA 2R8SL 1P6FA 4M00A 1PX4A 4UTAA 3TTYA 1SXSA 2EYTB 5FKAA 4ZFGL 2AVGA 3C09C 2EE2A 2WPGA 4FNSA 2IWKA 4WSGA 3WIIL 1WWWX 3MYJA 1HINL 1V55B 3W5MA 5KSBE 4ALAH 5KVDE 1JGLH 5C0ND 2QADB 5D55A 3ABMB 2ADJA 1A7QL 1DZBA 4LRIA 1L5GB 3ZR6A 5I75C 1AKJA 3DX8A 1T83C 3SDDC 1MFUA 4FXLA 1ORQA 3HI6H 4TPRL 2Y1AA 1IFHH 4JY5L 5B21A 3EW3B 4GQRA 1NMBH 4LRNL 2B5IB 4APQB 4FQIL 5KVGH 3QFDA 3MUY1 1N6UA 2GJPA 1SVCP 2O6CA 3MODL 2LGNA 1UWFA 5HY9B 2WYIA 4FQLH 2LTQB 4RMRA 1DBAH 1E4KC 5IF0B 1T04A 1RPUA 2GBUA 1F18A 1OXYA 4M61B 4WO4B 4U2YA 1NIBA 3BPOB 4JLRA 4QOKE 3Q2LA 2BHUA 3CPLB 3EGSB 4XO8A 1AQDA 5DC0A 1ZLWK 2LLNA 4P5TD 1A21A 2ZXGA 3FU5A 4UMSA 5ITBL 4E42A 2NX5E 4MRBA 4XHJD 1V3LA 3B1UA 4PG2A 4U7SA 4PW3A 2G2RB 1RURH 4N0UA 1Y6NR 1DUYA 1OARL 3K72B 5LBSL 3TIEB 4OCXH 2BSBA 5MEPB 3BRFA 4YLQT 1VFOA 3ZLQC 2CNYA 4DHLA 5C0FA 1F2XK 1FLTX 1XGQA 1ZANH 4HBCL 1PG7L 3PHSA 2BVOB 4F37F 3PWVA 4NQQA 3EFOA 1DQQA 1VDGA 3DSFL 3PHOB 1Q9KB 1TXKA 1ZIBA 3QZWG 4IW4C 4EDXA 3BX7C 1SMOA 2A74C 2CXKA 4K3EH 1RI8A 4PTTB 4GW4B 3X1NA 2Q8BH 3VRLF 1MCHA 1V3KA 3GSWB 2WYZA 4LSRH 1FNLA 2NY5L 4UQCA 4NRYB 3VFVB 3UTZB 4BK5A 3WTSA 3RRQA 3T3MB 3H53A 1E2VA 4OFKA 1QBBA 1AIFB 2FGZA 5GGTH 1KJ3L 4BHUA 5K33A 2AAVA 3K91A 3VX0A 4J1UB 3OZLA 1U95B 3O45A 3UTTD 1WC7A 2CCWA 1NIFA 3WE6A 1NGZB 5BO1L 2ZCHH 5FFOA 3IGAA 4R0LC 5GJSL 4X6CF 4QRBA 4TL5A 1DEDA 4LF3A 3OC8A 1R6VA 3CHRA 3FPXA 5IM7B 4N2MA 5BS0A 3GMRB 3NRPA 3UBGA 1KZYA 4I85A 2BS9A 1EJ6A 4Z7UB 4J27A 3Q8FA 1SJVA 4AYMC 4L3CA 3F6IA 2JVUA 1WG3A 3VFTB 1DE4A 1ICTA 3RDTA 1DVZA 3CFEB 3QA3B 1S9WB 4HWEL 2WQUA 3EGXB 2DI7A 4IBQA 1NCTA 3MBWB 3AXHA 3I6LE 3GI8H 4JAMB 2FX7L 3IWUA 4HU2A 4A04A 5HHMB 3QQ4A 5DRXB 1MFCH 3GBEA 4K7FA 3ZDYE 1YN6B 5AW4B 3U6RB 3WNJA 1SY6H 4JZJC 2A1WL 2VSMB 4NZTH 1FLRL 1OAUL 3QUZD 1E0OB 4ZDHA 3IETA 4OQTA 2EXWD 3TTSA 3KPSB 3U0WL 2BNQA 1U8KB 2WQVA 1R3LA 2VLRB 4P57A 3DRTA 2NUTB 2Z0UA 4PLNC 5D96B 1CTOA 5TTRA 3TWYA 3PUCA 2ITEA 3C9NB 3HAEB 3ARFD 5DQDL 3QP3A 1CN4A 1KULA 1I7TB 4LEOB 4HZLB 2C9XA 4GW5B 2VERN 3PFUA 4QTHB 4AM0B 2DL9A 1M7DA 2E7BA 2VDNB 1ZEAL 2VJ0A 3GMQA 3MN8A 3NK3A 2NR6D 4HJ0C 5I23A 4MKTA 3QS2A 4PS4H 2H2PD 5GGTA 3FQNA 3UJJH 4UM8B 3BLPX 3IDGA 4AK2A 1BYOA 1SEBA 4YSTA 5HI4C 1U8NA 1J12A 4X9HA 2GY5A 4LLMA 3D4GA 1L0XA 3ZE2F 4Q9CA 2R56H 2WKOF 4FYSA 5D6CA 3ZKSD 1QI3A 1PCSA 3B3IA 4UT6L 3CC1A 2GSIA 3FQUB 5I26A 3B9KA 2XV0A 1N2RB 1PIFA 4XVSL 3BUTA 3L7EA 2ZCKH 1NIEA 4UAOB 3U36B 2RQEA 4QGTA 3WFHB 3KR3L 4AUYA 4FQQA 1FG2B 2NZ9D 4G1EA 2R0KL 5E5MA 3G5YB 2VDKH 4CKQA 1OEZW 4EI5B 1N12A 5D1XC 3AGVA 4OLZL 4Z3TA 1LL1A 2X6CA 2O6EA 4PRHE 1J88A 5EB9A 2PPFA 4H8WL 1BJMA 3B2XA 3IB4A 3FTYA 4KRPB 4NJAH 4JPIB 3IMVA 4AQ8A 3VWKC 1CI5A 3K2IA 3GMLB 4Z8FH 2DMKA 3TV3L 4N5EC 2FJFB 2Y25A 1E5ZA 1T0OA 4LHQB 4XNUH 1XBDA 4WY7H 5K69A 4QO1B 2XPGB 2I85A 5EZJA 5FYKH 1BQRA 1BEYL 5DD1H 1URZA 1F2QA 4MAUH 4GO6B 5J6HB 3S5LG 1XGYH 1WLHA 5GS3A 4RISL 4PGEB 3QIBD 3K8MA 1J0YA 4Y2DD 2AV7A 1N0XL 1MCSA 4KUZH 4AVJA 4ETQB 2OMVA 1B4JH 2ZKXA 5IESL 4WI5A 4PREA 4A1RA 4UM9B 4YDLB 4PJDB 4NQDB 1OAXL 4TVPD 5DK2B 1ZS2A 4TM9A 4R5XA 1DLHA 1F8TL 1KBVA 1N3NB 1NC4B 2DEXX 3MRIB 4MD5A 3RWCB 3M17A 1RULH 3ROLB 4AJYV 2R2HA 1ZLWH 3BKML 4PJCE 3D2UD 3T0EB 1ODUA 5LGHH 2Q7NA 5IIEA 5I1CL 3DDGA 2Q7YA 3KH4A 3AB0B 5CZRA 3T0XA 1S4IA 3Q3GA 3V4VB 1NMAH 5JOFA 4FQXD 1A6UH 1U92B 5K9JL 1TIUA 4M5ZL 3F12A 4MCYB 4XPTL 1U8OB 4N8VB 5C71A 5KWYC 1A6PA 4CNIB 4NUJA 3CD4A 3MRJB 3WN5C 1VJSA 3MVSA 2AGJH 3KWUA 4MNQD 1S7WB 1UURA 4AENB 3WELA 1YNTF 3KPLA 1GOGA 3QRLA 4GJTB 4XC1L 4YEFA 5IJVA 3EG9B 1CURA 4QWWD 1DO6A 3CZLA 2Y2TA 1SPDA 4AEHH 4YHYB 1QLEH 3Q44A 4WTWA 3PWLB 4LLDA 3IJ9A 4G43B 1CLOH 4XGZB 3AMLA 3GUFA 