3GLDA

Crystal structure of the major pilin from streptococcus pyogenes e117a mutant
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
294
structure length
294
Chain Sequence
GPGSATTVHGETVVNGAKLTVTKNLDLVNSNALIPNTDFTFKIEPDTTVNEDGNKFKGVALNTPMTKVTYTNSDKGGSNTKTAEFDFSEVTFEKPGVYYYKVTAEKIDKVPGVSYDTTSYTVQVHVLWNEEQQKPVATYIVGYKEGSKVPIQFKNSLDSTTLTVKKKVSGTGGDRSKDFNFGLTLKANQYYKASEKVMIEKTTKGGQAPVQTEASIDQLYHFTLKDGESIKVTNLPVGVDYVVTEDDYKSEKYTTNVEVSPQDGAVKNIAGNSTEQETSTDKDMTITFTNKKVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pilin
publication title Intramolecular isopeptide bonds give thermodynamic and proteolytic stability to the major pilin protein of Streptococcus pyogenes
rcsb
source organism Streptococcus pyogenes serotype m1
molecule tags Structural protein
total genus 64
structure length 294
sequence length 294
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12892 FctA Spy0128-like isopeptide containing domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1140 Mainly Beta Sandwich Immunoglobulin-like Collagen-binding surface protein Cna, B-type domain 3gldA02
2.60.40.3050 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3gldA01
3GLEA 3RPKA 2XICA 3GLDA 2X9WA 3KLQA 2X9YA 2Y1VA 2XTLA 3B2MA 2XIDA 1D2PA 2X9XA 4BUGA 2X9ZA 1D2OA
chains in the Genus database with same CATH superfamily
3TFKD 2G9KA 1YY8B 4J3SA 4LCCC 1P5UB 4OGXH 2APVA 1ZV9A 4F15C 2HFFA 1WIPA 3O2VL 4KJQC 5IEKB 4DKDC 3A4AA 3MMEB 3FB7B 2C3XA 4KXDA 3QZPA 4L3CB 32C2A 2AGJH 2ZXCA 4PJIE 3M7FB 4EN3C 4F3FB 3KE0A 1VKXB 3TBYB 3RIFF 4KHTL 4YVUA 3E1ZA 2PTUA 3BUBA 1BD2A 5H8DA 1WQVT 2C9VA 1MIEL 3VXSB 2FJHB 1NGZB 1QWNA 3BUTA 3LXBA 3WXVL 1RUPL 3DK0A 3ETSA 1HHIA 5CHNB 1SYSA 1MQKL 1TVHB 4NKOA 2P1YA 2ZUYA 4XP1H 5ABAA 3V6ZB 2ORBL 3G5YB 2K0RA 1OTUC 5I1KH 4O00A 3CX5K 4LVOC 2I85A 4YLQT 2Q87A 4A2HA 3CDZA 5EO0B 3HVNA 1LDSA 3L16A 1JNNH 1FN4A 2UVFA 5CLWA 4XI5C 5CMAB 4PBDA 1C5DA 4XB8A 4JO4H 2Z8VC 1RY7B 4NJ9L 4UM8B 4XAWL 5JPNA 4H8QA 3B7SA 1AP2A 2AZAA 1EO7A 3GSNL 3BVNA 1U4EA 4Z0XA 2MNUA 4JQVC 5DQ9B 4E68A 3TT3H 1V55B 2G3MA 4R83A 4IBZA 3F5WA 1WFNA 2R7EB 3GJEA 4GSDL 3SDAB 3ULVD 2OKMA 1JOIA 2EO7A 4LESA 4MQXD 1HWHB 1J8HB 1K6QH 1UB6B 3TBTB 4MQSB 5E08H 2YUWA 1HILB 2CBMA 1BSIA 3BKJH 3Q3GB 2APBA 2PP9A 1H3PL 4WV1A 5I1CL 3TYFA 3V6OC 2NY1D 3U0WL 4A37A 2HKFH 2J73A 4PS4L 1OALA 2HJFA 3MUGB 2F74A 4LSTL 4NZTH 2DQTL 3BGFB 2R4SL 4NZ8A 1QEWA 3GTVA 1BA9A 1ITBB 4GRLA 4X6DA 1AGFB 3UJTH 2NY2C 2BMKB 4G7VH 4TPRL 3LNHA 3RTQC 3WKQA 4WZ9A 4EDWL 2XJLA 3FB5A 4C56B 1JWMB 4D7PA 2A73B 2D8KA 1KXTA 2X4QB 4NNPL 3NESA 1M7DA 5CEZH 4L4VE 4J28A 4ZD3H 2AJYH 3FQRA 2P7TB 4S1RH 1CURA 2F08A 4MS8D 1BVKA 4M8UA 5ALCH 2DL9A 1NL0H 2ZICA 4PJAB 3VQLA 3W11C 3ZW3A 4Q6KA 2GHZA 2XQBL 2FT8A 4AEIL 3L5WA 1TCRA 5LUMA 4JRXD 4Z7QE 1YMHB 4JREB 1BFVL 1FZMA 1A0QH 2IWGA 1EEQA 1D5IH 4OGZA 3MRQA 2ZKHL 1JN6A 2DI8A 3EF7A 3A23A 3WLWC 4IGBA 2Q76B 5D7EA 5J13B 2AI0H 4KZDL 2X4TA 2UXGA 3RWCA 4YDVB 4QMEA 2E5EA 3ECBA 1CDCA 1I9RL 3LH9A 4Y5XA 4DVRH 4F7MA 3NIFF 3CTTA 1JFQL 2NXZB 1ZLWH 3A24A 4H25B 4HIIB 4AIXA 1NGWA 1VHPA 3FT2B 5GGRA 2JJTC 1PY9A 3O6FD 1JV5A 3HPJA 4E5XB 3RBGA 5HPOA 4RQQB 1XBDA 5AAWA 2JCCE 2OK0H 3FT0A 3S36L 4L9LB 1YEJL 4POYA 1ZWIA 3ZYOA 2E7BA 5DMIL 2Q8AH 1N0XL 2OZ4L 4PJGF 1I9IL 4MA7H 3FN0H 1E42A 5ICZA 3HI5H 4UT7L 5JIMA 4N0RA 1ZVNA 2PPEA 4E9RA 3KDMA 4NKIH 5D1ZI 3MGTB 4ZMYA 3QUGA 2WQ8A 2X1PA 2OPCA 2XZAH 1EERB 4R4ND 4WIQA 1FL3B 4FLRA 3S96A 1EJ8A 5D7IE 4FJ6A 1NLDL 4QO1B 4U2ZA 3BVTA 4AQ1A 1EANA 5BMFH 5KSAA 4FC3E 1N64H 2YD3A 3BSZL 1OQOA 1FAIL 2Q20A 3DMMB 4IEFB 4KI1A 3WTYA 4CVWA 1FNGB 5HHME 4ZMWA 1WWAX 4OZHB 1Z3GL 2DKMA 4NENA 3OXRA 3RY6C 1EV2E 1JHTA 2F68X 3BP4A 4MNQD 1ZT4B 3N1FC 3O2DA 4XCNA 2BVOA 2V3DA 3B9VA 4PR5B 3REVB 3BDYL 5AOKA 4X5RA 4XGZA 2GK0B 3QC6X 1QWHA 2VDNL 1T1ZA 2Q7AA 1M9SA 3QWOB 3HZ3A 3C6LD 4NQUA 3KPSA 4AIZA 4PLNC 4P5MA 4QYOA 5LN8A 4RIRA 4LCUB 3BDXA 4BFBD 3ZMNA 4WW2A 4PRPD 4OI9A 3FUHA 3RDJA 3SBWA 1AXTH 3K3QA 5C0CB 4OAWB 2WQRA 4DK6A 3CC5B 3FCBA 2P5WE 4TNVK 3WL9B 5F96L 2DWSA 4TSBL 3HR5B 4XTRC 4GXUM 2Z64C 3VWKD 2CG9X 4X5PA 3NG5A 3PAUA 3X3GL 3IMBA 5ENWA 3UTZA 5MENE 4IKLA 3DX4A 3LNDA 5E6IC 2X9YA 3C09B 2O61A 3LY6A 1E4KA 3IE4A 3AABA 2NY1B 2BNUA 3QG6A 2J6EH 2HKHL 3FU6A 2VIRA 3I6GB 1K8IB 3QXDA 2CM5A 3BD5A 1AD0A 5KJRH 4KK5D 5BZWA 5MEPB 1JK9B 1L3WA 5EOQH 3L45A 5FKAA 5HHNA 1AG0A 1PQZB 1VEMA 2YD9A 1PF3A 2QSTA 4TF4A 4YHNA 4DGIH 4GQQA 1E8YA 1NAMH 1W9XA 3S5ZA 1BP3B 4PY7A 3U0TA 2HN7B 1A6UL 1IGFL 3DROA 3HCVB 4CMMB 1DZBA 3DHMA 3MXWL 2PR4L 2P3YA 4NI6A 3QUYC 4EXPX 3QDGD 4JRXB 1B0RB 3WAJA 2XX1A 4UT6L 2YD5A 2GY7B 1WIOA 4DP5X 2FH6A 5KYWA 2OR8A 4FXTA 5DTFB 2MCG1 4HISA 3ALWA 2V2XB 2W07A 2Z0UA 4X7FC 1YEHH 5AB9A 4GIAA 2VISA 4YN3A 2A6IB 4G8IB 2NZ9C 1KGJA 3KM1A 5TDNA 2JF1A 2VL4A 3L4CA 1EAJA 5D5MF 5FUZL 1RSYA 4NLHA 2VSMB 1Q9LA 4HUUB 5GGSA 4JG0L 1SJEB 3O6FB 1NBYA 1HYRC 2O30A 2OMWB 1LK3H 1FFRA 3HS0A 4IU2B 4R2GC 5E8OB 3X1GA 1YCSA 3WHXA 4M6ML 5CGBA 1IC5H 2VDPH 2WXKA 1XF4A 2BSCA 4LKCB 1AJ7L 4GMSH 1ZVHA 2FO4B 4YK4B 5BOPA 3UYRL 2W91A 3VFOB 4IOSA 4U1GC 1OEZW 1EH9A 3CFEA 1HOCB 4IRSC 1N5AB 4A6YH 2WQAA 2VXSL 4DCQB 4Z7NF 1OGTB 1IEAB 1DDHB 3GB7A 2WV3A 2VM9A 2WNGA 4PJ8C 