3GLLA

Crystal structure of polynucleotide phosphorylase (pnpase) core
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
544
structure length
494
Chain Sequence
LNPIVRKFQYGQHTVTLETGMMARQATAAVMVSMDDTAVFVTVVGQKKAKPGQDFFPLTVNYQERTYAAGRIPGSFFGRPSEGETLIARLIDRIRPLFPEGFVNEVQVIATVVSVNPQVNPDIVAMIGASAALSLSGIPFNGPIGAARVGYINDQYVLNPTQDELKESKLDLVVAGTEAAVLMVESEAELLSEDQMLGAVVFGHEQQQVVIQNINELVKEAGKPRWDWQPEPVAYRITDKQERYAQVDVIKHAIEKNVVRSRVLAGEPRIDGREKDMIRGLDVRTGVLPRTHGSALFTRGETQALVTATLGTARDAQVLDELMGERTDTFLFHYNFPPYSVGETGMVRREIGHGRLAKRGVLAVMPDMDKFPYTVRVVSEITESNGSSSMASVCGASLALMDAGVPIKAAVAGIAMGLVKEGDNYVVLSDILGEDHLGDMDFKVAGSRDGISALQMDIKIEGITKEIMQVALNQAKGARLHILGVMEQAINAPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Escherichia coli polynucleotide phosphorylase core bound to RNase E, RNA and manganese: implications for catalytic mechanism and RNA degradosome assembly.
pubmed doi rcsb
molecule tags Transferase
molecule keywords Polyribonucleotide nucleotidyltransferase
total genus 128
structure length 494
sequence length 544
ec nomenclature ec 2.7.7.8: Polyribonucleotide nucleotidyltransferase.
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
A PF03726 PNPase Polyribonucleotide nucleotidyltransferase, RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.400 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Polyribonucleotide nucleotidyltransferase, RNA-binding domain 3gllA02
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 3gllA03
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 3gllA01
1R6LA 5C0XD 2WP8B 5K36A 3H36A 5K36D 4OO1B 3GCMA 5JEAF 4IFDD 2BR2A 2PNZA 2WP8A 4AIDA 5JEAC 3M7NG 2PO0B 2C39A 2NN6D 4OO1D 2PO1A 2PNZB 5C0XE 2BA1D 5C0XC 2C39B 2BA0G 5JEAA 3B4TA 2WNRA 4OO1C 5JEAD 4IFDF 4IFDB 2NN6B 3DD6A 1UDQA 4OO1E 2JE6B 2NN6E 2BA1G 2JEAB 2NN6F 5K36C 1E3HA 1OYRA 1E3PA 3CDIA 4AM3A 1UDNA 4BA1B 4OO1A 1UDSA 2BR2B 3CDJA 3H1CA 5K36E 2C37A 5C0XA 2JE6A 3L7ZA 2PO0A 2PO2B 4IFDA 5K36B 2C38A 4BA2B 2PO1B 4OO1F 1OYPA 2JEAA 4NBQA 2JEBB 5C0XB 5C0XF 3U1KA 3HKMA 1WHUA 2C38B 2WNRB 3M85D 2C37B 2NN6C 5K36F 3L7ZB 2JEBA 4BA2A 5JEAE 4IFDC 2BA0D 4BA1A 1R6MA 4IFDE 1UDOA 3GLLA 2PO2A 5JEAB 2NN6A 3M85G 1OYSA 4AIMA 3GMEA 3KRNA 3M7ND
chains in the Genus database with same CATH superfamily
5J1UA 3F8CA 2GWRA 3DP7A 2XAFA 2IXSA 3BC8A 3PNTA 3HDDA 1VQ6I 3DWLE 1TTYA 2A68F 4XLNF 3MKZA 2QENA 4IHXA 2KL4A 2VT2A 3H36A 4AU7A 2IVMA 4BJ6C 5L3GA 3WTXC 4I6ZA 2EPFA 3D0SA 1S16A 4LLGF 2ISZA 3W2AA 1A6QA 4A0YA 2GXAA 4D9JA 4JI4I 3MZYA 1J59A 3OL3A 4FHTA 5H2FC 2OTJI 3LFKA 3M6AA 1G4DA 5LFAA 3EPZA 2IRFG 2BV3A 2QA4I 4DPWA 2KDOA 1BR2A 1XD7A 2JA7J 1K7AA 2KIFA 4JI8I 2VBXA 1XDSA 1XGMA 2ZFWA 3H0GJ 4MGRA 5CYVA 4AQYI 2BA1D 3KP2A 2EINH 4HV6A 5LGTA 4GDFA 4LD5A 4BL0B 5ICGA 2N8GA 3FMRA 1ZGWA 4A3BJ 2BY0A 1Z0CA 5KK1A 1PP8F 3PO3J 4HPQA 2E36A 3E6DA 3GFJA 4BJ5C 2E2HJ 3J80Q 4GYGA 4JI6E 3SEQA 1T0FC 1U2WA 2FE3A 2GAUA 2O0YA 2YR2A 5E1XA 4AUXA 5KAFC 2DODA 2ZXWH 4NC8A 1QQIA 2VJ4A 1OYRA 4IQ4A 3T1YE 2XAQA 3S8PA 2X36A 3SFIA 4FWDA 4GKKE 1IO2A 3KX2A 3GEZA 4M71A 1SFOJ 1I1GA 1HDDC 1ZREA 2ZSIB 3WTYC 3FDYA 2VONA 2JE6A 2WA0A 2PO0A 3HSEA 2CSOA 2JRTA 4FASD 1VQPI 5JI6A 4M72A 4FQGA 1XGOA 3L00A 4WXHA 1K79A 3FX3A 4OO1F 4BDZA 3SQNA 3HRMA 3CLOA 1HNWE 1P6RA 3RPQA 2Y31A 1YG2A 1B6AA 2IA0A 5BS6A 4DR7I 1FOYA 3HIFA 3OIPA 4A6EA 3G71I 4FX4A 4JI2E 3DBRB 3BTLA 2R7WA 1TQIA 1SVLA 3Q0WA 4XTJA 3H4LA 3U1DA 4ZYDA 4JX6A 1OCOH 2A6HF 4BQQA 3TO7A 2NVXJ 1WFXA 2PN6A 4JV5E 2PNLA 4RGRA 4RAFA 2O9LA 5D5XB 4JX5A 5M5WJ 2L54A 1IN4A 1POGA 3TL4X 4P5OA 5J1YA 4IZJA 3LA7A 3RIRA 3Q6NA 4FW3A 3GLLA 3ASNH 1HKTA 1Y60A 2B63J 1LEBA 2XDVA 1BI3A 5GTIC 2COBA 1N36E 3M7ND 2X7IA 1IRXA 4OU0A 1HNZI 3KYCB 2IGOA 5E1ZB 3CJQB 4HV5A 3DV8A 4ZYAA 3Q1QA 1XNQI 2ZO4A 2UXCI 2OF7A 2X1CA 1FWZA 2PBIA 1X1AA 1X1DA 4N3OA 4JYAI 2DO7A 1ZKGA 1XSDA 3D5SC 1FSHA 4U3DA 3HPHA 2XAGA 1MU5A 5ED4A 4YIFA 2ZFUA 1JI8A 2UXXA 2K27A 4NB5A 5GAEJ 1UFMA 4X62I 2CRGA 1J2XA 4XRFA 1U78A 4G7ZF 3H9JA 5J4YA 3WTSC 1MW7A 1OPCA 2DK8A 1FPQA 3NEUA 4UUSB 1AKHA 1YOVB 2V4JC 3KLOA 3MKYB 3QP6A 4JOMA 2VKDA 4N9IA 2PNZB 3KZIC 1JKQC 4DZPA 2ZITA 2KRCA 1RI7A 1MBEA 3QWLA 2L9NA 2HZDA 4B47A 3IRQA 2IS1A 5K5QA 4LCHA 3ZZUA 1WI9A 4Z2YA 1STZA 4IKFA 5IYBJ 3J7YJ 3G4SI 4IJAA 3ZN0A 3WU0A 2UZKA 2NOJB 1USTA 2XUBA 4JI0E 1QA6A 5C4JJ 2LTPA 4HXZA 4IFDB 4AD9A 1G3WA 4CYCA 3J80Z 2QF7A 2HI3A 2ZXJA 4G6QA 5E20A 3O8HA 1IBLI 4J00A 2UUBI 4XOTA 1QVTA 1DGRM 3QYFA 2ECBA 2O3FA 5FKOA 2AE8A 2WW4A 1FWKA 2FRHA 1W0UA 2LKXA 2XAUA 5HNHA 3P3CA 1XB4A 5EEAA 5TRDA 1BOAA 2DOFA 3DBLB 4U88A 4BEHA 1N32I 1R71A 1T38A 1MSFC 1XNQE 3C1DA 2XPUA 2VPRA 2ICWG 4RB3C 2HNHA 2Q2EA 2GBYA 3OYCA 4EJUA 2IGNA 3S93A 1RNLA 3JR9A 3J7ZI 1ZM2A 2HGCA 2Q0OA 3GWZA 3CCSI 3S32A 2LR8A 2XGCA 1EH8A 5K5RA 3ZP5A 2M3AA 1UHSA 3HKMA 2VPLA 1WH5A 3CJRB 2V79A 4XN3A 3GTQJ 3CLQA 5HDGA 2DTRA 1BW5A 1K6OA 3DEEA 1Y39A 2GXGA 1LFPA 1O3SA 1S8NA 3TO9A 3DEWA 1MX0A 5BPDA 4LIUA 1HW1A 2LY1A 2LF7A 3EYYA 4B3AA 2XF6A 3F6OA 2EA4A 1X3UA 4IFDC 5IY5H 3I53A 4HQEA 1YYVA 3S15J 1UHWA 1SD7A 4JI2I 4WXCA 1Y0NA 3OL4A 5IP6A 1RRJA 5E17F 4NQWA 1UDSA 3MCZA 1XMAA 5CVVA 1YFHA 3JAMK 1Z5BA 1BIAA 1T39A 1OKRA 4LOMA 2X85A 2LBFB 3TKYA 2CZ9A 4M73A 2GIVA 3LOCA 2F4MB 2XIGA 2F5EA 3K70D 4I76A 3EUAA 4I2OA 1DP3A 3PYDA 4IFDD 3CCEI 4F91B 1LNWA 2VQEI 2Y2ZA 3IKTA 2ELHA 1LQ1A 3HB9A 4IHWA 4NHJA 1DPUA 4NXMI 3HC7A 5DEQA 3VYRB 1SVMA 5KNLA 4EGZA 1QHGA 3F8MA 3P76A 2VN2A 4ZYEA 3OWTA 2F5DA 2V2QA 4DUZI 4B3MI 1XN7A 4O6JA 4IHVA 2L7ZA 3LSGA 3T1HE 2O7OA 4A3JJ 2DFHA 4RAGA 4DR1E 5DUIA 1BI2A 3K4CA 4LK0F 4G7HF 3BROA 2XV4S 1K61A 2OTLI 1D5VA 1FZPB 1TQMA 5JVGF 4IFDF 1HQCA 1OCZH 2NN6B 2CUJA 3LA2A 3VSKA 4DV1I 4Y13A 1UG2A 1NG7A 3H3VK 3HTUA 4TV7A 3DD6A 3ZR8X 4CCMA 1D1CA 2HOTA 2L5QA 4HYEA 1D8JA 2GS8A 2BVMA 3CCLI 4OIPF 2OZ6A 4LF8E 1PYVA 2OV7A 2FNPA 9ANTA 3DU6A 3OS1A 1LVKA 2IBDA 2O61A 1HKSA 4XLFA 4DPTA 2A5WA 1Y4UA 2Y0SN 3T1HI 3JRBA 2GA2A 1ZR4A 5D5VB 4NXNE 5HDKA 3OYHA 4LJZF 5JFRA 4JYAE 2XF5A 4CXFA 3GFLA 5J6XA 4BA2B 1EI1A 3IH3A 4MEXF 1N0UA 3BR1A 4B44A 1H7UA 1H9TA 4RPFA 4NBQA 4BHBA 2ZM6E 1T2KA 3HOZJ 3GYHX 2IEKA 1QZEA 1X4OA 1JT0A 4DR4E 1BBYA 2X6WA 3LTOA 2DA7A 2CVEA 4YFXF 3FXUA 4A3MJ 2R7XA 4DUYE 2JPCA 4YIIA 1MMDA 4P96A 1Y8RB 2PI0A 4AIHA 4LLNA 2KIQA 1SFEA 4PRXA 2Y9ZA 2CUZA 3M1CA 1T56A 2P8TA 4OIRF 4XONA 3VB2A 4N4OB 2VJJA 3UKGA 3LAPA 1HSTA 1VFCA 2VQHA 1ETYA 1NH3A 4BUPA 3E6CC 1ZXMA 1PDNC 4FW5A 4UUTA 5E8IA 4XM3A 5C4XJ 1H89C 1UZCA 