4U0QB 3RGVC 4H0LC 4N0CC 1JNHA 2ADFL 1OSPL 5FYLH 3LPOA 2IWGA 2V5RA 1RZ7L 5K1NA 2CUAA 3QG7L 5E1AB 1ND0A 1DANT 1BIIA 4TUJA 5C0BA 2XA8L 3GT6A 3T3PB 1U91A 1QP1A 4ZO8A 1CDJA 1CXEA 4JFFA 4LASL 3DUHA 3WMPA 3FMGL 2XHNA 5IBLC 2R9HD 4AJ0A 4HKZB 1ADQL 5K93A 3O3DB 4TSAH 4U6XA 4M4RA 1IB5A 3O6FC 1E8ZA 2OMUA 4OKVA 5C7XL 1LO3H 5F1NA 3BP7A 3U7AA 2ZD0A 3AREB 1E7VA 4CKVX 3UO1H 2WW8A 2BXZA 5E1IA 3SDXB 3LRHA 4M8VA 2JLLA 3PABA 4OIAA 1KJ2H 4TNVK 3J8F7 2GTWA 4LCWB 3F01A 2BWQA 2OCFD 3V8CA 1I4FB 4N1HB 2DM3A 2EH8L 4MAYD 3SGEI 5FAAA 1SHMA 2NDFA 2WLLB 4UILL 1HN1A 3VCLA 2WLJA 1F00I 1SVBA 1O7VA 5DQ9B 4EBQH 1FFRA 5AKSA 4KU1A 1QRNE 2Z7WA 3MBXL 3K6NA 1TO4A 4PJ8B 2XWDA 3REVB 4N0YL 2XWCA 2ZOLB 3DO7A 1XR9A 4NHCL 4KKLD 3ZBMA 3I9GH 4JY4B 3T2NL 2ADYA 2XX0A 3GXFA 4MXWL 3TV8A 3VGDA 2YD4A 3AQDA 3QRGL 1IAOA 4KMTL 2D7MA 2P8PB 3HVNA 2VABA 3CVCA 2E9JA 5IZ7A 4E9SA 3GSXB 2C1PB 1WFMA 4KH2A 4RMWA 1MJJB 2VN7A 3DUUA 5CSBA 3LKQA 4QCIB 3GF8A 3IK2A 4Z23A 5I1AA 1CL7H 1QASA 3RL1A 5IR1A 1MHEB 2R23B 2NY0C 3KWWA 3QJHB 4JRXE 1YPZE 4XNZB 1UZ8B 4H44C 2CCLA 1GC1C 4BWWA 2EC9U 2ILLA 1RZJC 3BH9A 4QHUB 1CICB 5IB4A 5EO0B 2YGOA 5IEKB 5I6MA 4O2EB 2EDBA 1Z6JT 1JTOA 2P8MA 4P9ML 8FABB 3F58H 4TVPE 1FYHB 1U6AL 4K5MA 3OKOB 4GG6E 2DMGA 1TVBA 4PJHA 1HH6B 2WVUA 1M2OA 2CLVB 2G5RA 3WFBL 2XFGB 3GB7A 2XT1B 3JV6A 3JYCA 3FQ2A 1N7MH 1MRDH 5TDPB 4U6VL 1J0KA 4UTBH 3OLDA 5C9JB 4H1LH 3UOAB 1UKTA 5D72L 3VFNA 2QQLH 2CO1A 1T5WA 5C1MB 2AXFB 3VXMD 1QO3A 3LRMA 1DL7H 3QSKB 1A9EA 1RIHH 4I0KA 4MNQE 3GD1C 4QXGH 3VA2C 1IVLA 3VFUA 4A7GF 1KXQE 5FO9B 1WIOA 4XX1G 5DK0B 3V4PB 5KVFL 1JZ3A 1DVFB 4M3HA 4LCIL 3WTUA 5EUKB 2NZIA 1HL8A 2QSCH 3SPHA 2K8QA 4MDIA 4XOEA 1F3JB 4Z77B 2Q86A 4TOYH 3SCMC 1CT8B 3EYVB 4FEMA 2BS8A 3I85A 2OMBA 2F0CA 4WI8A 4NLHA 5I74C 3QXUA 5DEJA 4JDZB 4PV1C 4JKNA 2BC4B 3CDFA 3T4YA 4NZ8A 3WNNA 3W9DA 3NIFE 2VMJA 1I75A 3OPUA 4FC3E 4N2FA 4TLUA 2D31A 3CVHA 3R1GL 2WV3A 2W92A 2VZOA 2G75A 2Y06H 2Z64C 3QCVL 1BGXL 3FU7B 4K07A 3EJPA 1F90H 2GITB 1SN5A 5JHBA 3QDMB 3KPQA 4UV7H 2PPEA 5L2KD 4JKPL 4PP2A 1AI1L 1TF4A 2CM5A 3GNML 4KHTL 3X3FH 3S2CA 4GAYB 3C60A 4ONFH 4G6KH 4PRID 4LEEA 1MHPH 4I87A 5EEYA 3V6ZB 1TVHA 3E0GA 4AKQA 5DYFA 4XPBH 2E4TA 1U33A 4IOIA 1ZLSH 4L9LC 1B6DA 5MEQA 4OJYA 4GQ9L 1HC1A 4Y5XC 4M02A 5JZ7C 1U2CA 3RJQB 2ZF9A 3RWDA 5LAXA 3NZHH 4ODWB 2FH8A 5GPRA 1TTUA 2ATAA 2BDNH 5FF6B 4F7EB 4KNTA 5I1EH 5AB1A 3P11H 1CD9B 2NY2B 1PY4A 1P53A 2A74A 2IBZX 3QHZH 1AHMA 1HXMA 1P84J 2D7OA 2NY5C 3COOA 4W9EC 4L1DA 1A7BA 3NP3A 3T8XB 1UVQB 2YXFA 2EH7L 5AW5B 1QWNA 1IEAB 3QCUL 3BUBA 5HHNB 4P5RA 3A4EA 3PAVA 5A40E 1NKGA 1JFHA 4PCKA 3Q6FB 4IKLA 5E1HB 5DI8B 4AUUA 4UDTB 3W3BA 1YEKL 4DEWA 4NNXA 4EO5A 3QEHB 3UPRB 5DWUH 2HLFD 1DTUA 4HUMB 5HDRA 1FNGB 1D5XA 4KZ0A 3BEVA 2HRPL 2VR7A 3BD3A 3EOBB 3FUKA 3LN5B 4MVBD 2DBLH 3RWHA 3ARTA 5TD4A 3VXTB 5A2FA 4G82A 2WKLA 3DX7B 5JOPD 5EOCH 4NOFA 4I13B 1JN6B 4GXUM 4NJ9H 2Z1KA 4OV6F 1FGNH 2EC8A 1SJHA 1Y18B 5AYUH 4LCUB 1AP2B 3SPVA 2W0KA 4R97C 4TUOB 1T03H 1OOAA 4P2RD 4RAHA 2DJUA 2YGVA 4D0CB 3DJTA 4MJHA 5C09A 1E9OB 2C8NA 2EECA 2R29H 1FCCA 4G5ZH 2EYRB 5AAWC 3DYPA 4WUUE 5D7IE 3P77A 4L1BA 1YYMH 4ZMTA 2V2TA 5LCVL 5L6YL 2WZ6A 2HTLD 3WFCL 4AQEB 2IPKA 1KPUB 2OKMA 4PGDA 3LXCA 1MLCA 1RVFH 3X11A 4J4PC 5C0IB 4TL4A 1JPFB 4MA3A 5GGVY 5IQ7H 4ZODA 4JPWL 3ETBF 3U83A 3QDGA 3WHXB 3VGBA 1I8MB 4BKLB 3D4CA 1D6EB 1PEWA 3MR9B 3QI9C 3U4BH 3L2NA 5CIPB 3WS6C 2DQHH 4WU7B 5CP7A 3ATBA 2GAZA 4OV5A 5EU6A 3FCUB 1LXMA 3HE7A 2D9QB 2BSEA 4C83B 4UNTA 3DMMD 4TN9A 3VMNA 5JHLH 3Q2WA 2EDWA 2CZNA 4OI9A 5C08A 1Q1JL 4MCZB 3KJ6H 5EBWB 3VG9B 3PL6A 1HNYA 4ZMZA 2KPWA 3G5VB 1YMMA 3IBOA 4FJYA 1FJ1B 1ZAGA 4K23H 