1MFEH 3DTDA 4QRQB 3MRLB 4RMSA 1I31A 3OAWA 4LIQL 2OP4L 2QVTA 3QEQD 4WWKD 4PG9A 4HF5H 3FHEA 2ZYHA 2YWYA 4M03A 4FXLA 4XPGL 1E43A 4O58H 4BUGA 4Y4HD 1IM3A 4QRSA 4YDNA 3EIFA 2CBOA 5E99L 2OJZH 4ZFOB 1D9KD 5F1IA 3TEUA 4F58H 5FLVA 4JFYA 1UQSA 4KTGA 3H56A 3RYMA 1EGJA 1JPSL 3QZOA 4HCGA 3EJZC 3RUGA 2F7IA 3I6LD 4MNQB 3RVXD 1TETL 1KCKA 3C12A 5FFGA 2AQQA 2IC2A 1XF2B 4E42B 2VZTA 2AJUH 1WH0A 3PGDB 3CMOH 2XWRA 3GMLB 2VWEC 3LNFA 2MSPA 4H8WC 4EDXB 1JNLH 1QKZH 2HXAA 5IBLC 1WGVA 3MOAL 1PZSA 4H8WH 4G8FB 4ZMAT 3ZO9A 2EVJA 3N85L 4CW1A 5IV2A 2GTZB 5IR1A 4PRPB 2YK1L 1ND0B 3ZKXB 4CBPA 3LDBB 3RDTA 2VDKB 2WTOA 4YXKH 5B1JC 3WS6A 2JVUA 1T5XB 1TQVA 3WYRA 1ZV5A 3SD5A 4CN6A 2W65B 5FYLE 5EC1B 4ZDHB 2YJQA 1D7FA 2D7OA 3HUJA 5GIRA 2QMJA 3T4YB 4ZPTA 5ISZD 2DQEL 3MBED 5FA3A 4PP2A 4GG8A 5E4IA 2WBJA 5FUCC 3T2QA 1FP5A 3MU3A 2AS5M 4ZXBC 3D5OF 1CE1H 1A6WH 4UOJA 1ZPUA 1WFIA 3CZJA 3GSNA 5FECB 1BZEA 2MQCA 5D72H 1ZSHA 5DJZB 1S7SB 4B60A 5BCAA 2EYSB 4LL4A 2WOBA 3TVMC 5KUKA 1MJ8L 1PZUB 4K9EH 4WFGE 4Y1AD 5D7LA 3MBWA 3VFTB 1D6EA 1NUGA 1OXYA 3MRNA 3OB0K 2XPZA 1LEIB 3TA4D 3WS3A 4GSUA 1V27A 4O02L 4ZJ9A 4Y2DC 3SPGA 4F5CA 2E86A 2F5AL 1AYRA 1SY6H 4Y7MA 4LO9A 3UFIA 4XXCC 2CUIA 1RK7A 4Z3GA 4PRHD 1T80A 4KI5F 5BRZE 4JPIA 4UOW1 4UNUA 3IFOB 5E5MB 1OE2A 2C4FT 3NCJL 2VLKA 3EH3B 4ZZFA 4MMXB 3ES6A 3HG4A 1CLZL 3RWHB 3MRFA 2Y7MA 5A2AA 1KJ2B 1TLKA 2Y1ZA 1XAUA 4MDRA 5ILTL 1I3GL 5DDHB 3EH5B 4X9BA 2ADGA 4L23A 1T5WA 2N1TE 4OCRH 2AJXH 4IKNA 2WVVA 4GAJL 2WLYA 3QZLA 1FV1B 4S1QH 1Z0NA 4TVPD 5F7MC 2ZCLH 1A14L 3UJJL 1JZGA 3MNVA 5C70A 4GFTB 1U3HA 3DARA 4N2AA 5J11C 4MQTB 4MDIA 4LBEB 5J1SC 2XN0A 1JDDA 1G6RB 5H35A 4TUKH 1D2OA 1GZQB 3LRKA 2B59A 3TXAA 3CFJA 5EBLA 1TIUA 4I13B 2XBZA 1YYCA 5DR5L 5E2VH 3U36B 3MLUH 3ULAB 4Q0XH 4NNXB 5IF0B 5DXWA 2XWZA 3ARED 2C7UA 3JQOB 4OJFL 4PJDF 3QEQB 4WWKB 2DQHL 1J5OH 4MQ7A 5GRZA 1RZ7L 3ZSSA 1G9EA 4IOFD 3MA7A 4LARH 1UWFA 1FYTB 3D51A 2COQA 3OAYH 2WJ7A 5DFTA 5F88A 4X5WA 5EZIH 4YGVA 5IM7B 3BKCL 2H3NB 5CUSL 3JWNE 4JMXA 4L4TD 2X70A 1T0MB 4ZUUB 1MVYA 1G1OA 2E56A 2JXMA 3PUCA 3UPRB 5AVSB 5GXBB 3WU1A 3BP5B 3ZE2E 3QDJA 3RFZC 2IIJA 5KG9B 2UZXA 1URZA 2HRPH 5GZNC 4PRBA 2AV7B 1PBYA 1A7RH 3LS4H 1NKRA 4K3DL 5AVUB 5GGUA 1HSAB 1TTBA 5CNHA 4GXVL 3R0MA 3L9RA 2EP6A 3MRPB 3V0IA 4N87A 1XSOA 1YPZF 2IG2L 4NQSA 5EN3A 4HD5A 1LWRA 3LZNA 3HI1A 4ZS7L 3ZDXF 2R29A 2P8PB 1DFBH 4WUUE 3HI6H 5EZOL 5HD8D 4ETQB 3JV5A 3BN9D 5ECGA 1O5DT 1F4WL 3C2SA 3B3BA 3IU4L 3RWFB 3BSZA 4KHXL 3IJYB 3GXIA 1OGAD 3ROOA 2MQ3A 3P2DA 3PHOB 3FQXB 3WG7B 2BSSA 3H2PA 3ZDYF 4QHMA 4JPWH 3L3JA 1BJ1J 2VC2L 3OF6A 3E8VA 4YDMA 3QT2A 1NJ9B 4LCWD 3DV6B 2AJ3B 4JY4B 4NBZB 2WP3T 2X44D 3JVGC 5C7ZA 3FT4B 1ZHBB 3MBEB 3TFBA 5ISZB 3LJ3A 4Y7OC 4DP8X 5JQIB 2JIXA 3N0PB 5I1IL 1XXFC 2UUDH 3HS8A 5DMKB 4YPGA 3HAEB 1LE9A 1U0QA 4M3JA 2H3KA 3JBG7 4R8WH 1DQIA 1EEYA 5ERWA 4PJGA 5IG7B 3UDWA 2OMBA 4I9WD 2Y9RT 4POZD 2ODHA 2O5ZL 4F7CA 5D2LE 1AXIB 3GPEA 3NDZE 4A2MA 4FA7B 5EN2A 2LU3A 4F91B 2VN5A 4I48B 1DN2A 3NA9L 2QT6A 3RNQB 5ETUB 4TSAL 1KPUA 4HALA 3QFJB 1W0WB 3J7HA 1G1YA 1KCVH 1EHNA 1YN6B 1LD9A 4P9ML 2GY5A 1TNNA 2QZ5A 1IM9A 3LZRA 4FF9A 5I6NA 5I18L 1U8KA 1XGTB 1XZWA 1DO5A 4WSGA 5T5FH 1BXXA 3QHFH 5DD0H 4WCYL 3BAKA 1UC6A 1ZGLA 3BLBA 4P4KB 1P0SE 5ICUA 1T03L 2Y22A 1YECH 3R19A 2I60H 1UEMA 3KPLB 1X5HA 3PY9A 3QQ9D 2KHAA 4DQOH 1IE5A 3IJ9A 5D7SH 1FZKB 2EYRA 1OP5K 4YHML 4G6KH 5H37H 1I1AC 3AG4B 2VM3A 3EGDB 4X98A 2PW2B 5F9AC 4M4RA 2HKAA 2Q9OA 4R26H 1FJ1B 2IPTL 5DS8A 1MCRA 5JW4M 3IDNB 4EUPG 3FTWA 3BLPX 3V0HA 4OLVH 2VN7A 1SXSA 3ZKQD 3Q6GL 1WFOA 4O5LH 4Z0BH 1BYPA 15C8H 4CU6A 2IADA 5BV7B 1QFWH 1DEDA 2R1XA 2HLFC 4LT7A 4PH8A 5B8CA 5J9PB 5JORA 2QVMA 3RP1A 5E24E 2WLKA 3G6JE 1LO3L 1ORSA 2O6PA 4AT6A 3AREB 5FYKL 1F02I 1B9ZA 2Z4QB 1S4IA 1AFVH 5DJCB 3CZUB 3CFTA 1P5UC 4DH2A 5IP4A 1UM6L 4JFDE 3GZPA 2CUAA 1PZDA 4JRYE 3K71B 3MLVH 2OMVB 5JIIA 2UY7A 4L4TB 4NC2B 4PY8J 3PJSB 1PIFA 4KRNA 1NDGB 4Q9QH 3PDGA 4FKKA 5IW6A 1KOAA 2I26N 1G7HB 3OKMB 3RLSA 4GBXD 3U9PH 4KXAA 3DI3B 4PJXE 3ZMRA 4LSRL 5I30H 3CDFA 3T0AA 2R2EA 5DC0A 4UQCA 3Q2WA 2H9GB 1JPFB 4GI6A 1IBHA 2FAUA 3IDMA 3UTSD 3CCHB 5C09D 4OLYH 4QRTB 4WY7H 2VLRA 2KDYA 3Q0HA 3WD5L 5IGXL 4LSVL 1J0YA 4JY6B 1OGAB 1YN7B 3MRBB 1RFDL 2OTPA 4X9FA 3T3ME 2AJZA 4QRPD 3VFMA 2Z1PA 2FNWA 1XR8B 4X9YA 2NY6D 5HJBA 3RGVA 5D5MA 5JHLA 4NGHH 3SE3C 2O72A 4LCWB 1G7PB 2XN9E 1IEBA 2GJZB 2VLME 1KCSH 4R0LA 4XC3H 1RHFA 2DN7A 3QZNA 2IF7A 4XMPL 5E4OA 5J7CC 2XFXA 1IJNA 1RUML 5T33H 3FFCA 1SHSA 5T3XL 1RJYA 1E0OB 2J25A 1EZUA 1UJTA 1R5IB 4W9EC 2C9PA 3ETBF 3ZU8A 3QHZH 2X88A 1D5BA 1LDPH 4Z76B 2PCYA 3B3IA 4U6YB 4G9FE 2CCLA 2E9WA 3FU0A 4MRBA 4TQEL 2IDSA 4OZFG 4GG6B 4F7KA 3BXNA 3GC3A 5D1QE 2PYEE 3HE6B 4FZEH 5AVVB 4J3TA 4A38A 4NZUL 3QNZB 5GQBA 2RQ8A 4BK4A 3MLRH 1A6AA 4TVSa 1DVSA 1WE5A 2WNKA 3LQMA 2LABA 4RAHA 2ICES 3MLZH 1DBMH 1I3VA 3M1OA 2CDGB 3V52H 1YEGH 4JKMA 4YWGH 3HZMA 3KPRD 2YZ8A 1U2CA 3QUKA 2AK4D 2AVGA 1H6UA 4FQHA 1L5GA 4KUZL 4NQVB 3MLYL 2HSIA 5E94A 1JNJA 1RJZA 3HLAA 2E4TA 4U33A 2V9RA 1DQLL 4L5FH 3PAYA 5C07E 3F7YA 5C0AA 4AJWA 4B7IA 1QATA 3RWFA 5IOPB 3IS0X 2G2PA 1KBVA 4MZ2A 2BSBA 4WTXA 4MAZA 4BFKA 4HT1L 5LDSA 1TVBA 5ANMA 3F7PC 5F7HA 3NJFA 3L4VA 2B8OT 3OV6A 5GRUL 4AV5A 4O02A 5LHDA 4E2OA 