3GLDA

Crystal structure of the major pilin from streptococcus pyogenes e117a mutant
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
294
structure length
294
Chain Sequence
b'GPGSATTVHGETVVNGAKLTVTKNLDLVNSNALIPNTDFTFKIEPDTTVNEDGNKFKGVALNTPMTKVTYTNSDKGGSNTKTAEFDFSEVTFEKPGVYYYKVTAEKIDKVPGVSYDTTSYTVQVHVLWNEEQQKPVATYIVGYKEGSKVPIQFKNSLDSTTLTVKKKVSGTGGDRSKDFNFGLTLKANQYYKASEKVMIEKTTKGGQAPVQTEASIDQLYHFTLKDGESIKVTNLPVGVDYVVTEDDYKSEKYTTNVEVSPQDGAVKNIAGNSTEQETSTDKDMTITFTNKKVF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pilin
publication title Intramolecular isopeptide bonds give thermodynamic and proteolytic stability to the major pilin protein of Streptococcus pyogenes
rcsb
source organism Streptococcus pyogenes serotype m1
molecule tags Structural protein
total genus 64
structure length 294
sequence length 294
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12892 FctA Spy0128-like isopeptide containing domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1140 Mainly Beta Sandwich Immunoglobulin-like Collagen-binding surface protein Cna, B-type domain 3gldA02
2.60.40.3050 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3gldA01
4BUGA 2X9XA 2XTLA 1D2OA 2XICA 2XIDA 3GLDA 3B2MA 1D2PA 2X9YA 2Y1VA 2X9WA 3GLEA 3RPKA 3KLQA 2X9ZA
chains in the Genus database with same CATH superfamily
3OZ9L 5KBDA 1K8DB 3C5ZA 5FOJA 3VWKD 5DEJA 4L3AA 4FX5A 1N0XL 4CNIA 2Y2WA 3DPBB 1MCDA 2OA9A 4HIPA 4IW4C 1MCHA 2R7EB 3ZTJH 1EEZA 5E8NB 2DWXA 4OZIB 4U6YB 1EMTH 1XB8A 2J73A 5EZLB 1VA9A 2FWUA 4KKAC 2J72A 1PDKB 3QPQC 4XE5B 3L9EA 4HCRA 4J1UB 1JPFA 4PB9L 2DJSA 4IGBA 3QXDB 4CKVX 1JGEA 1HL4A 1XMEB 1U93A 4IU3A 2VQ4A 1OSPL 1SLXA 2WXNA 1KT2A 3VQMA 1BF5A 3X11B 4Z7VF 1NKGA 1FWXA 3B2UC 4LLMB 4L4TA 3ASOB 4HCGA 3CVHA 5LBSA 4FRWA 3H54A 4PS4L 5FV2A 4N3UA 4YSTA 1DL7L 1GYVA 4NOFA 1CVRA 1YDPB 3WMQA 2VDNB 3FXIC 3BH9A 4X9BA 1DQKA 1LP9A 3LKRB 2M83A 3S5ZA 4R9HA 1ZV9A 1Q9KA 2IALB 4YDKL 1PYWA 1HSBA 1B0GA 1UASA 3FTGB 1GTFA 1A9EA 3LZFL 1JOIA 5DC2A 2BX5A 2NX5D 3WJMA 4G70B 4XNAA 1OCWH 1HESA 1ROCA 1HCYA 3IDXL 4PFEA 4UT6L 3TNNB 1HC1A 4OZGE 5C0JA 4XXDA 1KCBA 2PCFA 1GW0A 2Z91B 1ID2A 2FLRT 4Z3JA 3HIZA 2WKOF 4BUHA 3AB0B 4PR5B 3BCFA 1KJ2L 1RERA 2XBZA 5EH1A 2CD0A 3MI6A 1XR9A 1AO7D 3RWJB 2EUXA 1OGAA 5EZIH 1CD1B 2OMWA 4QPEA 5F9AC 1KG0B 2XPZA 2QPSA 2R2CA 4UV7L 2JXMA 3QJFB 2RALA 3TO4A 1THCA 2BIHA 5C09D 3B5GA 4JFYA 5AEAA 4XNMB 1LM8V 1PX4A 5TF0A 4L48A 2XKSA 4MAYB 2LU7A 5GSRA 3ROLB 1QW9A 3ULUF 3V4VA 3KEDA 3DMMA 5CLXA 5HGAA 3OXSA 1DSWA 3MRPA 3DYOA 1GYUA 3ZE2B 5L8JB 3VA6A 3WE6A 4CW1A 4Z0BH 1P2CB 5FHBL 3ESMA 5CJBA 2MNJB 1KOAA 2Q6WB 3N43B 1SY6L 4JKKA 4NFBA 1SJXA 1LK3H 4RMBA 1ZJBA 1WF5A 5E00A 4XX1G 1TJGL 3WEXA 4KY1H 4C54A 4M8QB 4HZ1A 1MW1A 3OMAB 1MXGA 1AZCA 2X2IA 4AYDC 1X7SA 5DJDA 5INDA 1WIPA 3UP1A 5E1QA 4UQBA 3F6JA 4RDBA 3TBYA 3UYRL 2V33A 4MCZB 2YRBA 3MUGA 9CGTA 3KGTA 4Z7NF 5HSFA 2IGTA 2X10A 4LCWB 2QMJA 1T03L 2DWDB 3QIUB 3ARUA 4IDJH 1A6VH 4NKOB 3OHXA 4LHJB 1UT1A 3WFEL 1H6TA 4GO9A 4UQ3B 1JZ5A 3HAEB 4Q9RL 3KPPA 2E9GA 2Q3ZA 3MLUL 3S4SG 4UAOB 4B9ZA 5E8DH 2VABB 4OU3A 1XT5A 1T6BX 4ODSH 1XSJA 3C60D 4YDVA 1OP3K 2Y06L 5DO2C 3Q1SL 1CG9B 4GAGH 2N4IA 4HU2A 3FFDB 1EXHA 2ICWI 3DROA 4MQXD 4P3DB 4FQXA 4M6AA 3S36L 4OD3L 2UY7B 5B39B 3D2TA 3VB9A 3TEXA 2PTVA 4D0DA 1JPTL 1RIHL 3MVSA 4OGZA 2BCKA 1U8OB 2PWDA 4G8FA 4Y1AD 1Y0LB 1JPSH 1WT5A 2FD6H 2GITB 5C0EA 2WINB 3PWNB 3O4OC 4MJHA 4LLQB 4WFGD 4U6VH 5KSUA 2I07B 4PJ9B 3KNBA 35C8H 4IBVA 4ZOCA 4ONHB 2RD0A 3ARSA 1PMYA 3TF4A 3PDOB 4MDJA 3LZQA 1UD6A 5G4OA 3P30H 4QXUL 5JXEC 3ORJA 3V52H 4GINA 3V7MA 1CGWA 4LE8A 4FLOA 2F19L 5HTSA 4RSYA 1QRNA 1IGFL 4KV5F 4UZGA 3VXTA 2IFGA 4BHUA 4H8QA 1YAIA 4ONGH 2K6ZA 1E8XA 2NY2C 3L1GA 4MBRA 4YDMA 4JZNB 3SE4A 4R97B 1I8KA 1YRKA 3AAZA 4K8RC 4ODTH 4QLWA 1LE9A 5DJ2A 3AGVA 4YUEH 3IEAA 2E59A 2J8UB 2W9EH 5FK9B 2WQAA 1GJIA 4FXKA 1ORSA 4WTQA 5B38B 4RLDA 1FNHA 2VR9A 3DVGA 2R69A 3WXVH 2HZHA 3F12A 4XN1A 4JMXA 4XVTL 2QV2A 5IJDC 5ISZB 4M7LH 4CGTA 1UXMA 3CCHB 1URZA 2IAMB 2WB1A 3I9GH 2AXGA 1S3RA 3ARXA 2GAZB 3C12A 1CQKA 1EA9C 1YEEH 5CZXC 3A24A 4MNGB 2GQHA 2HH0H 4QAWA 1KIRA 4I0KA 5J12C 3IB4A 4OGXH 3U4AA 2Q8BL 5DVMA 1WD9A 5DRWB 5GSVB 2XTJC 3PDGA 4L3CB 1SBSH 4U33A 1EZUA 1UZGA 2TRYA 1JPST 1F4HA 2YGVA 3AADB 4ZBJA 5JZ7D 3IKCB 2Q76B 2DQUL 4P8QA 4YBQC 4XOBA 5E8PA 3LPWA 4PV9B 3D50A 4IOSA 4APXB 1C08B 4F7CB 2ZE0A 3TCLA 1NOFA 5IHZA 3D0LA 2YUZA 2D7OA 3QHFL 4DK6A 5IHWA 3WNJA 1F3DJ 4FTVB 5DZJA 3V5DB 1KMGA 2BNRE 3O4LD 3KPMB 3SY6A 4NQEA 3TBSA 3BP6A 5TH2A 1AXTH 2RFXB 1OK0A 5TDNA 4Q97A 4YHML 1R5WB 2WPGA 4GRLC 1J11A 2AJYH 1FI8C 2DQCL 3FTXA 4JREC 2E9IA 1LK2B 4F8TA 4NKDA 1WAEA 3SSGA 5BZDA 1KEML 4KU1A 1FV1A 4OBSA 3DA0A 2EQDA 3RWGA 3WO3B 1KENL 2FEDD 1UJ3B 3AZUA 3FQWA 5T3XE 5I0DA 1U8KB 1V3JA 4W9ZA 5GGSA 3IFPB 3RVVD 1MG2C 4L8DA 4BRJA 2DH3A 1ZHKA 2J43A 5EORH 3LEVH 3L3IB 1HCVA 4PRDA 3P73A 4Z95L 3IU3B 4OIIL 2Y6TE 1JZ6A 1Z0MA 1AZVA 2VWEC 3CVIH 5CP7A 4Z0XB 1HCZA 1NMBL 2UZXB 3B7YA 4JN1H 5D8JH 1KYUA 4IRSD 4M7LT 5EU6D 2GC4C 4NN5B 4PV8B 3TT1L 4U6XB 4AK2A 3LCYA 1O75A 4E5XG 2COQA 4TSBL 1IL1B 4IRJB 4XO8A 2FCBA 4M48L 2ZXAA 3B56A 4FZEH 1QVOB 3N42B 1L3WA 5IMMB 2Z8WC 1JNNL 2XWXA 