1AQHA 2V9QA 1TEFA 3VXPB 3K74B 3T4AA 5IMMB 2B59A 2HZHA 4JGNA 1T0NB 5HD8D 5J7CC 4FG6C 2VDPL 2BX5A 4GXUN 4Y1AB 2SEBA 1VGEH 2K70A 2NXYD 2QLYA 1HZHL 2B3RA 4HS6A 3KYMA 4ZUSB 3RGHA 3CHSA 1XZ0A 5L2KE 3GMNA 2NPLX 2VKXA 3HE6B 2NW2A 4PRIE 3K71A 3DSNA 4IK7A 3JT0A 4H8WC 5TE4L 1W0VA 2Z35A 1OW0C 1BFSA 1INEL 4WAFA 4Q58C 4A39A 1F41A 1L9PA 4DPRA 3MRMB 5I6XB 3FU9A 5D7LB 5AKRA 5DWPA 5INDB 2B4CL 2J1KA 4Z0XB 1JV5A 3VXUA 3VWKA 2VXTH 3HN5A 1GSKA 5GRYA 4BQBA 5HGHB 2E0PA 5L88H 5E6YA 2VE6A 3D07A 4YLCA 4F1ZA 4JPVL 1VB9A 1AR1B 1I3RB 3QG6B 1N59A 4DSYA 5ICYB 4YSPA 3IBEA 5TQ0H 3FO1A 1JF1B 3OX8A 1FVDA 4C59B 5EF2A 4DKFH 1FUNA 1G4MA 3TCLB 4B3VA 3BGMB 5L4IA 2WD0A 1JI1A 1VEPA 2EYSA 3MV9D 2BP8B 4YR6B 3WKML 2X2JA 2BM3A 2GJ6B 1E4WL 1QI5A 5EU4A 5E8OB 5ICZA 3QYCA 2RIKA 2F7IA 2ZG2A 3VXSA 1Q0YH 2AFNA 2HX7A 1SN0A 3WXWH 1T3FA 4PY7B 3HC3H 1BQLL 4YX2H 4ZNCD 5JHLA 2AQQA 1YQ2A 2OX5B 4EMZA 2GPZA 4ZS6D 1X5XA 2VZTA 1EZUA 3B9VA 4X5WA 1KJMB 5H94B 1EIBA 2VYRE 3PYCA 4CMHB 1IILE 2CLRB 5E00A 4ATTA 1JZ8A 5ILTL 4EN3D 2CGRL 2EDNA 4IS6B 1FN4B 1HHJA 5HDBE 3HG1D 5CINL 1YG9A 1YYCA 3E9TA 5AW2B 3ULVL 5MENA 1DJGA 3OV6A 1Z9NA 4P2RE 1P9MA 2F15A 4WU5A 5JHMA 2LFGA 4RGMB 1L9QA 4ZS7H 5D9SA 4MXVE 5FO2A 1UA6H 1X4XA 2QQKL 3QO1B 1GY2A 2FQFA 1LO4L 4KTDL 3V5DB 3EUDA 5IVZB 3OXSA 5DS2A 1S9YA 3QUYC 1GC1H 3O2DA 1EZVY 5DZPA 5B4MC 5KEZA 2FB4H 2H32H 5KSUB 1RZJH 4K0OA 3STBA 4L8SC 2KLRA 5HPMA 5F3BB 1ZCRA 2XN9B 5FX3A 1CFTA 5J89A 5ID0A 2CAKA 1E30A 3ILPB 3L3KA 4NZRL 2IG2L 1LJMA 4P5MA 2C4FU 1BVZA 2CJ3A 4A2GA 4C47A 4U6HA 2VXUH 3KG5A 2WQXA 5B38B 2R8SH 4GQPH 4HKBA 2H2SD 4AYBA 4OZIA 3CSBA 3BISA 2ZYIA 1XF2B 4ZMOA 1CE6B 1QABA 2RBLA 2GBAA 3DHMA 3EH4B 3WIIH 1PKQA 1NBYA 2X09A 4JKLA 3WMSA 2WLMA 1HINH 3NZUA 1RZKL 2A6IA 1ET5A 2VDOL 3IDMA 4FI6A 4EUPH 4Z3JA 1BLNB 1A7QH 4YE4L 3ROOA 5MERA 1UENA 2CUMA 4OGAC 1PG7X 1Y1DA 3QS3A 4XPFL 3I6GA 3C12A 3PP4L 5CZXD 2UWEB 4TPRH 5BMFL 2IJ0C 1MZYA 3KPNB 4JY5H 4QRQB 3ME0B 5I8EA 1A3RL 1IJNA 4DVBA 2HKAA 3IN2A 4LRNH 4FQIH 2HRHA 4TQ8A 3FUHA 3HLAB 3MODH 5J0BA 3VFRA 3AAZA 3GZPA 4XVUD 1CBVL 1AZCA 2AQTA 4OCSL 4LSUL 2EE3A 4IBUA 1RP8A 1MCWM 4TNWF 2KUTA 4WJ5B 3GHEL 1HHGB 4JBSA 3KMDA 1HHKA 3BQUB 5IEHB 5FK9B 4DKEH 2YMOA 3DTXA 1PY9A 3IF1B 3M8OH 4DK5A 2H3XC 3P40A 5EC1A 3QULA 5HVHC 5ITBH 1T22B 1E9PA 3FQTB 1KIQB 3NSFA 1LE9B 4ZMWA 3NFNB 5HGGS 1IAKB 5AKVA 2HFFB 1EEUA 4GP8B 6CGTA 1OARH 1FBIL 5LBSH 4MJ6B 3VXNA 1IT9L 2YQBA 4GB9A 3C8DA 3BFWA 2WXMA 1MRFL 1FZKB 4HBCH 4PGBA 4B9FA 1PG7H 3UAJD 1AG0A 1IBDA 2ZYRA 5DMKB 3MV9E 3WUWA 4HP5A 2P5PA 2CALA 3DSFH 2PXYD 1IM3B 4JRFA 5FCUL 5BCAA 4FTVB 2XVBA 4H13C 2CUHA 4ACPA 3GS4A 4JFWA 3REWA 4JO4H 4WW1B 4A6YL 5C0JA 4UUJB 5ERWA 1IM9D 3TIDA 3CH1B 3JWNG 4KTGA 3NN8A 1NKRA 3U46B 2NY5H 4KKQA 2IQAA 4MZRA 2YQ2A 3UTSA 3OKEB 4KKPA 4P2QB 4OUUA 4RZCB 5IHLB 3P4NB 5HYJB 4FNLL 4DP2X 1I9RL 1GGCL 3KPOB 1IU1A 1BZ9A 4CRPA 2YEVB 4NO0D 5BO1H 5JXEA 3R19A 4XAWH 3CVIL 3HG1E 5GJSH 4L4TD 3WS3A 3AROA 3CX2A 3N43F 4AIZA 3QIWD 3B6SA 1WS7A 3FFDB 3KM2A 2O6PA 4LARH 4Y5VA 5D1ZC 5CJXC 5KYWA 5DFVC 2A6KA 5I73B 2R39A 1I8LC 2RD0A 4PR5B 3QHFL 1ZVYA 2Y7QB 1QVOA 4MB3A 2GQHA 2XLLA 1KJVB 1T7YA 2XWJA 2K6YA 4NXSA 4ZFZB 1FO0A 4PHZA 1JIBA 4QRRD 3P2DA 2VDRL 3QFJB 4GSRA 3QRFM 1FF5A 3H55A 4HWEH 3MJ6A 3G6AB 3OKNB 4N2NA 3VFGL 2C1OB 2FX7H 1AANA 1EAOA 3BLBA 4ZMLA 2BSSA 5EU5A 3SJVD 3SDXF 3DX2A 4YSOA 5SWZB 3AS2A 2NMSA 2PLTA 3ZQXA 2G3NA 1R3JA 2CHWA 2FQDA 2A1WH 4PW4A 2YFOA 1I1YB 2W0FA 3VRLE 1FLRH 1OAUH 1KNOB 4HAKA 2F8OA 3L13A 4V1DA 4WFED 1EERB 1YJDL 3QORC 3UZQB 3UJTL 4DEPB 2Z7YA 1R3HA 3W82A 3U0WH 4U0RB 4AM0Q 4FAAB 5C0RL 2E75C 3K7UA 2CHXA 3KWXA 4LPCA 2VOTA 5B1KA 2DL2A 2IFGA 4B96A 3VU2A 