4A7UA 3SY0B 5J13C 4ODWA 5KVGL 4DGYL 2ZNWA 3LEYH 3SKOB 3BAEL 3P0VL 4P4RB 5C0IB 2GI7A 4JR9L 2AJVL 3NFSL 4OZ4A 1A7PL 3R1GH 3VFUA 2NXZC 1F41A 3ELAT 2NPLX 2RBLA 3UTTE 1R3LA 1PJ9A 4J3OD 4OSUH 1P2CB 3C8KB 4EQ3A 1M42A 4N0CC 4X5XA 4HIQA 1MH5A 2FJFA 4FABL 4YHLH 5K9OB 3DUUB 3TFKC 3RWEB 1AZVA 3STZA 3IJEB 2X4PB 3RWIA 1JPGB 3PV6B 2J8HA 4J4PC 3VRLE 5LBSL 4EZLA 3MV7A 1RZKH 4P06A 3ZLQC 6TAAA 3ZUCA 2NZIA 2JKWA 4ZAKA 2VDML 3H9SE 4M56A 4MD5A 1HT6A 4HPOH 1B4LA 1IFHH 4EZJA 3LIZL 1EZVY 3PJNA 4MDJA 1G94A 4OUUB 4QOKA 3RJOA 1RXLA 2JCCF 1ZCRA 2F1BA 4GBXB 1FNAA 2J8OA 1GHFL 1T7WA 4UM9D 4M7ZB 5BVJA 2XQYG 4MCMA 4PTUB 1YC7A 3ILPA 3PE9A 2R59A 3DMMC 4HK0A 3DTUB 1DLHB 1U3YA 2WMPA 4L3AA 1WZ1H 5C09B 4QXVA 4HAFA 1MY5A 2AQPA 5E9DE 5KYYB 3MV11 4LK4A 3L3DB 4QT5B 5ACZA 5EEXA 3SGJA 1OSPH 1P4IH 4PJ5A 4ODBD 2UZYB 1A7NL 3EJJX 3PP4H 3QJRB 1VACA 4QRPB 3AS1A 2IPUG 5DD6B 1GJUA 2RB8A 2HJLA 2P8MB 2ZUVA 1DVUA 1FFNA 2UZIL 3AUVA 3ARPA 1R3IH 3PU7A 3X12A 1GSMA 4B50A 1Q94A 1CZ8L 3D9AH 3FB6B 4JL1A 4W4OC 5JQ6L 4PWIA 1MIMH 4KJYA 2OR9H 1FGVL 3ASOB 1DVZA 3PLYA 2X2HA 4AEHL 1C8QA 4JG1L 3ULVH 1R0AH 1OQXA 3WKMH 1UM4L 2IANB 1KDIA 5TDOB 2OTWB 4MFHA 4OJYA 4JHZA 1PX8A 3EGSB 1YZZA 1HINH 3SBRA 5IWLA 1BFOA 1AQKL 2NNXA 1XWVA 3MODL 3ABZA 2IH8A 1B4RA 4FZ8L 3GI8L 4FYQA 4R4FL 2NY1C 1JS4A 1XD1A 1IBFA 4GXUN 2LTQB 5DJYA 4FXKA 3ZE1E 3ZIYA 2G0KA 2R2BA 2SODB 3O6KH 1XTLA 1L9SA 2WNXA 4PJDA 1I7UB 1QBML 5L9DH 1C5BL 2KDGA 4QTHB 2V5SA 2OMUB 4RGND 4XN1A 2P8LB 4IMLA 3N9GH 3WTVA 2FATL 3S5LG 2DQUL 2NNFA 4JZNB 4WU7B 5ICXB 4LRIA 4RMUA 2DDQL 2NY0B 3BZ5A 3VB8A 2AK4B 5HHPA 1CLOL 5GGQH 1WHPA 1NAKH 4MS8C 3K6IA 5IBUG 2A6DA 2F19H 4EI5C 4LHUB 5DFWH 4JX0A 4KKNA 1COBA 5DZ9A 3JV4A 1MPAH 2K6YA 3V4VH 4GW1A 1FFPB 2MCAA 4X7SH 1GOHA 2ZG2A 3OMIB 3U2JA 3F3HA 1G7QB 1MDTA 4ZQKB 1YPZA 2FCBA 3BQUC 3CFBB 3UAFA 1RZIA 1TQCB 4XVSH 4ZO7A 5FHAL 2YQ3A 2XWXA 9CGTA 2HFGH 4MJ6A 3ALPA 5AB0A 5JA9A 3LHAA 3QAQA 3GDCA 3BVUA 2G2RB 5F7BA 3POCA 4PBVC 1NFKA 3S5YA 3TNNB 2Q10A 3BZDA 3P4NB 1BG9A 2KUTA 4LLWA 3BDBA 2JKRM 1KB9K 5EBWB 1DBJH 3OBAA 5KTEH 2BXYA 3OKOA 1X7TA 1MFCL 4ZI8A 5CU5A 1H15B 3W0WD 5J1AB 2AERT 4RWYL 1J48A 3LX9A 4YK4C 1C16A 1GGIH 1RZJC 4TVUA 1E7VA 4OFKA 3G5VA 2WQWA 2RR3A 3RVVD 3SJVE 3MRGA 2JQZA 4H8UA 1I1YA 4ONGH 5FDYA 4M4PA 3TO4A 5AOJA 1KBGL 2ZP8A 3TA3A 1ETZA 1U21A 2RJMA 3GBNL 2IALB 3RWGB 3KS0J 2R0WH 1OL0A 1MHCB 3EOBB 2EINB 1U91B 1U58A 2V0AA 1J0JA 1EEZA 2EIKB 4MAUL 2BLFA 3KLHC 1LYQA 3GMPB 3WMSA 2WVTA 4UM9B 1CE6A 4R96B 4IS6B 5DK2A 3NN8A 1U8QA 4LPUA 2TSBA 2PUQT 3SDCA 2R56H 3PQYE 4HOWA 4IBSA 1Q1JH 2YN5A 4EZKA 4ZOEA 1H9VA 4HIHB 4Y9FA 2RTTA 4K9JA 2Y2YA 1AH1A 2CA4A 3OX8A 4NO3A 5LVEA 2VLJA 3LD8B 2HVBA 1G9NC 1HXYB 2O5XL 4FNTA 1X4XA 4J6RL 3ZHKA 3BD4A 4OZFA 4DGVL 3NJIA 4AKQA 4XPAH 1MCHA 5C08E 1JWSB 2F54A 5ITFB 1YEIH 5T1MA 2WLLA 1DYZA 5FW6A 1H8NA 4HUXA 5CSGA 2O1AA 4NO5B 2GUYA 3ZKXC 3LDBC 3COOA 1YQVH 2EIMB 2ED8A 4PRIA 4LCYA 5IUCA 2GEEA 4WKZA 1K4DA 4AYMC 1INQB 4OV6F 4JB9L 5EU4B 1M6OB 2GJJA 3DWTA 3CBKB 3Q1SL 3GMNB 3L1GA 1FORL 1ZA3A 3IU3B 3UAEA 4BH8B 4TUOB 2O6FA 1EAQA 1S3KH 2BFVL 3H4HA 3FT3B 3ZHDA 1S9WB 3V0JA 4WO4B 3DRTA 2YEZB 3E0GA 1NPJA 3QB7C 5CCKL 5T3ZE 1IQDA 1G87A 1KNOA 2QHRL 5DI8A 1DJHA 4RGNB 1J5CA 3RZCA 3U9UB 4GLRH 3RZWA 2QFRA 2JKNA 2FR4A 3AWFA 3T77A 5LKNA 4I0PC 1H0DB 4IBVA 5C0FB 1IC7L 2J1YA 2ZD0A 4BQ8A 2EECA 3Q8FA 4Y9BA 4Q9RH 1O5PA 4MA3A 4OM0L 4U7SA 3RVWC 3SPVB 3LQAL 3QULB 2IBZX 2VDOB 3GZQA 3CSTA 2IBBA 2XZCL 3PREA 1GMIA 2IFGA 4OCYH 1FRGL 1DZ0A 4PJCB 1HL8A 1YMMD 1HIMH 3CX2A 4PCYA 1JGUH 5HJ3B 4Z78B 1CQYA 5FA4A 1Z9NA 4MMXC 4DZBA 3C5SB 1TQBB 2BVQB 1S7WA 4JRFA 4WJG3 3I9GH 4AG4L 2FQGA 1MCLA 1KJ2H 3VGDA 3QIWD 1PFCA 2A9BA 3ZRCC 5IMLB 2BNRD 3MR9A 1J05B 4A2EA 1FQ9C 2CIIA 1N6VA 4AYDC 1E9OB 3V55A 1RIVL 2IQ9L 2WINA 4LAQH 3OL2A 3D18A 5D70H 5KJ7E 3W0WB 4MCZA 1IBBA 1JXDA 3EH2A 1CWVA 5E2UL 1E8XA 2OMYB 5DURB 4KROD 3S6CA 4BZ1A 1HAWA 1N3NA 1F90H 5B7EA 5IFHH 3BMVA 2PWGA 4M5ZL 4ACTA 2APSA 4AVHA 4ATWA 1ACYH 1AS6A 3HZVB 2DTML 1G1KA 1G6RH 2B39A 1YNLH 3ARGA 4W1TA 1NCCL 4KK9D 1X7QA 2O5YL 3B9EA 4Q97A 2UY6B 5I28A 1TU2A 3TF7C 3QR0A 4PV9B 5H94B 1IAKA 5E6SB 1IKFH 2R83A 1ETB1 1J1OL 3VI3B 4ABVA 4WWKC 2Z92B 3F84A 4Z7WE 2JV6A 3SIKA 4ADGA 3H55A 1SNRA 2GKIA 1ZIAA 4JFFA 3PWVB 3LZFH 3FU7B 4MBOA 3ECVA 4PJFB 5HHVH 2W38A 4TULH 1Q8MA 4H8HA 3ZDZE 1MI5A 4NPKA 4WTWA 5GGTA 5TF1H 1OAXH 4BSVB 1BM3H 3U6XA 3E6HA 2VLLA 1MJ7H 2DLHA 1OSYA 1UZGA 5KN5A 1DVFA 3PL6C 3UCRA 1WITA 6FABH 4XXWC 2FZ3A 3GFUA 3SCMB 1ZXQA 3F6IA 5HHXL 1T66C 4M3KB 4XE0A 3LEXB 2ZIDA 1KLFA 4UNVA 3R0NA 1Z7JA 5TE6L 5BJTB 3UGUA 1PLGL 4ZSOA 5C0JB 4U6VL 3S5LA 3P4MB 1L9QA 1FHGA 4WDIA 2PW1B 1RULH 2BSDA 1PEWA 4IU3A 2FQEA 3R18A 4YFEA 1BVNP 2PR9A 5JXED 1AANA 3BQVA 3SKNA 4LP4A 1PAZA 3VWJA 1QI4A 25C8L 2YRBA 1F6FB 3W3BA 2FYYA 2A9MH 2NRDA 4MJ4A 4XVUC 2EDHA 2H26B 3TH3T 4AL8H 3C5ZA 4GW4B 4YXHH 3FZUD 4YE0A 5J6GA 3GXMA 2YARA 3MBEC 5AW6B 4WHDA 3EG9A 3ZVVA 1KTDA 3C08H 3D05A 3T08A 3B5TA 3MUUA 2OULB 1NCDL 3VFVB 5GRYA 4H40A 1KENH 3LKQB 3WE6A 3QCVH 3OAZK 5HI3D 3T1WA 1G6VK 4N3UA 4XBEH 1BJ1H 3ZE0E 4I3SH 4DUWA 3DI2B 5AVYB 3HAEH 4M6NL 4MWFA 4Y19A 4PP1D 5CKGA 5AW5B 4AM0A 3RX7A 3UPAA 1KIUB 3UERA 2AXFA 1OW0C 2Z93A 4JGNA 3HIZA 5DS1A 5FYJU 3KLAA 4PB9H 