3I9V2 1A31A 3JRGA 1FEXA 2QCOA 4IHYA 2V7FA 1ELOA 4UVCA 4USMA 2YPRA 1BR4A 2QQBA 1HOMA 1SVOA 3I59A 4DUYI 1R36A 3VOEA 5ELWA 2VIXA 4KT6A 1R6RA 2WBMA 2LFBA 4MQ9F 3J80C 2BR2A 4II2A 3QYBA 3JRIA 1VQ8I 2L2OA 3F8NA 3HUGA 3PUFA 2K40A 1N33I 2GXBA 4DR2E 2OI2A 2HK2A 1CF7B 4IZJD 3B6CA 5J4VA 3H0DA 2DA4A 3O6BB 2HR3A 2PO1A 1XSXA 2V34A 1UB9A 2BGCA 5FFXA 4EJWA 3KPHA 5D5WB 2CUEA 2BHZA 3A2KA 1D0XA 2GM4A 3PS1A 4FW9A 3RZDJ 5C0XC 3S3OA 4ITVA 2OA4A 2RQPA 2DPUA 3H35A 4V2FA 4LFUA 4AQYE 4UUSA 4NC6A 2BA0G 5JEAA 1F9NA 4JI1I 1IXSB 3JRFA 4BQAA 5JEAD 2QSHX 5M3MJ 1ZELA 3F6VA 2VQFI 3K70C 1B1BA 2EV0A 3FKIJ 1BOBA 4GCVA 3OYLA 4BXXJ 2NYXA 3ROUA 1H88C 2ZXHA 1IAWA 5JLXA 4MU0A 2BY3A 3HUGB 4I0BA 3NZKA 1HNXI 1F4KA 3IWZA 2DU9A 3ABMH 4U7DA 2Z5UA 2FF4A 1NZ0A 3JRHA 1WUUA 2IS2A 2XSJC 5DROA 3HL2A 1WGXA 2R5ZB 1MBHA 5K36B 4DPUA 3SJMA 4FE4A 2EV5A 2VJ5A 3RYPA 3NARA 1K4TA 4EJVA 3NQOA 4LG3A 2MD5A 4BAYA 4W97A 1K78B 3L2UA 4IRIA 2QZ8A 3LL7A 2GLOA 3DEUA 4MFEA 4P1WA 3HKZA 2C38B 2DFEA 4BBRJ 3C7JA 1AU7A 5K7ZA 1F43A 1HF0A 5EGOA 4BE1A 4KT5C 1TT5B 5KHDA 1B72A 3M07A 1W7PA 1FJGI 1FIPA 3MQ0A 2ADUA 2DJIA 2DXIA 2E35A 4LCFA 4D7NA 3M8FA 1G6NA 1VF9A 4KYWA 4GXOA 3GUDA 1U9OA 1O3RA 4M1KA 3CZ6A 3GZ5A 4RS8A 2L01A 4MTDA 1PJRA 3MFKA 4DYRA 1IG7A 4CGZA 4DXLA 4B43A 4LB6B 2EILH 4IQJA 5A2QK 3WU1B 4YELA 3PYEA 4XQFA 4AVPA 1WZ2A 3OYBA 1FP1D 3DPTA 2WB1N 4XRMA 2K9SA 5DS9A 1DARA 1VQMI 4KICA 1XNRI 2P5KA 3OSFA 1IXCA 3E1SA 4K0KI 1RPWA 3NWSA 1U8BA 1OCPA 1XC5A 4D5FA 3HGGA 4AIDA 2WAFA 4I01A 3HJCA 1VISA 2Z5BB 1W7PB 2RREA 2EFPA 2M34A 1SFKA 1TZLA 2K9NA 4D7MA 3MMYB 4YEJA 2C39A 4ISAA 4IVNA 3ERMA 2UXNA 1RR7A 1OYIA 3BTJA 3HXLA 4A3GJ 3DQVC 1MMAA 5L3EA 2UXBI 2DFIA 1FKAE 1S4EA 5A2QC 4F7ZA 2OJED 3Q0VA 3V4GA 1W1WE 2AXLA 3G1OA 3P06A 2P6SA 2DA6A 4NC7A 3W6JB 2UWMA 4BJTA 1ETKA 2G0EA 2D2WA 4KN7X 1HNWI 1A5JA 1TWCJ 1IDYA 2F5VA 4P9FA 5E3MA 3GTOJ 2HQRA 2VE8A 4HZFA 5E3LA 2EFGA 2I5UA 1TW3A 1MBFA 4WCGA 3U2RA 5H20A 3IC7A 2R7DA 4A5MA 3FK6A 1ZGAA 3EDPA 1KKHA 1IBME 1SD4A 3SZTA 1W5SA 4BA1B 2KKOA 2HZTA 3W2VA 4KQVA 4ETSA 3B78A 1J5EE 3EUKL 5IP7J 2HKXA 2RV8A 5GADJ 4DR6I 1Z0EA 3CWVA 4GRIA 2MFZA 4UVBA 1EF4A 2C37A 5C0XA 3I71A 2H94A 2P81A 3L7ZA 2KDZA 1MMGA 2FEZA 3CUQB 2PO2B 4UUVA 1FNMA 5J1RA 4HNUA 5CVJA 1IGNA 4DV5I 1UCRA 1FOKA 2M5WA 3EQLF 3PM1A 1ODDA 3ECHA 2H09A 1R5GA 1DPRA 4HF0A 3ZN1A 4F55A 4IHSA 1Z6TA 4G6DA 5LHIA 2WNRB 3SFZA 4L9JA 3REOA 1SC7A 3M85D 2UUAI 2DMUA 3GLXA 1VQKI 2Z1DA 4IZKB 5F1JA 5JLWA 1NHIA 3DU5A 5D6EA 3ZRGA 3BPXA 1BC8C 1RZ4A 1FT9A 1Z7LA 1S9HA 1JE8A 5D4RA 4FWGA 1UG0A 2LNBA 1JKRC 1R5HA 4XKVA 2UUBE 4KMFA 2FUG2 5JHFA 2O1TA 3BR0A 1YS6A 1FWLA 2PO2A 2PJRA 2D5VA 2JA5J 1N25A 1MH4A 3P5JA 4EMDA 1H8AC 3C18A 4DV3E 3L2CA 3N05A 3KRNA 1E3OC 2XEXA 2E71A 2FQ3A 1LJ9A 1TL8A 1QZRA 3CMYA 2VBZA 3DLLF 3KP7A 4O5VA 1A04A 3N97A 4IXAA 1BW6A 4IX7A 3RDIA 2VQCA 3K4KA 3JSPA 1HXDA 3OV8A 2STWA 3CD6I 3R4KA 1MMSA 1VQ9I 3GTPJ 2W85A 5K5OA 4I02A 1J5EI 3DPUA 3OY9A 1YX5A 4HLYA 3GCMA 1Z0GA 2BEOA 4BE2A 1XTAA 2EV6A 4QIWN 1WWXA 2GA1A 5HDNA 5EL9A 4JV5I 1XSVA 2CJJA 1V3FA 4PFPA 1SFUA 1IN6A 4XKCA 5JEAC 3ONQA 2PO0B 5HNFA 1Y56A 4LB5A 2L9VA 4CH7A 3CF5F 3I55I 4A3FJ 1GDTA 2M8EA 2JWTA 4FX0A 3K2AA 4M74A 3BCBA 1OFCX 4PJLA 1JHHA 1V4RA 4MNUA 4MHGA 3CCRI 1XNRE 3I54A 5CQEA 2VXZA 4YG2F 4BE0A 3M4OJ 3MEXA 1XMOI 3DCFA 1EH7A 3BG9A 1I94E 3RSNA 2CS3A 2BV6A 5LHHA 4HG2A 3OYGA 2ZMEC 3K1MA 2V1DA 3I5UA 2VODA 3GTMJ 4Y17A 4CICA 5HS8A 5JHUA 4AIKA 3QAHA 1W4MA 4IZJB 2IJLA 3CO6C 3H5AA 3WG9A 1O4XA 3BQZA 3GVAA 1JJ6C 4XLEA 4NNJA 3LPSA 2GOXB 1BM9A 1I1SA 2DA1A 4JG4A 5K36E 5FLXQ 2LVSA 1NK2P 2RNJA 1HK7A 1ETVA 4RGXA 1OMIA 1KU3A 3S1NJ 2B7EA 2VKHA 3K4LA 2XPVA 3GBGA 1PP7U 4LF9E 1LDDA 1IRGA 1IBMI 3OYAA 3MWMA 4RAZA 1WPKA 2HEOA 1S72I 1BN5A 3E7LA 2E5ZA 4A3CJ 4DV4E 1VI0A 4L5IA 2DA5A 2VC1A 5J8CA 3Q5FA 4EM2A 1X1BA 4KITB 1WHUA 1WJAA 2MGQA 3BTIA 1H0MA 1Y4SA 3K1JA 1QO0D 3KEOA 3TW6A 1UHMA 2GQQA 2E60A 2P0WA 2W48A 5DNLA 4PCQA 1FC3A 2BOLA 3RTRA 2FA5A 2L7MP 3K6GA 3WU6A 1K78A 3QPHA 1FP2A 3CCVI 3PSFA 1A35A 4OINF 1MJ9A 2KRHA 3AFHA 3AG2H 4E7JA 1CQTA 3RZOJ 5JEAE 1XMOE 1V5GA 2DBBA 3WU3A 4BH9A 1ZRCA 3A01A 2K3FA 4LG0A 3ZCOA 4IZZA 1ZXNA 2RKHA 3OYNA 3M1EA 2JMWA 2NS0A 2A6TA 1OR7C 2JA2A 3HOYJ 3SZPA 2PMUA 1P4XA 4CYCB 4UY8I 1P7IA 5F04A 3ZQLA 1YHCA 3VEPA 2EZHA 1YTYA 1I3AA 2WP8B 3DBHB 4GGGA 5K7HA 2WY7Q 4DR3E 1ZRFA 4N9HA 1D0ZA 1U5TB 2BXZA 2ZMEA 1GLNA 1S7AA 3HOVJ 1Y0UA 2XVCA 4Y7NJ 2AS5F 4A3DJ 3R6SA 2B0LA 3DKYA 2JTVA 1SFXA 4LF6I 4MYUA 4WUDA 3D5LA 2LKSA 5FKNA 4E7LA 4A3LJ 1HW5A 3BR2A 2M0CA 3KP3A 1REPC 2NN6D 5BPIA 1P4AA 4NUBA 2EB7A 3WHBA 3JCUC 3IH2A 4RB2C 2UU9I 3A01B 1XXEA 2Y30A 2LK2A 1R4NB 3IL2A 2ZKZA 1B9MA 1TLHB 2IPQX 1Z0BA 2K85A 5L3CA 2K5CA 5BR8E 2L7KA 1R00A 1DDNA 3B82A 1IN8A 3E5QA 2LP0A 5HS9A 3ERED 5IT9K 3BJ6A 1PVGA 3ZXSA 2DMNA 1HR0I 2DJNA 4BBSJ 3PSIA 3LNUA 2IP2A 2MSYA 1JUMA 2VI6A 4ZYGA 4A93J 3ML6A 1XMQI 1B8IA 3MKLA 1UDQA 3FHNA 5FLMJ 2R7QA 4OIOF 2NN6F 2JEAB 2M7AA 4AYBA 5LMNE 4DV0E 3GTJJ 1O3TA 5DRQA 2A07F 5FKMA 3F23A 2LJPA 4BDYA 5EEGA 3K1NA 5BMZA 2MG4A 1DP7P 2L9RA 3S16J 2BR2B 3DTIA 4UT4A 2XGEA 2MH9A 2HHHE 1PUFA 4OAYA 4HLXA 3S3MA 1H7SA 5LGNA 4IFDA 3SDGA 5FD5A 3OYIA 1FYLA 5IT9C 3N4MA 4I3HA 1ZLJA 4JP0A 2QM3A 3QOEA 5DD4A 3IKVA 3S2HJ 1OYPA 2IGMA 2VQGA 2GOMA 2NPFA 2H8WA 1FY7A 4XK4A 4G8XA 4DBRA 2ZCWA 4DV1E 1R4MB 4Q48A 5BNGA 4AYBN 3WU4A 1J09A 1MBGA 4YRVA 1Q1HA 4U7BA 1O7LA 4N4NB 2DT7B 5E18F 1E17A 1V54H 1BJAA 3V7CA 2DDAA 3OYMA 4JK1X 3HOTA 1H74A 1USSA 3BR6A 1W0TA 3OR1C 1FLIA 2NOGA 5FJ8J 2CW8A 2IAIA 2R4GA 4A2UA 1PUFB 3A1YA 3T8TA 2PFBA 4MEYF 2QUFA 4HDUA 1YRNB 3FMQA 1Z0VA 1JT6A 2LOOA 4CCKA 1OYSA 3PIPF 5DCMB 2L3DA 1OJLA 3L7WA 4Y15A 3QPSA 1Z0WA 4X64I 1SAXA 3HKZN 3V2UC 2YSRA 3WU2C 2MD0A 4RLFA 1ZH5A 2E5LE 4JI3E 3VYUB 2P5LC 3OR2C 3M8EA 1JGGA 1KQ0A 4C3IJ 2WC2A 4JI1E 2M45A 5EJCA 1VQ4I 3DFGA 5ICEA 1MBJA 1ZM9A 1IW7F 3KLNA 4CSWA 3CTAA 1B9NA 1E2XA 3HOXJ 2RNGA 1MZBA 1ZARA 1KU7A 4JI5I 3TOBA 4WX9A 2VL8A 3TQNA 3J80K 4HDVA 3BT9A 4HACA 2QYOA 2F4VI 2ESHA 4HX8A 3WTTC 5TGTA 5DRPA 4JYKA 4ENKA 4CZZA 2EWNA 1E0EA 5CQGA 4U0YA 2HVQA 1DGWY 5M5XJ 4B4CA 2FOWA 5FGMA 1KU9A 5C0XE 2R7VA 5DCMA 5J8FA 3BY6A 5LMUE 3U9GA 2R7ZJ 3WGHA 3PIOF 4FETA 3H3ZA 1K6YA 2K7LA 5DNXA 3O8GA 2LRDA 3DF8A 2CGPA 2XAHA 5LRRA 1FBSA 4MLOA 1NG6A 4AC0A 4EV0A 4M9XA 1S7OA 5D4SA 1V5EA 2XAJA 5K1YA 2DT6A 3TP3A 4BEHB 1IV6A 3QU6A 2Z9OA 5IT9Z 3HGYA 3ZKDA 3CDIA 4GFBA 2KJCA 2XB5A 3V8KA 1YH8A 2VC0A 2X0LA 4LLLA 3ZGKA 3CUOA 2J65A 3H92A 2AQEA 3OMYA 1R9TJ 2PJPA 2HPMA 3PNVA 1UJ8A 2H1LA 