4HF5L 1W72B 2W59A 5TDPB 3ARBB 5GRUH 3MLTA 4JFXA 1QFOA 3KDMA 3G9AB 3MRIB 3K71B 1FG2A 3ZIYA 1LEKB 1YG9A 3BKCL 3RJOA 5IBLD 5IROC 3ZDWA 1UEMA 4Q6IC 3JV4B 5SWSD 1KSRA 4JM4L 2UZYB 5FOBA 3SDDB 4J8QA 4NQSA 3C09C 4P59H 1ZMYA 4JZOA 5DEGB 1FN4A 2NDFA 3BQUB 3Q0HA 4N68A 1R24B 3RURA 4RWYL 5HDLA 4O4YH 3HJ0A 3NIDF 4URKA 4A7VA 3FH8A 4ZUTA 4L8CA 5I1EH 1BXVA 5HVFB 1GOHA 3B9AA 1RQ5A 2CO3A 4LARL 2R59A 2CLZA 1I7TA 3HS8A 3LH2H 1UACL 1QHPA 5G5DA 2AQTA 3GXFA 1UXSB 2X4UA 2SEBB 3RNKB 4OV5A 1ET7A 2YD7A 3NSJA 4NPYB 3L3DA 4HISA 5F96H 3MROA 2CR3A 2CKBB 4G1EA 2WNGA 1OP5K 2C7UB 4FQPA 2F7IA 5GGTH 4P2OB 2JELH 2OMVA 3T1FA 2ITDA 2WXHA 1BLNA 2AVGA 3I9PA 4NHCH 2ERJC 1IKNA 3BVNB 3M86A 3MBEA 4U3CA 4IBWA 1TZIB 1CTOA 1NC4A 3NIGF 2BM3A 3NCJL 4K23H 3ULUC 4JQXA 4YE4H 4YZFF 4B9KC 1S9WB 1RJZA 1OGTA 2DQEL 1FP5A 2XHNA 3RLSA 4Y5XC 4FTDA 4MNQE 5CBAB 2ZXBA 1ZTMA 1S78C 1ASPA 4M6OH 4O02A 3MRMA 4PG9A 1WLHA 1OTSD 4ANWA 4PGEA 4KVPA 5CJOH 1C5CL 4NO2B 1T1ZB 2Q3AA 4PTTB 5K39B 1KWGA 1RXLA 3K4DA 2K6WA 4HZAA 2Y36H 2H32A 2GUOB 2J1XA 1ZRUA 1U3JA 1ZGLM 4RX4D 4MRBA 5TFSH 25C8H 2BSTB 2B4CC 1KBGL 5BXFA 2VDQH 2YD8A 4PRID 4ZO9A 5FYKE 1RUQH 5CINL 2EVHA 3MCKA 2DQDL 1DUYA 2V3FA 3BEWA 2GBUA 5HGGS 5TE7H 4UBDD 4HD5A 4JG0L 5D6DA 3FQXB 4N8CH 2QPFA 3N1MC 1XX9C 5A6LA 4OZHB 4Z5RB 3GZOA 4OM0H 3W56A 4MJIA 1OSEA 3NQIA 3B37A 2VL5B 1U30A 1E7VA 2XIIA 1YYMH 3C08H 3MXVH 4N2BA 1TNNA 2YJLA 4F92B 3VE0B 2F53A 3CDZA 3OPZL 2VSKB 4JDVA 4QUOA 5IIEA 1JV5A 1BVLB 1WEJH 1Q90A 2R83A 3QXAA 4PRNB 5IMOB 1QR4A 4ZK8A 4A7TA 3V79C 4XMVA 4YHOL 1K85A 1NINA 3HRZB 2YK1L 4JFOB 3W39A 5C2BL 1E5AA 1VCAA 3EGXA 4QRFA 5KOVC 1DVYA 1M2OA 3HC3H 2DIJA 3VGAB 1TYRA 4PP1D 4ZAKC 3ZDXE 2VAAB 3C5JA 3RA7L 1PTZA 3MFFA 2EDBA 3IWVA 1G6RA 4HJSA 4UILL 2HLAA 3KJ6L 1DN0A 5TQ2H 3BFQG 3SBPA 4DTGL 1O6SB 3APCA 4O5LH 1T1XA 2H7WA 4XODA 5LAXB 4EBQL 3H7BA 1F1DA 3N1FC 4GRLA 1CFVL 5DD6A 2PKDA 4ZS6D 3S88H 1H8SA 3C6EA 5KANG 2AC0A 1NCJA 2DWSA 3DJRA 5EBGA 2A38A 4PJBE 1A8JH 1R3LA 1IQDB 1SDDA 4QRTA 3IDYB 4PJ8D 2KPWA 2RACA 2VLJD 4N87A 4Y4KD 1CYWA 5KVFE 4B6ZA 3S98A 4NHUB 1A7RL 1DVFA 4NDMB 1NDGA 1TYEB 5EU4B 1G1OA 4P9HC 4NM8L 3MJ8B 1HSAB 1MVUB 5ANMB 3TA3B 1CGSL 1SHMA 4YSDA 3T0EE 2MPVA 3MNVB 1OGAD 4W9IC 3BKML 1ZT1B 3WDHA 2BP0B 3DXAD 3TZVC 4DKEH 5D5MF 1UM4H 2IH9A 4OD2B 4OJCA 4BQBA 2XWBB 3TO4D 5ENWA 1PIFA 4PRHA 1IQWH 5IZ7A 4TVUA 2ZCLL 2ZJSH 4HUVB 4U1GB 3OJMB 5ADOH 4JKPH 5FDWB 3DMMD 3O2WL 5L2KE 4MCYA 2HP4A 2RGSA 2VLLA 5E03A 1VFAA 3VFRA 3L6FB 2HTLC 3WY2A 1M1SA 1I8MA 3NRFA 4MLIA 3PL6B 4W6XB 4Z7VA 1ETZB 1NM4A 2K4WA 3K2KA 4XZUA 5IV2A 3CBKB 2WZ0A 3CUPA 3FRPG 3REVB 1X5LA 3STLB 5AD0A 3GXUB 5LGKA 2WY3B 1P4UA 3I6LE 4HAFA 5E6IC 4F33A 1Q1JH 4B7IA 4OVUA 1FO0B 4BJLA 4LEEA 2HT3C 1FL5A 2XKNB 5ABDE 1RIUL 3FAWA 1UM5H 4HUXB 2F5AH 3TTSA 1NBVH 2ZCZA 4S1SL 2A6IB 1JMZA 5T5FL 1JYXA 2WUBL 3U30B 1BVOA 4BV1A 1S9VA 3U0WL 1ZLWK 6TAAA 5D7KE 1RUAH 4WFHD 2GSIA 3MA9H 3T3PE 4E9XA 3RDTD 5H37H 5D7JC 2ORBL 3CBRA 4G6KH 4PJXB 3VFTB 1YNTF 5DQ9A 4JANB 1VEOA 5DVOA 5KTEL 4HH9A 5EIQA 3KYMA 4HHWA 1PSKH 1GC1H 1I53A 3FU3A 1LDPL 1U2HA 5E94A 5BRZA 3MXWL 4K55A 4PJFF 4NKMA 5GGUA 3X1FA 2WBXA 3QWNA 5IG7A 2Y07L 4BFBD 1YVLA 3N85L 2EC8A 4FFYA 4TQEL 1MCFA 2JIXA 4XO3A 1EEUA 4OI7A 1A3RH 3TS8A 2Y5TA 3HMXL 2Y3AA 3DGDA 1P6WA 2GB2A 2GSMB 2QFPA 4HU8A 3BGMA 1FAIH 3DSNB 1JRHI 4Y5XA 5DJ6B 3IJEA 3BMWA 4G6MH 5BZZA 1XV8A 3HLAA 1WFNA 1BF2A 3OKDA 3T2NH 5F7EL 2X4QA 4Y19A 2EZ0C 1E65A 2A4EA 1XEDA 3LRKA 4GFTB 3UTTA 3JWDC 2VJXA 4TVPH 5E5LA 1KCLA 3UTOA 4IRZA 1E2VA 4G9DA 5EIIG 1LMIA 1UA7A 4OLYH 4KKZA 1Z5LA 7FABL 4XBGA 4CA4A 1DEEB 2HG5A 5AZEH 3GJFB 1FJ1A 2PPAA 2ZYIA 4AL8L 5JLZA 4L3FA 4OZGF 5KN5A 4Z7WA 3LS5H 1LYQA 3ARDC 2Z1PA 4PY7A 1A6TB 4NN7B 1CFSA 4QOKA 3T09A 3KYNA 4LCUB 3LQZA 3VDBA 3QDME 1E5ZA 1GGIL 1OAQL 1JGUH 2Y7QB 4QRQA 4UM8B 3KXFD 5FYKL 1JNJA 5GISH 3ZE0E 2F7QA 1AGBB 3OGCB 5B21A 1VZHA 1CJYA 3BT2H 2YSSB 3V9EA 1THAA 2JSFA 3P02A 2VR3A 1JTOA 4BFRA 1GGCL 4N8VA 5D1QA 4ABQA 1RFDH 1QA9B 2DJUA 1L6PA 1SEQL 1YN7A 3JV6B 5IESH 4G7VL 1QSFA 1OPGL 3H53A 3T8XA 2B3IA 4HDIB 3WHE1 3QPQD 4HIEA 3QXVA 4LVOB 2X09A 4J8RB 1FGNH 2YFOA 3LHPH 4X0KA 3UTZA 4ZAKA 3VWJC 2ZWLT 3KWWA 3T0BA 1B2YA 2KUTA 2O6DA 1WFTA 2R4SL 1K2DB 4PJEF 4O2CA 5CZRA 4NC1E 4JR9L 3T0AA 4GEIA 5JOPE 1NLBH 4Q9QL 3B2UD 3TBWB 4JBSA 3VGDA 2FZ3B 3KZ8A 2W9DH 3UAJA 4A6YL 5DVPA 1ZSDB 3HR5A 4BGLA 5KYYB 3DUSB 1H3PH 3QO1A 2GT9B 4LSQH 4J3OF 3IDUA 4IOSD 1NGXB 1B4JL 5D2LB 3UPCA 1X7TA 3VI3F 4UOQA 4EOWH 3EDJA 4YQXL 2I9TB 4KZDH 3P2DA 2O5ZH 4NQED 1N8OE 2XXFA 3ME0B 4KKBC 4L9DA 4OVVA 4DPCX 1WIUA 1ZGLP 2FH8A 3FUHA 1PU0A 3JVGC 3IJ8A 1SVBA 4PJGF 1KGWA 5I6XC 4R8WL 1WGVA 3RTLA 1CFMA 2WXIA 3D4YA 5F9WC 5SWZB 5EN2A 5KVFL 2C5DC 1JFQH 2NXYB 2AJSH 3I6SA 4H13C 4JFFD 4NQDA 3RPBA 5CZVL 5J13B 5DWPA 1A4CA 1IFRA 1JI2A 3PWVB 4LVNC 5LXGH 4MA8L 1WCBB 2F6AA 4JHAH 2BIPA 3I9IA 1NCIA 3E8VA 1X4YA 4PHXA 3ZDZF 1MFAH 1XL4A 1DBML 4EO5A 4R2GC 4WHTA 5BS0E 4JPVL 4OGQC 1D6VL 1EIBA 2CG9X 3HKFA 4XNQA 1KNOA 2YR3A 4G9FE 5DA4A 2QSQA 1I4FB 3EBHA 3QPXH 3MV7A 4CVZB 5D1XE 1NCWL 2OL3H 5ESVA 4ENEC 4G3YL 1J7VR 2FJGB 3Q8AA 1SGKA 2FO4B 2N56A 3O3UN 5EOQH 1OWRM 1L9PA 3BKJH 3SE9H 3Q13A 1V7MH 2PF6A 1BD2E 1I7ZB 1CICC 2YC1B 1ZLUK 1KACB 3X3FL 4GOSA 1EO8L 3AT9A 1I75A 