5I71C 1AI1H 1NOLA 2IXQB 5JIPA 1KLUB 4L8CB 1K2DB 2JCCA 2NYKA 4LVNC 1HCFX 4NPJA 3LKOB 2VUYA 4GQZA 2AP2A 2VE6B 5DO8A 1JF6A 3E8UL 1SLWA 4Z77B 3FTVA 1VADA 4MVBD 2NTFB 1TSHA 1GGCL 1XGUB 1BVZA 2ICEB 3IXTA 2Y07L 1YMMB 1NANI 3AQDA 4FXGB 3ETBJ 2D7QA 3RWJB 4P4KC 3SGEH 3GGWA 5D2LF 5ID1A 1S9YB 1JF1B 4F37F 1OCZB 1UOKA 1ZDQA 1PTZA 3QIWB 2YC1B 3WY1A 3ZL1A 2VSCA 1KIQA 1XCTB 4UQ3A 3VD3A 2DYPD 2BNRB 4ILDA 1BVLA 1F3JB 1TFPA 5CIPA 1H3TA 4Y4KA 1CXIA 4FLOA 2WGXA 3WAKA 1T1XB 2BP8B 4YDZA 2Y72A 4F2MA 3AUWB 3LH8A 2GJPA 1LO2L 2ZAHA 1Q0XH 3KWXA 1YDPA 4JDVB 5TQ2H 1C7SA 4KROB 1AGBB 1BZ9A 1I7RA 2XBTA 4HWEH 3V4PB 1W8NA 1MW3A 2X7LB 1ET5A 2WYIA 5IMMA 3I74A 4HZLB 3SE8H 1UB5A 1QUPA 2CDEB 5BV7C 3L3OB 3O2WL 3BWAA 4WENB 3GBML 5KW9L 5LQBH 1NDTA 3F58L 5JW4N 2Y7QB 1FFOA 3TU6A 3JWDL 2P5WD 4PFEA 1F4XL 3INUL 3AW5A 3PWUA 5EO1A 4P5TA 1HH6A 5CN2A 3AREC 3JWOC 4WFFD 1T21B 3K1DA 2KI6A 4JQXC 1MN4A 3QW9A 3ARDC 2A38A 2HMIC 4HHAA 1CLYH 5CILH 3SGKC 1ZEAH 5KVFH 3S0PA 4HJ0D 2EDBA 3MZGB 4HS6B 2BC4B 3F7VA 4N6RB 5IB3B 1ITCA 3O9WA 5MENA 2XTJC 4YO0A 3DPBA 3IDJA 3OKEA 3U7YL 3QQXA 1EHLL 2CKBH 1OCWL 3B2UD 3H3PH 4KH2A 4HIEB 2JB6A 1B9KA 4H7VA 4XPTH 3R4RA 2XG5B 1KUMA 3WIAA 3S35X 4ALAL 4CVXB 4K5OA 3BSGA 3QI9D 3HMXA 3L3GB 1A7OH 1BOGB 5I76A 1B2WH 3S48A 4FQXA 2NY3C 1PD6A 4LU5H 4MCYB 3R8QA 2AQRA 2YWZA 7FABL 2OMZB 3GIZH 3HZYB 1MCWM 3RG1C 1QSEE 1AHWC 1FNLA 3TYGH 4PJXF 3UGXA 2C9QA 3WEXA 4D9RE 3GSVA 1CTMA 5MEOA 1WZAA 2OM5A 3EYOA 3D06A 4M1GH 3UTOA 3GTNA 3QG7H 3QZBA 2ZYRA 1EMTH 3IDXL 4KBPA 4LEOA 4TOYL 2BIHA 1V3JA 5DMJB 5AYTA 3GMOA 4HLZH 5EZLA 1FF5A 3GS7A 3AMKA 1HZHH 3KBFA 4MGXA 3OKKB 3T3MF 2W9DL 3PWPE 5CN1A 1K85A 2YQBA 2ZWZA 2WIIA 5J12B 5TTRA 2OMNA 4MD0B 4POZC 4BHUI 4L1BA 1JNHB 5I6OA 4K71C 3QZWA 3D2UD 3KMDA 2C9SA 3LV3A 3HE6C 2M8XA 4LPXA 5I16A 4XVTL 1DTUA 1IGCH 1Z32X 4PMFA 2MMXA 1U8NA 1MEXH 1CGXA 4F1SA 1YUHA 4G8EB 5DA0B 4PCSA 1L9OA 5FO8B 3H7BB 1VFBB 2LHAA 2DMHA 4XNXL 3GT6A 4WI2A 2P24B 5J8OA 4TSCH 4K3JH 4RCAA 3TBWB 4OCWL 4BA0A 2QDVA 2VDQH 3OC8A 2OR7A 4NBYB 4YIQA 3THML 4J5VA 4Y16A 1GH7A 3WKPA 5BW7A 1KEGH 2V2TA 2DYPB 2NDGA 4J12A 5CF3A 4FQCL 4YZFF 3KWWB 1N70A 4KTDH 1KTCA 2Y06H 3MX0B 1QI5A 4GRWH 4JY5H 3H3BC 3C6SA 3ESVF 1ORQA 2HT2D 1U6AH 1GC1C 4ANWA 4K7PX 4GKLA 4OLUL 3IXAB 4KOCA 2HH0H 1YEFH 1N6QH 1YJDH 1X4ZA 1ZT1A 1YHPA 1EFXD 1X9RA 3VACA 1BD2B 4BZ2L 4YC2B 3M8OL 2Y36H 2Z4TA 4KOBA 5KYUB 4RZCB 2DMBA 3DECA 2CGRL 4HXAH 3TWCH 2P9RA 1HHIB 1SYSB 4OF5A 4NKOB 4OBSA 5LAPA 3EO9L 1QO3A 1F18A 1W8EA 5FYLD 4KRPD 2C9UA 1OB0A 2VXQL 4PD4K 2G3ZA 1QTPA 3MN8A 1NBVH 2BZ7A 3CDZB 1FN4B 1OM9A 3HC3H 2QSQA 1UCBH 1I1CA 3O6LL 2WVUA 4B9CA 4F92B 3M17B 1HHKB 1RPUA 1C5DB 3MRIA 5JPNB 3N1GC 3LKPA 4PGCA 4H1LG 3FU8A 1N5YH 2ESVA 3QRGH 1U36A 4WFED 3NIDF 1SUJA 1RIUH 2GCYB 2WCGA 5LN4A 2NTSP 4K94H 5DQJA 1UWEH 4BSWA 1Z9LA 3FTUA 4P59L 3T0BA 1W6WA 2X87A 4DFIA 4JFPB 4XRCA 1XIWA 2YR3A 5CEZE 5KSUB 4N1HB 1UH4A 4O4YL 1WAEA 1QAWA 3QI9B 1HKLL 5JYLA 2CO3A 1JYNA 1NEUA 3RJDA 2JELL 2LLLA 1XEUA 3V7AE 4WWOA 3TYFB 4NQQA 1QSVA 5BRZD 4G9DA 5KBLA 3VFPB 1L7TH 3TV3H 5B3JE 1AACA 1UGNA 5F7FA 2X4UA 1QEWB 1ED3A 3VE0A 4X6DB 2IH1A 1A47A 4FRWA 1N59B 4R7LA 5F7DA 5HYQA 2J5LB 3WNNA 3WTSA 2COVD 4W9DC 5FW7A 3GIVB 2EVFA 3UZEC 4Q6IA 5EDXA 5JHBA 2XWEA 2XRAH 2ATKA 5LGKA 1M7DB 3S3PA 3OZKA 3ZRFC 5L0QC 1BVKB 4UILH 4OGYH 4NFCA 3N43B 1PCXA 1MFAL 2BIIA 3MJ9L 5JOFA 5FF6B 1TCRB 4M5YH 2WB1A 2VXUH 1FZMB 1KACB 3D50A 2WYTA 1Q0YH 2HT4D 4E9YA 3KJ6H 4NWUH 4ONHB 2LTQC 2HT3C 4NFDA 1FO0B 1JN6B 1SMOA 2R0ZL 2QQQA 4S11A 3W56A 2W8CA 2DI9A 3L1EA 2X4TB 3M6DA 3M1CA 4M3HA 5DD5L 1MREH 4MB5A 1FL5B 1W16A 4Y5XB 4NQDE 5BS0A 4M29A 2XIDA 1KPVA 3NMEA 1CDGA 1TEGA 2DLFH 5I75C 1NGWB 3ESNA 3QWNA 3AM8A 4F8PA 3QORA 2Y6SD 4RSVA 2NY0C 4HIJA 2M1KA 4LSSH 3UAJA 5I2IB 2J55A 2CLRA 3U0PA 2EH8H 4KO5A 3FUDA 4IK7A 4XCEA 4Z6AT 4WGWB 4IRJA 2EVHA 2O6DA 4MJHA 3BESR 1ZWIB 4BDVA 5HGDA 3FC8A 4TQPA 1NM9A 2E7MA 1II4E 5FGCB 5ICZB 4N8VG 3V5KB 3DETD 1I85C 4HUKB 4F8QA 3WFZA 4F7TA 1TQCC 3U48A 2A77L 4DN3H 2IBGA 2W60A 4JGUA 1FLRH 2NX5A 5DEGA 3V10A 2IAMD 1E5UI 3SD2A 4M7LH 1EXHA 2YAMA 3S96B 1LNUA 1EFXB 4HGWA 5INCA 3WN5B 2YD4A 3AXLA 3H1ZA 3ME0A 4J3OC 1PZBA 4X9GA 5KSAB 4OLXH 2ZUQB 4PPTA 3KM2A 4XN9A 3VNZA 1YUKB 2ZP0T 3FQUA 3ULUD 5L7XL 3IRZA 5J57B 3IDYC 4N1CA 5K9QI 4ONFL 4HOZA 3UTPE 4NQCE 4DETA 4G1EA 5CJOL 1LVEA 2YLHA 3OXRB 1JHTB 4YHKL 5D1ZD 5EU7C 2CJ3A 2QV2A 3D69A 4N2NA 3T0EC 3IJSA 3DV4A 1ZK9A 3WBDA 4F57L 2A6KB 1KXVA 3QDMD 5E5LA 1I1RA 4PI2A 1T1ZB 3PWJA 4O9HH 3CVHL 1E6OL 1FUNA 3U1SL 1TZGH 3AZUA 4HAKA 3S34L 2VQUA 4P5MB 4QYOB 1S9VA 1TTAA 4DGWC 3NCXA 3TL5A 4WW2B 2OMTB 4HFUH 3NQIA 1SJHB 4I85A 4LPWA 35C8H 1NGQL 3MRKA 1KF9B 3KS0H 2V8MA 4WW1A 1C12A 1MFBH 1XGPA 3W9EA 5CZVL 5ENWB 3UTZB 4ZUTB 2P4AB 3OMAB 3VXUE 1ZTMA 2EC8A 4JM4L 2O61B 2N3JA 4TKWA 2BNUB 4JKPL 3QG6B 1KT2A 2VIRB 3QXDB 2WAHA 4BFRA 5D2LA 3A47A 1AD0B 2B9BA 1CI5A 4BK8A 2FWOA 5BZWB 4QNPE 2V8LA 3VTMA 2DWDA 1OE1A 5CU9A 4S0HA 1T1WA 4RISL 5HHNB 4JAMA 5I1HH 2WWNA 2BK8A 1JTOA 4YHNB 4ERSH 4NSKA 3O4LE 4MNGB 1QFUL 2D0FA 4KVNL 5GRVL 3IGAA 3DROB 3K2KA 4JO2L 1GZPA 5DJAB 1PGRB 5C0EB 3VH8G 4Y5VB 5HHOE 1SN5A 1ZIBA 4QYAA 3EJPA 1OPGH 1QFHA 4G7YL 3LXCA 4L0PB 5D1XA 1SQMA 2EXWD 3BHBA 1QBAA 1GGTA 1S7RA 4AJVA 5KYWB 