1CUOA 2WIIA 5DQDH 1VFBB 1NBQA 4M3JA 3SGKC 2YD2A 4BSVA 3G6DL 4Q2ZA 4XH2A 4PJEA 5ICUA 4PB9L 5GGSB 3BSHA 4MS8C 1S9XB 5KJRL 5LXVA 5AW1B 3V0AC 1B9ZA 1BHGA 4HG4K 1FNEA 3F64A 1HQ4B 4J3UA 4C8XA 2IH1B 2VQ1B 3V0HA 1E3XA 3QEUB 3VD3A 4U7MA 1YEFL 2V8LA 5CFHA 4K3HA 3IAPA 1WYJA 4WIQA 3U2JA 1OLLA 1QUPA 4JDTL 5D7JC 3DECA 2A9ML 2WTPA 4FNQA 1J18A 1GZQA 3V0VB 1EFXA 3TU6A 3ZDZE 4UT6H 5FUZL 4KDTA 3FT4A 2OXGB 4XVSH 3K1DA 3EF7A 3IU4L 1NDMB 5IHZB 2FDBP 2R1XB 3O4LA 3SPIA 3KR3H 2F08A 4KQ4L 3UGXA 3BVXA 1H0DA 2R0KH 1U3HC 2ZWKA 4Y0GA 1Q1PA 1QHOA 3VI3A 4OLZH 2JJTC 3EOAB 2Y7MA 1JWUB 3VXQA 5LBVA 1DN0A 5D71L 1MH5A 1ZS8A 4H8WH 1M57B 3RLSA 5IQOA 5AZ2L 4RFEB 1UG9A 4KVCL 3LKRB 4LP4A 3MROA 1OWRM 4KK9D 4Z78B 4PWKA 3TV3H 3M1BB 3RPIA 2GC4C 2GSGA 5F0JB 2X53A 4IKIA 1VPOL 2C4FT 4XNQB 1NDGB 4YHPA 1IAII 3NIDB 1F1GA 5FYJL 1TT6A 1WWAX 3D1MC 2X4OB 3L9YA 2DZEA 5E5UB 1MKFA 2IAAC 1M7IB 4NKDA 3BRGC 1BEYH 4HWZB 4DWHA 4U1IA 2IOOA 2RGSA 4AX3A 1I1FA 4ZTPL 5KYXA 3DV4B 3RVUD 4RISH 2HN7B 4I0PD 2ODIA 1CXHA 1N0XH 5F1KC 3OJMB 4M1CC 4EIZC 1DQJB 4KX7A 2WCGA 4PMEA 4I18B 3G6JB 2J5WA 2DYPD 1ZD6A 3DOSB 1QFWI 5E94B 5EUOB 2H6PB 2HLEB 1HE8A 1OAXH 3MGTA 5JDJA 2CMRL 5A43C 2OMWB 1F8TH 4QHKI 3ZE2E 5D1QC 4OAWA 1WPCA 3CX5J 3QXDA 2R51A 5FA3B 2PW2B 5HGAB 3DROA 3NCEB 1OAJA 3M1OA 4Z18A 3KDMB 2DI8A 1A7RL 4J8RA 4OU3A 3C2SA 3PIQB 3STZB 4DOHB 5TH2B 5IQNA 4J3TA 4X9IA 1MCEA 2ATKA 5KOMC 1RJLA 4MCMA 4XO9A 3RZCC 5K9JH 3S9DB 4M5ZH 4M93C 1LDSA 4WI2A 2W59A 4XPTH 5E8NA 4NC0B 4QRRE 3BZEB 1I9EA 4I48A 4Y19B 5IVOA 2NCMA 3NACL 4JVWA 4GW1A 1A7PH 4XC1H 1TQBB 4P23B 4AWJC 4ZAKD 3U1SL 4P2OA 5AFAA 2EKJA 3MLRL 2P49B 3SJVE 3DK0A 4DPCX 2P80D 4CU6A 2X6AA 3L2LA 4R2GC 5TE6H 3V4UL 4KAQL 5GSVA 1XCXA 1RZ7H 1P7BA 4XN9A 2XTJE 5CJ8A 4XCNA 4X6BB 4YAQB 3DPBB 3QG7H 2O61B 2OMZB 4GUOA 2ZP8A 4JO1L 3VD5A 2B4CC 2XA8H 3BO8A 3WKPA 2YPVL 4LSSL 1G7HA 1P7QD 3EYUL 5JORB 3IFOB 4RGNC 3ZHKA 4LASH 3G04B 5BUGA 2D7NA 4N2HA 5I82A 4KRMB 2WLYA 3FMGH 4G6ML 3TZVA 2H7WA 1PQZA 1ADQH 3MO1B 5F93C 1TKWA 3AXIA 1EEZB 2H8PA 2HFEA 2VR6A 2HJLA 3MV01 4L3EB 2OL3L 2A4EA 1FFOA 2IXQB 1P1ZA 4JRYB 4QYAA 4BFEA 5C7XH 5GZOD 4MNGB 1MFVA 2H4EA 3OC5A 3RI5F 3IJHB 1PPIA 2DIJA 3TBYA 4KK8C 3H9SB 2HT4C 1Y0LB 2R27A 4JUTA 4YL4A 4AT6B 1MWOA 3UIYA 5K5YA 2ETWA 3F00A 3PQYB 3FUNA 4UYQA 4B9CA 5I5MA 2AZUA 1Q38A 35C8L 3PWPB 4XO5A 3ECVA 1WBXA 2WYTA 4R7NB 4OI8A 2ZXWB 1OL0A 4PVNA 3PWNB 1CG9B 4WWKC 2QBWA 2ZZUT 3C87A 3ZHFA 4PW9A 3H6AA 4JW3A 2WSDA 2AF2A 3BI9X 3MBXH 4PSRA 3WJLC 2QR0A 1JGIA 3QEQD 5KS9F 4E0RB 1E6OL 3L7FA 4NHCH 1QW9A 3D09A 3T2NH 3EYFB 4MXWH 3WIAA 3ULVC 4WW2B 3QRGH 4I9WD 1UT9A 2HRLA 2VR3A 3NDZE 2PTTA 2NY6D 4X9BA 5EA0L 1DDHB 4HJGB 3KE0A 5AOIA 5I66A 1XH0A 4FQHA 5JQ6H 2XBZA 4P3CH 4OZHA 3BUYA 1QLRB 1RJCA 2X1XR 1H9DA 1AQKL 2FWLB 5SWSD 3MNVA 3BVWA 3D3VB 1J9TA 5ID1A 4KROB 4QKTA 3TJHD 2CRZA 3UZEA 4L05A 4UZUA 4XRCA 2EE6A 5GZND 2H41A 5DYOB 5EBLA 4F7TA 4F9PA 3AT8A 4CUCA 1H3TA 1LEKB 4GP5B 4OCYL 3TO4A 4H26B 4ADGA 3QUYA 4KRLB 4P4KB 3LH2L 3CFCL 4N2LA 3TN0A 3FT0A 4L8SA 4RFOH 1BMGA 5DTFA 1M7UA 5K9KB 1IKOP 4ORGB 4P9MH 3V79C 3W0WD 4GRWH 5DHVB 1EDQA 1LO5B 2J6WA 5T1JA 3ALPA 1U6AH 5EWIL 3VM5A 5B38G 5DJDA 1L9NA 1X6NA 5B1JC 4ODHL 3B7YA 4IJ3B 1LE5A 3LS4H 4KK6C 2K4AA 4UOZA 4JJOA 5GS2H 5AW9B 2VLKA 1IGFL 1HYSC 1LQBC 4MTMA 5D72H 1RZKC 3UJIH 3W11C 4D2NA 2QFRA 1F4WH 3CXFA 3ORJA 1U42A 4WHDA 4GIOA 2HTKD 5IW6A 2WN3A 4RCAA 5I71B 1AGCA 3L48A 4RQQB 2OZ4L 4GIPD 5FKAB 3MU3A 3BMVA 2FECI 5KVFH 3QWOA 3MYJB 4W9GC 4LCIH 5K9OB 4X5XA 4HS3B 3KCWA 3V6FA 1CLZL 1XL4A 4X4ZA 1UCTA 4E41E 1VACB 4TSBL 5C0AA 3A4AA 1SYSB 3JUZA 5ANMB 1AKJB 3UBXA 5F1OB 1J8HE 2WQRA 2EDYA 3GSNL 2RA1A 3HC4L 