1IN5A 3H1CA 3MVPA 3R0AA 2GQ0A 3TDZC 3AG3H 4X64E 2EFQA 4HF2A 5LMUI 3K1PA 4Z6YA 2NVQJ 1BIBA 5F08A 2LC2A 1FMVA 1ETQA 3KYDB 5TJJA 2VOOA 2OCEA 1XMKA 3PO2J 3WHCA 1TNTA 2OBPA 1FBUA 4QPOA 4FT8A 2L9SA 2QQAA 2AJ4A 2Z99A 1WJEA 3HPGA 4II3A 1LB2A 5DYMA 1G3TA 2PLYA 4KIBA 4ZVIA 4WUCA 2LH9A 1W5CC 5F27A 3O2PE 4I09A 2FMLA 2V26A 1S3JA 5IPAA 1NHHA 4XIDA 2ZNZA 2HQNA 1RKTA 2HU9A 4OOIA 3KP5A 1RR8C 3G1LA 5BR8I 3ZM7A 5F1RA 1QRYA 4BA2A 2IS6A 2J5OA 1GVJA 2RVCA 1FJLA 1LDJA 1YJNI 4C30A 5DRRA 3E6MA 1U2RA 4BA1A 2R42A 4HNVA 2H6CA 2JSCA 3HTSB 5JEAB 4LGWA 1YIOA 4FW7A 3H9GA 3CC4I 3GFMA 1G59A 1IRZA 4OX9I 2XC7A 1RESA 4EM0B 1Z5AA 3FM3A 4BNCA 1XMQE 1R6LA 3HRSA 2I10A 2YX4A 3ESWB 5J47A 4CHUA 2IERA 2RN7A 2A2CA 3CUQA 3TP0A 5KCMA 3FHZA 4RA2A 3IWFA 2IGKA 4BY7J 2CH0A 1ETOA 4J3DA 3FWEA 1J0RA 2JPBA 1L0OC 2KZVA 5EZGA 1QPIA 3LSIA 3FKJA 3GW2A 2MLKA 2PX9A 2ZSHB 3KFWX 4HEA2 4S05A 2G7HA 5EG0B 1TP4A 2E1MB 2FMYA 3P9KA 1P2FA 4XN0A 4AVZA 2HOSA 2WP8A 2H6BA 2P7VB 2PMZA 3A4CA 2HDCA 1N34E 4XLCA 4PJ0C 2F4IA 1Z77A 1ORKA 4WXDA 4IZKA 1JGSA 1FOWA 3NAUA 3ZZTA 3GXOA 2VUMJ 3G73A 1HKQA 4RLQA 1TNSA 4KHPI 1N75A 1AA7A 4LF7E 3K69A 1DU0A 1GUUA 3OS2A 5FRMA 1R5ID 2PJRB 1ON1A 3UHMA 2DW4A 3L1PA 3B73A 3PS2A 2V8PA 2NRAC 2LMDA 3W6KB 1VQ7I 2OU2A 1B72B 2LKPA 4FISA 1X2MA 2HXOA 3BR5A 4DNCA 3TBIA 1X3WB 2R7SA 3J7AO 2HFHA 2O1WA 4IOCF 1VQLI 1M1EB 4JI4E 1E3PA 4QLCU 3F72A 3ZMZA 2WV0A 3IAS2 1C0WA 1UDNA 1JTYA 4XRSG 3OIQA 4DPXA 1H9GA 4OO1A 5FFZA 3BOQA 4PJNA 5B1BH 2K9MA 4C2TA 3VPRA 5M3FJ 1YX3A 5D8LB 4UV8A 4E4HA 1D5YA 2R7UA 2RDPA 3K0LA 2DTZA 3L2VA 2DOAA 2ZJRF 3OIOA 2X6XA 3FXQA 1S29A 4PJMA 2FOKA 1UMQA 1R7JA 4CYDA 1YHQI 2HFUA 4L5EA 1MG7A 1RKWA 2UU9E 4B48A 1BR1A 3X2QH 4DV3I 1RR9A 1W7PD 1QGPA 3S14J 4YFKF 4X0GA 1UELB 4JI6I 2Z5BA 2LY2A 3F9KA 1UAAA 1U3EM 5GP9A 3K7AJ 4XLAA 2OZUA 1I94I 4IPAA 4RM3A 3ZQGA 1OLTA 3F8FA 4XSZF 4ZZLA 1FI4A 4MQYA 5BOXA 2KMUA 3QODA 2DCEA 1B59A 4CCJA 2E1RA 2FX0A 3FXMA 2COMA 2CYYA 1QZZA 5AIQA 2O3ZA 4RDUA 1ZHFA 3FXKA 2BA0D 4JI8E 5A2QQ 2VBYA 1ZRDA 1WJCA 5DD8A 4X66I 3I58A 2BXYA 1HDPA 2Q8KA 1ENHA 3IV5A 3GTKJ 5HLIA 4XRSA 2OQRA 5EF6A 1FYKA 1S5LC 3S2WA 1Y1VJ 1FTTA 1FMWA 1GVDA 3QT7A 3Q0UA 4LITA 2HYFA 3FK7A 1SD6A 4DU8A 5GAGJ 2L4MA 2X51A 1G8XA 2OC6A 2XRLA 3HOUJ 1CF7A 2FQ4A 2J7KA 3BG3A 4BXFA 5HLTA 1YQAA 2X9DA 4M3GA 2HTSA 3GO5A 4ZDLA 1QBJA 3QPTA 4L0YB 1X3ZB 1IJWC 1I6XA 4M9SA 2R3VA 3K85A 1XDUA 4C3JJ 1RC9A 3J81C 2KRFA 3E97A 2E1OA 1HW2A 4HY1A 4XSXF 3TO6A 2FD5A 1B8IB 1XHKA 1J7KA 1J5YA 2YS9A 1MDMA 4CA0A 3ZQHA 3W6VA 1X1CA 2ZB9A 4DOZA 2ZXIA 1NTCA 2PEXA 1SMTA 4XORA 4EEFG 2R7OA 4S0HB 2DPDA 2QSGX 5J40A 4MU4A 5DM7F 1I3QJ 2ZNYA 1HCRA 2X1DA 1MNDA 3LSJA 4LG0B 4A3IJ 1EV7A 1KU2A 2A61A 4GO1A 3TGNA 2WNRA 4G94A 1GHCA 3RKXA 3LAJA 1BJZA 4DU7A 1XX5A 2EA2A 3LMMA 2LLKA 5DV5A 2LREA 1F1ZA 1XMXA 4DV4I 3HHHA 1MJAA 4OO1E 3A02A 5M5YJ 3G6EI 1K47A 3P3GA 3PYGA 5K36C 4WWCA 4LF6E 3E0JB 3MN2A 4A0ZA 1MJBA 4U3BA 3S1RJ 3BR3A 3FXLA 4M6XA 1KTVA 3CDJA 2WTEA 1MDMB 4LMYA 2K9QA 2BW3A 3PFYA 3HRTA 4KIFA 1D8KA 4HX4A 1ZYRF 2RC4A 2D1HA 2WAEA 4ON0A 2BZTA 4PGHA 4CDGA 5F0HA 3WGIA 2D45A 3FBNB 4A5NA 3BQYA 4OWRB 4UVAA 3ZOBA 5LBQA 4P9UA 3FXOA 1N32E 2HHHI 2C38A 3PRYA 2CQNA 3FISA 4DPYA 2DMTA 1USUA 2K02A 2Y75A 1WVRA 4LCGA 3PL8A 4CCNA 3EYIA 3F8BA 2JEBB 3SHFA 2M9HA 3P7NA 3WU5A 1HR0E 5CJ9A 2ZBKA 3VYTB 1N34I 2GIZA 4FTHA 3OOUA 2ECCA 5GPCA 1N77A 3WTUC 4N0BA 1T08B 2CV0A 2ZM6I 3LQRA 4DR5I 2QQ9A 5F6FA 3HOWJ 1XCVA 2PMHA 2JZYA 3LSMA 1ZR2A 3L9FA 2IA1A 1J75A 1VQ5I 2C37B 4X62E 4NXME 4ENNA 3L7ZB 4ED4A 3JREA 2V2VA 1QHHD 5ILUA 3S3NA 4EJOA 3J81K 4PZJA 2MYSA 3PYFA 1BI0A 4O3MA 3RKYA 3ZQIA 4DUZE 3H3UA 2X48A 2ZJ2A 2NXNB 3HG9A 2V6CA 3PNYA 4LIVA 5AIPA 3IRRA 3G3ZA 3OYJA 2QKLB 3P9CA 4I0AA 3GZ6A 1HSJA 1G2HA 3TMOA 4E7KA 3GMEA 3I4PA 3V8JA 2P6TA 1D3YA 2E1CA 3HHGA 1TWGJ 5EZHA 1NK3P 4D5CA 5KVRA 1RHYA 1JUSA 4EJTA 4JBAA 4P7AA 1OYYA 2XKOA 2NS8A 2JT2A 2ZBKB 3J7AM 4CUGA 3PUBA 2XGXA 2Z5CB 3SEZA 3RPUD 3ELKA 5L3JA 1RIOH 2LF8A 2M4KA 4CCLA 1TT0A 1OCCH 2BYVE 2EIJH 2HTJA 4AIJA 4ASNA 1DUXC 1ACIA 1IBLE 2DK5A 3QQAA 2CG4A 1VZ0A 2JQ7A 1LDKB 4LPFA 4EVIA 3J7AY 2P4WA 2QWWA 3M7NG 4HX7A 3DTEA 4BHPA 2QSFX 3IHUA 3L2QA 2EH3A 4Q47A 5FLXC 4OO1D 4OKGA 1LFUP 5LMNI 3JW4A 2XROA 4X65E 4BU2A 4W1UA 2CWEA 5LL6R 4A69C 2TRTA 1XPXA 3SDBA 1Z7UA 1B4AA 3DKXA 3DTKA 4E6KG 3MD2A 1IDZA 2BM0A 4NXNI 4PRVA 4QNKA 2HVSA 1WCMJ 2ID6A 4B3ME 4XKBA 1RUNA 3V5RA 5AONA 5ILVA 1PIEA 4DQ2A 5HS7A 4XICA 2QBYB 5HLHA 4DV6E 5E3NA 4DR3I 1ETXA 2M30A 2XB0X 3L2WA 1D6TA 4ESBA 1W36C 4B3SI 2HXIA 2W00A 4D0PA 3RCOA 1SEUA 2TCTA 1AHDP 5E3OA 2NN6E 4MU3A 1NHJA 2R92J 2WAQN 2DA2A 4IRHA 3ZQCA 3RPUA 2BBYA 1Y6IA 4OAZA 1KGSA 2QKMB 1P4WA 2MBFA 5GMEA 5LLQA 3HM5A 3ISPA 1FYMA 1X1PA 3VFZA 2DQLA 1YW7A 3OYEA 4B3RE 1X19A 3BCAA 4HW0A 3MKWB 1YI2I 3CCUI 4X1EA 4FE7A 2M1BA 3E3VA 3FXJA 2OD5A 2NNNA 4KN4X 4Q5SF 1YO5C 2FNAA 3TW7A 2ZMEB 1QPMA 2I8DA 2QBYA 4YFNF 1KIJA 4V19K 3U1YA 3I56I 1Z3YA 1ZAOA 3H5RA 1GXPA 1OJ4A 1ONVA 1LUJB 2HQ5A 3NWTA 4I7HA 1TWAJ 3BDDA 4I98B 1VNDA 3T8RA 2KZGA 2VQEE 4K2EA 3KP4A 3V7SA 2EIKH 1TBXA 4I99C 3L2RA 4KA4A 1FTZA 5K36F 4ANJA 3JRAA 4J19A 4R79A 4DIQA 3OYDA 1WRJA 2NAZA 3WGGA 4H4KC 2R5YA 3B8HA 5LGUA 2KHMA 1D1BA 2F6CA 5EG0A 3Q6MA 1R6MA 1ZN2A 1F36A 1MNMC 4L18B 2CQ7A 2ZC2A 3DXJF 4JI7I 2BE5F 3B02A 2ELJA 2CW7A 4WF2A 1YJWI 2VESA 1MGTA 3F0NA 4UTGA 4AIMA 1LFBA 2IA2A 2ISYA 4URLA 2HOAA 1X2NA 3H5NA 1QNTA 1U9NA 3O3KA 5ICFA 3HRUA 1EA3A 1NHAA 2JA6J 2JUGA 3RYRA 5HLGA 4YHHI 2G7UA 1QZYA 3TDUC 1T0FA 1Z05A 4RGSA 2E5LI 2E7WA 2L7FP 1IXRC 2Y69H 2XASA 3CP2A 3QYEA 5CLSA 4ZZDA 5L3FA 5JEAF 6PAXA 2F4OB 2K4JA 4GYIA 3BJAA 3KEYA 3A0BC 4GKJE 1HNXE 1A6FA 2W82A 3WTZA 2R0QC 4PK4A 1R49A 3H9QA 4JI5E 4PFOA 4Y3OA 3Q9SA 1YS7A 1Z9CA 5BQTA 2Y0MA 1GT0C 5GMDA 1FOXA 2NVTJ 3OYFA 3I4MJ 2DEIA 1U5TA 1WH7A 3E6BA 4IHTA 4AWXB 4PDKA 3LSKA 5C44J 2IS4A 4YY3I 4B3TI 4XKWA 5CVUA 2CUFA 1ZG1A 4LFCE 3BZKA 4GQUA 2E34A 2Z33A 3G2BA 5JVTA 2CQXA 2HS5A 2DDBA 1H73A 4DV7E 1G3YA 4G12A 5F0FA 1JJ8C 4X66E 3RJPA 2CMPA 4PSXA 1IBKE 1Y8QB 3DLAA 1WI3A 4MDTA 4X65I 2QQ8A 4F52A 2KP6A 2KFDA 2LY9A 3CF2A 4KIGA 3S17J 4HQMA 2E19A 1LEAA 4M3EA 1ZM4A 2JK3A 3P9IA 3J7AG 5B66C 2VE9A 2BY2A 3K4NA 4XBFA 2PQ8A 4ZH4F 5IT9Q 1WSUA 1N33E 4LOCA 1IZ1A 4E7ZA 1LKXA 2K3PA 3CCMI 5FKKA 3K4BA 4YY3E 1FNNA 4ZC3A 4EGYA 3FZVA 1YITI 4EMSA 4A12A 2O1VA 2EFOA 3HSRA 4A0XA 3D1NI 3LNQA 4M6YA 4YHHE 2O8XA 4DR4I 5D8KB 2W4SA 2JEAA 1RETA 1VTNC 4KHPE 4L5JA 3M8JA 4UB6C 5L3BA 2AQFA 3U1KA 4DV5E 3BLYA 4U0VA 1PUEE 4IL6C 3PFIA 3S2DJ 3LSPA 2CW0F 