2O6CA 4NNYA 1VIWA 4W9LC 2AJVL 2CDFB 2F54B 5AVRB 3B6SA 1DQLH 4KTDH 3TA4D 1J0IA 3NJKA 4BH7A 2F8VA 3QEUA 3ILEA 1N9PA 2QTEA 4PJ6A 2WB7A 5EO1B 5KJRL 4X6DF 4YDLB 1U91B 5CU9A 2X38A 3GBEA 1DE4A 1P7HL 4L29B 1FDLH 3CN4A 4YO0A 3HPLA 4M5ZL 5DMIH 5E99H 3WYRA 1D5RA 5MERA 4NUGH 1Z7JA 3SY0B 2CO1A 5H4YA 1BGXH 1CFTA 4UTAL 1G7JA 1F58L 3A3YB 4OLUH 2YPVL 3G5ZB 2CGRH 1BMWA 2XACC 4KRPD 2ESVB 3QEQB 2V3DA 2C9RA 4MX7B 2Q87A 2DI9A 3AG3B 1EZSA 1K4CB 4UT9A 3T0WA 2I69A 4MMZC 2ZSWB 5HHQA 4LLWB 4YXLH 1EPFA 3KWVA 3ABMB 5DO2D 4UOZA 3GS0A 5IFAH 4JFQB 2X5PA 3NJGA 5IFJA 4NOBA 1F41A 3D52A 4PJ7B 2EYRB 1RUMH 3NRQA 3FU6A 4MLSA 2XV6B 1JERA 2DDQH 2APXA 4GUPB 1PF3A 4I9WD 4OJAA 4FFTA 3ESNA 3MLSL 3G04A 1QATA 1OSZB 3R06B 3KYAA 2WMPB 5F7UA 1HFUA 2R4RH 3ARRA 1KIQA 2BS9A 3FU7B 1S7XB 3AW5A 5IBUB 1AI1H 3D39D 4QF1A 4MJ6B 3LKPA 3HNTL 3CLEL 4M1GH 1ED3A 4BK5A 4I5BA 1EJOH 2V8LA 1U21A 1FL6A 4U31A 1NC4D 4LHUA 3ABGA 4ODUA 5F0LB 4OR1A 4ZXBA 5AENA 5I1IH 2NNFA 5GGRA 1ONQA 5JXED 2P5EE 4PS7A 1SHSA 3QDJA 2FIRT 4K3HA 3NK4A 4A38A 4Z8FH 5EOCH 4TSCL 3FTVA 3DDGA 2RCSL 1TR7A 2BRQA 3RAJL 2ZOTA 5FAAA 3KW8A 1EHNA 4LQFH 2E6JA 2H45A 4WUUA 1M7IA 1WAAF 2AI0L 2NY2D 3J7HA 1XGUB 2ZUQB 5BOPA 4ZQKA 2OCJA 4CBPA 2B1HH 3DO3A 5IW3A 2Y3NA 1CDBA 1MEXL 3L4CA 4K8RD 3AM8A 4EQ2A 3RRQA 2QV4A 3C5SA 5T33H 4B97A 5HY9A 2NZIA 1ZJAA 2KI6A 4LLYA 4AGOA 4NQCA 4LLDB 5KOMC 5FC9A 3DX4A 2WO2B 1AFVH 3Q6GL 4JE0A 1DVSA 1WFIA 1E28A 3MODL 4FAAB 5FGCE 4X9YA 2NUPB 5D7LD 5L4MA 4LPVA 4I2XE 4Y9GA 12E8L 2EDKA 3AS0A 3S37H 3HG1E 4YVNA 3FPXA 1T20A 2R1WB 2QSVA 4XOCA 1WVZA 1FFPB 1TPXB 1OP9A 3GSOB 1BFSA 4ODVL 3GRBA 3O9WC 3OTTA 4NQDE 3BFWA 1BZDA 3VFOB 5CZXD 5C08A 2AANA 3SPGA 1QNZL 4GAYB 1YO4A 4X7TA 3BZEB 4R7DB 2D0GA 2AEQH 1PLGH 4JO2L 1ZPLA 4MKTA 4L1SA 1W80A 4ODXB 1MJ8H 1IGTA 5EC2B 2XTJD 3RIAK 1ZE3C 4APQB 3CDGA 3PAVA 5D70H 5EUOB 5DDHA 2ITFA 2VR7A 2BSEA 1KIPB 1EFXA 4XB8A 4Q9BA 1NAMA 2ZCKL 4JFDE 3MV7E 1A3LH 1JF1A 1MRDH 5DI8B 4YBQD 3BYYA 1YPZB 5CD3B 4X6CF 3N2JA 3IJ9A 3LKSA 4W9GC 4UU9A 1KYFA 2ZTBA 4KUZL 2VXSL 3HN8A 4JM2F 4EJ1C 3OKMB 4MASA 4KBPA 5IJVA 2XY1A 3S3SA 4F20A 5FUZL 4P99A 2NYKA 1P5UC 3BPOC 1SVCP 1K8DA 2EDRA 4KX9A 1DVUA 1I3UA 2V17H 1HINL 1YMMA 4OCYL 3S4SB 5KVMC 2I27N 3ISWA 3JVGA 4GRLD 5CD5C 1HI6A 3ZU8A 1CS6A 2BNQA 3KM2A 3VXRA 4S1DC 2DJMA 3GTTA 3LN5B 4N22A 2WIMA 3HC4H 3BVDB 5C0AE 2O72A 4KTYA 2HYMA 1KJ2A 5DFTA 2XQBL 4MXWH 3BPLC 3V5HA 2X0WA 4ISVA 3VVVA 2XVKA 4BWTA 4JJ5A 3X13A 2SODB 3CSYB 1OXYA 3EO1A 4J1UA 3B83A 4H88H 3SO3B 1N3NB 2H26A 1DVFD 1OHQA 3GPSA 2XI9A 2JV6A 3UADA 3WGUB 1MCSA 1VADA 1QACA 1QEWA 1M1XA 5HHOE 2PW1A 3O3EA 5HI4C 4K94L 3PWLB 4LLMA 4DVRH 2X40A 4MS8D 1IU1A 2LQRA 5IB3B 5I1AA 3RHWK 5ES4B 1E2WA 1J05A 3UC0H 3QUYC 1SY6A 4Q0XH 4JRYE 1SF5A 4LCCA 4XMPL 3LKRA 3H3KA 4UOW1 1KELH 3KYKH 1WICA 3U1QA 4DK3A 3GUFA 4QRRB 4LCIL 1BBJB 2YQ3A 4PGDB 3FCTA 4LESA 2YBRA 1RZKH 4MMYB 3WTVA 1MCPH 3UBXG 1JGLL 3MV11 3GLEA 1UVQA 1ICTA 2GKIA 3NAAL 3DHMA 1KB5A 4WHCA 1HHKB 1G1KA 3L8QA 1S7RA 4JRXA 4PUBH 4EQ3A 2VXTL 4E41E 3MV8E 4Y5VC 3SKOA 1IGCH 5JA9A 2PW2A 3QHZL 3UMTA 2PN5A 3H6JA 3RKDC 4OFVA 3CMGA 3EYVB 3U6RA 1IM9A 1CD1A 3FRUB 4J3OC 1QHQA 4NX0A 3KPOB 4YK4C 5HGDB 2JQMA 4UUJA 3DVNB 5K1NA 3EO0B 1GAFH 4A2FA 4UTBA 3PXLA 1KCRH 3ATEA 4IKLA 3QJFA 4MFHA 1XTMA 4AQOA 4F7EB 4FKKA 1N2RB 3QUKB 2X4TA 4KOBA 4MMZA 2E8ZA 2COVD 4JG5A 4ZFZA 4EI5B 5C86A 1UOVA 1F4WH 1G9EA 3INUH 4AJ0A 2IH8A 4A2DA 3QCUL 1LEIA 4CU8A 4ZDHA 1A6UH 3AXLB 3ESUF 3N04A 4PBDA 4YHKL 4PLKD 2FECI 5IQNA 3VTTA 2E9WA 3MJ7A 4NO0D 4XO4A 3RBGA 4ES9A 1RUPL 1IGIH 2D4DA 1T5WA 2D7MA 3VX0A 2BH0A 1NC2B 3BKYH 1TLKA 3GINA 3PHSA 5BQ7B 3EFDH 5D5MA 5A2IH 1BCIA 5J6GA 3K6IA 1NBZB 5C0CE 4NO5A 2KKQA 3B2MA 1R3IH 1N5YL 1T0OA 4L8BB 5ALCL 3PWPB 3D2UA 2BW4A 3ULUD 4DP7X 1QTYT 4Q74A 3N9GH 1SYVA 5CGMA 4ANVA 2H1PH 3FB8B 2L3BA 2WBKA 4AQZA 2C1PA 1AANA 4AYGA 3D05A 1S78D 1TQWA 4LCWA 2DWDA 3QIUA 1VFUA 3IAPA 3ZOAA 4Y19D 4E2OA 3P3SA 1R3JB 4AEFA 5JHLH 1SXAA 4XB3A 5FECB 3GLDA 2JLLA 4UQ3A 3GHBH 1RUKH 2I5YH 1G87A 3T4AC 2QHRH 4PJBF 2Y6SC 1CFBA 4G7YH 1HEHC 1KEGH 2H0EA 1AGEB 5C0RL 1O6VA 3CTTA 1JTTA 3GBML 5IB1B 4YLCA 5KVDH 1H3GA 1N10A 4X5XB 3HG4A 4HJIA 1Q9WA 3QUMH 4POUB 3A21A 1RULH 1BZ9B 3RVWC 5JIPA 1CYXA 2WUCL 4QOKD 1CGTA 5D4HA 3LKNB 4WAFA 1MI5A 4P3DA 2OJZL 3CNKA 1PX8A 3GSXA 4GIAA 4GSDL 2CKNA 1XMWA 5B39A 2R8SL 2YMXL 2ARJA 1Z9OA 4MD5B 2PCPA 2VLKA 1HH6B 1U6AH 2EKSB 1U8OA 2J8OA 4X80H 5LCVH 4WKXA 1G9NL 2XQYK 5AL8A 4PVBA 1KCVH 3F5WA 3FQUB 2YHGA 4LLQA 3WKQA 1H6EA 1YNTA 2Y1VA 3BD3A 2B2XL 3VFGL 4OQ1A 4YEEA 4B9FA 4ODWB 4ERSH 5T5NG 4OZIE 1FLTX 2FX9L 2AAAA 4P5KB 3TC9A 1R0AL 1J0HA 2HFGL 1MJ7L 1ZS8B 3GEWB 3PGDA 5AAMC 5DLML 4XZ4A 5F89B 4PJFA 2MMXA 3HHSB 3ZKNC 4XN4A 2UUDK 4N5UA 4CVUA 2OJEA 3SE8H 1M2VB 1N59A 2HKHL 1ZLDA 2BMKB 2BY3A 3OKLA 4PHZA 4ZAKD 4WRLA 1NGPL 4HA1A 2R9HC 2DD8H 3QI9C 4X9IA 4FYRA 5C6TH 2GTQA 4WHYH 1G7QB 4Y9CA 2GJ6A 3EDDA 2WW8A 3VXSD 4HHAA 1VACB 1A1OA 1QBML 5D72L 1HQ4B 3GNML 3QFJD 4FA6A 1I9RL 2H6OA 2ATKA 4MQ7B 3MA7B 2HUEA 3PGCA 4X4ZA 4BWUA 4GQ9L 1BLIA 1XAUA 3MUZ1 3O8XB 2XTLA 1BOGB 3MCLH 3MLWH 2K3HA 4OIAA 5JO5A 3C9NA 3T3PF 2OP4H 3EOBA 2VKWA 3D4CA 1WHPA 1JRHH 2IV8A 3E2HB 5JIMA 3U46B 5FX3A 1CVSC 2H2SD 5IUSA 3RX9A 5HYJB 2V5MA 3CCHA 2N01B 4FQ2H 1MSPA 