1EJFA 1JG9A 3VD0A 4EPSA 2BCKA 2F8XC 4QAMB 4EZJA 4TQPA 3R1GH 1PZUB 3L5WA 1QPXA 1LP9B 3QFDB 4OZGB 3QCVH 3L4CA 4LLVB 4PJ5A 3BUPA 3SE4C 3F7LA 2X7LA 2R4RL 5K9QI 4MZ3A 3RWJA 2EO1A 2EDLA 1T5XA 4JKPH 3N3EA 4LESA 4KHTH 3GNMH 5I16B 3WNPA 5E2VL 2QTVA 4JLRB 1RSYA 1V27A 3V5KA 4PTUA 3ARDC 4OJEH 1U4EA 5CP3H 2YZ1A 3WUWG 4L2LA 3IRCA 2X70A 2BSTB 5DMJB 4AL8L 1RJYA 2PCPA 1T80A 3CIQA 4E42B 3M46A 2X9XA 3MJGX 3EJQA 2B1HL 3CSYA 3UAFA 4IGBC 4PJFE 4BJLA 4JZNB 3AQZA 1CE1L 3BPCA 5EU3B 1G7MA 1DUYB 1A4KB 3PHAA 5LNDA 4TVPL 2YUVA 4RMQA 1QZNA 3CFKB 3FQWB 4OGZA 3SD5A 1ZSDA 5C0FB 3AXLA 3K6SA 1NJ9A 1WISA 4JGJA 2YAEA 5I17A 3IJ8A 1PX8A 1KDIA 2EH7H 2W60A 3I3EA 3PWVB 3WYRA 1PYWA 3EFOB 1QBML 3QCUH 4ZG1A 4Z5RA 4IDLA 4EDXB 2AVFA 1PJWA 4WKZB 4Y2OA 4HHAB 2AQ3A 3QEQE 2AAAA 4U1SB 3NSDA 1HJCA 2WJ5A 2FJHB 1YEKH 3I3DA 3C5ZC 5C92A 3PXLA 4KY1L 4P04A 1PEZA 2EINB 4G83A 4I9WE 2FX8L 1W0WA 1ZHBA 4H25A 4ZQKA 3IFPB 1J0IA 4HAFA 4YHNA 3ZYJA 1K3ZA 2HRPH 3R06A 3ATFA 1WGOA 1M7XA 3DPDA 5D1ZA 5CJXA 3HKZA 5E8PA 2YUXA 3IGAB 4ZXBC 2W94A 3H9HA 5DDHB 5SWSE 3O8XD 4LF3B 4OH2A 4DUWA 1IGJB 2H26A 2CBTA 3LXUX 5BRZE 2E9GA 2IWEA 1LO0L 3K8KA 1A14L 3OKKA 4YXLL 1WUZA 3P4OA 4JJ5A 1AE6L 2X42A 3S37L 3RVXC 4ZUWA 4JR9L 3QDAA 1JV2A 2FATL 1SUHA 3ZMEA 5FFGA 5DA4A 2Q6WB 3ZZSA 1IAIL 1ADWA 1S7XA 5FO7A 5HBBA 1HCYA 4ZW5A 1JYWA 4OFDA 3RDTB 5HHOA 1NCBL 5LCVH 3GRBA 1H6UA 3QUHA 3WFCH 2WLNA 1ZDQA 5CP3A 5GS1A 3H6JA 1YJDC 4WWPA 1R33A 4RMTA 3WDJA 1UC6A 2XZCL 3HBGA 4JPWH 3O9WC 4M43L 4WFGD 1M2VB 3D51A 4K7FB 2E7DA 2WC7A 4L8CB 1WZAA 1XB3A 2XA3A 3K46A 3IAQA 3ZE1B 2OP4L 4X4ME 2J1YA 5FFLA 3RFZA 4YDMA 5LGYA 2BNQB 3QZLA 1R3LB 4P57B 3GPSA 1MY5A 1DSFL 2ZWZA 3C5SA 4EIGB 5FYJU 1Q1JH 2BIQA 4LCYA 3W39A 5D7HA 3BH8A 5F97E 1FNAA 2GCYA 2VISA 3LKOB 3ARGD 3H9YA 4LSDA 3G08B 4JE4B 5BV7L 2NY3D 4NKOB 4JFUA 4JM2C 4NKQB 3A4FA 1G7LA 1HWGB 3K8LA 1XT5A 5KG9A 1CPUA 1AH1A 3QPXL 4LHJB 4HXAL 2DJ4A 5GRZA 4BIKA 5IFJB 4Z7VB 5FW6A 2VDPH 2YOCA 2PTVA 5TDOA 1N0LB 5L7XL 4YMPA 3DYOA 2ZX7A 1FPTL 4YBLB 2B3IA 3IDGB 4LCCB 2ORBL 1IQDA 4LNRB 3N9GL 1QAWA 4ZNEE 5C7ZA 2AHIA 1PL3A 3FQRA 3TVMD 3CVDA 3MNMA 3WU1A 3EUUA 2F7PA 2VLRD 1YDPA 4MLSA 5I0XA 1IGYA 5D6CB 3F7YA 1AOZA 2GSIB 5TE4H 1FE8H 3B9KB 3DIFA 2Z4QA 1INEH 4Y4FA 3IMTA 2MKWA 5BOPA 5HXMA 4EZLA 2HH0L 4S1SL 2B4CH 2NY1C 3E1F1 5E5MB 3T6VA 2DQIL 1U8JA 4Q9RL 2A38A 4LKCA 3BUQA 2CDEB 4JKKA 4HCRH 3QXAB 1FVCA 3QFGA 1NGPL 3RILA 2F2HA 4HFUL 1ZA6B 1CD8A 4CJ1A 3WE1A 1N4XL 3TA4D 4JPVH 1G6RL 1FFPB 1TFHA 2XXCB 3NFSL 4BSWA 5JMOC 4QRFA 5DMGC 1ZXQA 3ATDA 4KO7A 2G3MA 2NW3A 1DVTA 4X99B 3KW8A 1WHOA 4NN7C 3NK4A 1T66D 4L1HA 3VX1A 3BDYL 3IGKA 1PD0A 3WKMH 1IC7L 5EZJB 5EN3A 2YFNA 3DK2A 5C0NC 1E40A 2ZUXA 3VH8G 1E4WH 4GSDH 5E2WL 4HT1L 2AK4D 5ACMA 4EI5D 3MLXH 5I1DB 4KK5D 3WDHA 4JPQA 4OFYD 2AV7B 1QRKA 2YGQA 5D1QA 4TLTA 1EZSA 1JAEA 2OMVB 1NUNB 2PYEA 3GXIA 2BSDA 3RHWF 3VQMA 4NN5B 3KLSA 1KCWA 3BC9A 4NHUA 3L3OB 4U7KA 5ILTH 2RH0A 2XPZA 2CGRH 1KGJA 2GJZB 4MD5B 2OSLA 5I24A 1S9VA 3PGDA 3BD5A 4GXVH 4MXQD 5CINH 3ULVH 1UADC 1MCKA 2EE9A 3R8BB 2Q7YB 3V4PL 3Q3GB 4FMVA 5JOFB 3FN0L 1TCRA 3ULUF 1UOKA 3ARUA 4IMKC 3GRWL 4LVHC 3AY4A 4XHJC 5LXGL 3HTLX 4TSCL 4NQEB 1NOAA 4QRTA 1J05A 2QQKH 1CFMA 3KPLB 4MZ2A 2H1PL 3TT3L 5IJVB 2QLVB 2VW6A 1LO4H 4KTDH 3EGDB 4UM9D 5KVEE 1G84A 4B5ZA 1N26A 3SDAA 4O4YL 1JWMA 1F4AA 3BWSA 4PAZA 5SWQA 3MCKB 1K4DA 4LLDB 3T0ED 3ENEA 1I9IL 4WFGE 4NKMA 2CO2A 4J3OG 1JNHB 2BNUB 2NT1A 4UQ9A 4NZRH 1WD8A 2IG2H 4HCRA 4YHIA 5C0BB 1DQLL 1WZ1L 3L4XA 1KYUA 4AY0A 3MUHL 4FD0A 5I1KL 3N0PB 4IRJD 1FFTB 4JFFB 4KGJA 4P3WA 3CC5A 4DP0X 4Q4EA 4GUQA 1VFUA 3O3AB 1PSKH 1QR1A 1UATA 5JHDA 5KJ4A 4YHZL 1QSEA 4IBWA 3OMIB 2DYRB 