4MXWH 1OARL 2DQMA 3MLWH 2VLKD 4WO4C 3MRMB 3P54A 2W07B 5DSCA 1ETJA 1RKRA 5TE7H 4UANA 4WLCA 5TDNB 5KYNA 2VZ3A 4RGNC 3TJHD 3CU1A 4NERA 1Q9LB 5JXAL 2BNQE 5LGHH 1OB1B 2V2WB 5C7XL 4L3EA 5GGSB 1IGML 5FDWB 1NBYB 1Q9OA 1SOSA 3SDYH 4NRXA 2DEXX 3HS0B 3QRBA 2YQGA 3GSWA 4UNTA 1TO4A 4LBAA 1XF4B 4DP9X 3IMRA 4PUBL 4HUVB 3GDBA 2MCPH 2R69L 4X83A 1AMYA 4PAZA 2HVJA 4PWEA 5BPPA 1GCFA 1BCIA 2H32A 4FFYH 1O75A 4JFDA 3UMTA 3CFEB 3EO1B 4M1DH 2R8SL 4YXLL 1BF2A 3EJRA 1UVQA 4U4IA 4JRYA 1TTCA 5I1GL 3VTTA 3MACH 4D8PB 3MBXL 4IIZA 1TQBC 4XVOA 2VWEE 5J89A 4XC1L 2AEQH 4H1LA 4S2SB 2E7LC 3FW6A 1X5YA 4LEXL 1TJIL 2M2DA 3BT2H 3UCQA 5E2TH 2YPVL 1A22B 1IM3B 1CU4H 4PJXA 4QRSB 5CM1A 3BP7A 3DGGA 1OF2A 2K45A 4UYQA 4JNXA 1NBZB 5SX5K 5L6YL 4ZOAA 5F1IB 1O0VA 2ZOKB 4JFYB 4A2FA 4KGJA 3NH7L 5C2BH 1FH5L 5D1ZB 1Y1DA 1RV6X 3NOIA 2ZF9A 3ELQA 3N5AA 3SQOH 5F44A 1HJCA 1DUZA 2YXWA 2ZX9A 3WEAA 1MZZA 1V3LA 3IJHA 3BGMA 1NCBH 2WOYA 3BWZA 2BX5A 1UD4A 3IPFA 3QDMB 5TE4H 3P0YH 3TC9A 2VAAA 4HKBB 4NQXA 4YEEA 1JMXA 5FUCE 9PCYA 1XO8A 3QBTB 4MS6A 4KAQL 1AAJA 1LQSR 4WTZA 3D85D 3RIKA 4LQFL 3VFNB 5IV2B 1AZBA 2XN9A 5F71A 4BZ2A 4LMQI 2H0PA 2ZUSA 4G9FD 3ARFD 2XWTA 1UFUA 3IMUA 3NCYS 4HPYH 5G4OA 4WNJA 2PYED 2NY7L 5IVZA 2MIZA 2YGOA 3WUWB 1I8KA 3VD1A 3MYJA 3O11B 4P2OD 2VXQA 4UCFA 3HUJB 5SWSE 1XFPA 5GIRB 5K69A 1O6SA 4CRPA 3NA4A 3L95A 3QJFA 1ZPLA 1IBDA 4Z7WF 3SCMC 4GG8B 1F8TL 1BZDA 5I15L 5D1QA 5DHMC 2FQDA 3WV0A 1QPPA 1B3JA 2VR4A 3N50A 4Y4FA 3ZDZF 2YA1A 3L5XH 1PLAA 3D12B 4CKVX 2GK2A 4M7KL 3LNGA 2Y1YA 4UU9B 3MBWB 1D6EB 1ZD6A 2DM7A 2X6CA 3H7LA 2D4FA 3TBBA 5BVPL 1G9NL 4AE1A 3FCTB 2MHAA 3EAKA 5C0NC 2AAVA 1MOEA 4RSYA 5C07A 5EIQA 3F7RA 5TFSL 2VR7A 1OD9A 1IAIL 4N8VA 2ADFH 3SOBL 1IM9D 1WZMA 3ROLA 2VN6A 2VLKB 3PP3K 2VERA 4AYSA 2X4OA 3MRFB 4BQBA 3B2DC 4DW2L 3FHQA 5CEXA 1L7IH 1QVOB 4U3CA 3T65A 1ZY9A 4RZKA 2D0GA 3HFMH 5A2BA 2ADGB 3UGEA 5IMKB 4ANKA 1EDQA 4RDBA 4OJCA 3VXRA 2XA8H 4XHQA 4BKLB 2Y7OA 2WVVB 2XT1B 2IDFA 2W1NA 1TQUA 3LAFA 1ZANH 2QZQA 3MNVB 3MJ9A 3EFFB 1IBGL 2A4EA 4X6EA 5ID0B 2A6JA 2HCZX 2CGYA 1P7HL 1BBJB 4MDIB 3D0LB 2YAEA 1E27A 3RA7L 3T2LA 2G9HA 2GFBA 1WEJL 2VM4A 5H35B 4HOMA 3PWLA 2ICEC 4PJHE 3TNMA 2MNJB 3IKKA 1ET7A 2FX8H 4KY1H 3WO3B 4AX3A 4Z8FL 4WHYG 4FXGC 2QQKH 4JCWA 3DBXA 5EBLB 5DHEA 2ITFA 3QQ4A 1R3KA 3K1KC 4XNUH 3H9SA 3U4KA 3EDKA 5HYJD 4JN1L 5EU3A 5DD1L 2VMJA 4GAAA 2VXVL 5F88B 2FT7A 4YHOH 4X5WB 4YGVB 4LSUL 4I9XA 1KEMH 3OZ9L 4LOEA 2L7JA 5GISL 4PJBB 2X70B 2FLRT 2JI3A 4NZRH 3KNBB 4LLQA 4GUPA 1X7SA 1KGCE 4XCCH 3K7UA 3MUHL 5D93B 5EA0L 4MZRA 5EIVA 3G7TA 3QDJB 1S7VA 5E9DA 3RWDB 5DUBA 4GI8A 1YO4A 3V4PH 1J1XH 5CJXA 4JDTH 3J2PA 4OV5A 2BHUA 3L3OC 3OR7A 4G7RB 2J88L 1R5VA 4OF7A 1CIUA 5GGUB 4PJ7B 2X3CA 3L9RB 3FSOA 3HBPA 4G11A 4ODTH 4DEPC 1PY4A 2AEIT 4EF3A 4V1DE 4WF7A 5BRQA 1DEEA 3L4UA 4NQSB 3QQDA 4YX2H 3HI1B 4X6BB 2WKGA 1A6ZA 5CBEA 3AWGA 4RNRA 3WSQH 4AIZB 1J7VR 4QRRA 4YUEH 2Z31C 3AT0A 4HJSA 2OXGA 2FX9H 4HSQA 1BDYA 3BIBX 1SXZA 4JDZA 3RY5A 3VH8A 4AQAB 1TJHH 4HC1H 5EEZA 2D03H 3NIFB 3QUXA 3K72A 1FFQA 2Q1EA 5BZZA 3VI4F 1ZHNA 1DN0A 1KYDA 2EVIA 2VDRL 4L8SB 3ML8A 1E9QA 4AITA 4XNMA 2VDNB 1N9PA 2D73A 5EBMB 2FTAA 1RERA 4YPGB 3ZT7A 1LE9B 3WNOA 1NIBA 1EEYB 5ERWB 4N8CH 4PJGB 1I8MB 1WA1X 5CCHE 5EIIG 1XEDA 3CFKB 2H0EA 5BOZG 3S88L 2F7RA 4HHWA 5C71A 3ZR5A 4NN7B 1AHKA 2Y3NA 2PN5A 1NMCB 4P3CH 3EBHA 4MJ5B 4A7SA 1ZT7A 2HWZH 4TV3A 4N3TA 3KPNA 3GRWH 4PJEB 3AVEA 2VUOA 4A2LA 4OFIA 3FZUC 3NZSA 2KLSA 5CLYA 4LSQL 3IB4A 1W72H 1MFVA 1MJUH 1EBAA 1IL1A 3VD9A 2FSEB 4M6OL 4NM4H 1IM9B 1TLMA 1IB5A 2DQIH 5AB1A 1IAII 4Y5YA 2ZOWA 4ODSL 2BY2A 3BZ4A 2Q3AA 3WNJA 2EIBA 3K6OA 2WZPA 2UWEE 1AVAA 4YQXH 5IK3B 3NFPA 3OJ2C 3MRRA 5J12C 4PS3A 1PD1A 5D96B 4I1PA 2X10A 3BSHA 4EBQL 3QUZD 3FB8B 1NC4D 4NUGH 4ZG1A 1E4WH 4RFNB 2ZXAA 1U2YA 2IFFL 3U82B 3W5MA 1INEH 3B8YA 3LQZA 3S37L 3SGDI 3MRHA 4M43L 5D7HA 3T6VA 1WBXA 2FUTA 4M4RB 1JRHL 1GY1A 4APQA 2OTUA 1MJJA 5DS8B 4XWGH 4GT0A 4KKRA 1MLCA 2XHNA 3FRPA 1W0VA 5TQ0H 2IV8A 1U95A 1KC5H 2IOMA 2IADB 3Q2VA 5C0DA 3T5WA 4CAGA 3X1FA 2QKIB 3SJVA 5B8CB 2CHZA 4ZMPA 4IYKA 4PGZA 2OL3L 5EFIB 3PQYD 3ZZQA 1ORSB 3K5SA 3VXSE 1VEPA 4JFTA 4AT6B 4IJTA 4EVNA 4WEBL 1MG3C 3WJJC 5HYJB 5EF1A 1NPNA 3R06A 1G9MH 2DH3A 1LWHA 4J8RA 1ZS8A 2DQ6A 2X6MA 1P5VB 5KANG 5J6SA 4RMVA 1YYLL 1CFMA 2XUWA 3U46A 2EE2A 1RUAL 2XTSA 2UY7B 3E38A 1WSST 5HGBB 4G6ML 5C08D 4OGAC 5L8JB 2ADIA 3KLLA 2ITCA 3MGOB 2R69A 3WJMA 2BSEA 4A7GF 1E2ZA 4PRNA 2OX5A 3D3VA 3PFUA 4Q9CA 1FG9C 4ZTOL 1JGVL 1RLBA 4RFOH 2MCMA 4YC2C 3US9A 1HEZA 1TENA 1U8LA 2PWHA 3K81A 1DBKH 1B3IA 4U1MA 3GI9L 3ARUA 1RP9A 5IJVB 2QPDB 3IDMB 2ZSVA 1UCTA 2YKLH 2XJKA 3CJJA 3K6DA 3P3YA 1J8HE 5G55A 2PXYD 1GRWA 2JKXA 1IE4A 2R0LH 3EJUA 2YPVA 3V0WH 1S78D 1RI8A 3HA0A 1DSFH 4LLAA 4LB8A 2V5RA 3BKYH 2AJZB 2G0LA 2YUXA 5CZXD 3ZE1B 4HG4K 4OGXL 1A9EB 2J21A 2CK2A 5DHVA 3CIQA 1HQ4A 4M62H 5D5MB 5JPNC 4UTBL 1JTPA 5CLTA 2WYHA 4RGMB 5T3ZD 2E76C 1P9MC 2CKNA 1QYGH 2ZWSA 4R0LB 3VD5A 4B3VA 2XLLA 5IROD 2KT6A 2X12A 2BCKA 3JWOL 3CN3A 1JYVA 3B2UC 4D3CH 5FFLA 4UWQB 2F8XC 4LL1A 4C56E 2ZAIA 5F0PB 2F18A 4OD2B 2EZ0D 3Q5OA 2BRRH 4URTB 4L5FE 4MRCA 1D5BB 3H53A 5CAYB 1VAHA 3DX3A 2FGWH 4PJAE 1RJLA 3B3IB 4WK4B 3RQ3A 5IY5B 4Z7NB 3QH3A 2PCFA 3KPOB 1NC2A 