4OW6A 3TIEA 2FEEL 3BIKA 3LKQA 1NCCH 3VXQB 4WV1B 1KTDB 4DH2A 3LNFA 1JXGA 1S7QB 1J8HD 3GXTA 3KVPA 1ZANH 4L1BA 2BZCA 3D30A 4AGNA 1IV8A 3ILPB 1H0DB 4F8LA 3MX0A 4HC1L 2I85A 4QHUA 4AYFA 5CLYA 5DRWA 2JKXA 4TSAH 1JZIA 2OQJB 3L4XA 2D8KA 3HBGA 4OUOA 5LGYA 3TZVD 2E9JA 4ZMWA 4FP8H 1FVCB 3DURA 3SB3A 5I2IA 3IKCA 3BJLA 3RZCB 3EW3B 5I6MA 4HPOH 2VZ3A 2DEXX 4FXTA 3QUYA 3DSFH 1WGOA 1QASA 3LJ3A 2BFVH 5CFHA 1JSYA 3BUYB 3ZE2E 4F7CA 2KLTA 2QBWA 1WSST 1A4AA 2QLYA 2NT0A 2HTLD 3LPFA 4ZFQA 3B2DC 3D4GA 4PJEA 5EA0H 3G6DL 5HHNA 1CL7H 1HDMA 3INOA 1HZLA 1B90A 4F8PA 3OG4B 5F7DA 4JHBA 5A2BA 5J5EA 2HVJA 3HJEA 1JGVL 4OZ4B 1U8MB 3ALPA 4ZI8A 5JMOC 4G80B 5E6ID 1PG7X 3DV6A 3E6FA 4LGRB 4ZD3L 2CQVA 1K6QL 3E9UA 2V7HA 2HT3D 4HBQA 1VGKA 1XAKA 4P06A 1F6LL 3VD4A 2B1AH 2DMBA 2IAND 3FSZA 5I75C 4NCC1 5LBGA 3VXPA 1ODAA 3QJHA 1CDUA 4HLZH 3VI3A 4UQ2B 4JM2C 4YLQT 1MCEA 1M05A 4LLAA 3IFPA 1TZGL 5DJZB 1JK9B 3KR3H 4HCRH 3NCMA 3WBDA 1CGYA 4XVJL 3MR9B 3ZR5A 2GTWA 3BXNB 3L3IA 3LH8A 4LSRH 1AKJB 5K59F 4PJGA 3W2DL 5D7JD 1MIML 4LSUL 3DLQR 2VZOA 5G4MA 3TJHC 4WK4B 4Z0XA 4AT6B 2UZXA 4A1RA 4WUKL 5I19H 4PV8A 5I1LA 3AWEA 5CHNB 4CMHC 3CVHH 3HHMA 4H20L 3JSSA 3HHRB 1RU9L 1RZQA 4R7XA 2JCCB 3H3PL 3KHOA 5IB2B 3ARWA 1GJUA 2EIDA 3J27A 1QVOA 3K7UA 3Q1EA 4IHOA 5ADPH 8FABB 3A22A 4GW4B 1RK7A 3CX5K 5HI5C 5E2TL 3H9SD 4EI0A 3MRIA 5EU3A 4DW2L 2CBMA 2AV7B 2XN9A 2DB8A 3UG4A 1HHIA 3TN0C 1Z9PA 2NSQA 3KJ4B 3O11B 3FPYA 3WIHA 3RTQB 3L16A 2ENQA 4Y2NA 4YC2B 3HI5H 3NFNA 1QLEL 1G43A 1Y1UA 2FYYB 4ELMB 4HVBA 1DLFL 2XWDA 3WUWG 3MV9B 4LHUD 1KYOK 2EZ0D 3GIVB 2VZUA 3IFOA 4ZXBD 4ZMTA 5C9KA 4F2MB 1HL9A 5M95B 2NNRA 2CIIA 2FWOB 5DEZA 3QDJD 2A6KA 5HPMB 1WZAA 2OK0H 5I6OA 1GHFL 4HS3B 5ICYB 3HMWL 4AL8C 4X6DA 1CPUA 3ARDD 3PUUA 1UA6H 4WUUD 3LMJL 3P77A 2LABA 4OSUH 4HMDA 3QIWC 3CQFA 1DBAH 3RNKA 4HFUL 2MOGA 3VAEA 1GTNA 2AK4B 4WWID 4FQCL 3V4VH 4HOWA 4YBHA 4N20A 5FCUL 3D7PA 3C6LB 2XOTA 5I73C 1RD6A 2J8UE 3GLZA 2BDNH 4X8GA 3EKCA 3HG2A 4P2OA 1TEFA 3E8UL 1XSKA 3B4NA 1ULVA 5AW4B 4RGNB 4NQCD 43CAA 1CD9B 3W0WB 1P4IL 1IBYA 1Q9LB 5ISZE 2P5WA 3NA4A 4UV4L 5JQ6H 2WP3O 2X3CA 4RNRB 5AAMA 2WNWA 3EH3B 4NBZB 5KAQF 1VGEH 2IPTL 2W1NA 2W0KA 4XX5A 5F0JB 4D9LH 1SUJA 4XVUC 1FC1A 1K4DA 2OYMA 3BAXA 4MNGE 3VWJD 2DQJL 5GS1C 3CFCL 3FRPB 1XGQA 4NO3A 4RAVB 4HKXA 1W0VB 5DURD 5ERWA 4NWUL 3H55A 1CBVH 2FJHA 3CPLB 3DX2A 4PTTA 5K39A 3SKMA 3BI9X 2Y22A 1QO3A 4ZUWB 4BBWA 2BSED 1PKOA 1EFXD 5F1SA 1U8QB 4LRIA 4AZ8A 1I31A 5IQMA 1TENA 2VLRA 3EFOB 2VUYA 2X70A 3OGOE 4KI1A 3QCVH 4ZZKA 3RFZC 5D96C 3TYFB 4FLQA 1CGXA 2MRYA 5B8CA 4DT2A 2VDNL 1XD1A 3L3GA 3BAEL 2AJXH 4TLTA 1FFNA 4FTVE 4Z76A 1DZBA 1OOWA 1CU4H 2IOOA 3PWUB 3FQTA 3C87A 4JPIA 4BFOA 4DOHB 2L7EA 2EO1A 2Y7NA 3BWZA 2QJDA 2X53A 2X42A 2H0FA 4KKBD 1B6DA 2VL5A 2G60L 2WWMD 1YMMD 2PETA 4OTXH 4U1HA 1UT9A 3W82A 2VN7A 1GSKA 1WAAA 3K72B 4IU2A 2CJSA 2FBRA 4P49A 1RURL 2AKRA 2E75C 3EYUL 4F9PC 1BVLA 1CLYL 1WZLA 2E9BA 2K1MA 3V6ZA 5HXMA 5JW5B 5IJKC 3FT9A 3HZVB 3VNZA 3OB0H 4XCNB 1AG6A 1EGJL 2GFBA 1BMZA 1G0DA 5K9JL 2E5EA 4NWTL 1U41A 5EFIA 4JO4H 3T0EC 1SXZA 5DJYA 3ABKB 4L37B 2HKFL 2VXUH 1OGSA 4R2GD 1XF4A 4WHDA 4GRMB 4YWGL 5A7EA 5F7BA 1CT8B 4ABUA 4JG1L 4QRSA 2WQRA 3IE4A 3BDBA 1F6FB 1O6SA 3EYFA 4RESB 4ENED 1ETA1 4P2CG 1N64L 1ZVNA 4AXWA 3VXOB 4W4NA 3N1QC 1I8IB 3E0GA 1CICD 1D9KB 5H35A 2C34A 3VFUA 2X44D 3ZSTA 1KPRA 1CUOA 1N6QL 5E23A 4HLEA 3HE7B 3QNFA 2OZ4A 4JPWH 4MA3A 5HHVH 4XBPA 1CR9H 3I2CL 3TCXA 4AYSA 1OOAA 3OAYK 2AF2A 3ZBMA 4DKDC 2EP6A 1EDYA 2R69H 1D5XB 4X6CA 4Y16C 5E7BA 5D4JA 4JRXD 2EEFA 4YS4A 2VO5A 3SDYL 1WA2X 5LQBH 3D85B 3GI9H 4M7ZB 5ANMA 2AJZA 3O2VL 1IM9D 4BZ2L 2BP0A 4OT1H 1E27A 4LSVH 1XF2B 4L0YA 3TURA 3R8BB 5C0DB 2JKJA 1OE2A 3NFSH 1KJMA 2WC7A 1MCBA 1SYSA 2EXWC 1UA3A 3LDBB 5T1MB 4ADJA 3GI8H 4HPYH 1M42A 3VG0H 3VD7A 4DHLA 3LNHA 3QXTA 3QXWA 2YO3A 4G72B 4ORZC 2E7CA 3O45A 4KVCL 1FA4A 4KXDA 5JR1H 3GB7B 2AMGA 2CBOA 2B1OA 2VDQB 3K0WA 1F90L 3CX5J 4KHTL 3ULSA 1DHKA 1ETZA 1ZOXA 2YS4A 4YHYB 3HMXA 4TTDC 1TKWA 4BSVA 3GHEL 4WTWA 3L1OL 4A68A 4GYBA 5JIQA 1EV2E 3U9UA 4EKXA 1OT2A 4TQ8A 4TLKA 4I48B 2G75B 1C16A 3NZHL 3WD5L 4MKMA 4HBCL 1Y6NR 2HWZH 1GPOH 2IQ9L 4JKWA 2IPUG 3SGDH 1KN2L 1E9PB 2WN3A 3UL4A 3LRMA 4BFNA 4JY4B 4PJAF 3V9CA 3E7JA 1MHPH 4I7ZC 4IIQC 4KFZC 4XCCH 5JXAH 2X4NB 2A6IA 4E9VA 2HT4D 5F1KC 3GKWH 4HSQA 3L7FB 4DO4A 1GCFA 3H85A 4DERA 1WV7T 3KPQB 1FVEA 5KJ4A 2WOYA 3M17A 3P40A 3GSNA 3SDXB 3PV7A 3QIWA 4KMTH 5GS3A 4RFNC 4PVMA 4KJQC 3RJDA 5AUMB 5DTFB 1ZA6B 4KZEL 1ANUA 1LO5B 3SD2A 2EH8H 4QY8A 1FC2D 4OCMC 2ZX8A 1UB5B 3CK0H 3QHTC 2AEPH 6FABL 1MI5D 4LPCA 5AW9B 1AMYA 1ZEAL 4POZC 3L9RA 3PABA 3Q3GA 5EV7A 4XP6L 4OZHE 1DJWA 1JI1A 1MCOL 2CUIA 3ROOB 1OAZL 4D3CL 3FU5A 5BOZG 1F2QA 4PJIB 4NJ9L 1G7LA 1CFNB 3K6NA 5GGRY 3ARPA 5MI0C 1NICA 3WS3B 1C1EL 4PJ5B 4LKCB 4TOYL 3PS6A 3O9WD 2HPOA 5DRXA 3LZLA 2BY1A 4RA0C 3JUZA 2EXSA 5F0MB 4QCIB 1G7MB 1BFVL 3SDAA 3GSRA 4ZSOE 1QSVA 5F97E 3FOLB 3KPSE 3TASA 2W88A 2N7BA 4RMWA 1NLDL 1H5BB 3QVAA 2XDHA 3NP4A 4HIXL 2UXTA 4C83A 2X6VA 4DK5A 2YWYA 4QXWA 1R3HB 2H0PA 2WHVA 4W4OC 3QEHA 4KTEL 1KLGB 4XOEA 2JB6A 1RH8A 4WWKC 3UEZA 2VLMD 2Y7QA 2JK5B 4FQIH 4LLVA 1MRCH 4XGZB 1G7PB 2ILLA 4AMWA 4G82A 3ZY7A 5DJXB 4KQ4L 5CD5D 4XXWC 5IMKB 1NFDF 3ARTA 