4NQCB 4Z7QB 4KWUA 2M26A 1RZKH 3VB8A 1KBPA 3LMJH 1Z9MA 2N1KA 2OMUB 3MRFA 1FIGL 3IKCA 4YE4H 3LPGA 4OKVB 5EO9B 2ITDA 3BP7B 4OQ1A 3V0FA 3E2HB 3K6FA 4XPFH 4D9RD 2FECL 2VN6A 4EAEA 5BMFH 2G4GA 3DJSA 5DLML 3K2UL 1A3RH 1USQA 2VR5A 2GTWB 2NYYD 2GVYA 5EC2B 2JKXA 3UO8B 1JD7A 1KCSH 3BVDB 1CBVH 2VLRE 1NPJA 2MKLC 3J07A 2R1WA 3G9AB 4OCSH 3WLBA 4A37A 4PJ9D 1QG3A 4HZAA 1A6TA 3GHEH 3I84A 1CQKA 4S10A 4ENEC 4HK3J 3AGWA 5DRZB 1L3WA 1PS3A 1U8CA 2IANB 1S5HA 1Z7JA 2X2YA 2WXGA 3O0RL 1P69B 1W91A 1YEIL 3DO7B 4TTGA 1QWUA 3OJDA 1N5YH 1R1CA 4K73A 3X3GL 3QQ3A 1A3ZA 1MCLA 1WF5A 2BIIA 1IAOB 2PWFA 4RETB 4Y16B 2OJ1A 5C3IA 1RZIA 2HPOA 4MQXD 2WYHA 3IEAA 4PJIF 3GM0A 2VABB 3CQQA 4NDMA 4UBDD 5JIHA 3RIKA 2A4ZA 2NUPA 5DMIL 1ZDSA 4C4KT 1IT9H 3Q8CA 1QLEB 2NQ3A 5L9DL 1A3LL 5H35A 2PETA 3DUUB 3LKQB 1MRFH 1PD1A 4G80B 2X9WA 3RL1B 2IBZY 2X4TA 3NZ8B 5FCUH 3OKDA 4PJ8D 1OAKL 1UJ3A 4WV1A 4N8UA 4HOWA 2AK4E 3ZZQA 1QQDB 4G9DB 4M5TA 4A6YH 2WLKA 1OIOA 3OG4B 5DS1A 3BH9B 2ZPKL 1RMFL 3HI5L 4GBXA 5KANG 2XICA 2ZWLT 3TS8A 2I9TA 1HXYA 4J3VA 2NR6C 4AGNA 2CG9X 2JB5L 5B1JA 3KCPB 3E6FA 3DGGA 2H2PC 3KBPA 3X2QB 4C57C 4HHWA 5D96C 5A3ID 5C9KA 2R15A 4FNLH 5EOQL 3TCXA 1I9RH 1GGCH 4MMZB 2OJZH 1TVBB 4PJHB 1A1NA 2Z0BA 4MAZA 1R75A 2FSEB 4KH9A 3GB7B 3CVIH 3Q8BA 4R96B 5F0MB 4ELMA 3WTVA 3IDIA 2PWGA 3UBXG 5E2JA 4KI5F 3S35L 5KJ7E 3T08A 3UP6A 1Z9SB 3GKWL 1OP3K 1R24A 5IVNA 1KJ2B 1D7CA 1T5WB 2DTML 1EGJL 3H42L 3L4UA 1MCFA 2NZ9C 1XL6A 3QHFH 4K3GA 4OD3L 3ZQWA 1CICD 4Q56A 1QO3B 3BIAX 4N2GA 1A9EB 4PWJA 4QRUA 3UDWA 2Y5TA 5DHEA 4ZUVB 3VFUB 2DLFL 1RUPL 3C6LA 1U8MA 2JK5B 4J3OF 4YDJA 2AANA 4ANVA 2VDRH 1ZT7A 2CPCA 4G6JL 2PF6A 1UYWL 4GRLD 4PJDE 1MIEL 3MNDA 4MDIB 4LDOB 5DO8A 3VFGH 1B0GA 1RH8A 1X5AA 3T0EE 1GH7A 3MAWA 1IZJA 1EO7A 3H3BC 4JREC 1JJUA 1DJWA 3OB8A 1R5VA 3T4YB 3W9DB 1F1DA 4NQVA 3EAKA 2IAMD 5J5EA 1MW0A 3RUGA 2G75B 3L9BA 2OCJA 2ZE0A 3N55A 5FA4A 4ANKA 3QR1A 4KRPC 4KTEL 4W6YB 3BVVA 3ARDA 5CFAA 4N0FA 1IBGL 4AL8C 1YJDH 1NCAL 3QIBC 2X4NB 4Y2DC 5H2BA 3UJTH 3ZKMC 3HHSA 3BN9D 2G9KA 4GRMA 3SPJA 1BVOA 4HIHB 5C0RH 3C8KA 3SKJL 1TVHB 4B41A 2D3LA 3MQIA 5IOPA 5EZOL 3F7RA 3G6DH 5KJRH 4PB9H 3D0VA 1D7BA 2WVVB 1NM4A 4TVUA 4D9RE 2Y36L 4HX1A 3CLFL 5DU7A 1PZAA 4TVSa 1OM3L 4Z0BL 1C16A 4XMZA 2DWTA 3P2TA 3C60D 4W9LC 1EXUA 5TPWH 4FQXC 1AD9A 2ADIA 2XQYA 2X38A 5T3ZD 2D7QA 2VW7A 2UY6A 1YEFH 4YDLC 2A74B 5KSBA 1E5CA 3BKJL 1HXMB 5EIIB 3A6CL 4JDTH 3SKNA 1CXIA 4G42A 1AJ7L 2A9MH 3N44B 5CZVL 4LVEA 3QDJB 2CGYA 2VLJB 3S7GA 3DI3B 1GZHA 1Q9LA 4QWWC 5FUZH 1JK8A 2YD1A 1MEXL 2YJLA 4FGMA 4UCFA 3VYPA 4H1LB 3GSVA 3SQOL 2WNGA 5ESQA 4HIJA 4QRSA 3VFSA 1TQSA 1KCKA 4DZ8A 2TSBA 4KQ4H 5AAPA 2CRIA 1P5VA 3O6KL 1ZLUK 3ZW3A 3SDXE 1AHWC 4Z7OB 1ECYA 5DJ8B 4ZXBA 2Q2EB 4NRZB 3AJ7A 4R0LB 5IK3B 4ODXA 5D71H 3BEVB 4G8FB 5AZ2H 4KVCH 4YO0A 3QO0A 3RWHB 3BQVA 4QOKA 3DUSA 1MIML 2BOBB 2FH6A 3CMOL 3PS6A 4HFWB 4GKZA 4F2MB 4WWNA 1VPOH 4QPEA 4WFFE 4KKZA 1DQIA 3CZGA 4XNAA 3WXVL 5FYJH 1T5KA 3LRSB 4R3SB 1UD2A 2NX5A 3RZWA 2XYBA 3BLKA 1SZNA 2JB6B 1J8RA 2ZOKB 3L95A 5CU9A 2BWIA 1Z2KA 3PPSA 4HUCA 4ZTPH 4ZUTB 2OR7A 1AIZA 5C09B 2VUYA 5GIRA 3MI6A 3R4DA 2Y2WA 3CMGA 5J1SC 4PLOB 4O51A 1N5AA 3MJ9A 4PGDB 2Y4SA 3ATEA 4YSCA 3U9WA 1M05A 3B56A 2VZSA 3OTTA 3X11B 2PWHA 5D6DA 1Y6MR 1WT5A 1TZIA 4W9JC 1KBGL 3QDGB 4EI0A 3BWAA 3ECBA 3NIGF 1JXKA 1LP9F 4ZMAT 1C9SA 1PZ5A 5CP7B 5AVXB 4ANUA 5BV7C 2GAZB 4IU2A 2CKBL 2BFVL 5DZVA 5EU6B 4Q52A 4KKLC 1HX0A 4UWQB 4A2HA 4XNMB 4JM2A 3WIHL 4MJJA 1BAGA 4JG1L 2D3VA 3NACH 1XCTA 5L4JA 3KWVA 4EQ2A 3JWNE 3U1SH 1DVXA 1MJUL 2WXKA 5IHUH 2QEJA 4EF3A 5IROC 4HWBA 4I9XA 4IIQC 2KLSA 3CN1A 3HE7D 3VQ1C 2BSED 1U58A 1PD6A 1JSYA 2AQPA 