1KVKA 1T98A 4QNJA 1JKOC 1WJBA 2KT0A 2X6YA 1FJGE 4U87A 2JEBA 4MQVA 2Z2SB 2FBHA 2UUAE 1V5FA 3C2GA 5FRNA 3ABTA 3M3YJ 3QPLA 2UXCE 5DCFA 3W2WA 4JX4A 2FXAA 3K4JA 3RQIA 3ZQ7A 4DW6A 2KISA 2ZJQF 2HKEA 3SXYA 2CQQA 2KLOA 2VQLA 2OCCH 3JTGA 3CCYA 2R5ZA 2ESNA 1ON2A 2P7CB 3S1MJ 4MFDA 1X58A 4L0ZB 5ERIA 2OAZA 4DV7I 2CG9A 1TC3C 3A0HC 4A3KJ 4KFCA 3PJRA 3F22A 2EK5A 4UXNA 2AO9A 2M7BA 1KA8A 3RKWA 4H0EA 2H27A 3HYIA 2V1XA 2ID3A 2WADA 2RQQA 1W5TA 2VQFE 2V1NA 2XSDC 2H1KA 4IO9F 1OCTC 5GAHJ 3ZPLA 4G9YA 3GONA 3BZ6A 1Z0XA 3HJEA 3KCCA 3CQZJ 3F3XA 4LFBE 3BP8A 4PGGA 2BY1A 3KZYA 4DR2I 4USKA 2YU9J 1XGSA 1G3SA 3CMEI 1Y5YA 1SAUA 5LEKA 5F64A 2KIUA 1Z91A 1P9QC 2MA3A 2W1OA 2W84A 2Y0SA 1BL0A 1BI1A 3ECOA 2Z5CA 2E2IJ 1ZGJA 2CFXA 4DV2E 2MC3A 3J81Z 2HKOA 1TQPA 3RQ4A 3CDLA 2FBIA 4RAYA 2BHYA 1MMNA 4BY1J 3J81Q 2EZLA 5FO5A 2IT0A 4P52A 1WQ2A 3JTHA 3L09A 5DUKA 2LDUA 4BKXA 4OZEA 2K9LA 4FW6A 2QVOA 2J5PA 1Z1DA 1TWHJ 2BW3B 4FW4A 4RB1A 5DTDA 2JN6A 2HOEA 4OO1C 2JJ7A 4ABZA 5LD2C 4DR7E 5A2QZ 1MBKA 5IOZA 5EKWA 4FN5A 3AL0B 4MYTA 4DZJA 4LFAI 4XOPA 3HULA 3I4NJ 4B1RA 4IOAF 2CFOA 2JUCA 3FMSA 3CMMA 2DYRH 1E3HA 2R7FA 2M2EA 1ZG5A 3WE2A 5B5EC 3V8LA 4AM3A 1HA8A 4DJAA 4LF4E 2WWYA 4UNOA 5H6QA 4L9VA 4Y52J 5FKLA 5FROA 1P92A 4RBOA 4KDPA 1Z21A 4BGDA 4HSRA 4BQNA 4F3QA 2IESA 1U5TC 4HA8A 5EYRA 4LF5E 3RI4A 2GO4A 3P3EA 1APLC 3AKZA 3KIOA 3LSHA 2UXDE 3MZ8A 2FSWA 3K2ZA 3GF2A 3G1MA 4Z7YA 4G7OF 1PKPA 1HNZE 3KEQA 5E8GA 4QTRA 1U0JA 2QLZA 5FLXZ 1KQ9A 5LHGA 1MIJA 2MABA 3OOPA 4DGWB 4LF9I 1T8IA 4LFBI 2HVRA 2MLGA 4P55A 2FU4A 4R1HA 1QU3A 2VKVA 5TISC 1DU6A 2L0KA 4EATA 4XLPF 1LVAA 4F92B 3JAMC 3JAMQ 1YRNA 2B9SA 3HBLA 5IWAE 1OQYA 2LBFA 4BQOA 2O03A 2DQRA 4OMYA 2VLAA 1EJ9A 1BA5A 3ABUA 4LFCI 3OTOE 2O1UA 2JVGA 4HSTA 1ZLKA 4DR6E 4FCYA 2ACJA 2JA8J 3FF5A 2UUZA 4BXUA 2JRMA 1ZTRA 2Q1ZB 2UUCE 5C3EJ 1HBXG 5E79C 2DOEA 1I50J 1JHFA 1MKMA 1IBKI 2CU7A 3BPVA 3CP8A 1LPQA 1RUOA 3NRVA 1KQ8A 4XLHA 3FM5A 2HDWA 1FBQA 1W36D 4E7SA 1Z0TA 4LF4I 2RAEA 3DPLC 1Q1VA 4GKKI 2F2EA 4OO1B 2OQGA 1EH6A 2NS7A 3CDHA 1YE9A 2C6YA 1MSEC 5FWKA 2PNMA 1Z59A 5CVIA 4BHCA 1O7FA 3HSFA 3I59B 4RM2A 1YLFA 2WAQA 4JQFA 4YIRX 4FWHA 1U6GA 1I5ZA 4PSWA 3ASOH 3M7GA 2IOQA 3SZGA 4XL9A 3HZJA 2HDDA 2XKPA 3S1QJ 4HYMA 2LG4A 3LFUA 3VYSB 1J9IA 1U8RA 3EUHA 3HEFA 3ZMTA 4JI0I 2DLLA 3R60A 3C3WA 2HFSA 3COAC 4Y4RA 4ESJA 3UNGC 4D1QA 1YW8A 4DYCA 4XR6A 2TDXA 4L9NA 4DV2I 1B62A 1JTXA 1P42A 2MW8A 1BC7C 1Z6RA 4B3XA 1KONA 4IRGA 4PU9A 4ZTFA 2JVHA 3JAMZ 4E70A 5J3LA 3WTWC 2VJIA 1Z67A 3T1BA 2RGVA 2WB1A 4F93B 5FLXK 2LD5A 3QRFF 2M8GX 2AXTC 3GX4X 4E7IA 1Z5CA 1TWFJ 4PUSA 2R3SA 1LE8A 2EZIA 4A3EJ 2O5RA 5FB2A 5HODA 1VQOI 2K4BA 2V1UA 1DQUA 1N36I 1FX7A 2DMPA 2KJBA 1MNEA 3CCQI 3CC7I 4Q4ZF 2M0MA 4M3DA 4BYYA 4CZCA 5KAIC 1RREA 5DDGA 3ZQQA 1OCRH 1ETWA 2Z3YA 5HVQC 1K4SA 4M3BA 1VI7A 2XHKA 2DFFA 4UB8C 2VOPA 3T5XA 2YX7A 5C0XF 3IUOA 3MAJA 4S04A 4C3HJ 4MO7A 4CCOA 3LSRA 1AOYA 1ZK8A 4G6TB 4Y33A 4LF5I 4V2GA 1Y1WJ 2W25A 3FBIB 3I3LA 2K86A 3EETA 4XMYA 3WG7H 1IC8A 1AKHB 2AHQA 2NN6C 3K17A 1O57A 2UXDI 1ULYA 2ME0A 5LRSA 5EEHA 3Q9VA 4DV0I 2L4AA 4Z7CA 2G9WA 4HRIA 2V2ZA 2ME6A 2YUSA 1S7EA 1GXQA 1JXSA 3IP4B 4MU1A 2F5FA 2LYCA 3PQKA 1T95A 4IFDE 2Z5EA 3IAM2 3QP5A 3FXRA 5B1AH 4IEJA 1WKMA 2MC4A 2BM1A 5C0XD 1K83J 3JRDA 1IN7A 2DA3A 2VXDA 2VBWA 4ENJA 5IWAI 2R7RA 3AG4H 2OUMA 3OTOI 5GTHC 3BWGA 2DMQA 4UV9A 4UHTA 2EBIA 4DYQA 3D4JA 4LK1F 4OMZA 3VWBA 4IF4A 2UUCI 4J01A 1B63A 1IUFA 1D1AA 3CCJI 2UV1A 3Q3SA 4RB0A 3D5RC 1ZM3A 4KUMA 3ZMUA 1CGPA 3UR3C 4BS9A 1JUPA 3AL0C 2EFWA 2IW5A 2E2JJ 2E1NA 2ETHA 2XRNA 4R8HA 1X4PA 5L3DA 5DM6F 2R5YB 2EFNA 4XNFA 4DR1I 1FSEA 3QT5A 4KJZA 3ABKH 1KZHA 2C39B 2ELKA 3JRCA 2M87A 4QWQA 3E5UA 3B4TA 4EM1A 2V6EA 2X4HA 2Z16A 5B3SH 2EZKA 2VKEA 4B3TE 4C2MJ 2P5VA 3IH4A 2V9PA 4WK8F 3CC2I 1IRFA 1ERDA 5H6RA 5ICCA 1Y6ZA 2HYGD 1JKPC 2JE6B 1YJ9I 3KE2A 2BA1G 3E5XA 3WTVC 1QVUA 2HK3A 3SYTA 1XGNA 3M9AA 1A36A 2HQAA 2JSPA 2F48A 2H8RA 4GKJI 3TEDA 1WJFA 3CESA 3R0JA 2DI3A 2GZWA 4NQWB 4U0WA 4ZJZA 3KETA 3RKQA 5EGOB 2VF3A 5IOYA 1VQNI 2PMZN 3CMAI 5ILSA 2STTA 4M6VA 2EJRA 2PO1B 5F0CA 4WUBA 3JSOA 2NVUB 4KISA 3A03A 5HOOA 1R22A 1OYWA 2E5NA 5C0XB 3C2BA 1IUYA 3AAFA 3T0YA 4B3SE 2A69F 3OYKA 3BTCA 1EA6A 1ZQ3P 4DBQA 1R1VA 4PJJA 2JT1A 2CGEA 5LEJA 4R1FA 3KZZA 5E1WA 2CV1A 1O3QA 4ZDOA 1V55H 4HACB 3K4MA 3ABLH 2E1MC 3I64A 3BG5A 2W57A 3GTGJ 4B3RI 4KNYA 1OR7A 3PQJA 1F5TA 1UDOA 2KIMA 2DEJA 3PS3A 4DR5E 5D6FA 1T33A 1WJDA 4X6AJ 2D1VA 2FJ1A 3U21A 1N78A 1WJ5A 3GTLJ 2NN6A 1I27A 2O8KA 2LSOA 4CO8A 3KYLA 1AWCA 5EDNA 3QT8A 3C2HA 4ENMA 2HPIA 1XS9A 3OSGA 3AG1H 3ULQB 5K36A 3GFIA 5IP9J 3CJNA 5K36D 2VT3A 3B6AA 3BG7A 4M9ZA 5CKTA 2NVYJ 3ZZ0A 1SD5A 4JI3I 1I39A 1A6IA 1YW9A 2DYSH 3WODF 2UXBE 1D0YA 3LWFA 2PNZA 2R7TA 1P7JA 3LA3A 3KP6A 4C9YA 3QT6A 2CQKA 2OPTA 2XGDA 4ZTJA 3DKWA 5CPRB 1UEKA 3BZCA 5CVRA 2F4VE 2DN0A 2DAOA 2X1EA 1N0VC 2KPMA 2A2DA 3V7RA 1OISA 1XCBA 2O6GE 4JI7E 3GZNB 3QOPA 2A6EF 2BVLA 4OIQF 2F5CA 2L02A 4HF1A 3K9TA 1T6SA 4LF7I 3ZMSA 2YU3A 3ZMDA 2ZJPF 5D5UB 1ITYA 4MIMA 4B8XA 2W7NA 2HYJA 4LF8I 2VB6A 1YIJI 2F1DA 1KYWA 1S6LA 2A3SA 3OS0A 1R1TA 3QU3A 2A05A 4QSHA 3LQQA 4MTEA 2A5YB 2Y48A 3ZMVA 4EQQA 3EUHC 3F21A 2QEXI 4LFAE 2Q2EB 4A6DA 4QPQA 2X6OA 2V9VA 2FBKA 3W3CA 2DT5A 2WY8Q 3BJOA 5GPAA 1TW2A 2MH2A 4HOBA 5IYCJ 4DV6I 2Y9YA 2M4GA 1USVA 2WV1A 2EIMH 4RGUA 4ZYHA 1BKNA 2E7XA 2XF7A 1IV8A 1XG1A 2NNYA 1HC8A 3VSLA 1HLVA 1I6HJ 2HWVA 3VODA 5IYDJ 2R93J 1KYZA 5FLVA 3WE3A 2QGUA 4B09A 2PG4A 3TOAA 4C2UA 3F0CA 2HKJA 1SMYF 1LE8B 2XPWA 4RMNA 5JR3A 1R58A 2CO5A 5IT3A 1R23A 3MZHA 4IS9A 1ZG3A 1Z3XA 3BG6A 4K0KE 3I0TA 4KMUX 4ZDPA 5FD6A 5K7FA 4ESFA 1GV5A 2EQRA 2V9KA 4HBLA 4M3FA 1IF1A 3V42A 3K10A 1H72C 3ZKBA 3CUQC 1GV2A 1MH3A 4BACA 1FIAA 2KQRA 2IOPA 1PVEA 4E7HA 3ZQFA 1EKEA 3VDXA 3T1YI 3CJTB 1L3LA 3LSTA 1SANA 4L9TA 4OX9E 3HOSA 4NDLA 3CO7C 2CV2A 3FIWA 2VASA 1R1UA 2W24A 2GO3A 3M85G 3R61A 4HNTA 1MD0A 4HAMA
chains in the Genus database with same CATH topology
1R6LA 5C0XD 2WP8B 5K36A 3H36A 5K36D 4OO1B 3GCMA 5JEAF 4IFDD 2BR2A 2PNZA 2WP8A 4AIDA 5JEAC 3M7NG 2PO0B 2C39A 2NN6D 4OO1D 2PO1A 2PNZB 5C0XE 2BA1D 5C0XC 2C39B 2BA0G 5JEAA 3B4TA 2WNRA 4OO1C 5JEAD 4IFDF 4IFDB 2NN6B 3DD6A 1UDQA 4OO1E 2JE6B 2NN6E 2BA1G 2JEAB 2NN6F 5K36C 1E3HA 1OYRA 1E3PA 3CDIA 4AM3A 1UDNA 4BA1B 4OO1A 1UDSA 2BR2B 3CDJA 3H1CA 5K36E 2C37A 5C0XA 2JE6A 3L7ZA 2PO0A 2PO2B 4IFDA 5K36B 2C38A 4BA2B 2PO1B 4OO1F 1OYPA 2JEAA 4NBQA 2JEBB 5C0XB 5C0XF 3U1KA 3HKMA 1WHUA 2C38B 2WNRB 3M85D 2C37B 2NN6C 5K36F 3L7ZB 2JEBA 4BA2A 5JEAE 4IFDC 2BA0D 4BA1A 1R6MA 4IFDE 1UDOA 3GLLA 2PO2A 5JEAB 2NN6A 3M85G 1OYSA 4AIMA 3GMEA 3KRNA 3M7ND