3NIFB 3DV4A 4S1DD 1AHWC 4ONFL 4PREA 3SEPA 2CHWA 3JV6A 4XPTL 1OQXA 2IQAA 4QRPA 1PCSA 4YE0A 3VA2C 1ZT7B 2NW3A 1V10A 3C8HA 1V3KA 3IDIB 1VEPA 3SIKA 3HPJB 4I89A 5CBEA 1D5BA 1OAYL 3VRLE 5IEHB 5AB1A 1A7PL 1H8OA 4FXGA 1TO5A 1Z5HA 3SE3A 1CMOA 3NTCL 4ZFFA 5ANME 4AW4A 1CO1A 5CEZL 1P7QB 1EO7A 1BBDL 2QMKA 2XG5A 3U25A 4AC2A 4C4BA 5HI4D 4K94C 1Y6MR 2J12B 4O02H 3BN9C 1JWUB 1JZJA 1XFPA 3D9AH 4QT5B 4AEEA 1C12B 5DZAA 3CSBA 3AUWB 1C5DA 1KCWA 3ES6A 3DUSA 3OAUH 2H32H 3BSGA 3QUYD 1G94A 4K8RH 5ICZB 1SDAB 3MV01 4ZFOL 2D3VA 3D25B 4X6FA 2QKIB 5C07B 4QHKI 2I9TA 5HHMB 2LVCA 2VAJA 1X5ZA 2DRUA 3F58H 3GJEB 1I1YB 4J28A 5E70A 4AMKH 4R4FH 5C9JB 3LKOB 3OKOA 1IC4H 1NL0H 3GKZA 3ZO9A 2IMMA 2ZG3A 1DQJB 4P2RB 2FK9A 4NNPH 1AGFB 3QWOA 1NCBH 5BRPA 3ZHLA 1E42A 4RRPG 3RYMA 5IW1A 3DRQA 3RKDD 5HJBA 4UINL 3RWDB 2PXYB 4J3OD 4G6JH 4PWGA 3VM7A 1DDTA 3P69A 2YPVA 4E0RA 5FA4B 3BW9A 3KGSA 3IDNA 3IFNH 4DP2X 1CE6B 3MGTB 3HBQA 1HNGA 3QJTB 1M71A 4X5WB 1IGML 2CRZA 2XNAB 5B1CA 4PJXE 5I1JH 3QAZC 3VH8B 4OZFG 1OAXL 1B0WA 5F7AA 1WYJA 2J57A 1ZLSL 1OF2A 2FJGA 2CAKA 3M6DA 1G6RH 3GIZH 5AAWC 3U36A 1A9BA 5CJ5A 2ITEA 2A73B 1ETJA 4Z7OF 3N40F 3DOSA 2YC1A 3WFBH 1WBZA 1F8TH 1AR2A 5CU5A 3GSUA 5L7XL 1HHHA 2DZEA 3A4DA 1KCSH 5EO9A 2IDFA 4FQJH 4HJGA 3MYJB 3OKEB 2AV1A 4WU5B 2OYLA 1TNMA 1A6ZB 3NFPA 4YHZH 4WW2B 4RDQG 1A9VA 1QBLH 5EBMA 1YN6A 1U91A 1NCDH 1GGYA 5FWRA 3ZKXC 4OI8A 2GC7C 3L3KB 2P4AB 1SRDA 5ALBL 4YN3A 5A2CA 5DUMH 5FYJE 4MHHI 1A4JA 5F71A 4P57B 2BZ7A 3BHBA 1ECYA 4JFHE 3WNOA 4JK0D 1XQ4A 4LNVA 1VJSA 2Y6SD 3QDAA 5D7IF 3AQXA 4NRYB 4GG6F 1ACYH 4MX7A 5IVOA 1K4CA 1LMKA 4BM7A 1T1WB 3EXLA 5CGBA 1PY0A 2XV3A 1KPVA 3P9MA 3OWRA 2WCSA 3RVWD 2EYRA 2ICWB 1MIEL 4EKJA 5I15L 2JKWA 3FQYA 4XPBH 5DZVA 5IKCB 4PJCB 3MNMA 2ZD0A 3U2JA 4Q9CA 1G9NC 3BEVB 4GKSA 4UIKH 3WNLA 2J6EA 2WMPA 1DDHA 3CZNA 4HV8B 3O6FB 2G2NA 4KXBA 3QNZA 2WLHA 1JV2A 4GH7B 1HL5A 1WH0A 1WAPA 2PYEB 2FX7L 1AZBA 4N5EC 1YEGL 2HX8A 2P5WD 3FUNA 5HYSG 2VDPH 5B3NA 5DRZB 2IGFL 4JQVA 1UENA 5TE4L 4S0SD 5T3ZE 4ZW8A 2Q8AL 1CB4A 3TTYA 3UPRA 2A74A 3FN3A 5D9SA 1A7QH 2UZIL 4TS6A 3ZKND 5HYFA 2HJKB 1DSFH 5DHYA 3DX9A 3BUDA 5DHVB 4J39A 4MA7L 2R9HD 5GIRB 3DVIA 4F5CE 3IJSA 3TVMC 5DSCA 2VZTA 2ROXA 3CXFA 3ECBB 1LNUA 3P0YL 4WWKA 1JWMB 1CDJA 4KROC 4U1NA 1Q38A 3VXUB 2G2RB 2IFFH 3MRCB 4OCRL 5AOMA 4DGVL 4U0RB 2VLRD 2OL3B 4PD4K 4U6HB 4XWGL 3FONA 3T2PA 4NJAH 5D2LE 1ZA3A 3WAJA 2BNRD 3MOAH 1XO8A 2H9GA 3FO2A 1AE6H 4PP2B 2F1BA 1D2PA 2H1LM 1T0NB 1AHWA 1PZ5A 2J1YA 1ROWA 1CXLA 5AWNH 2YXMA 5FIEA 4M7JH 3TO2B 3CD4A 4FFYH 1M3IA 2WGNB 2WXKA 4MAZA 5CIPA 5E0QA 2FBJL 5SWZE 3U7YH 1QR1B 4KFMA 4R3SA 1HH9A 3S3DB 2W07B 3K1KC 3PHQA 4I77L 3ETTA 4H44C 2XXCB 3BZEA 4R7DA 4HT1H 3S2CA 3EUDA 4KJYB 2IIJA 1U33A 1DJXA 3SBRA 3SPJA 4APQA 3HUJF 3THML 4M3JA 3ARFA 1TDQA 1YA5A 3U4BH 1IVLA 5I1GH 3G3LA 4NQTA 4IRZH 5CUSL 4JQIA 1SEBB 5E2WH 2BW5A 2F74B 5IVXB 4B9JA 2OMYB 1YPZA 2LLLA 3AS3A 2NMSA 1LO3H 1QLRB 1FLRL 1MXDA 4CGUB 1FORL 3PU7A 1HOEA 2R0KL 4XP1L 3QNYB 3UC2A 1KTRL 2VZSA 5BO1H 1LWHA 5K9KB 1XIWA 2ZWKA 2Z7ZA 1C5BL 1TCRA 3P4NA 2FEJA 1HIML 3UMNA 1T1YA 2F54E 4R4BA 3T6QC 2WVVB 3QUXC 1ZGLA 4BH8B 4GT7A 4YBLB 1IBDA 1AQHA 4XI5C 2NY1B 1YJDL 1FO0L 2HX9A 1U8IA 2EJ1A 3QORA 2AQRA 5J6HB 3PE9A 1E3XA 2MCG1 4JM2D 5I8CA 2APBA 4YDIH 1GIGL 3PP4H 1TMCB 2Y72A 1IUZA 2VDOH 4Y2DB 3Q5OA 1A7NL 4DZ8A 1XGZA 4KQ3L 1AO7B 2ESVE 3QEQE 3TJHD 4GG6A 1X44A 2YAEA 4OUUA 3RGVC 2PR9A 3V5KB 5AAWA 2FHFA 1VKXA 3RB5A 1RZ7L 2C3VB 2FX8H 3IJ7A 3KLKA 3WAKA 1SN5A 4NLAA 2G3NA 1RZJL 4G5AA 5C09B 1WWCA 4UZUA 4CN1A 2PCYA 1SJHB 4PJ7E 4JO3L 1KZYA 3ZT6A 1W9XA 1ILSA 4NT6B 4QRRA 5ICXA 1I7UB 4BEIA 3MU3A 1UQSB 4X99B 5E6RB 4WGKA 1QMUA 2R2HB 2YQGA 3LRSB 4XWOC 5HI5D 5CEXA 3D33A 1RAMA 5J1AA 5CXPA 1J5OL 1GVIA 4TULL 1UYWH 4XVSL 3WTSA 1AY1L 4LMQE 5IEKB 1EZLA 1ZLVH 3TN0D 1BEYH 3GMNB 4PRBA 5F9JB 5C92A 4RRPM 3RUGF 4HG4K 3GPEA 3LN4A 4IOFC 1GA2A 5K9QI 2QZQA 4FFWC 2A1WH 2J25A 4MNQD 5C0IB 2NW2B 5TK4A 3FRUA 5FYJL 5L6YH 3TJEL 1XGTA 5JNYB 2VJ0A 5DMYA 3FFCA 1XHHA 4DEPC 1ORQB 3ZRSA 2R56H 2GBAA 1E9OB 5E1GA 1FE8H 2K9UA 3TGXA 2BSSB 1CLOH 3L13A 4EI5A 2VQ1A 5H2BA 3V6FB 2NY3C 4WI0A 5BMFL 2W65B 1FZMB 4AH2B 1MFEL 4LAQH 1P1VA 1XF5B 3EJTA 1D7CA 5GS0L 1AR1C 3HI1A 1AQKL 2V9RA 3QIWD 1FNLA 2OMNA 1BIIA 2OR9L 4AG4L 4UMGA 3IK2A 3C60B 4KI5F 4UQDA 4OV6F 5FGBC 2CXKA 1R3KB 4LEOB 1S7WB 2XWEA 3VQ1C 1RZIB 3HI6L 2XFXB 2OYKA 1T2QH 3SGJA 3CZKA 3WEMA 4L8BA 4HS8L 3P4OA 4L9LC 15C8L 3PWPA 3FCSA 5ESAA 1MFDL 5AB9A 2Z7WA 2E7LA 4ZMNA 5HDBF 2IWFA 5JPNB 5T3ZL 4XVUD 1CFQB 3GZQA 3C8KA 2QQNL 1AYOA 3HTLX 4I8DA 2PUQT 4NSKB 3QISA 3ULVE 4QHLB 2ODIA 3EG9B 4ICXA 4XX1E 4XXCA 3WFZA 3VFWB 43C9B 4UOJA 3SPCA 2GVYA 4GMTL 3TVMA 3KBFA 1QABA 3FB6B 1YNLH 3VI4A 2HN7A 1TTGA 4XNXH 5EUOE 2IPKB 5FF6B 2PCXA 4D94A 1MFCL 4X5XA 4O2FB 4HWEL 2IVFC 4YHNA 5D93B 4H0IA 4PD4J 1E0OB 1YPZE 4MA1B 4BQCA 2J88H 5JIIA 3PQYB 3QE5A 4PJAA 6PAZA 4UT9H 1G7IB 1IGYB 5I8OL 2Q20A 2V3EA 4QRAA 4P9ML 4MD5A 4X4YA 4WTZG 3OKNB 3B7UX 1R5VB 1MF2H 3IYLW 4L3EB 4CADB 4DNLA 5TF1H 4ZODA 3GZPA 4DQOH 1IIIA 1WFUA 1RHHB 2KZKA 3F65A 3NJHA 4ODWA 1O7DC 3ZX1A 3AU1B 1L5GB 2ZIDA 4JFEA 4HXAL 4E5XA 1BDYA 5I30H 1JUFA 1Q94A 4QRPD 4JRFA 2GBTA 3WELA 1S8DA 4AK1A 3VXNA 5EBLA 1NCAH 4M93B 1ZHBB 1M2VA 5HJ3B 