1PU0A 4XN5A 4KAQH 2X4QA 3FTZA 4X4XA 5F1SA 5C08D 5EDXA 1EHXA 2SEBB 5GRJL 2IGFL 1F4YL 3A5VA 4G72B 4HS6B 3PL6D 4JO1H 3DHUA 2OXHB 1XZ0B 2Z8RA 1YMMD 3AM8A 2YPVH 4QT5B 3KD4A 2EUXA 3EYUH 3TBWB 1WD9A 5IJCC 1QACA 2X4PB 2NW2B 5CILL 1I7RA 5IB1B 3K71B 3DSNB 1XB6A 4F33B 1SDDA 4NIYE 3CXDL 4G6MH 2PKDA 4Y7MA 4HH9B 3MUUA 2CQVA 4XMUA 3WNKA 4HIEB 1UFUA 3S4SA 5HDQL 3QEGL 1OP3H 2OL3H 4C58B 1JV5B 4TLSA 2HXAA 4M9PA 4PJBB 5ESAA 3DJ9A 3VWKB 2CK2A 2Y6SC 4OD2A 3ZDXB 4CSSA 1B4TA 1MLBA 1OHQA 2F9BT 2DD8L 1F13A 3NG5A 4JG0L 2QKSA 3ETSA 1I9JL 2VE6B 4D3CH 3BH4A 5DURB 4UINL 2JJSA 4PJXB 2FWUA 2OLDA 5T3ZE 3AWFA 2QHRL 2QPDB 1N59B 2AJVL 4ZFOL 4L0YA 3O6ML 4JNXA 1NGWB 4A7VA 4G3YL 35C8H 4UT9A 1MCNA 1MCRA 4IHOB 1BECA 1ZOXA 3BIKA 1BLIA 1NGXA 2B1OA 4H7VA 1GS7A 4OJDH 1HS6A 2HRGA 5DZNA 5EU4B 1E6OH 3MCLL 2C3XA 4HLZG 4HV8B 1ONQB 3WCYA 5IT2L 1T3FB 2XTSA 3SIKA 2DIEA 2Z93A 3US9A 3PUUA 4FFYL 1HWHB 3CBJB 3GXTA 4XPHL 3MV8B 4P46A 4P4RA 1MJ8L 1OK8A 1SGKA 3K4ZA 5E03A 5T1KA 5E00B 5EA0H 1B0IA 2HKFL 2XKNA 3Q5TA 1QFHA 3IRZA 4OF8A 1EAJA 2BS71 4P5TA 4X8XA 5FGRA 5JPMC 2EEBA 1AQKH 1HHJB 4X7TA 1MHHA 5B39G 4IMKA 4D94A 4WUKH 3WN5B 4UU9A 2H47C 4XNYL 4PRHA 3MRQA 1PFOA 2D7TL 2LABA 4M1DL 4KX8A 4LPWA 3NJXA 4WU5B 4EDWL 4K55A 3E9UA 3FONA 3ZQ9A 4OCYH 2JCCB 3CCHB 4FNRA 1IAMA 2YPVA 2G5BB 1HKFA 3LH2H 4DGIL 1D5RA 5HGDA 1W6LA 3RKDD 5CCJA 4BQ9A 3RGVB 1L9OA 2PPAA 2TRYA 3UYOD 3OXSB 4S1RL 5IV2B 1S6NA 1S9YB 2DLIA 3UMTA 3JTSB 1P6WA 1ED3A 5HPMB 2XJKA 4HGWB 3HFML 2LQRA 1F4HA 1MPAL 1CFTB 1LLAA 1YEDA 2MWCA 1ZLUH 3B2DC 3L3KB 5TF0A 1QEXA 3VGAB 2KDGA 1CIDA 2Z8VC 1IGFH 2N7BA 4U6HB 2AITA 5I2IA 1BBJA 5KS9E 2DQFA 3SE9L 1MAJA 2LHAA 3HAEH 2X3AA 4JMNA 3DOHA 4HMCA 1KB3A 3O6FB 1CD1A 2MOVA 2OZ4H 4WK0B 2QGCA 1Q9WA 4CMMA 1SUJA 4K8RL 1MFEL 1W72H 4QLRA 4MVBC 4PJCA 2EDHA 5IWLC 3MV11 1CLZH 2A6IB 1FNFA 3FRUB 4TSBH 4K7PL 4KXZI 4M3KB 5MERB 3FXIC 3ROOB 1OB1A 2ED9A 4KHXL 5GRWA 3CFTA 3GSNH 1P2CB 2FBJH 3HC4H 1OALA 4RDQG 1JZEA 2KC0A 1LM8V 5I8EB 4JG5A 1GPOH 2RFXB 4MQ7A 3ES6A 3FJTA 4K5PA 3RWEA 5EBMA 1IL1B 3WO4B 1ZVSA 4BH8A 4BHUI 2R4RH 5E2TL 3LH9A 3LSOB 1CDUA 2YO3A 1EHLL 3IVKB 5HJBA 1FYTB 1YEJL 4OF3A 4AQOA 4DQOL 2QJDA 4OLUL 5E2VH 1F42A 2HTLC 2BIPA 4ZMQA 5T5FL 4MWFA 4FTDA 5AD0B 1UT2A 5F9WC 6FABL 5LN8A 2YPLD 4OGXL 3K81A 1H15A 3QUZA 3QUKA 4R8WL 2OJEB 4AL8H 4DFIA 4QMEA 5EC1B 1YZZA 1AC6A 1G7PA 4Y1AE 1W15A 3VYOA 4K5NA 3S48A 3KGUA 1G7QA 1KN2L 1CE1H 3FH8A 5J1AA 4HJTA 4Y9FA 2Y1YA 4IKNA 2YA2A 1ZTXL 3IJEA 4TVPH 2NY0B 3VXNB 1BQHA 3HS0C 3ARFA 1CFSA 4KTYA 4AQAA 1TSRA 1H8OA 3DMMC 3ZL2A 1XSOA 1DBKH 2H32B 3ATAA 5ADOL 5FOBA 3HC0A 4Z7IA 4N3TA 4Y4HA 2UZYA 4NM8L 1QBMH 2NR6A 1J8SA 4W4OC 5LGJA 1S8DA 4HLJA 3CV5A 4ZBJA 5FCSH 3GXPA 4NEHB 4AQ1C 3QWNA 5ERWB 1FDLL 5CM1A 1G43A 5E9NA 5D2NC 3WFEH 1T1YA 2J57A 1ACYL 3QJOA 4PVLA 3PWJA 4FF9A 2YZ8A 4KY1H 2L0DA 4XZ4A 3SOTA 2W9EL 4I2XE 1EX0A 2FX8H 2J6EL 4FXKA 2OZ4A 1VGKA 2DRUA 1RIUL 2PR4L 1VEOA 4AUJA 5EZLA 1W72A 1DR9A 3EYQD 4HC1L 4YHKH 3V0JA 1L6XA 1AAJA 4K4KA 2NYKA 3RWIA 3DO4A 5KOVC 3AMKA 1QRNA 3KL5A 3B5HA 4EUPB 3WS3B 1KIPB 1OSYA 3NCFB 4OF5A 4XB3A 1N8OE 1JHTA 4BFIB 4C4BA 4AIZB 2CR3A 2GJ6E 1ZIAA 3B6SB 5KYWB 2A6KB 3FTSA 1LO0H 5DJZA 1A14H 1XXDC 4YXLH 3CFQA 3SDCC 1QVOB 1AE6H 3LKSA 3QISA 4WI4A 3S37H 2XWTA 4X8CA 1RK1A 4JR9H 1Z5YD 2FATH 3RL2A 3BJ91 4GAGL 3SCMB 1VESA 1IAIH 4K94L 4U1MA 4P5KB 4NUQA 3UCRA 3DETD 2M83A 1NCBH 4HXBH 1CI3M 3IFNL 4O58L 4WTQA 2QPEB 3UZVA 4X6FA 3UL4A 4JRXA 1YPZA 3ZOAA 3AS0A 1WCBA 4L1SA 2CK0L 4LZKA 2BSSB 2XZCH 4G6AD 5EU5B 4NQUA 1SQ2N 3QYNA 3MRCA 4M43H 3QIBA 4Y2DA 3O3BB 2H9GA 2JKIS 3QQ9D 4NFDA 1R3JB 1DSWA 3GK8L 3NEOA 4Z3HA 1KGXA 2GC7C 2W0FB 1TLKA 1E5AA 