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R6L A;  5C0X D;  2WP8 B;  5K36 A;  3H36 A;  5K36 D;  4OO1 B;  3GCM A;  5JEA F;  4IFD D;  2BR2 A;  2PNZ A;  2WP8 A;  4AID A;  5JEA C;  3M7N G;  2PO0 B;  2C39 A;  2NN6 D;  4OO1 D;  2PO1 A;  2PNZ B;  5C0X E;  2BA1 D;  5C0X C;  2C39 B;  2BA0 G;  5JEA A;  3B4T A;  2WNR A;  4OO1 C;  5JEA D;  4IFD F;  4IFD B;  2NN6 B;  3DD6 A;  1UDQ A;  4OO1 E;  2JE6 B;  2NN6 E;  2BA1 G;  2JEA B;  2NN6 F;  5K36 C;  1E3H A;  1OYR A;  1E3P A;  3CDI A;  4AM3 A;  1UDN A;  4BA1 B;  4OO1 A;  1UDS A;  2BR2 B;  3CDJ A;  3H1C A;  5K36 E;  2C37 A;  5C0X A;  2JE6 A;  3L7Z A;  2PO0 A;  2PO2 B;  4IFD A;  5K36 B;  2C38 A;  4BA2 B;  2PO1 B;  4OO1 F;  1OYP A;  2JEA A;  4NBQ A;  2JEB B;  5C0X B;  5C0X F;  3U1K A;  3HKM A;  1WHU A;  2C38 B;  2WNR B;  3M85 D;  2C37 B;  2NN6 C;  5K36 F;  3L7Z B;  2JEB A;  4BA2 A;  5JEA E;  4IFD C;  2BA0 D;  4BA1 A;  1R6M A;  4IFD E;  1UDO A;  3GLL A;  2PO2 A;  5JEA B;  2NN6 A;  3M85 G;  1OYS A;  4AIM A;  3GME A;  3KRN A;  3M7N D; 
#chains in the Genus database with same CATH topology
 5J1U A;  3F8C A;  2GWR A;  3DP7 A;  2XAF A;  2IXS A;  3BC8 A;  3PNT A;  3HDD A;  1VQ6 I;  3DWL E;  1TTY A;  2A68 F;  4XLN F;  3MKZ A;  2QEN A;  4IHX A;  2KL4 A;  2VT2 A;  3H36 A;  4AU7 A;  2IVM A;  4BJ6 C;  5L3G A;  3WTX C;  4I6Z A;  2EPF A;  3D0S A;  1S16 A;  4LLG F;  2ISZ A;  3W2A A;  1A6Q A;  4A0Y A;  2GXA A;  4D9J A;  4JI4 I;  3MZY A;  1J59 A;  3OL3 A;  4FHT A;  5H2F C;  2OTJ I;  3LFK A;  3M6A A;  1G4D A;  5LFA A;  3EPZ A;  2IRF G;  2BV3 A;  2QA4 I;  4DPW A;  2KDO A;  1BR2 A;  1XD7 A;  2JA7 J;  1K7A A;  2KIF A;  4JI8 I;  2VBX A;  1XDS A;  1XGM A;  2ZFW A;  3H0G J;  4MGR A;  5CYV A;  4AQY I;  2BA1 D;  3KP2 A;  2EIN H;  4HV6 A;  5LGT A;  4GDF A;  4LD5 A;  4BL0 B;  5ICG A;  2N8G A;  3FMR A;  1ZGW A;  4A3B J;  2BY0 A;  1Z0C A;  5KK1 A;  1PP8 F;  3PO3 J;  4HPQ A;  2E36 A;  3E6D A;  3GFJ A;  4BJ5 C;  2E2H J;  3J80 Q;  4GYG A;  4JI6 E;  3SEQ A;  1T0F C;  1U2W A;  2FE3 A;  2GAU A;  2O0Y A;  2YR2 A;  5E1X A;  4AUX A;  5KAF C;  2DOD A;  2ZXW H;  4NC8 A;  1QQI A;  2VJ4 A;  1OYR A;  4IQ4 A;  3T1Y E;  2XAQ A;  3S8P A;  2X36 A;  3SFI A;  4FWD A;  4GKK E;  1IO2 A;  3KX2 A;  3GEZ A;  4M71 A;  1SFO J;  1I1G A;  1HDD C;  1ZRE A;  2ZSI B;  3WTY C;  3FDY A;  2VON A;  2JE6 A;  2WA0 A;  2PO0 A;  3HSE A;  2CSO A;  2JRT A;  4FAS D;  1VQP I;  5JI6 A;  4M72 A;  4FQG A;  1XGO A;  3L00 A;  4WXH A;  1K79 A;  3FX3 A;  4OO1 F;  4BDZ A;  3SQN A;  3HRM A;  3CLO A;  1HNW E;  1P6R A;  3RPQ A;  2Y31 A;  1YG2 A;  1B6A A;  2IA0 A;  5BS6 A;  4DR7 I;  1FOY A;  3HIF A;  3OIP A;  4A6E A;  3G71 I;  4FX4 A;  4JI2 E;  3DBR B;  3BTL A;  2R7W A;  1TQI A;  1SVL A;  3Q0W A;  4XTJ A;  3H4L A;  3U1D A;  4ZYD A;  4JX6 A;  1OCO H;  2A6H F;  4BQQ A;  3TO7 A;  2NVX J;  1WFX A;  2PN6 A;  4JV5 E;  2PNL A;  4RGR A;  4RAF A;  2O9L A;  5D5X B;  4JX5 A;  5M5W J;  2L54 A;  1IN4 A;  1POG A;  3TL4 X;  4P5O A;  5J1Y A;  4IZJ A;  3LA7 A;  3RIR A;  3Q6N A;  4FW3 A;  3GLL A;  3ASN H;  1HKT A;  1Y60 A;  2B63 J;  1LEB A;  2XDV A;  1BI3 A;  5GTI C;  2COB A;  1N36 E;  3M7N D;  2X7I A;  1IRX A;  4OU0 A;  1HNZ I;  3KYC B;  2IGO A;  5E1Z B;  3CJQ B;  4HV5 A;  3DV8 A;  4ZYA A;  3Q1Q A;  1XNQ I;  2ZO4 A;  2UXC I;  2OF7 A;  2X1C A;  1FWZ A;  2PBI A;  1X1A A;  1X1D A;  4N3O A;  4JYA I;  2DO7 A;  1ZKG A;  1XSD A;  3D5S C;  1FSH A;  4U3D A;  3HPH A;  2XAG A;  1MU5 A;  5ED4 A;  4YIF A;  2ZFU A;  1JI8 A;  2UXX A;  2K27 A;  4NB5 A;  5GAE J;  1UFM A;  4X62 I;  2CRG A;  1J2X A;  4XRF A;  1U78 A;  4G7Z F;  3H9J A;  5J4Y A;  3WTS C;  1MW7 A;  1OPC A;  2DK8 A;  1FPQ A;  3NEU A;  4UUS B;  1AKH A;  1YOV B;  2V4J C;  3KLO A;  3MKY B;  3QP6 A;  4JOM A;  2VKD A;  4N9I A;  2PNZ B;  3KZI C;  1JKQ C;  4DZP A;  2ZIT A;  2KRC A;  1RI7 A;  1MBE A;  3QWL A;  2L9N A;  2HZD A;  4B47 A;  3IRQ A;  2IS1 A;  5K5Q A;  4LCH A;  3ZZU A;  1WI9 A;  4Z2Y A;  1STZ A;  4IKF A;  5IYB J;  3J7Y J;  3G4S I;  4IJA A;  3ZN0 A;  3WU0 A;  2UZK A;  2NOJ B;  1UST A;  2XUB A;  4JI0 E;  1QA6 A;  5C4J J;  2LTP A;  4HXZ A;  4IFD B;  4AD9 A;  1G3W A;  4CYC A;  3J80 Z;  2QF7 A;  2HI3 A;  2ZXJ A;  4G6Q A;  5E20 A;  3O8H A;  1IBL I;  4J00 A;  2UUB I;  4XOT A;  1QVT A;  1DGR M;  3QYF A;  2ECB A;  2O3F A;  5FKO A;  2AE8 A;  2WW4 A;  1FWK A;  2FRH A;  1W0U A;  2LKX A;  2XAU A;  5HNH A;  3P3C A;  1XB4 A;  5EEA A;  5TRD A;  1BOA A;  2DOF A;  3DBL B;  4U88 A;  4BEH A;  1N32 I;  1R71 A;  1T38 A;  1MSF C;  1XNQ E;  3C1D A;  2XPU A;  2VPR A;  2ICW G;  4RB3 C;  2HNH A;  2Q2E A;  2GBY A;  3OYC A;  4EJU A;  2IGN A;  3S93 A;  1RNL A;  3JR9 A;  3J7Z I;  1ZM2 A;  2HGC A;  2Q0O A;  3GWZ A;  3CCS I;  3S32 A;  2LR8 A;  2XGC A;  1EH8 A;  5K5R A;  3ZP5 A;  2M3A A;  1UHS A;  3HKM A;  2VPL A;  1WH5 A;  3CJR B;  2V79 A;  4XN3 A;  3GTQ J;  3CLQ A;  5HDG A;  2DTR A;  1BW5 A;  1K6O A;  3DEE A;  1Y39 A;  2GXG A;  1LFP A;  1O3S A;  1S8N A;  3TO9 A;  3DEW A;  1MX0 A;  5BPD A;  4LIU A;  1HW1 A;  2LY1 A;  2LF7 A;  3EYY A;  4B3A A;  2XF6 A;  3F6O A;  2EA4 A;  1X3U A;  4IFD C;  5IY5 H;  3I53 A;  4HQE A;  1YYV A;  3S15 J;  1UHW A;  1SD7 A;  4JI2 I;  4WXC A;  1Y0N A;  3OL4 A;  5IP6 A;  1RRJ A;  5E17 F;  4NQW A;  1UDS A;  3MCZ A;  1XMA A;  5CVV A;  1YFH A;  3JAM K;  1Z5B A;  1BIA A;  1T39 A;  1OKR A;  4LOM A;  2X85 A;  2LBF B;  3TKY A;  2CZ9 A;  4M73 A;  2GIV A;  3LOC A;  2F4M B;  2XIG A;  2F5E A;  3K70 D;  4I76 A;  3EUA A;  4I2O A;  1DP3 A;  3PYD A;  4IFD D;  3CCE I;  4F91 B;  1LNW A;  2VQE I;  2Y2Z A;  3IKT A;  2ELH A;  1LQ1 A;  3HB9 A;  4IHW A;  4NHJ A;  1DPU A;  4NXM I;  3HC7 A;  5DEQ A;  3VYR B;  1SVM A;  5KNL A;  4EGZ A;  1QHG A;  3F8M A;  3P76 A;  2VN2 A;  4ZYE A;  3OWT A;  2F5D A;  2V2Q A;  4DUZ I;  4B3M I;  1XN7 A;  4O6J A;  4IHV A;  2L7Z A;  3LSG A;  3T1H E;  2O7O A;  4A3J J;  2DFH A;  4RAG A;  4DR1 E;  5DUI A;  1BI2 A;  3K4C A;  4LK0 F;  4G7H F;  3BRO A;  2XV4 S;  1K61 A;  2OTL I;  1D5V A;  1FZP B;  1TQM A;  5JVG F;  4IFD F;  1HQC A;  1OCZ H;  2NN6 B;  2CUJ A;  3LA2 A;  3VSK A;  4DV1 I;  4Y13 A;  1UG2 A;  1NG7 A;  3H3V K;  3HTU A;  4TV7 A;  3DD6 A;  3ZR8 X;  4CCM A;  1D1C A;  2HOT A;  2L5Q A;  4HYE A;  1D8J A;  2GS8 A;  2BVM A;  3CCL I;  4OIP F;  2OZ6 A;  4LF8 E;  