5I74B 4Y2OA 3B9EA 3RWCB 3MSPA 3T0ED 3JWDH 4X98B 3V6OE 4GT0A 3GMMA 4NZUH 4PY8I 4CMMA 3K1DA 3MBWB 4MNHA 2AQ1A 5I0VA 4MAYC 1BVKA 3WUWB 1CURA 4LSSH 4UIMA 1KBPA 1UOKA 3SJVA 3TWCL 1QFWL 3QG7L 4K7PH 2BHUA 5E8EB 2YQ2A 3KYOB 4HULB 4MQ7A 5BPPA 5JPMB 1Z9SA 4B5EA 1UWXK 1IZKA 1DUZA 2AEIT 4RMSA 4DGYL 1XGYL 4GEJA 1RLBA 2XY2A 1WS8A 1TQSA 3HG0A 3QUXA 3LXCA 4XC3L 4MBOA 1N0XH 2Z92A 3TFBA 3U46A 4B0MM 2Y2TA 5J0BA 4Z7QB 3N0PB 1NBYA 3UXFA 3I6LD 5C0FA 5KZCD 1S5HB 3KM1A 3D34A 2R0WL 3NA9H 4Y16D 5HHXH 3VXQA 1R5IA 2Z31B 1D5ZA 2DH2A 4JKMA 2PO6A 4IOIB 2GI0A 3RVUC 2XWZA 3A6OA 3ZTDC 1ET5A 1T3FA 2DLFL 4PB9H 3CFQA 4XPGH 3D6GA 4B27A 1M6UA 4N8PA 3GEFA 4CC4C 2Y1YA 5HGBB 4UQIM 4NIYE 3PJLA 2WYIA 2VTFA 1QI4A 5JHDA 1EVUA 4GRWF 1NFDA 3ZZQA 4XMKL 1I9JL 3RGVA 3UZQA 2B0SH 5JIDA 4MQTB 1A6PA 3Q8FA 4A37A 3X3GH 2EXWD 3RZCA 4LEXH 3UGEA 1YECL 1WZKA 2NXZD 2R0ZH 1D7DA 3QBTB 5F1NA 2P9RA 2W80C 5F44A 1CTMA 2UWEB 1DL7H 4M8RA 1O5DT 3H4FA 4Y5YB 4P5TC 3QUMB 2K6YA 3S37X 5L2JB 3FL7A 4Q56A 2LT9A 4HKZB 4HUMB 3MBXH 4YDKH 4TTDD 3VFVB 5GS2H 4NZFA 2JKLA 2O61A 1ES0A 3HNVH 4KGLA 4OZ4A 3T3ME 5HJDA 4D9RE 1IAIL 3LZFH 4HG4J 3LHAA 4PJ9C 2F58L 2ARWA 3BC9A 4OAWA 2D31A 3IDXH 2CSPA 3AG2B 3PWPE 2MKWA 3S5LB 4OM1L 4L23A 1ZD6A 1MPAL 4H1LH 4KUCD 1JE6A 4DIXA 2X2YA 2QADC 5KYUB 2VXVH 1JPGB 3EJRA 4JRLA 4P5MB 3T77A 1KJ2H 3GMPA 2AJ3B 5A2FA 5GPRA 3B2VL 4AV5A 2YPLA 1L7TH 3PF2A 3ZDYF 5KSVA 3IU4L 3MRDA 3GBDA 3BXNA 2P42B 4TNWF 3C8DA 3U83A 5L88L 2O30A 4M1DL 1A4KB 3L3HA 4UI2A 3APMA 4GJTB 4RIRA 5KSBB 1FQ9C 1DJZA 2FLBT 2YN3A 4R97C 1SF3A 4KJQD 2H6PB 1Z6JT 3PY9A 4AGLA 3L5JA 1T80A 4G5ZL 1S7SB 5DEFB 3VRLF 3DBSA 4OF8A 5MENB 5MEOB 2JI3A 1LO2H 2JVUA 5GGVH 3OXRA 4POZD 1AHMA 2OTWA 5LUMA 1SY6H 2V37A 1XZ0B 1S5IH 2FATH 2LU5A 4U1SB 4GKZA 3M1CA 1BZ7B 2OI9B 4XNZC 4ZMLA 3G6JB 4DAGL 3IE9A 1BV8A 3UYRH 2IAMC 1KB5H 1QPKA 1KLFA 2FYYA 4H8WL 3W11C 1AD9A 2Y25A 2F61A 1XB6A 3D69A 3GIVA 3QRGL 3AWGA 3IDJB 5KJ7E 2MPAH 3ISRA 1T03H 2JFCA 2FWOA 2YAOA 4RAUB 2X1QA 4S1QH 2H1XA 3DJ9A 3OZLA 3N44B 1U3HA 3RVTC 3WFEH 2V8MA 4Z23A 2FQEA 3MRBB 3EOYG 3SHSA 3P3TA 1MW3A 2WXQA 4Q9RH 3MRNB 3OL2A 4UTBH 4YGVB 3UERA 4L4VA 4BFGA 5IFHL 4XP9H 3MLZH 3I6KB 1HKLH 1J86A 3L95B 1S7TA 2OXHB 4BUGA 3ZKQD 5J9PB 2G3MA 4WWKD 3Q1SH 4NGHH 2ADIB 2AGJL 4HWBA 5KYXB 1WFOA 1GZQA 2AEWA 4NBXB 3S36H 4OD3H 2DQGH 3UFIA 2X4RB 2O6PA 1RIHH 4PRIB 3T6WA 5D7IA 5DD1L 2DAVA 4AJYV 1D3CA 3FB5B 4NCDA 1B88A 2Z35B 3ECUA 4X7FC 3R0MA 3GRWA 5HYJE 4U1LA 2DWEA 3O2DA 2X89A 3C5ZB 5AFAA 3WI9A 1XCTB 4CNIB 2OFQA 1UJ3C 4JDTH 2OV0A 5A16A 1EEZB 1X9UA 3PJSA 6CGTA 1B2WL 1CBJA 1V55B 1BFOA 2W0FA 5DMJB 1WCQA 1RIVL 5DZNA 3CV5A 3CPLA 4EIBA 3PNWB 4Z77A 2EIZB 1KFAL 2W5PA 3M1BA 1JPFB 4G9FD 2XZAL 4RA3A 1SXNA 4IGBB 1JMXA 3BP5A 5DD0H 1CGUA 1U93B 1S46A 2WQVA 3IMSA 4IU3B 1HEJC 3EFOA 1N4XH 4NN5C 1F42A 1WO2A 4MXVF 5CWSA 5CEYA 2E8YA 4UF7C 3SOBL 1JNLH 3UTPE 4BXVA 2C3GA 1BD2D 3IFLH 1I1CA 3CVHB 3BGAA 1T22A 2X1WL 3NDYE 5DGQA 5DS1A 2WYTA 3Q5YA 1Z66A 1U92A 4ZYKA 2DBJA 5LJYH 1AOHA 2OR7A 3ARBC 4XRCA 3SBWA 1GRWA 5F7YC 3T0XA 3OKKA 4M9PA 1U8HB 3WKML 3P3YA 3BH9B 4LHUG 4UAHA 4ZPVA 3UYPB 1LP9B 5D2NC 3UJIL 1Q9KB 2NSMA 1PYWB 1HSBB 1B0GB 3BESR 1KXVA 1V05A 1A9EB 1KV7A 1SZNA 4BZ2A 5F1OB 4NERA 2VLJB 3WJMB 4Y4KB 4UB0H 2EKJA 3BQUC 5DCCA 5C0JB 1E3ZA 2PCFB 1KC5L 2IBBA 2Q8BH 4JDEA 2AXFA 1OM3L 1NMAL 3OMNB 2CXGA 1CDCA 3WIIL 4GRMA 4TN9A 4NZRL 1XR9B 1OGAB 2OMWB 2MCPH 3AMKA 1XBDA 3DXAB 4P5TA 1MCJA 4CRPA 1MFBL 2JXMB 3TO4B 1KZQA 5FS5A 4C55A 4GAFB 2JCCE 5EIIA 2X4PA 4WTXA 3PREA 3S34L 5GSRB 5DXWA 5E1HB 5BV7L 2C1OA 3HUJA 1L9OA 4XP5L 3V4VB 4JHWL 1J5CA 5HGAB 3DMMB 2X4SA 3OXSB 4YHMH 1CK0L 3MRPB 4I1PA 4CW1B 1D5XA 1KEMH 3TBTA 1VFMA 3WY4A 4NB7A 4JFTA 3MYZA 1I1FA 2V9TA 4L8SA 4ELME 1TTAA 5E00B 3ESOA 4QEGA 3WEXB 3MV9E 4U49A 1EMTL 3QPKA 4MZRA 4AKQA 2DYSB 4F2ME 1PCXA 5DJDB 2WYZA 3QUZC 3TBYB 5FW7A 4XPAL 2VO8A 1IO4C 4LF3B 3MUGB 4I0PC 4Z95H 2Q2EB 2QT6A 1YEHL 3LV3A 4OIIH 3DETC 4GG8B 5LVEA 2JJTC 3QZNA 3GS7A 4FNLL 3DI3B 1NMBH 2KT6A 3HS9A 2PLTA 4HQQH 3RDTB 5IK3B 4Z7UF 4XTRC 2I7SA 4MZIA 2AK4E 3CN1A 3KPPB 1OTUC 3ZUNC 4TSBH 3V6BR 2Z8VC 4M48H 2EEXA 1TQTA 4DSYA 1IC7H 3T0DA 1R9FA 3T0VA 1X6NA 4HOXA 3AXIA 3VQLA 4H1LG 4RGNE 4YDVB 3J07A 3W0WE 3SQOL 3WIFA 4PM1A 1MCCA 4I48A 2WVUA 3HG1D 4FQXB 7TAAA 4N5ED 2QQLL 5DRNA 4Y4HA 3F6IA 3ZL1A 2BCKB 4G8FB 4M7KH 5C0EB 3BGFC 3ZSSA 1OCWL 2IADA 3HRZC 4JM4H 5KSUB 2XPGA 1KJ3H 1N6VA 3QQDA 1MELA 3ZE1F 1NIBA 3QJUB 4QHNA 3KPQA 3U2SA 5AOJA 4X8JA 1UD2A 5EZIL 4MDJB 3TVMD 2PMZA 5I5IA 3ASNB 4YFLF 2NTSP 3UTSA 4JFDD 4KROD 1QNIA 4JEGB 4X50A 3EH5B 3SYCA 4FABH 4G8IA 3ILQC 3P4LA 1MLCA 4LIQH 3ESVF 3VXTB 1FNAA 3VMOA 2Q10A 1NGYA 4DOHE 1PZAA 4JLRA 4XNYH 1I8KB 1MW0A 2FB4L 4P4RB 5I6LA 2DKSA 1UKSA 3AAZB 3KXFB 4PWJA 2YPKA 4KX7A 4YAQB 3R7QA 1LE9B 2MWCA 3NCBB 4IK6A 3L4ZA 2GI7A 3IDYC 4FXKB 1ORSB 4S1RL 4ZMPA 5LKNA 2ZOLA 4KY1L 4HUWA 3DVGB 1TU2A 3SCMA 4U2ZA 1IZJA 2DQEH 3WIHH 2CJUL 3WIAA 3WTXA 1DN2A 1YYLL 1MCIA 4IKNA 3TA3C 4XNUH 3EF4A 5HHOD 2LFGA 2G3XA 2AXGB 5E5MA 4FLSA 1LL1A 5C0NC 1WPCA 4IDJL 1A6VL 4HK3J 1KIRB 1KYAA 3GDBA 5LBVA 4H2CA 4U1GC 4UQ9A 4NM4H 3N0AA 1MZZA 3QUHA 4FFZL 4ZFOA 3VXMA 2QPUA 2JWYA 4JRYD 4N0YL 4ODSL 3WGVB 3NABH 1OWWA 1E3FA 5CAYB 2X12A 2IXQB 4JG0H 4GAGL 1VHPA 1PKQA 