1FVDB 4XP1L 1D5ZB 1ZE3H 3FQTA 3MV8E 4GRLC 3WFBH 5BO1L 5AOMA 3IVKA 4U1IA 1U8IA 1HTYA 3CFIC 2Y7LA 2N56A 4GAYB 4JO4L 5PAZA 3LVEA 5LGJA 4X80L 3HZMB 4FLSA 4CGTA 2RH0A 3M1BA 5IMOB 3TT3L 3C9NA 4L1HA 4FNSA 2R4RH 5ALBH 5LBVA 1V7MH 5JOPD 4ACPA 4KQ3H 2FJGB 1RJZB 4MHHG 3ZT5A 2X28A 1PPIA 1BIIB 3K4ZA 2DQGH 5B3JF 3FH5A 1C1EH 4H0HB 2J12B 1EO8L 3GHBH 2ZX5A 1LMKA 1VESA 2CDFB 2NYYC 2SEBA 1RHHA 2WUBH 2V7NB 3AQZA 3NJXA 4U1SA 1NC4B 4LCIL 3BUDA 1DL7H 2ZG1A 3V0EA 5I17B 1TVBB 3LRMA 5ANMB 2PCPB 1S46A 1MW0A 4O02B 1QRND 2GSMB 3UBXG 1XSJA 2AEOA 2HKFL 3ZJAA 1FO0H 4FE9A 4CN1A 4NZTL 3NAAH 4Y5XC 4OZ4B 1U8HB 3VFUB 1JRHI 1BXAA 2E47A 5LO7A 3KBHE 1LK2A 3DDGA 5FXCH 4HKJA 1R3LB 3DHPA 4G7VL 4LFHG 1PNCA 1P84J 3TJPA 2B16A 4X5XB 5I8KH 2DQDL 2BCMA 2VTFA 5F0LB 1OLZA 1MH5B 5AAWC 4XHJD 3PHQA 2GEQA 1PZCA 2H8PA 1DLFH 1AZUA 2DQCH 1M3JA 1RZ8A 2I27N 1E3XA 5I73B 1D5RA 4OCXH 5ESVA 2AJYL 4OZHE 4ZD3L 1FI8C 4LP8A 3VMOA 1MG2C 4Y89A 1CDBA 1F58H 1JWUB 4Z7WA 5ALCL 3RWIB 1E9PB 1B2YA 1NL0L 3VD4A 2JK5A 1S9KC 2NR6D 3L3HA 4ODVH 1XR9A 4E9TA 3MV7B 4RRPM 1C5CH 5KWYC 4HS8H 5AZEH 3SZKC 3AJ7A 4ZAKB 1A0QL 1UXSB 1B90A 4MD5B 5EH1A 1D5IL 1SOXA 2AITA 2R9HC 4MDJB 1Y6KR 1A9BA 3ARRA 1PG7X 4PQXA 5K39A 1QRKA 1DJYA 1O7DC 2R0KH 3TLRA 4AQ1C 4MSWB 5KSAC 4UINH 2ZUQC 4MMYA 5DVLA 3UZVA 1E4JA 5E9AA 4ODUA 1F4HA 3EZJB 4K7FB 4TNGA 2TSAA 5C0CE 1JXKA 2KC0A 4FCHA 4U0RB 1FWXA 4XB7A 4WI6A 4ZPVA 5FYKD 4UV4H 3VGFA 3AG2B 1JHLH 2BO0A 2RD0A 5EIIA 4OB5H 2MNWA 5ACZB 3HB3C 5FYLH 3T8XA 5CP3A 4O2EA 4MHHI 3T2NH 5FWRA 1BAWA 5CN3A 4PW4A 1VACB 2Q8AL 1ONQA 3BZEB 3VM5A 3I9AA 2HJLB 2GTWA 3FN0L 2J4WL 1FFNB 3HI5L 2HLAB 4NN6B 4WU5A 2KYIA 3EGXB 1V10A 1Q94B 3O3AA 3NCEB 2F9BT 4GEJA 4DO5A 4XOBA 4KJYB 3G6AB 2J8UF 2EICA 3UBXI 4WW2C 1SEBA 3ATAA 2M26A 2XZAL 5CWSB 3SBWC 5EC2B 1IVLA 2ENPA 2PWDA 4DPBX 1AKJD 5HDBF 4MMZB 4PGEA 1TZIB 2QSCH 5BMFL 1K5NA 5JR1H 1N64L 5JYMA 4M9OA 4UZGA 3FHAA 5TDPA 4W9CC 5DC9B 5C0BA 4JZOA 1CFNA 5IZ7A 1CVRA 4DVBA 1E4KC 1HK6A 3MLSL 4JRXE 5GZOD 3SYQA 1MHPH 2YBGA 1WD9A 4FXKB 2BY1A 2FBOJ 2R2BB 3IAGC 2VC2B 4F9PA 1MVUA 3BO8A 5DQDH 5KVMC 2HB0A 3SYOA 1FDLH 1R6VA 3N1MC 4EUPB 1CYGA 4RBPK 4IMLB 3B1TA 4JO5A 2J1KA 1N10A 4BFOA 4G8GA 4ZMXA 1CG9A 2WWKO 1RZFH 6PCYA 4GB9A 1E8ZA 5F7KC 1AXTL 4Y5VC 4CU8A 3NZ8B 4IRZH 3W9DB 1X5MA 4M48H 3K6SA 4XMTA 3TN0A 3JV4B 3BC9A 2ENYA 4GW1B 4QNPF 3FCGA 2HT4C 4QLWA 3O3DA 4C83A 1YPZB 1BBDL 3D07A 3FS9A 4L1DA 4W6XB 1PX3A 4AYGA 3B9AA 5GS0D 3OLIA 1QRNB 3P30L 1DE4A 1G7LB 2WQUA 3HHMA 4PLJD 2J6EL 3QXUA 4MJ6B 3X14A 5L4MA 2ZOLB 4P46A 1T6VN 5KJRL 3CC1A 5AOIA 1JP5A 4BFIB 4AKOA 4DF9A 2DQJL 7CGTA 5I5RA 5MI0B 1JYWA 3HS0C 3OKOB 3VI4A 3V0VB 1OF0A 1PG7H 43CAA 5B21A 3U4AA 1D7DA 4Z7UF 1X6LA 1IX2A 1MCFA 2NMSA 1C16B 3QS2A 4I1NB 3FXIC 3O3EA 3H2QA 4MASA 4PGBA 4H26A 5J3HD 1UJ3A 5HDRA 3DETC 3MRCA 3MRGB 4MNQE 2NY5C 1A8JH 3BPLB 3QXVA 1I1YB 1Y07A 2XQYK 3ARGD 4G6FD 3O45A 3WEBA 1BXVA 3TA3B 3L4YA 2H2PD 3ZR6A 2LT9A 4ZRGA 2CXGA 4JVUA 4NCC1 3MLPA 1J0HA 2DWEA 3CFCL 4NIYE 4WFHD 4FP8H 2Z8SA 3ZHNA 1EEZB 1YEHL 3VAEA 4Y1TA 1FZJB 3NN8B 2QELA 3MRDA 5E00A 4KKPA 4R6UA 5FM4A 4JM2D 4PRPE 5IB1B 4MAYD 1R34A 2R27A 3TESA 2BP5M 2VH5H 2IPUK 3DVGB 3MNMA 1OCOB 1OIOA 5INDA 3S7GA 4D9RD 3IDUA 3OX8B 4NO3B 1J0ZA 2VLJB 1T04A 2CCVA 4B0MM 1TZAA 3Q8AA 1NA8A 3OPZH 4GMSL 4P99A 4UUJA 4LGRB 3CN0A 1WAAE 4NI3A 4QRUA 1ZJBA 2WQXA 2GIMA 4IMKA 3O2VH 1KXHA 1M9WA 2F54B 3K4AA 1ZTXE 4Q2ZA 1IBYA 1KGXA 1QSEA 3SE9L 4M8QA 5T1MB 3WIFB 2WLLB 4A6YL 3UACA 3FSWA 1TF4A 3PWPD 4IBLT 3DSNB 4HUXB 3VU2A 4QGYA 2XU9A 5D9SA 1MFEL 3GZKA 3MKGA 3RDTC 1NDMA 1AKJB 2WGNB 2JJSA 2G5RA 4GQ9H 4J8QA 5T1LD 4O58L 1K4DB 4WKZB 3WXVH 1RUPH 1WFTA 3BFWA 1Y18B 3NPSB 2OJZL 1OK8A 1ZA3B 4DJMA 3KLSA 2WW8A 4Y2NA 3CWGA 4J2XA 1YY9C 4EN3D 3WXWH 2KZWA 4OLEA 1UZ8B 4W6YB 2DAVA 2LLNA 3DRTB 3A67H 4KXBA 3UBXA 2DM4A 1T7VA 3BH8A 4KPHH 2OMXA 4LLYA 2AJUL 3P9LA 1IAMA 4NJ9H 3CMOL 5ESQB 1N8ZA 1JNLL 1QKZL 1JJUA 3HPLB 3RZCB 4QXTB 3MRJB 3D4GA 4K2UL 5F7LB 1DSYA 4GSDH 3ZKND 1XF3A 3A4EA 2FR4B 1X3DA 3T77B 2WKLA 4P9HL 2A9DA 3OJMB 4A7GA 3FH8A 4IBTA 5CSZB 4ELMF 1DJGA 3VQ1C 4FFWC 3ARXA 4YXKL 4WI3A 2WTRA 4UDUA 4TNEA 1JZ6A 2EDDA 4XBGA 1GJWA 4NNYB 4HWZA 4NXSA 1T6BX 3CBRA 3O41B 2EXWC 3JTBA 3PGCB 1H3PH 5I1CH 4EI6A 5I8CB 3U0WH 3QQNA 1WYJA 4PS4H 5F9WB 3UABA 4N0UA 1AR1B 3H54A 4BFGA 1HDMB 3EBGA 5FA4B 1ZLSL 3FTGB 3AWEA 1MELA 1QACA 4M61B 5IVOA 1DSWA 4X4ZA 1S7WB 1L9TA 4PYGA 3ARZA 3TTSA 4HKZA 1KIPA 5FPIA 1S7UB 3VDCA 1CE1L 3ZL2A 2P5EA 3MR9B 2RCSL 1HVXA 1OAYH 3QEQE 5D72L 3UTQA 5GSVA 3DX0A 4OD3L 4NNPH 4X8JA 1WV7T 2WINB 1MCQA 4N0FA 1FYTE 3D18B 3Q43A 3ZGIA 4AYFA 4Z3JA 4M7LT 1PIGA 1L0XA 4MCZB 4N86A 4K9EL 1MCIA 1SHWA 4I0KA 4ZQTA 1U3HC 1Z9SA 5EUOF 4ZMQA 1MCOH 4O2CA 3RURA 3H9ZA 3MOBH 2NY2D 2XNAB 5BQ7A 3I6LE 5EEWA 1PD0A 1KTJA 3RTQD 3ARGB 4G6FB 4K23H 1QNZL 4I18B 3OJDB 1TU2B 4H2AA 1WWBX 1IAKB 4KZDH 4L8BB 4ZW6A 2EEDA 1WBYB 4DK5A 3GKWH 1OSZA 1UKTA 2APFA 1DDTA 3W11D 1AE6L 1QUNA 2GBVA 5C1MB 3B6SA 4JFFB 4JM2B 5E8PB 2J7LA 4HS3A 5JPMA 1ZLDA 5T1KD 4MAYB 3TH2T 4OCRL 2AXGA 4QHPA 4B9KC 1MI5B 4JFED 4PJHF 1Y7VA 2Z7YA 3QWRA 3S36H 2H3XC 4X4ME 4S1QL 1OZTG 2VKWA 5D93C 3CSYB 3WLWD 2VLLB 4WHTA 2P45B 2ZCLL 1MHHA 5DMIH 1N0XH 2OZ4H 1I9IH 2H2SC 5HDQL 1XSIA 3MO1A 4UT7H 3UL4A 5JUEH 4RDQF 