1PYV A;  2OV7 A;  2FNP A;  9ANT A;  3DU6 A;  3OS1 A;  1LVK A;  2IBD A;  2O61 A;  1HKS A;  4XLF A;  4DPT A;  2A5W A;  1Y4U A;  2Y0S N;  3T1H I;  3JRB A;  2GA2 A;  1ZR4 A;  5D5V B;  4NXN E;  5HDK A;  3OYH A;  4LJZ F;  5JFR A;  4JYA E;  2XF5 A;  4CXF A;  3GFL A;  5J6X A;  4BA2 B;  1EI1 A;  3IH3 A;  4MEX F;  1N0U A;  3BR1 A;  4B44 A;  1H7U A;  1H9T A;  4RPF A;  4NBQ A;  4BHB A;  2ZM6 E;  1T2K A;  3HOZ J;  3GYH X;  2IEK A;  1QZE A;  1X4O A;  1JT0 A;  4DR4 E;  1BBY A;  2X6W A;  3LTO A;  2DA7 A;  2CVE A;  4YFX F;  3FXU A;  4A3M J;  2R7X A;  4DUY E;  2JPC A;  4YII A;  1MMD A;  4P96 A;  1Y8R B;  2PI0 A;  4AIH A;  4LLN A;  2KIQ A;  1SFE A;  4PRX A;  2Y9Z A;  2CUZ A;  3M1C A;  1T56 A;  2P8T A;  4OIR F;  4XON A;  3VB2 A;  4N4O B;  2VJJ A;  3UKG A;  3LAP A;  1HST A;  1VFC A;  2VQH A;  1ETY A;  1NH3 A;  4BUP A;  3E6C C;  1ZXM A;  1PDN C;  4FW5 A;  4UUT A;  5E8I A;  4XM3 A;  5C4X J;  1H89 C;  1UZC A;  3I9V 2;  1A31 A;  3JRG A;  1FEX A;  2QCO A;  4IHY A;  2V7F A;  1ELO A;  4UVC A;  4USM A;  2YPR A;  1BR4 A;  2QQB A;  1HOM A;  1SVO A;  3I59 A;  4DUY I;  1R36 A;  3VOE A;  5ELW A;  2VIX A;  4KT6 A;  1R6R A;  2WBM A;  2LFB A;  4MQ9 F;  3J80 C;  2BR2 A;  4II2 A;  3QYB A;  3JRI A;  1VQ8 I;  2L2O A;  3F8N A;  3HUG A;  3PUF A;  2K40 A;  1N33 I;  2GXB A;  4DR2 E;  2OI2 A;  2HK2 A;  1CF7 B;  4IZJ D;  3B6C A;  5J4V A;  3H0D A;  2DA4 A;  3O6B B;  2HR3 A;  2PO1 A;  1XSX A;  2V34 A;  1UB9 A;  2BGC A;  5FFX A;  4EJW A;  3KPH A;  5D5W B;  2CUE A;  2BHZ A;  3A2K A;  1D0X A;  2GM4 A;  3PS1 A;  4FW9 A;  3RZD J;  5C0X C;  3S3O A;  4ITV A;  2OA4 A;  2RQP A;  2DPU A;  3H35 A;  4V2F A;  4LFU A;  4AQY E;  4UUS A;  4NC6 A;  2BA0 G;  5JEA A;  1F9N A;  4JI1 I;  1IXS B;  3JRF A;  4BQA A;  5JEA D;  2QSH X;  5M3M J;  1ZEL A;  3F6V A;  2VQF I;  3K70 C;  1B1B A;  2EV0 A;  3FKI J;  1BOB A;  4GCV A;  3OYL A;  4BXX J;  2NYX A;  3ROU A;  1H88 C;  2ZXH A;  1IAW A;  5JLX A;  4MU0 A;  2BY3 A;  3HUG B;  4I0B A;  3NZK A;  1HNX I;  1F4K A;  3IWZ A;  2DU9 A;  3ABM H;  4U7D A;  2Z5U A;  2FF4 A;  1NZ0 A;  3JRH A;  1WUU A;  2IS2 A;  2XSJ C;  5DRO A;  3HL2 A;  1WGX A;  2R5Z B;  1MBH A;  5K36 B;  4DPU A;  3SJM A;  4FE4 A;  2EV5 A;  2VJ5 A;  3RYP A;  3NAR A;  1K4T A;  4EJV A;  3NQO A;  4LG3 A;  2MD5 A;  4BAY A;  4W97 A;  1K78 B;  3L2U A;  4IRI A;  2QZ8 A;  3LL7 A;  2GLO A;  3DEU A;  4MFE A;  4P1W A;  3HKZ A;  2C38 B;  2DFE A;  4BBR J;  3C7J A;  1AU7 A;  5K7Z A;  1F43 A;  1HF0 A;  5EGO A;  4BE1 A;  4KT5 C;  1TT5 B;  5KHD A;  1B72 A;  3M07 A;  1W7P A;  1FJG I;  1FIP A;  3MQ0 A;  2ADU A;  2DJI A;  2DXI A;  2E35 A;  4LCF A;  4D7N A;  3M8F A;  1G6N A;  1VF9 A;  4KYW A;  4GXO A;  3GUD A;  1U9O A;  1O3R A;  4M1K A;  3CZ6 A;  3GZ5 A;  4RS8 A;  2L01 A;  4MTD A;  1PJR A;  3MFK A;  4DYR A;  1IG7 A;  4CGZ A;  4DXL A;  4B43 A;  4LB6 B;  2EIL H;  4IQJ A;  5A2Q K;  3WU1 B;  4YEL A;  3PYE A;  4XQF A;  4AVP A;  1WZ2 A;  3OYB A;  1FP1 D;  3DPT A;  2WB1 N;  4XRM A;  2K9S A;  5DS9 A;  1DAR A;  1VQM I;  4KIC A;  1XNR I;  2P5K A;  3OSF A;  1IXC A;  3E1S A;  4K0K I;  1RPW A;  3NWS A;  1U8B A;  1OCP A;  1XC5 A;  4D5F A;  3HGG A;  4AID A;  2WAF A;  4I01 A;  3HJC A;  1VIS A;  2Z5B B;  1W7P B;  2RRE A;  2EFP A;  2M34 A;  1SFK A;  1TZL A;  2K9N A;  4D7M A;  3MMY B;  4YEJ A;  2C39 A;  4ISA A;  4IVN A;  3ERM A;  2UXN A;  1RR7 A;  1OYI A;  3BTJ A;  3HXL A;  4A3G J;  3DQV C;  1MMA A;  5L3E A;  2UXB I;  2DFI A;  1FKA E;  1S4E A;  5A2Q C;  4F7Z A;  2OJE D;  3Q0V A;  3V4G A;  1W1W E;  2AXL A;  3G1O A;  3P06 A;  2P6S A;  2DA6 A;  4NC7 A;  3W6J B;  2UWM A;  4BJT A;  1ETK A;  2G0E A;  2D2W A;  4KN7 X;  1HNW I;  1A5J A;  1TWC J;  1IDY A;  2F5V A;  4P9F A;  5E3M A;  3GTO J;  2HQR A;  2VE8 A;  4HZF A;  5E3L A;  2EFG A;  2I5U A;  1TW3 A;  1MBF A;  4WCG A;  3U2R A;  5H20 A;  3IC7 A;  2R7D A;  4A5M A;  3FK6 A;  1ZGA A;  3EDP A;  1KKH A;  1IBM E;  1SD4 A;  3SZT A;  1W5S A;  4BA1 B;  2KKO A;  2HZT A;  3W2V A;  4KQV A;  4ETS A;  3B78 A;  1J5E E;  3EUK L;  5IP7 J;  2HKX A;  2RV8 A;  5GAD J;  4DR6 I;  1Z0E A;  3CWV A;  4GRI A;  2MFZ A;  4UVB A;  1EF4 A;  2C37 A;  5C0X A;  3I71 A;  2H94 A;  2P81 A;  3L7Z A;  2KDZ A;  1MMG A;  2FEZ A;  3CUQ B;  2PO2 B;  4UUV A;  1FNM A;  5J1R A;  4HNU A;  5CVJ A;  1IGN A;  4DV5 I;  1UCR A;  1FOK A;  2M5W A;  3EQL F;  3PM1 A;  1ODD A;  3ECH A;  2H09 A;  1R5G A;  1DPR A;  4HF0 A;  3ZN1 A;  4F55 A;  4IHS A;  1Z6T A;  4G6D A;  5LHI A;  2WNR B;  3SFZ A;  4L9J A;  3REO A;  1SC7 A;  3M85 D;  2UUA I;  2DMU A;  3GLX A;  1VQK I;  2Z1D A;  4IZK B;  5F1J A;  5JLW A;  1NHI A;  3DU5 A;  5D6E A;  3ZRG A;  3BPX A;  1BC8 C;  1RZ4 A;  1FT9 A;  1Z7L A;  1S9H A;  1JE8 A;  5D4R A;  4FWG A;  1UG0 A;  2LNB A;  1JKR C;  1R5H A;  4XKV A;  2UUB E;  4KMF A;  2FUG 2;  5JHF A;  2O1T A;  3BR0 A;  1YS6 A;  1FWL A;  2PO2 A;  2PJR A;  2D5V A;  2JA5 J;  1N25 A;  1MH4 A;  3P5J A;  4EMD A;  1H8A C;  3C18 A;  4DV3 E;  3L2C A;  3N05 A;  3KRN A;  1E3O C;  2XEX A;  2E71 A;  2FQ3 A;  1LJ9 A;  1TL8 A;  1QZR A;  3CMY A;  2VBZ A;  3DLL F;  3KP7 A;  4O5V A;  1A04 A;  3N97 A;  4IXA A;  1BW6 A;  4IX7 A;  3RDI A;  2VQC A;  3K4K A;  3JSP A;  1HXD A;  3OV8 A;  2STW A;  3CD6 I;  3R4K A;  1MMS A;  1VQ9 I;  3GTP J;  2W85 A;  5K5O A;  4I02 A;  1J5E I;  3DPU A;  3OY9 A;  1YX5 A;  4HLY A;  3GCM A;  1Z0G A;  2BEO A;  4BE2 A;  1XTA A;  2EV6 A;  4QIW N;  1WWX A;  2GA1 A;  5HDN A;  5EL9 A;  4JV5 I;  1XSV A;  2CJJ A;  1V3F A;  4PFP A;  1SFU A;  1IN6 A;  4XKC A;  5JEA C;  3ONQ A;  2PO0 B;  5HNF A;  1Y56 A;  4LB5 A;  2L9V A;  4CH7 A;  3CF5 F;  3I55 I;  4A3F J;  1GDT A;  2M8E A;  2JWT A;  4FX0 A;  3K2A A;  4M74 A;  3BCB A;  1OFC X;  4PJL A;  1JHH A;  1V4R A;  4MNU A;  4MHG A;  3CCR I;  1XNR E;  3I54 A;  5CQE A;  2VXZ A;  4YG2 F;  4BE0 A;  3M4O J;  3MEX A;  1XMO I;  3DCF A;  1EH7 A;  3BG9 A;  1I94 E;  3RSN A;  2CS3 A;  2BV6 A;  5LHH A;  4HG2 A;  3OYG A;  2ZME C;  3K1M A;  2V1D A;  3I5U A;  2VOD A;  3GTM J;  4Y17 A;  4CIC A;  5HS8 A;  5JHU A;  4AIK A;  3QAH A;  1W4M A;  4IZJ B;  2IJL A;  3CO6 C;  3H5A A;  3WG9 A;  1O4X A;  3BQZ A;  3GVA A;  1JJ6 C;  4XLE A;  4NNJ A;  3LPS A;  2GOX B;  1BM9 A;  1I1S A;  2DA1 A;  4JG4 A;  5K36 E;  5FLX Q;  2LVS A;  1NK2 P;  2RNJ A;  1HK7 A;  1ETV A;  4RGX A;  1OMI A;  1KU3 A;  3S1N J;  2B7E A;  2VKH A;  3K4L A;  2XPV A;  3GBG A;  1PP7 U;  4LF9 E;  1LDD A;  1IRG A;  