1SN0A 4JFZL 1MKFA 2NRDA 2YEZA 3CC5B 5E8PB 5IMKA 4TQIA 2KZBA 1NJ9A 1H3WM 3QUXD 3TCLB 5IHZB 2F7RA 3Q8CA 5D2NA 1AHKA 1JPSL 2FD6L 3W37A 4XI5D 1YJDC 4B3VA 4E41D 3C6SA 2JKTM 3MV8D 4NQEB 1V7NL 1IJNA 3BP6B 3COOA 5HDWA 5TH2B 1KLUA 4U6VL 3TBSB 1U36A 5TDNB 3MLRL 3T65A 4YHOH 35C8L 5T1KA 2B8OT 5E7FA 4QYAA 3E1F1 4U05A 5C3LD 2BSBA 4NKDB 5B3SB 1P7QA 5BZDB 2Q86A 1HVXA 3U30C 1FV1B 1ZDSA 2JLPA 3V52L 4WI2A 3RA7H 3RWGB 4FNRA 3D48R 3FQWB 2CR6A 4NENA 3RGVD 3DX8B 2RBLA 2TSBA 5KBMA 3KJ6H 2G4EA 2V2XB 1ZHKB 1RZJC 4YZWA 2VMJA 1BYOA 3KPLB 4FMFA 4M5YL 4ONGL 4PRDB 5ICZA 4X4XA 3P73B 3BPCA 2CNZA 4YNYA 1W8OA 4J5VA 1UURA 5CP7B 3IMVA 1OCOB 4HP5A 4ODTL 1CFVH 3BDYL 2C4XA 4EI6A 3B9KA 5EUOF 4XWOD 3ASWA 3CJJA 2VDMH 4P4KC 5C0CD 2W9EL 2C9UA 5E5RB 1IBZA 5B1BB 5JQHC 1QUNA 4MJ4A 3GS4A 1BZOA 3WXVL 2OULB 4IOFD 4AQEA 3QA3A 1A7RH 5K93A 2ZWSA 3HOGA 3MLTB 4JFXB 1KGYE 4PGBA 5FYLL 3RWDA 3KDMB 1V3MA 2APFA 1I82A 3I9GL 1S3KH 1FG2B 4NM8H 2UVFA 5HD8C 4F2EA 4I0PA 2YPLD 3VDCA 5A43C 4B0MB 2HH0L 1IE4A 2JJTA 5FOBB 4OGXL 1B0RA 2NY3D 4NIKB 1ZXQA 4GXFA 1E40A 4IEFA 4JZOB 3SDXE 3TYGL 1FN4B 1AR1D 3FHAA 1SBSL 2BWDA 2ENPA 2ZCLH 4NN7C 4F7KA 2H2PC 2XSKA 2CPUA 4KRPB 1BJ1H 2ODHA 2YWZA 4W9DC 5DZOA 4LQ1A 4ZUTB 1ZTXL 4M62L 4KKRA 5IVZA 4L8CB 2KZ1B 3CXDH 5DGRA 5MEQB 2V5RA 3LPOA 5AG9A 1I7TB 2XZQL 2DQHL 3F7KA 5G5DB 3D4ZA 4WFFD 3UIYA 2DMKA 3NZ8A 4WU5A 4KNSA 2MKLC 2X4UB 3II2A 2EYSA 5IBTH 4PJIE 4OV5B 2O5XH 1AXTL 3QIBC 3L3DB 2OZ4H 4N2HA 3MROB 4G1EB 1HT6A 1Z9LA 4PJ5E 5FUOL 3O4OB 4BDVB 2OMVB 2XU9A 3B7SA 3T1FB 1RIUH 2ITDB 1RZFH 4LZKA 3II3A 2N3JA 1H9VA 4V1DA 2BOCA 3MBEB 4W9EC 4AEIH 2G0LA 1NC4B 4FXLA 4EVNA 3FMGH 3K46A 3LTVA 1H3VA 2V7NA 1TJIH 3EGDA 1F6AA 1RJZB 1OGTB 4NZTH 4OF5A 2F18A 3GJFK 2Y7LA 2D7QA 2ORBH 3JT2A 5HDQL 3PP3H 1X9RA 2IC2A 3LEVL 3U7WL 3V4PL 4L4VD 4Q4IA 3OMIB 4O02B 4PGEB 1OT1A 5F3HA 1EZVX 5DZLA 3CHQA 4D0CA 4P2QA 4M8VA 3FQ4A 2XZZA 3HE6A 2QQKH 2HFEA 2NY2B 1WS7A 4JN1L 1C7SA 4DWHA 5D8JL 2V2WA 3MXWH 2H32B 3OD3A 4RFEA 4F8NA 2OMZA 5F7FA 4KY2A 1IIKA 1BIHA 4HV8A 5DD3L 1LD9A 5GZOC 2Y07H 4TQEH 3NIFE 4FZEL 1IBHA 3MCKB 3BDXA 3HMXH 4PY8J 3AS1A 1DUYB 3BEWB 4DZBA 2PABA 4J3OG 5GRUL 3DRTB 5HDOA 5AG8A 5C3IA 5FA3A 2Q5BA 2NXYC 4MJIB 3VU1A 4AENA 3H8NA 5F7EH 3BJ91 3UBXA 3WDJA 2F53B 2BOLA 4JDVB 2EEDA 1DO5A 2YMTA 1BSIA 1JV5B 2YZ8A 3IJHA 2ZNWA 3QXAB 3IXTA 5DHVA 4FFVC 3FTZA 3T3MF 4JO1H 4P59L 3CFJA 4XCEA 3W39B 1H8LA 3ECBA 3WTYA 4ZPTA 3EGXB 1JZHA 2I32A 1JWMA 5SWQA 4O4YL 3RIFF 3VXUA 3D1MC 4H0HB 2XWTA 2G2RA 5J56B 5I1EL 4ZNCD 3C5JB 2XQYG 4JY6A 2EE2A 1GGIH 1WC7A 3GSNH 5ECJE 4WO4A 1O9VA 3EYOA 3EHBC 2WKGA 1G6RB 4TQPA 2HLAB 1DN0B 5C07E 4AM0A 4GW5A 5HHME 1BXXA 1EDHA 2DI8A 3B5TA 4PMEA 1L7IL 1TXKA 1GGCH 1T1XB 1XCWA 5GGTL 3VWKA 1DQTA 1SEQH 4JO5A 2OXGA 3H7BB 4GRLB 4P2RE 4WQOA 5DD6B 3QH3A 4YDLC 4NHCL 2BHZA 1OPGH 4JREB 3RVUD 2IF7A 5FM5O 4G83A 5EULV 3RI5K 3WCYA 3ET9F 4NLHA 1R3LB 4K23L 4MMXA 4YE4L 4E9SA 2A6DB 1SDDB 4QRTB 3JZ7A 2CH8A 2R1YA 3LXUX 2DMHA 2LGNA 2ZUYA 3QC5X 1E30A 3JTSA 1DVFB 2PTTA 2XN0A 1FGVH 4M6OL 4TVPE 1IBBA 1R33A 2N59A 3BWUF 3GWJA 1SEBA 5CJOL 4FQ1H 2VDRL 1Y18A 2EYTB 1FNEA 1TJHL 4AC4A 4H8UA 3P11H 3CFEA 4P5TD 2GBVA 25C8L 3GTNA 2M1KA 2P5PA 3L7EB 1B4JH 3WNIA 5ENWB 4PRHB 1RZGA 4N1HB 3T71A 1RUQL 3UAFA 2I60H 4J6RH 3U6XA 1ADQA 4MCYB 4PJ9D 5AKVA 2L0DA 2VLLB 1VFAB 3VFRB 1OTTD 4OM0L 1I8MB 1M7DB 1R1CA 5KVGL 2IAAC 3PHOA 4Z7VB 1YYML 3MXVL 2NX5A 1DP0A 2FGZA 4X4MA 4XZUB 1JK8B 2QADD 2ZAIA 5IV2B 5FHAH 2P3YA 2VDPB 3MACH 4BKLB 5AD0B 4J2XA 1IAOB 4ANXA 3CFTA 4F33B 1BAGA 2DKUA 4CU6A 5FFLA 4LSDA 1FL5B 4ECNA 2XQ0A 3VSTA 1FYTA 3QZMA 4JPVH 3HC3L 2ALWA 3KLHC 2Z4TA 2F8IA 2ZUQC 3KPNB 1NCWH 1T0PB 1MCQA 4ODHL 1S9VB 1ET8A 3EJSA 3WTTA 2GSIB 3L4UA 1SJHA 4YJZL 4LAJH 2VE6A 3IPFA 4B3EA 2BOBB 4WWPA 1XH3A 5DQ9B 3MGAA 2MCAA 4PJCE 2HLEB 4O5LL 2WD0A 4X99A 4HH9B 2HA1A 3ZYJA 3PGFH 3VD0A 3HS0A 3OPUA 1HAWA 1N19A 3KYMB 1V27A 3QIBA 4NO0B 2AJVH 2LV4A 3L1FA 3ARGC 3WFCH 5E94B 5BRZB 3FHEA 3APFA 2PYEE 5GGUB 5KBLA 4KWUA 1G7HA 3G5VA 1SJEA 4OCWH 4L0ZA 2XZCH 5LDUA 4O9HL 5IG7B 1NUDA 4H8WC 2IAMD 3FUJA 2B14A 3V0IA 3WXWH 2ERJB 2JIXB 5C0IA 4XN5A 2X87A 1PZSA 2NW2A 2VJ8A 3Q2NA 3UCQA 2IDSA 4WI5A 3QS3A 2YOCA 3CX2A 3BGMB 3FT0A 2M2DA 3RVTD 4ZS7H 4Y5XB 4AGMA 3IJEB 1F58H 1HL8A 2YPVH 3C2AH 3OKDB 1BQUA 1U8JA 2BSSA 4IK7A 2X4QB 2XWJA 4Y19B 3V6FA 2X28A 4X9FA 4KRLB 4AH2A 5I71B 1KTJA 4M3KB 4X5QA 3UTTB 1DJYA 5KANI 1KGUA 4DKEL 4JCMA 1UM4L 1E4WL 3UTSD 3VXUE 4G9DB 5B1JA 2ID5A 1Z5LB 4LL4A 2E7BA 1IEBB 1GZPA 1SBBA 2HG5B 4XBGB 3GMRB 5AZUA 4ZW3A 1FJ1B 4PJDF 4FTVD 5JLZB 1Z32X 4N6RA 2XIBA 2ZJSL 4RMTA 5E9DA 5KN5B 4Z7WB 1IBGL 3JV5A 3BH8B 4KK8C 4QOKB 2XFXA 3LQZB 1N0LB 5E8OA 3RY6C 3VRJA 4Z7NB 4RDQF 3QAQA 1YEJH 4QRQB 2EIJB 1H3UA 1MWOA 3BE1L 3CLEH 4Y1AA 4OLWH 1T7ZA 4Z7UA 1JZDC 1Q1JL 4TUJA 3PFUA 5D1QB 2VC2L 4N1CA 4WJG3 3SO3C 4EDWL 4YSCA 4GI6A 1YN7B 3W81A 5CEZD 2W38A 4JZJA 3V6OC 1QSFB 3T8XB 5KS9F 2RCSH 5CJ8A 3L3OA 4HIEB 2VDOB 4TNGA 1A6WH 2P24A 4X0KB 3UTZB 3O0RH 2AI0H 1RUAL 4ZAKB 5IVXE 2ZXEB 3KWWB 1OV8A 1ACCA 2X1XR 4E9LA 1MEXH 4O2CB 2AQNA 5BJTA 4R6UA 2PP9A 1RVFH 5F6HJ 1EHLH 1TFPA 2YAMA 1BYPA 3MJ9L 3GSWA 4V11A 2WLIA 1ND0A 3MRJB 3BAJA 3L17A 3P0VH 2BC4A 3POCA 3GGWA 1L3NA 3R1GL 1JGDA 3IXAA 4KJPC 1PSKL 1GC1L 