2FZ3B 3TEYA 2VDMB 5ISZE 4WK0B 4N2BA 4TUKL 2NUTA 2X9ZA 3OMZA 3T04D 3CLFL 1NMAH 4YBLB 5A16A 1P7QA 1A64A 4F8LA 2D7TH 3ATEA 3FUJA 4ZSOB 5HGHA 4Q0XL 1QBLL 3S5LB 5E1GA 1WFMA 1IKNC 2ZP9A 2XY2A 3KBEA 1J5OL 4IU3B 2OFQA 3BVWA 4M93B 3FONA 2GAZB 5T1LB 2BP3A 1IGYB 5IBUB 3SKNB 3VWJB 5EZIL 1NMBH 4WTQA 1ZLVK 1ODUA 2FYYB 4M6AA 3C5ZB 3ERXA 4BIKA 1NCGA 1GOGA 2J43A 3QFJE 4K3EH 3EG9B 2FB4H 1KTDB 2OZNA 5AAMA 4BZYA 1S5HA 3WUZA 2AF2A 1KWGA 1M2VB 1XF5A 3LS4L 4QHLB 2VDNH 1LHZA 2EAEA 2WUCH 2V4LA 1HCVA 1AIFA 1MHEB 1T0NA 3AAZA 3H3KA 2B2XH 3UDWC 4KVPA 4W6WB 2EUVA 4GINA 1JI2A 4Y19B 4HKXA 3LB6D 4MWFB 2B1OA 3DTXA 4BFEA 4R7XA 2AXFB 2Z93B 1CD0A 1DFBL 3KLAB 3QIUD 1RZGB 1DQTA 1NMCC 5F96H 4TSBH 4LVOB 3GINA 3AU0A 2W0KA 1U92B 2X09A 4I3GA 4TVPE 5F9JA 5FO9A 3X3GH 1AS8A 3FUFA 4W9HC 3UG5A 1UA6L 3RJQB 4LRNH 4JO3H 4OZGB 1VADB 4JPWL 4ABQA 2ATAA 1J88A 1B0GB 2G60H 3IXTB 5DVKA 4YHIA 3VMPA 5K9KA 1WCQA 1X9QA 1VLXA 1EEUA 2XV2A 1BPLB 2UV3A 4B27A 3GGWB 5EWIH 5FM5O 4NQCD 1HI6A 4U4BA 4Y16D 3ISYA 5KVDL 4ORGA 4UQ3B 1A6TA 1EQWA 1Y1UA 2G4GA 2I07A 4FYSA 4XTRD 5CIPB 4Y4KB 3V4LA 1ID2A 2I7OA 3EJCA 3N91A 4F2MB 3AGWA 5KOMC 4A63A 5HYFA 1IGFH 3TJEL 3VDBA 5DVMA 5KVFE 2PR4H 1YDPB 3QUMB 2J8UA 3I3DA 2ZWNA 4L4TE 5BXFA 1BZ9B 5KVEE 3B9KA 2A1WH 5JHDE 2E75C 4A7TA 5H2BA 4UT6H 1U8CA 4KVCL 2X3AA 1ZS2A 2QKIC 5B8CC 5LLIC 5E6IA 1FFOB 3I6KA 2J6EA 1M7XA 2BY3A 3SQBA 3PWUB 2VL5A 5EO1B 1HH6B 2ZUTA 5E6RB 1FYHB 3LKRA 5ADPH 4CGUB 3SB3A 4XNZB 5T5FL 3FUEA 3G08A 3ZKSD 2DBLH 5FUZH 4OVUA 3QUYD 5AENA 1UADC 3IPEA 4RDQG 2V3FA 2XPYA 4M7JH 3VXUD 3F7QA 2I60L 2HFEA 2V5YA 4JG0H 4RAUA 2IJ0C 3TEXA 4DQOL 2Y25A 1OGAE 2LU7A 5HI5D 3KPTA 4JFEB 5I82A 4UBDC 1T1YA 3MKKA 5C6TL 4NC1C 4LKXB 1AJ7H 3F7VB 5E7BA 3CZFB 5DU7A 2ESVD 1RSFA 3NCFB 2R1YA 3E2HB 2OXHB 3SYPA 4R26L 4C4UA 2NW3A 2GIXA 2NZ9D 3IDJB 4CC4A 2JLPA 3OQ3B 4R7NA 2EUXA 3O0RH 2AK1L 4X7TA 1CD8A 3WN6A 3INOA 4OLVL 4UT9H 1XIWD 4O5LL 3FCUB 5DA4A 4Z0BL 15C8L 1QMUA 3N40F 3KCPA 4E9LA 3OJVC 2K7PA 5EEVA 1JCKA 3T09A 3Q01A 3IKCA 2L0DA 4LIQH 4QXWA 1ASOA 2OP4H 4W9FC 1MCPL 1JHKH 4I9WE 4L29B 4FQXB 1FNSL 2BOBA 4XPGH 4OCSH 4OI8A 4P57A 3GSXA 3BAJA 1QFOA 3O4LA 3Q5TA 1AFVL 2CLVB 2VRAA 5FFOA 4R97B 3DRQA 4RX4A 5GSRB 3WEXB 4DTGH 4EZMA 4IRSD 3MLVL 3ARBA 4RGMC 5MEOB 5TGBA 1DBBL 3CUPA 4R0LC 4Q9QL 3EYOB 3TT1H 2IDUA 3QCUH 4NQEA 1VA9A 4C4BA 1SMAA 4AQEB 4C59B 4ELDA 2A9CA 3VFSB 3U9PL 4Z7UA 1VRSA 5SWZA 2ICWJ 5I30L 4A6YA 3GMOB 4E0RB 5DWUL 4G6AC 1IC4H 3L13A 1BYNA 3HMWL 1KELL 1CR9H 2WIIB 2X3BA 2YMXH 3P77A 3X1NA 5I1DB 4YHPA 5JDSB 1CXEA 4JRWA 1FGNL 1KCRH 1N0LA 1EZLA 2YK1H 4QCIB 5D71L 4OLYL 3QIUB 4TRPL 2BNQA 3OXSB 4WY7L 3EJZD 4WO0A 4YZWA 4FCAA 4CILA 3BEWA 5HGGS 1USZA 4XCFH 4Q9BA 3KCWA 3LH2H 2C3VB 2XIIA 4XO8A 5H37G 3NJNA 2WHVA 1U8NB 2BSTB 4U6XB 3MJ8A 1YUHB 2GIYA 4YSDA 2YGNA 2UZPA 1T83C 2HZHA 4NIKB 3L6FB 2KZBA 3U6RA 3QORD 1T7YA 1M57B 2F7QA 4U6HA 1KCSL 1KFAH 4Z7VB 5DZLA 2ID5A 1MWAL 2N59A 5DYOA 5T33L 5JIHA 4YIQB 4WI7A 2GITA 4Y16B 4AXWA 3LIUA 3NACL 4OLWH 4N0YH 1HQRA 2YPLA 3BH9A 4PJ9A 1L6XA 4D9QD 1C08A 1MJ8H 4PGDA 4BBWA 1LDPL 5K1NA 4H5SA 4ZX3A 3C6SB 4B5EA 3TBVA 2AV1A 4HETA 5CBAB 2DH2A 2XICA 4FZEL 3ILEA 5M95B 3MLRL 2IPKB 3F2LA 1SBBA 4L2LA 1JZ5A 3NCJH 3MLZL 3QPXH 1DBML 5CZRA 1F4AA 2EDTA 3TVMD 3V52L 1XCXA 4C4KT 1YEGL 4G1MA 5GGRY 3CN1A 4PCKA 3W37A 4YDKH 1J5IA 5I73C 5ILTH 1I3GH 1Q9WA 4B6ZA 1QO3B 5GS1A 1EIBA 5C09E 4R90H 2CHNA 3KHOA 5BUGA 3ESMA 1A4AA 5SWSD 4JPKL 4Y2DD 4HPHA 2RHEA 1V5JA 2YSSA 3NJVA 4I2XE 4ZAKC 5CZKA 1M7IA 1NUFA 1YVLA 3OVUB 4B0MB 2WSDA 3HBZA 3MRIB 4QRPE 3HG1D 3LKPB 3AG1B 2ESVB 1BMZA 1X6NA 5E2WL 1FZOA 2F53A 5E6YA 3SN6N 1QNIA 3LEYL 1I4FA 4D94A 1SY6A 5DQJB 4ZW3A 3IGKA 4OZHF 4ELMA 2MQGA 1OWWA 3JVFC 2FLMA 5I6KA 3BAYA 4XRCB 1XIWB 3PNRB 5L2JB 4OSUL 4U0RC 3Q7JA 4HZ1A 1AC0A 4I7ZC 2IANE 2J5WA 2QDWA 1BECA 4OJFH 2YS4A 4FQQB 3VM7A 3Q1EA 1I8IA 5I66A 3SGJC 1S9XA 3DGDA 1EXUA 4G9DB 4J39A 5CZXC 3K46A 4FNQA 3RNKB 2EVGA 5CUSH 4YR6A 1UH2A 1YRKA 1N19A 5CD3B 1ADQH 1KN2H 2IH1B 2XFGB 4I4WA 4PBXA 1RZKL 2NLJA 5F7DB 4YSAA 3ULVF 1CF1A 5T3ZH 3B56A 4Q6IB 4A66A 5HTSA 4HPOL 4LLUA 1OCRB 5AWNL 4P3DA 2PWEA 1YQ2A 4KUCD 3SODB 2FBJL 2JNZA 5E8DH 4GXVH 4C57C 5AW3B 4MMZC 3VJ6A 1PEZA 2IG2H 5EUOA 2BERA 2AK4E 3QJUB 2W0PA 4F37K 3O8XA 4ZS7H 3CLWA 3U1QA 5IWLC 1MRFH 2BW4A 5EZOH 1J9RA 2W94A 3GMQB 3SDDA 1K4CA 5T5NF 1F4WH 1U8PA 4KHXH 3JYBA 1DQVA 5BZDA 3OKDA 1ZLUH 4FXKC 1M6UA 1OSPL 1DFXA 1NLBL 2CBQA 4GOSA 4UQDA 4KTEL 1F97A 1JZHA 4ZMVA 1FCGA 1BF8A 3X11A 1R24B 1RJCA 5HHQB 5DS2A 2CPCA 1R3IL 4EUPH 5EMYA 4OT1H 2HVKA 2J2ZB 3QORB 5CP7A 4LRIC 4HIJB 4PJHA 1H6EA 2OR9L 5I1JL 3VXMA 2VJ0A 1TQWA 1WFUA 2CLRB 3U0PB 5I1IH 4JZJB 4YDLC 4YNYA 4KNQA 1R0AL 3ULVL 5L8LB 1FL6A 1KGCD 2Z65C 4BDVB 1QZ1A 5HGDB 5FB8A 4WJ5A 5L2KA 2Q86B 5CLXA 1H5BA 2Q7YA 4F7TB 5I8EA 4X5QA 1A2YA 5JLZA 4V1DD 2W60B 3LRSA 5DEGB 3Q6FB 3QFDA 4BELD 2H5UA 1IGTA 1GL4B 2XPGA 3C60A 3O6KL 1LNUB 4HGWB 4N2MA 5HY9A 3OR6B 1GR7A 2Y5EA 3ME0B 4B9JA 5L9DL 5F3HA 5HJGA 4J27A 5MI0C 3LOWA 3SQRA 5I18H 3KYNB 3FQUB 3GXPA 2VT0A 3N9GL 2BIMA 3QCTL 1AD9A 4OBRA 1BZ7A 1AR2A 4G1EB 1T03H 5E8EA 3NGBC 5GGQL 3ZTCC 4QKTA 5HYSA 3D69B 3FJTA 2A4ZA 3KPMA 3IJSB 1Z5HA 4AQOA 5IJBC 2K9UA 3IFLH 3DV4B 3TO4C 3TCLB 1YAZA 1MPAL 3V4VL 3TA3C 4X7SL 