1IBM I;  3OYA A;  3MWM A;  4RAZ A;  1WPK A;  2HEO A;  1S72 I;  1BN5 A;  3E7L A;  2E5Z A;  4A3C J;  4DV4 E;  1VI0 A;  4L5I A;  2DA5 A;  2VC1 A;  5J8C A;  3Q5F A;  4EM2 A;  1X1B A;  4KIT B;  1WHU A;  1WJA A;  2MGQ A;  3BTI A;  1H0M A;  1Y4S A;  3K1J A;  1QO0 D;  3KEO A;  3TW6 A;  1UHM A;  2GQQ A;  2E60 A;  2P0W A;  2W48 A;  5DNL A;  4PCQ A;  1FC3 A;  2BOL A;  3RTR A;  2FA5 A;  2L7M P;  3K6G A;  3WU6 A;  1K78 A;  3QPH A;  1FP2 A;  3CCV I;  3PSF A;  1A35 A;  4OIN F;  1MJ9 A;  2KRH A;  3AFH A;  3AG2 H;  4E7J A;  1CQT A;  3RZO J;  5JEA E;  1XMO E;  1V5G A;  2DBB A;  3WU3 A;  4BH9 A;  1ZRC A;  3A01 A;  2K3F A;  4LG0 A;  3ZCO A;  4IZZ A;  1ZXN A;  2RKH A;  3OYN A;  3M1E A;  2JMW A;  2NS0 A;  2A6T A;  1OR7 C;  2JA2 A;  3HOY J;  3SZP A;  2PMU A;  1P4X A;  4CYC B;  4UY8 I;  1P7I A;  5F04 A;  3ZQL A;  1YHC A;  3VEP A;  2EZH A;  1YTY A;  1I3A A;  2WP8 B;  3DBH B;  4GGG A;  5K7H A;  2WY7 Q;  4DR3 E;  1ZRF A;  4N9H A;  1D0Z A;  1U5T B;  2BXZ A;  2ZME A;  1GLN A;  1S7A A;  3HOV J;  1Y0U A;  2XVC A;  4Y7N J;  2AS5 F;  4A3D J;  3R6S A;  2B0L A;  3DKY A;  2JTV A;  1SFX A;  4LF6 I;  4MYU A;  4WUD A;  3D5L A;  2LKS A;  5FKN A;  4E7L A;  4A3L J;  1HW5 A;  3BR2 A;  2M0C A;  3KP3 A;  1REP C;  2NN6 D;  5BPI A;  1P4A A;  4NUB A;  2EB7 A;  3WHB A;  3JCU C;  3IH2 A;  4RB2 C;  2UU9 I;  3A01 B;  1XXE A;  2Y30 A;  2LK2 A;  1R4N B;  3IL2 A;  2ZKZ A;  1B9M A;  1TLH B;  2IPQ X;  1Z0B A;  2K85 A;  5L3C A;  2K5C A;  5BR8 E;  2L7K A;  1R00 A;  1DDN A;  3B82 A;  1IN8 A;  3E5Q A;  2LP0 A;  5HS9 A;  3ERE D;  5IT9 K;  3BJ6 A;  1PVG A;  3ZXS A;  2DMN A;  1HR0 I;  2DJN A;  4BBS J;  3PSI A;  3LNU A;  2IP2 A;  2MSY A;  1JUM A;  2VI6 A;  4ZYG A;  4A93 J;  3ML6 A;  1XMQ I;  1B8I A;  3MKL A;  1UDQ A;  3FHN A;  5FLM J;  2R7Q A;  4OIO F;  2NN6 F;  2JEA B;  2M7A A;  4AYB A;  5LMN E;  4DV0 E;  3GTJ J;  1O3T A;  5DRQ A;  2A07 F;  5FKM A;  3F23 A;  2LJP A;  4BDY A;  5EEG A;  3K1N A;  5BMZ A;  2MG4 A;  1DP7 P;  2L9R A;  3S16 J;  2BR2 B;  3DTI A;  4UT4 A;  2XGE A;  2MH9 A;  2HHH E;  1PUF A;  4OAY A;  4HLX A;  3S3M A;  1H7S A;  5LGN A;  4IFD A;  3SDG A;  5FD5 A;  3OYI A;  1FYL A;  5IT9 C;  3N4M A;  4I3H A;  1ZLJ A;  4JP0 A;  2QM3 A;  3QOE A;  5DD4 A;  3IKV A;  3S2H J;  1OYP A;  2IGM A;  2VQG A;  2GOM A;  2NPF A;  2H8W A;  1FY7 A;  4XK4 A;  4G8X A;  4DBR A;  2ZCW A;  4DV1 E;  1R4M B;  4Q48 A;  5BNG A;  4AYB N;  3WU4 A;  1J09 A;  1MBG A;  4YRV A;  1Q1H A;  4U7B A;  1O7L A;  4N4N B;  2DT7 B;  5E18 F;  1E17 A;  1V54 H;  1BJA A;  3V7C A;  2DDA A;  3OYM A;  4JK1 X;  3HOT A;  1H74 A;  1USS A;  3BR6 A;  1W0T A;  3OR1 C;  1FLI A;  2NOG A;  5FJ8 J;  2CW8 A;  2IAI A;  2R4G A;  4A2U A;  1PUF B;  3A1Y A;  3T8T A;  2PFB A;  4MEY F;  2QUF A;  4HDU A;  1YRN B;  3FMQ A;  1Z0V A;  1JT6 A;  2LOO A;  4CCK A;  1OYS A;  3PIP F;  5DCM B;  2L3D A;  1OJL A;  3L7W A;  4Y15 A;  3QPS A;  1Z0W A;  4X64 I;  1SAX A;  3HKZ N;  3V2U C;  2YSR A;  3WU2 C;  2MD0 A;  4RLF A;  1ZH5 A;  2E5L E;  4JI3 E;  3VYU B;  2P5L C;  3OR2 C;  3M8E A;  1JGG A;  1KQ0 A;  4C3I J;  2WC2 A;  4JI1 E;  2M45 A;  5EJC A;  1VQ4 I;  3DFG A;  5ICE A;  1MBJ A;  1ZM9 A;  1IW7 F;  3KLN A;  4CSW A;  3CTA A;  1B9N A;  1E2X A;  3HOX J;  2RNG A;  1MZB A;  1ZAR A;  1KU7 A;  4JI5 I;  3TOB A;  4WX9 A;  2VL8 A;  3TQN A;  3J80 K;  4HDV A;  3BT9 A;  4HAC A;  2QYO A;  2F4V I;  2ESH A;  4HX8 A;  3WTT C;  5TGT A;  5DRP A;  4JYK A;  4ENK A;  4CZZ A;  2EWN A;  1E0E A;  5CQG A;  4U0Y A;  2HVQ A;  1DGW Y;  5M5X J;  4B4C A;  2FOW A;  5FGM A;  1KU9 A;  5C0X E;  2R7V A;  5DCM A;  5J8F A;  3BY6 A;  5LMU E;  3U9G A;  2R7Z J;  3WGH A;  3PIO F;  4FET A;  3H3Z A;  1K6Y A;  2K7L A;  5DNX A;  3O8G A;  2LRD A;  3DF8 A;  2CGP A;  2XAH A;  5LRR A;  1FBS A;  4MLO A;  1NG6 A;  4AC0 A;  4EV0 A;  4M9X A;  1S7O A;  5D4S A;  1V5E A;  2XAJ A;  5K1Y A;  2DT6 A;  3TP3 A;  4BEH B;  1IV6 A;  3QU6 A;  2Z9O A;  5IT9 Z;  3HGY A;  3ZKD A;  3CDI A;  4GFB A;  2KJC A;  2XB5 A;  3V8K A;  1YH8 A;  2VC0 A;  2X0L A;  4LLL A;  3ZGK A;  3CUO A;  2J65 A;  3H92 A;  2AQE A;  3OMY A;  1R9T J;  2PJP A;  2HPM A;  3PNV A;  1UJ8 A;  2H1L A;  1IN5 A;  3H1C A;  3MVP A;  3R0A A;  2GQ0 A;  3TDZ C;  3AG3 H;  4X64 E;  2EFQ A;  4HF2 A;  5LMU I;  3K1P A;  4Z6Y A;  2NVQ J;  1BIB A;  5F08 A;  2LC2 A;  1FMV A;  1ETQ A;  3KYD B;  5TJJ A;  2VOO A;  2OCE A;  1XMK A;  3PO2 J;  3WHC A;  1TNT A;  2OBP A;  1FBU A;  4QPO A;  4FT8 A;  2L9S A;  2QQA A;  2AJ4 A;  2Z99 A;  1WJE A;  3HPG A;  4II3 A;  1LB2 A;  5DYM A;  1G3T A;  2PLY A;  4KIB A;  4ZVI A;  4WUC A;  2LH9 A;  1W5C C;  5F27 A;  3O2P E;  4I09 A;  2FML A;  2V26 A;  1S3J A;  5IPA A;  1NHH A;  4XID A;  2ZNZ A;  2HQN A;  1RKT A;  2HU9 A;  4OOI A;  3KP5 A;  1RR8 C;  3G1L A;  5BR8 I;  3ZM7 A;  5F1R A;  1QRY A;  4BA2 A;  2IS6 A;  2J5O A;  1GVJ A;  2RVC A;  1FJL A;  1LDJ A;  1YJN I;  4C30 A;  5DRR A;  3E6M A;  1U2R A;  4BA1 A;  2R42 A;  4HNV A;  2H6C A;  2JSC A;  3HTS B;  5JEA B;  4LGW A;  1YIO A;  4FW7 A;  3H9G A;  3CC4 I;  3GFM A;  1G59 A;  1IRZ A;  4OX9 I;  2XC7 A;  1RES A;  4EM0 B;  1Z5A A;  3FM3 A;  4BNC A;  1XMQ E;  1R6L A;  3HRS A;  2I10 A;  2YX4 A;  3ESW B;  5J47 A;  4CHU A;  2IER A;  2RN7 A;  2A2C A;  3CUQ A;  3TP0 A;  5KCM A;  3FHZ A;  4RA2 A;  3IWF A;  2IGK A;  4BY7 J;  2CH0 A;  1ETO A;  4J3D A;  3FWE A;  1J0R A;  2JPB A;  1L0O C;  2KZV A;  5EZG A;  1QPI A;  3LSI A;  3FKJ A;  3GW2 A;  2MLK A;  2PX9 A;  2ZSH B;  3KFW X;  4HEA 2;  4S05 A;  2G7H A;  5EG0 B;  1TP4 A;  2E1M B;  2FMY A;  3P9K A;  1P2F A;  4XN0 A;  4AVZ A;  2HOS A;  2WP8 A;  2H6B A;  2P7V B;  2PMZ A;  3A4C A;  2HDC A;  1N34 E;  4XLC A;  4PJ0 C;  2F4I A;  1Z77 A;  1ORK A;  4WXD A;  4IZK A;  1JGS A;  1FOW A;  3NAU A;  3ZZT A;  3GXO A;  2VUM J;  3G73 A;  1HKQ A;  4RLQ A;  1TNS A;  4KHP I;  1N75 A;  1AA7 A;  4LF7 E;  3K69 A;  1DU0 A;  1GUU A;  3OS2 A;  5FRM A;  1R5I D;  2PJR B;  1ON1 A;  3UHM A;  2DW4 A;  3L1P A;  3B73 A;  3PS2 A;  2V8P A;  2NRA C;  2LMD A;  3W6K B;  1VQ7 I;  2OU2 A;  1B72 B;  2LKP A;  4FIS A;  1X2M A;  2HXO A;  3BR5 A;  4DNC A;  3TBI A;  1X3W B;  2R7S A;  3J7A O;  2HFH A;  2O1W A;  4IOC F;  1VQL I;  1M1E B;  4JI4 E;  1E3P A;  4QLC U;  3F72 A;  3ZMZ A;  2WV0 A;  3IAS 2;  1C0W A;  1UDN A;  1JTY A;  4XRS G;  3OIQ A;  4DPX A;  1H9G A;  4OO1 A;  5FFZ A;  3BOQ A;  4PJN A;  5B1B H;  2K9M A;  4C2T A;  3VPR A;  5M3F J;  1YX3 A;  