3Q6GH 4YX2H 2AQPA 3ARBD 1DVXA 3LS4H 3QO1B 2EDTA 1JG9A 4PWIA 4I3SH 4TXVB 1CGVA 1C8QA 3ZZSA 2J6EH 4FF9A 3IETA 3HZYA 5I17A 5IM7A 1A3RL 1MFUA 1NPNA 2OMXA 3WENA 4D2NA 2DQIH 1IEHA 1IGJA 4OQTA 4ODVH 3U1PA 4P46A 3IGAA 3BLPX 4KHXH 5T1KD 3QARA 4R26H 4G6ML 1SMDA 1RJYA 4JO2H 5EN2B 3CQQA 3FW6A 2BHYA 1Q4NX 2WXOA 3SDCC 3TOPA 2MTAA 4ES8A 1AO7E 3MBWA 2EIEA 1BVNP 3QRLA 2N7SA 2WAQA 1VLXA 4OLYL 3L5WA 3ATAA 3GMQA 3TZVB 3ZRFC 4G8GA 4RZKA 2CHZA 1I8UA 1BZEA 1U4FA 5C09E 1LO4L 1J1OH 3X14A 4AMXA 4KUZH 1INDH 4UZSA 5E8EA 4WHTB 3X17A 4XNQB 5F3FA 1KNOB 5BV7C 3UO1L 1DJHA 4FN0A 1JGUL 5ESVB 1QG3A 5DHEA 3LIUA 1HINH 2KBGA 4O58L 4OCYH 4PWEA 4NYLA 4ZNEE 5GISL 3O3AA 4QXTA 1NANI 1E50A 1AKPA 3B9KD 3O4LA 4NBYB 1KBBA 3T2QA 4RFOH 3BRFA 1RY7B 4IKJA 2VR8A 5K5YA 3RNQA 2GUYA 4NNYB 5CIPH 5IESL 1G84A 3B6SB 4GY4A 4BH7B 2R27A 3QEUB 5HGBA 1FIGL 2FT7A 2IANB 2OS7A 3QUZD 4KO5A 3J2PA 3RPIA 3JWOL 2EEBA 1T5XB 1WWAX 1DE4B 2DM4A 1AZZC 1AGDA 4I0PD 4U7KA 3DETD 4MCNA 4QI3A 1A02N 4YO0B 4K7FA 3HPLB 4RBPH 3Q06A 5JIKA 2EDFA 5MERB 1NLBL 1OO2A 3GT6A 1XD0A 5D7JB 4XTRD 1G7JB 4Y5YA 3JQOB 2QVIA 1OTUD 3IGLA 5L2JA 4IRSA 1WK0A 4XMPH 2MOQA 5EU6A 3VFNB 5HHQB 1H3PL 3R7RA 4LCIH 5KSAA 3BZ5A 3HKZA 3QQ3A 4ODBD 5IFJB 1JGLH 2L7UA 4EOWL 5DU7A 4CJ1A 5E56A 5IHBA 1AP2A 4TNFA 4KZDL 3BWUC 3O81A 2BZDA 1A6AA 5DMGC 1O9ZA 3MLPA 4UV4H 1NEUA 3G04B 3K4AA 3H9SB 3M46A 1T66C 1UWEH 4P5MA 4EN3A 1KIQB 4BCZA 2JTDA 4QF1B 3TESA 2YAQA 5L9DH 5FV1L 1XGPA 2FJUB 3KPSD 3RB7A 1ED3B 1JFQL 5SWSA 4I5BB 2HKAA 3CSGA 4GMSL 2A77L 3LD8C 1WZ1H 2WLMA 4NXKA 5LO7A 4LHUB 4ODUB 4ZXBB 5KYNA 2A9NH 4JGJA 3CIAA 4QTHA 4N2CA 5GGRB 1ONQB 3JBG7 4JHAL 1K5NA 2JKRM 1F0LA 2NYYC 3QDJB 3VSQA 1PLBA 3VD2A 4Q6KA 5SX5H 3PQYE 4KO9A 5IQ9B 3ILQD 5LNDA 1J1PL 2XICA 3QPXL 3WN5C 4Z78A 4P2QD 1UH3A 3HE6D 4WUUB 1M7IB 4Z7AA 4B9IA 1RUPH 3UTQA 3PAUA 3NPSB 4JPKH 2G9KA 5EOQL 1E8YA 2NY4C 4BINA 4L3EE 3BKJL 3SE9L 2VM9A 2NR6C 2ADJB 3A4FA 2UY6A 3KGRA 5HVHB 2DY2A 1UEYA 2JJUA 3C5SB 4OJYA 3SODB 1NGZA 5HY9B 2W94A 2ZKYA 1N5YH 4LLYB 5E1AA 1L6ZA 4NQCB 5EZOH 3LVTA 3KPTA 2FWSA 2O6EA 5D71H 5EC1B 2KMWA 1CTNA 1DQLL 3NIDB 1E28B 4KTDL 4LASH 4K3JH 4K5MA 1EFQA 4PG2C 4WV1C 2VR6A 2XN2A 1PS3A 3TA3D 3BCDA 3ZUCA 1T20B 2W8CA 3QZWA 1J9QA 1U8NA 3BSZA 5DWUL 4E36A 4A39A 1MAMH 1MRFH 3WS6C 5B7EA 5DMIL 5E99L 5C0ND 2J2ZA 2YUXA 2YRLA 4D8PA 5C08B 3F7LA 5C0RH 1QWHA 3GBMH 4JGMA 4M3HA 4X7TB 4BIKA 2K3TA 4OLUL 1S4IA 1X5KA 1PY4A 1IGTB 2DYPD 3CDGB 2V0AA 1NEZA 5CJXC 5DDHB 4YVUA 4YXLL 1EFXB 2OJZH 1IMHC 4R90L 4N24A 2R8SH 4WO4D 4IIZA 1UXLA 5IFAL 1JF1B 3K74B 5ITFA 1Q9OA 1G9NH 1RUML 2Z35A 3LKSB 1I8LC 2XG4A 4HGWA 4UU9B 5EO0B 4Z7QE 3BT0A 2B2XH 4GAAA 3VFGH 5IWLC 1N70A 2EACA 4ZTOL 1UCBH 3D0VA 1I1AC 2HFGH 1MJ7H 1YMMB 4TUOA 4X7SH 1JHLL 1XCTA 3IMRA 3UABA 3UZEC 2PYFA 4L18A 1HI6B 4WU7A 4OKDA 2BNQB 5LGHL 3U82B 3VXRB 1EJOL 5F9WB 4H1LB 2WNKA 4O51A 2HKHH 3BO8A 2YSTA 5I1IL 1KJ2B 1WFJA 3V5HB 2NY5H 3BP4A 3PNWA 4ISVB 1RK1A 4JJ5B 2EIZA 3X13B 3EO1B 2A4CA 4AKOA 3F6LA 1HU8A 2H26B 4Z8FL 1UTDA 3AREC 1T04A 2IH1A 5EOCL 1GS7A 1VADB 1K72A 3BISA 4R2GB 2JKIS 2E46A 1QEWB 1M1XB 3WNPA 1A25A 2PW1B 2UWEE 3O3EB 5KVDE 1KIUA 1OLZA 5D72H 4PGJA 3FYEB 1LXMA 4Z3HA 1LVEA 3EOTL 4CBZA 2EDDA 3DDFA 4LHQB 4YIQA 5I1AB 2BP8A 4P4KD 1J05B 2Z1KA 1U8HA 3UYPA 3G6AA 1RPQA 4N1EA 1AFVL 4FA7B 4LCCB 3S48A 3LN9A 2B77A 1VCBC 2JJWA 3FCTB 5EZJA 2YBRB 3U4EA 2HFFB 1ACXA 1IFGA 3S37L 1QYGH 1GXEA 1LEGB 2E74C 2Z7YA 3EH4B 3S3PA 1UVQB 3ETSA 5FYJD 3GK8L 2VSCA 1MLBA 2VLJA 3OF6A 4PJ8A 4Y4KA 1KB5B 3D0AA 5F9OH 3CDCA 1EO5A 3S9DB 1PQZA 1S7RB 4JRXB 4AVKA 2PPEA 5CGTA 4R84A 3SKOB 1XBRA 2PW2B 4F3FA 1RSFA 2HVBA 2E7DA 2AEQL 2FT6A 3U6RB 4XN7A 1IM9B 1FYTD 1MJ8L 5KSBE 3DXAA 4UUJB 5GJTH 2B20A 1M6OA 2H2PD 1JCVA 1QQDA 4QNPF 4L0PB 3RVXC 3TBBA 2Z8SA 2PTUA 2X41A 2X4TB 3FHQA 4MMZB 3NSCA 2DTML 5MENE 5KWYC 1MRDL 4X7CC 1CF8L 4LL1A 1MNNA 3C6LC 4ZFZB 3S96A 4LOFA 4RVBA 4F37K 4P3CL 4FLHA 3MRFB 5FR3A 5KW9L 3G6DH 3I84A 1IC0A 4RGNC 1LEIB 4ZDHB 1U8LB 2JQZA 1N12A 3PV6A 2OLDA 2WM0A 5TQ0H 5GRWA 3QIBD 3MJ7B 3FT1A 3G6JE 4PRPA 1T5WB 3NACH 1K6QH 1NIEA 3SYOA 5C8JB 1VFBA 3APDA 1A8ZA 5D5MB 5T3ZD 1OEZW 5J6GB 4RCAA 2D2CC 4I88A 1TVBA 4FA8A 4NO5B 2V2TA 4N2KA 1KCUL 2X1OA 3EZ8A 4KH2A 3D2UB 1E4KA 4Z3TA 5AKSA 1MAJA 4H88L 2K7QA 4LF3A 1T4KA 4JY5H 1HKFA 1SYVB 5KAQG 4K7PX 1MIMH 2A99A 1B4TA 2C1PB 4GG8A 2R2EA 4S2SB 1IM3A 2DM2A 3D3VA 3RDTA 1AZRA 2PR4H 5IK3A 3WN5A 4HAGA 4DVRL 2VQTA 4OKVB 3QWRA 2ZNXA 1WQVT 3H3PH 2ZOKA 1EHKB 4M4RA 1ERNA 4PS3A 3TV8A 1MDAA 2BPBA 2NR6A 1Q9WB 1ZIBA 2AQQA 2ZUSA 5E9DD 2LHAA 4PRIE 4Q0XL 2DMGA 4U1IA 2VSDA 1KELL 3KYKL 1JP5A 3MRGA 3NG5A 2BVUA 1MI5B 2CALA 3GSXB 4DW2H 4ZMQA 1RZKL 5FPIA 1JL8A 2ARJB 1MCPL 1UOWA 2PCPB 2VLKB 3ILDA 3NJJA 4N25A 5J06A 4X6EA 4EPSA 2EDHA 2NXYD 2EUWA 1QLEH 3F5WB 1MHCA 4UQAA 3NH7H 1YNTB 3WNNA 1IAKA 1NGQL 2BO0A 1IGCL 3MJ6A 4AQ1A 2GK0A 4OB5H 3CU1A 1JBJA 4FFVD 2EVGA 2K8MA 3UCRA 3PGDB 4UTCA 4PJFB 1GAFL 2MTPA 2Z8RA 4RRPA 2OJEB 4FFZA 1N59B 3L3JB 4U1JA 2XVLA 3FU0A 1IB5A 3VFSA 3UBXI 3O6LL 3OKLB 1ESOA 3LMJH 4R0LC 1BG1A 4WDIA 4I87A 1F4WL 4HFUH 3INUL 4FQCH 3EHBD 4K3EH 1D9KC 2OSLB 4L4TE 4JUTA 4Y1TA 3HRPA 2GJ6B 3FSWA 4NQVA 1I8LA 3UEQA 4HHAB 2W95A 4MZ3A 4P4RA 1A1OB 3KXFA 4G59C 4OZFA 4YAQA 5IWLA 1P4IH 2F54D 4YHPA