5AD0A 3DSFH 2DICA 3HG1B 3S37X 4ZFFB 3SPCA 3SHSA 1MNUL 1MRCH 3KYMA 4FG6C 5EOCL 5A3IC 4QAWA 2HFGL 2Y5TB 3T71A 1UWXK 5DYFA 4KKBC 3DX6B 5I19L 5FHBL 5IW1B 5ITBL 4XX1G 1IMHC 4HCRH 3U79A 1XGQA 2FLBT 1XCQB 1KB5H 2GJ6A 2FVNA 1VZIA 3MRKB 4GMTH 4HEPG 4JL2A 4NUMA 4QF1B 4WW1B 5T5FA 4ZUSB 2C3GA 1DBJL 3W9EB 1XGPB 2VITA 3HE7A 3HS9A 2A9AA 4Z23A 5AAPA 1I1AD 5FYKH 3SZ6A 1NCWL 1RZPA 4AGMA 4QHNA 4DFHA 2DOCA 2DZEA 4ADJA 2MFNA 3KYKH 1XL4A 3G04A 2CQVA 1A4BA 2FWOB 3FSZA 3M46A 3E6FA 5H37A 4C8XA 4J3UA 2HLFD 2YA2A 4NX0A 5T5NG 5LWYL 4JAMB 4N9GB 4AMWA 3FO9A 2R0WL 3HG3A 4S1SH 2CLZA 3P3SA 4NSKB 5A6LA 4RGNE 4LSRH 3DHJA 2EUZA 3TBCA 2DIEA 5AG8A 5CO1A 4KMTH 3FOMB 1WAAF 2K9FB 3H0TA 3O2DL 2AHIA 2R56L 1LMIA 1HH9B 2WXFA 5AVQB 2VN3A 4G6JH 4Y8DC 3EYUH 4KKCD 1WUZA 1Q1JL 4RBPH 3WD5H 2Z6FA 5D1XB 1T7XA 5GZOC 3WMQA 5D7KD 1RFDH 3GLEA 1CXHA 2J20A 4X2UA 1KFGA 1P5UA 4FI7A 3UROR 3QJHB 4PJCE 5DSCB 4QI3A 2OSLB 1JZJA 3VXSD 1VCBC 3EDEA 4XPAL 5F70A 1T7ZA 5DVNA 5A7EA 1YEIL 1BPVA 5EBGA 3RZCC 3EYFB 4L3CA 2K8QA 4L3EB 5I5JA 4ODXB 4F3FA 3LZPA 1VKXA 3TBYA 1Q9OB 3LKSA 1UT1A 4XO5A 1M1XB 3WDJA 2I24N 2QJDA 3GSWB 5AVZB 3BWUC 3NIGB 1J0IA 1IZJA 3K74B 2CE6A 2JCWA 2FJHA 5FYKU 3F7KA 4BRVA 2EILB 3W0WE 5GJTH 4NUQA 1KBPA 3LEVL 4LPYA 5CHNA 5AW0B 2H32B 1TVHA 3VX1A 3LN4B 5F9WC 1AR1C 3ULSB 5D2NA 1IAIM 4Z7OF 2QGBA 3G5YA 3MOQA 1NTDA 5GS0H 2NZ1A 4V1DB 3ZOAA 4U7KA 4NZUH 4YLCA 1RP8A 3D52A 4GKNA 2Q0ZX 1U8JA 4H1LB 4DP4X 3G5ZA 5HDWA 4QHKI 1VGEH 2ALWA 1PW3A 3NUKA 4ATTA 1WCBA 3VI3E 4P3WA 1KV7A 1Z9MA 5DQ9A 5J56B 5IREA 4IBUA 1OF2B 4K07A 1MCBA 4FTVA 4KUZH 3BIAX 2B4CH 2R7EA 5D7JA 3WY3A 4PJFE 3SDAA 2PO6A 1K5WA 4XN8A 4FD0A 3LVTA 1DQLH 5AB2A 3II1A 1HHHA 1J8HA 2DMKA 2YZ1A 1DUZB 4PWFA 3IJHB 3TBTA 4WWID 3I3BA 3GF8A 3ARGC 4QTFA 1TQTA 5GRUH 3IETA 4OCYL 2H2PC 3WCYA 1XSKA 3MV9A 1JVKA 2VAAB 1HIML 1JGUL 3BAEH 3KL5A 3MUGA 4H88L 4JR9H 2AJVH 3FUMA 1PLCA 1AGFA 3V4UH 4BQ9A 2BIOA 2BMKA 2XWJB 3I9GL 2Z9TA 4JM2C 1KJ2L 3VXOB 4FL4B 1QSFA 3DVNA 2KERA 2V5MA 1AGDA 4FQ2L 4Z3IA 4I1RA 5IVZB 2AQ2A 4C56A 3MV8D 4AQZA 1JZ3A 1JWMA 2KPNA 2A73A 2X4QA 1I1AB 1I8KB 1OT4A 4LAQL 3WIIH 1S5IL 3VRIA 1L6PA 5D70L 2CK0H 1WBZB 1ZLEA 3LRLA 1DVFC 3CN2A 1O6SB 1XT5A 1XB8A 5LBSH 5TK4A 3L9YA 3NFNA 4W70A 1F90L 5IFHL 3NSJA 4X6CB 3ZKMC 2VDMH 2D4DA 5CJ8A 4JCLA 1YNLL 1HHJB 1KYOJ 1ZVYA 3LIZH 4YBLC 1N67A 1OE3A 2Q76A 1XZ0A 43C9B 1IKFL 1IFRA 3APDA 4WSJA 1JZ2A 2YGVA 1XQ4A 5DFVD 1EGJL 2YN3A 3IK2A 4M93C 2W0LA 4R5VA 4J4PD 3UC0L 1E65A 3WO4C 3VWJC 3IMWA 2VQ4A 3LZFL 4E5XA 5HHVL 2W81C 1UYWH 4TULL 4W81A 3C5ZC 1B6UA 4IOIB 4DKAA 5TF1L 2OCCB 1OAXL 3ZSTA 4L9LA 1SRDA 1A7NH 2HPTA 1MJ7L 3CNKA 3LZLA 4HJJL 4N2GA 2F5BL 2C5DC 3PABB 3DO7B 1YMME 2UZIH 4HU2A 2X4OB 3DIDA 4YFLI 5BUPA 3L08A 1G9HA 3OQRA 5CEXB 3DMMD 3MGTA 4F1ZA 1V54B 1K3ZA 3T65B 4WSKA 1HL5A 5JQ6H 2Y6TE 4KXZI 1HZLA 4HVBA 3ZKNC 3VXRB 1AY1H 1J8SA 5F93C 1CFBA 2D7PA 1FL3A 2BNRE 1D3CA 4ODHH 4QO1A 3NSFA 3APNA 3NZUA 5C0GB 2EIZB 2CZNA 3H4FA 2OJ1A 4LOFA 3NIDB 1KXQA 5E9NA 1RULL 4X6EB 5LNEA 1YEWA 4YE4H 4IEFA 1KCLA 1FNGA 2YD1A 3AU1B 4NT6A 4OZHA 2G9HB 4R4FH 2A9ML 3CHRA 4XP4H 3TNMB 3H6AA 3FUNA 4AL8L 4LNRB 4M8VA 2VO8A 5GRVK 1PZ5A 3DBXB 2MOQA 3QQ4B 1R3KB 5AZ2H 1FG2B 2AKRB 3DIFA 3VCLB 5C0CD 1E50A 3REVA 1C5BH 1OP4A 3DBSA 2VMDA 1N4XH 1KENL 3QCVL 4OFPA 4XNYL 4ZNEE 1QD0A 4HDIA 5I8OH 5LXVA 3QWOA 4Y4KC 4I3SL 3FQYA 2FATH 1AQMA 5JW3L 4AH2A 3MFGB 1KCUH 4HEPA 4UI2A 2CRIA 3DX7A 4HQQL 4QHUB 5FO7A 4LLQB 1AZCA 1JI1A 2E8ZA 3CC5A 1AI1L 3GSQB 3QUMH 3WL9A 4ZYKA 2GTQA 3O4OB 1GAFH 4DSYA 4AE0A 5DUBB 3D3VD 3HR5A 3MLTA 3ECWA 4GSQA 2LR4A 4OV5B 3OR7B 4HIXH 2EO9A 1FNHA 4XT1C 5AKSA 3CG8A 4ZTPH 1JK8B 2WZAA 4NP4H 4N4YB 2V6HA 3QQDB 3VB9A 3JZYA 3I6GA 1H3WM 1IGIL 1A7BA 1A6ZB 1CVSC 1R46A 3L5HA 4XNZC 5J6HB 4XN5A 5CBEB 5JHAA 4YHYB 5HXMA 3QXTA 4O51A 4EI5D 5MEPA 2AXWA 1TJXA 4QRRB 1JF5A 1Z5LB 3MREA 2OXGB 3BFQG 1PQZA 3PPEA 3CHXA 4R9HA 2X5PA 3LRHA 4Q14A 1JXFA 1ZSDA 2EC9T 1MFCH 3VH8B 4APXB 3MV8B 4OJDH 2OW6A 3DOHA 3BQUD 3QUXB 1GYVA 2HN7A 3HG0A 3K72B 3HCVA 1YEKH 2H6OA 2QVIA 3O9WC 4OD1L 3BUIA 4CMMA 1A65A 1Q0XL 1ZHNB 1DN0B 3E2HC 4KQ4L 1MCNA 2DJUA 3KG5A 4XN4A 5TQ2L 1FC2D 5KOVC 4RMBA 4DZ8B 1NM4A 1J9SA 4QRAA 3V4VA 2PNDA 3JUYA 1E9QB 4HWEL 1X5JA 4XNMB 5SX4I 1UWGH 3E1F1 5F0MB 3SE8L 3CVHB 4Q6YA 4KX8A 1J87A 3IDIB 5LQBL 5ESAB 2FHBA 4UDTA 2C1PA 3Q9PA 2BW5A 3HAEG 4FQXC 4JO8A 4NHUB 5DMGC 3PAZA 4JN2A 5HP5A 3CSPA 3CX5J 4R97C 1FSKC 4HUUA 4NOBA 2VRKA 5CILL 1SJEA 3O6FA 2WC7A 3KPNB 1ZEAL 2XKSA 4D0DB 5KVFL 5DRZB 4IU2A 2F8IA 4GUCA 5E8OA 1K8DA 2A9NH 1DCLA 3OHXA 2O5XH 4JK0D 3SKJL 4XPBL 5HPMA 1IL1B 1F3RB 4J6RH 5F7AA 3IRCA 3MLXL 2R29L 5AYUL 3VDAA 4ENEC 3KLHD 3KH3A 2AABL 3VFOA 4Y5YB 2CKBL 1RMFH 3H3PL 3I2CL 1N5AA 1CFTB 2P42B 3LB6C 1G0DA 4DCQA 5AG9A 1D5XB 2JI2A 4XPTL 1DDHA 3CLEL 3QR2A 4GG6F 1FPTL 1Z2KA 3FSAA 4HULB 2OJEA 3QIUC 3D34A 4F7EA 4U1HB 1A1MB 2ZNXA 2XWBA 2IGFH 2VO5A 5JMOC 2QGDA 3I75A 1RUQH 2DS4A 3HC4L 2CSPA 1WBXB 4N85A 4X7DC 4LU5L 4UNIA 5TH2A 3GIZL 1MJJB 2V9UA 2J44A 3IAPA 3L7EA 3FU9A 4GT7A 4ZFOA 2Z3FA 5EG6C 4XMZA 1U95B 3DX9A 3CU7A 4PV8B 2BFVH 5C0DB 1C8PA 3OB8A 2VQ1B 4MNQA 1BD2E 1WD8A 4M1GL 1NINA 5A43C 1LEKB 2OSXA 1EZSA 2A83A 3PGDA 3ZBMA 4Y16C 4GRWF 4U3XA 1BAGA 1EMTL 2BS8A 4L8DB 4NN5B 4EDXA 5BW7C 1ZS8B