3L3HA 4H8PA 3S5YA 1CR9L 4G8IA 4JFZL 1ZK9A 5IBUB 2OP4H 2XQYG 5DT1L 2WTRA 3VYNA 4GG6A 1WQVT 3D48R 4RDQF 1EMTL 3QFJD 5GSRB 1DSFH 3D2UA 3GJFK 4Y5XB 1OD7A 4U6TA 4AEIL 4EXPX 1G9EA 2GI0A 4JL1A 1RUAL 2VLLA 2WIIB 5BV7H 2Z31C 4BSVB 4EN3C 3G7TA 3GBNL 4PRDA 4FQXA 5KBMA 5CD3A 5FECA 2FGWL 1BYNA 1MXDA 2CNZA 5J8OA 4JANB 1G7IA 4OT1L 4V1DD 4H0IA 4CU7A 3D85D 1JGEA 3WEXA 3PG2A 1DEEA 1FNEB 1GOFA 4HXAH 5FUCE 3AG4B 1NAML 3PFQA 5DCCA 4MNQA 5LDUA 2V7NB 1IE4A 4NRXB 5L7XH 1OAQL 1KXQA 3EOTL 3IKKA 4NUMA 7CGTA 1J5DA 1FPTH 3M07A 8CGTA 1P5UC 2ORBH 5E6SB 3N9GH 4NERA 1GYUA 3ULUD 4P07A 4AMKL 3TO2B 3ZHNA 1DQVA 4JFHD 3CG8A 2FEEL 5TK2A 2F7OA 4ZW3A 3CFDA 1GZQB 3IGFA 4YSQA 1EFXB 3LV3A 3DOIA 3FT4B 3UROR 5JR1L 1YRKA 3CHPA 1GVIA 2WKGA 4GLRH 5F7WC 2BW5A 2YPLE 2DWEB 4P48A 4W6XB 5FHBL 2F6AA 1RY7B 3O4LB 2HH0H 4PGCB 4HMDA 4S1SH 3P3UA 2F54B 5AOLA 2VRAA 4BGLA 1T1ZA 2WIMA 3VI3B 2HLAB 3CAFA 1WEJL 1LYQA 4ELMF 5KSVB 3L5XL 1MH5B 5ISZD 1KTLA 1V3JA 1ZS8B 3EDEA 1NGPH 1QNZL 4HFUH 3PWUA 1N4XH 3CK0L 3NJMA 2FX9L 3STLB 5JW4R 1G6RH 1OTUD 1YQVL 3NFSH 2QSQA 1U30A 4MLIA 5DUPL 1BFOB 5INCA 3RPIB 4R97B 4KZEL 2AJ3B 2R0ZH 5FW8A 2OTWA 1ZPUA 1ETA1 2EILB 2OMXA 1G6VK 2EZ0C 3SKUD 4X9YA 1M1XA 1MREL 1MI5B 3BDYH 4F93B 1AY1L 2WK2A 1D9KC 4NKDB 4B7LA 3PREA 4X7SL 4U1IB 1DJZA 3MX0A 5EG6C 5E2WH 5ACLA 4HT1H 1I1FB 5KYXB 2N7AA 4MAYA 3QNZA 3GS7A 2YK1L 5CZXC 2GI7A 1MZZA 1ZKAA 4U4IA 5DD3L 3FZUD 3WV0A 5E4OA 1O7DC 4ZPTB 3WKYA 3RNQA 3DX6B 1XF4A 3GMPA 4I5BB 1K9TA 1OGTB 4LU5L 4GEIA 5C0DB 1KENL 3EHBD 4XVUC 3MUGA 3GSOA 5AVRB 4OAWB 5IFAH 1BFVH 4UTAL 3QXDB 3EJYD 4CADA 1GR7A 3DROB 2NT0A 4J8RB 5IG7A 3UFIA 3FBKA 2JKLA 5CCHE 2WB1A 5JNYA 1IRAY 1A64A 2CD0A 1MCPL 5IMLB 4PN6A 1RJLB 2WXJA 2OW6A 3FN0H 1YEHL 5E70A 4N28A 3CFBB 1MCWW 4G8GB 4Y9CA 1GCFA 3D08A 4LP8A 4YIQA 4NAQA 3GRWH 5E8NB 3VI4B 4I48B 5LXGH 1HFUA 4TSCH 2YPKB 1IEBA 2AEOA 3MRGA 4IIQA 4GW1B 3TT3H 2H1PH 3M7FB 3S34L 1NEPA 2EO7A 3Q5OA 4AE0A 4AKPA 4O4YH 3BQUC 5KYUB 1HSBA 1F3RB 5DUMH 1F3DJ 1S7TB 3UAJC 1I9IH 3F6LA 2XXGA 3S4SG 3IDNA 5C6PB 2CU9A 2YD9A 2AEQL 4E68A 3WL9A 2ESVB 5GSVB 3TJPA 1JYNA 4WUUA 5D7IA 1PTZA 3GSQA 4XCNB 1FL5A 5AYTA 3WBDA 1AXIB 5HDLA 4X6DB 1G6RA 1X5FA 3QJRB 2X4RA 1G7HB 4P2OD 5KYNA 5I1KH 3QFJE 5D7KE 3ZO0A 1EK3A 5AVUB 2LOEA 3M1CA 1DQDL 1PQZB 2OMTA 1A25A 3NCYP 1EH9A 4F37K 2DDQH 2IH8A 1OB0A 2HJLB 1FZJA 3MCYA 1FIGH 1FFOB 1FV1A 3ZMNA 1P1ZB 1OE1A 5SWZE 1F0LA 1P4LB 2CA3A 3IM1A 3NJFA 3VXMA 1Z9OA 4KI5D 2EABA 2DWDB 3TBYB 5DLMH 2YQ3A 3K2UH 3HUJF 4NS0A 1G9HA 4UQ3A 5I8CA 3AU1A 4M7LL 3TZVD 4FQ2L 1DHKA 3A0OA 4I77H 4AZ8A 2NNAB 2ZXCA 4S1DC 3ULUE 3H7BA 3TNMB 3NCJL 4ZOBA 2YD8A 2R4SL 1MG2C 1XGTB 1GCYA 3RP1A 4J3OD 3OAYH 1X6LA 1XSKA 5GGUB 5TF1L 3CFJA 3KPPA 2BOCA 3VG0H 1JK9A 3MREB 2DM2A 2Z4TA 3I9PA 1WTGT 1KTDA 2N0MA 3HG2A 4RAUB 3QUXD 2KKQA 3O0RH 4ALAL 1GYWA 4HIIA 3U9UA 1U2YA 2BVUA 4CU8A 1BOYA 3KXFD 2A9AA 1QOKA 3GRWA 3X3GH 5L2KA 5ISZE 4NB7A 2EIKB 4PRIA 4NIKB 1NUFA 2QZ5A 3K5SA 4AV5A 3GHPA 4CDHA 2DIAA 5E9DB 3GJFH 4NQXA 1BXXA 4FQHB 2V4LA 3CGTA 4OD1L 4OZHB 5L9DH 3F85A 1A3LH 5CKGA 4FQLL 5C2BL 1RK0A 3ZKND 4NN6C 1A47A 1XIWC 5ID1B 2BIOA 1BBDL 2GK0A 5IB3A 5C6TL 5JTWA 2XN0A 5FLUA 1OAKH 3QUMA 5DC4B 2DS4A 3ZJAA 4BDVB 5LG1A 4F7TB 5DS8A 4AMWA 2ZONA 3HI5H 2ZPKH 1RMFH 4L0ZA 4M6AA 4UZSA 1INDL 3IXAA 4LSVL 3QUYB 2KZBA 4QR7A 4U1KA 3ARXA 3SPCA 1JNNL 2JB5H 4BFRA 3VSTA 2Q87A 4L8SB 3B7RL 1LWJA 4IKJA 5EDSA 5A2IH 4FKHA 5FB8A 5EOQH 4N9OB 5DJDB 1RURL 1TPXB 3BP5A 5DUBA 1GYAA 3PY9A 3R7QA 3NIDE 4OQTL 1B9KA 3HZVA 4HW6A 3TO4D 1LE5B 4JRWA 3APNA 3E38A 3WIFB 4KROD 3S35H 4CBZA 4LHUB 1JF5A 2VLKB 3BXNA 3GKWH 1BZ8A 1U8LA 2WSPA 2DTMH 3H42H 4OD3H 2W65B 5IW6B 5IWLA 3JVFC