5D8L B;  4UV8 A;  4E4H A;  1D5Y A;  2R7U A;  2RDP A;  3K0L A;  2DTZ A;  3L2V A;  2DOA A;  2ZJR F;  3OIO A;  2X6X A;  3FXQ A;  1S29 A;  4PJM A;  2FOK A;  1UMQ A;  1R7J A;  4CYD A;  1YHQ I;  2HFU A;  4L5E A;  1MG7 A;  1RKW A;  2UU9 E;  4B48 A;  1BR1 A;  3X2Q H;  4DV3 I;  1RR9 A;  1W7P D;  1QGP A;  3S14 J;  4YFK F;  4X0G A;  1UEL B;  4JI6 I;  2Z5B A;  2LY2 A;  3F9K A;  1UAA A;  1U3E M;  5GP9 A;  3K7A J;  4XLA A;  2OZU A;  1I94 I;  4IPA A;  4RM3 A;  3ZQG A;  1OLT A;  3F8F A;  4XSZ F;  4ZZL A;  1FI4 A;  4MQY A;  5BOX A;  2KMU A;  3QOD A;  2DCE A;  1B59 A;  4CCJ A;  2E1R A;  2FX0 A;  3FXM A;  2COM A;  2CYY A;  1QZZ A;  5AIQ A;  2O3Z A;  4RDU A;  1ZHF A;  3FXK A;  2BA0 D;  4JI8 E;  5A2Q Q;  2VBY A;  1ZRD A;  1WJC A;  5DD8 A;  4X66 I;  3I58 A;  2BXY A;  1HDP A;  2Q8K A;  1ENH A;  3IV5 A;  3GTK J;  5HLI A;  4XRS A;  2OQR A;  5EF6 A;  1FYK A;  1S5L C;  3S2W A;  1Y1V J;  1FTT A;  1FMW A;  1GVD A;  3QT7 A;  3Q0U A;  4LIT A;  2HYF A;  3FK7 A;  1SD6 A;  4DU8 A;  5GAG J;  2L4M A;  2X51 A;  1G8X A;  2OC6 A;  2XRL A;  3HOU J;  1CF7 A;  2FQ4 A;  2J7K A;  3BG3 A;  4BXF A;  5HLT A;  1YQA A;  2X9D A;  4M3G A;  2HTS A;  3GO5 A;  4ZDL A;  1QBJ A;  3QPT A;  4L0Y B;  1X3Z B;  1IJW C;  1I6X A;  4M9S A;  2R3V A;  3K85 A;  1XDU A;  4C3J J;  1RC9 A;  3J81 C;  2KRF A;  3E97 A;  2E1O A;  1HW2 A;  4HY1 A;  4XSX F;  3TO6 A;  2FD5 A;  1B8I B;  1XHK A;  1J7K A;  1J5Y A;  2YS9 A;  1MDM A;  4CA0 A;  3ZQH A;  3W6V A;  1X1C A;  2ZB9 A;  4DOZ A;  2ZXI A;  1NTC A;  2PEX A;  1SMT A;  4XOR A;  4EEF G;  2R7O A;  4S0H B;  2DPD A;  2QSG X;  5J40 A;  4MU4 A;  5DM7 F;  1I3Q J;  2ZNY A;  1HCR A;  2X1D A;  1MND A;  3LSJ A;  4LG0 B;  4A3I J;  1EV7 A;  1KU2 A;  2A61 A;  4GO1 A;  3TGN A;  2WNR A;  4G94 A;  1GHC A;  3RKX A;  3LAJ A;  1BJZ A;  4DU7 A;  1XX5 A;  2EA2 A;  3LMM A;  2LLK A;  5DV5 A;  2LRE A;  1F1Z A;  1XMX A;  4DV4 I;  3HHH A;  1MJA A;  4OO1 E;  3A02 A;  5M5Y J;  3G6E I;  1K47 A;  3P3G A;  3PYG A;  5K36 C;  4WWC A;  4LF6 E;  3E0J B;  3MN2 A;  4A0Z A;  1MJB A;  4U3B A;  3S1R J;  3BR3 A;  3FXL A;  4M6X A;  1KTV A;  3CDJ A;  2WTE A;  1MDM B;  4LMY A;  2K9Q A;  2BW3 A;  3PFY A;  3HRT A;  4KIF A;  1D8K A;  4HX4 A;  1ZYR F;  2RC4 A;  2D1H A;  2WAE A;  4ON0 A;  2BZT A;  4PGH A;  4CDG A;  5F0H A;  3WGI A;  2D45 A;  3FBN B;  4A5N A;  3BQY A;  4OWR B;  4UVA A;  3ZOB A;  5LBQ A;  4P9U A;  3FXO A;  1N32 E;  2HHH I;  2C38 A;  3PRY A;  2CQN A;  3FIS A;  4DPY A;  2DMT A;  1USU A;  2K02 A;  2Y75 A;  1WVR A;  4LCG A;  3PL8 A;  4CCN A;  3EYI A;  3F8B A;  2JEB B;  3SHF A;  2M9H A;  3P7N A;  3WU5 A;  1HR0 E;  5CJ9 A;  2ZBK A;  3VYT B;  1N34 I;  2GIZ A;  4FTH A;  3OOU A;  2ECC A;  5GPC A;  1N77 A;  3WTU C;  4N0B A;  1T08 B;  2CV0 A;  2ZM6 I;  3LQR A;  4DR5 I;  2QQ9 A;  5F6F A;  3HOW J;  1XCV A;  2PMH A;  2JZY A;  3LSM A;  1ZR2 A;  3L9F A;  2IA1 A;  1J75 A;  1VQ5 I;  2C37 B;  4X62 E;  4NXM E;  4ENN A;  3L7Z B;  4ED4 A;  3JRE A;  2V2V A;  1QHH D;  5ILU A;  3S3N A;  4EJO A;  3J81 K;  4PZJ A;  2MYS A;  3PYF A;  1BI0 A;  4O3M A;  3RKY A;  3ZQI A;  4DUZ E;  3H3U A;  2X48 A;  2ZJ2 A;  2NXN B;  3HG9 A;  2V6C A;  3PNY A;  4LIV A;  5AIP A;  3IRR A;  3G3Z A;  3OYJ A;  2QKL B;  3P9C A;  4I0A A;  3GZ6 A;  1HSJ A;  1G2H A;  3TMO A;  4E7K A;  3GME A;  3I4P A;  3V8J A;  2P6T A;  1D3Y A;  2E1C A;  3HHG A;  1TWG J;  5EZH A;  1NK3 P;  4D5C A;  5KVR A;  1RHY A;  1JUS A;  4EJT A;  4JBA A;  4P7A A;  1OYY A;  2XKO A;  2NS8 A;  2JT2 A;  2ZBK B;  3J7A M;  4CUG A;  3PUB A;  2XGX A;  2Z5C B;  3SEZ A;  3RPU D;  3ELK A;  5L3J A;  1RIO H;  2LF8 A;  2M4K A;  4CCL A;  1TT0 A;  1OCC H;  2BYV E;  2EIJ H;  2HTJ A;  4AIJ A;  4ASN A;  1DUX C;  1ACI A;  1IBL E;  2DK5 A;  3QQA A;  2CG4 A;  1VZ0 A;  2JQ7 A;  1LDK B;  4LPF A;  4EVI A;  3J7A Y;  2P4W A;  2QWW A;  3M7N G;  4HX7 A;  3DTE A;  4BHP A;  2QSF X;  3IHU A;  3L2Q A;  2EH3 A;  4Q47 A;  5FLX C;  4OO1 D;  4OKG A;  1LFU P;  5LMN I;  3JW4 A;  2XRO A;  4X65 E;  4BU2 A;  4W1U A;  2CWE A;  5LL6 R;  4A69 C;  2TRT A;  1XPX A;  3SDB A;  1Z7U A;  1B4A A;  3DKX A;  3DTK A;  4E6K G;  3MD2 A;  1IDZ A;  2BM0 A;  4NXN I;  4PRV A;  4QNK A;  2HVS A;  1WCM J;  2ID6 A;  4B3M E;  4XKB A;  1RUN A;  3V5R A;  5AON A;  5ILV A;  1PIE A;  4DQ2 A;  5HS7 A;  4XIC A;  2QBY B;  5HLH A;  4DV6 E;  5E3N A;  4DR3 I;  1ETX A;  2M30 A;  2XB0 X;  3L2W A;  1D6T A;  4ESB A;  1W36 C;  4B3S I;  2HXI A;  2W00 A;  4D0P A;  3RCO A;  1SEU A;  2TCT A;  1AHD P;  5E3O A;  2NN6 E;  4MU3 A;  1NHJ A;  2R92 J;  2WAQ N;  2DA2 A;  4IRH A;  3ZQC A;  3RPU A;  2BBY A;  1Y6I A;  4OAZ A;  1KGS A;  2QKM B;  1P4W A;  2MBF A;  5GME A;  5LLQ A;  3HM5 A;  3ISP A;  1FYM A;  1X1P A;  3VFZ A;  2DQL A;  1YW7 A;  3OYE A;  4B3R E;  1X19 A;  3BCA A;  4HW0 A;  3MKW B;  1YI2 I;  3CCU I;  4X1E A;  4FE7 A;  2M1B A;  3E3V A;  3FXJ A;  2OD5 A;  2NNN A;  4KN4 X;  4Q5S F;  1YO5 C;  2FNA A;  3TW7 A;  2ZME B;  1QPM A;  2I8D A;  2QBY A;  4YFN F;  1KIJ A;  4V19 K;  3U1Y A;  3I56 I;  1Z3Y A;  1ZAO A;  3H5R A;  1GXP A;  1OJ4 A;  1ONV A;  1LUJ B;  2HQ5 A;  3NWT A;  4I7H A;  1TWA J;  3BDD A;  4I98 B;  1VND A;  3T8R A;  2KZG A;  2VQE E;  4K2E A;  3KP4 A;  3V7S A;  2EIK H;  1TBX A;  4I99 C;  3L2R A;  4KA4 A;  1FTZ A;  5K36 F;  4ANJ A;  3JRA A;  4J19 A;  4R79 A;  4DIQ A;  3OYD A;  1WRJ A;  2NAZ A;  3WGG A;  4H4K C;  2R5Y A;  3B8H A;  5LGU A;  2KHM A;  1D1B A;  2F6C A;  5EG0 A;  3Q6M A;  1R6M A;  1ZN2 A;  1F36 A;  1MNM C;  4L18 B;  2CQ7 A;  2ZC2 A;  3DXJ F;  4JI7 I;  2BE5 F;  3B02 A;  2ELJ A;  2CW7 A;  4WF2 A;  1YJW I;  2VES A;  1MGT A;  3F0N A;  4UTG A;  4AIM A;  1LFB A;  2IA2 A;  2ISY A;  4URL A;  2HOA A;  1X2N A;  3H5N A;  1QNT A;  1U9N A;  3O3K A;  5ICF A;  3HRU A;  1EA3 A;  1NHA A;  2JA6 J;  2JUG A;  3RYR A;  5HLG A;  4YHH I;  2G7U A;  1QZY A;  3TDU C;  1T0F A;  1Z05 A;  4RGS A;  2E5L I;  2E7W A;  2L7F P;  1IXR C;  2Y69 H;  2XAS A;  3CP2 A;  3QYE A;  5CLS A;  4ZZD A;  5L3F A;  5JEA F;  6PAX A;  2F4O B;  2K4J A;  4GYI A;  3BJA A;  3KEY A;  3A0B C;  4GKJ E;  1HNX E;  1A6F A;  2W82 A;  3WTZ A;  2R0Q C;  4PK4 A;  1R49 A;  3H9Q A;  4JI5 E;  4PFO A;  4Y3O A;  3Q9S A;  1YS7 A;  1Z9C A;  5BQT A;  2Y0M A;  1GT0 C;  5GMD A;  1FOX A;  2NVT J;  3OYF A;  3I4M J;  2DEI A;  1U5T A;  1WH7 A;  3E6B A;  4IHT A;  4AWX B;  4PDK A;  3LSK A;  5C44 J;  2IS4 A;  4YY3 I;  4B3T I;  4XKW A;  5CVU A;  2CUF A;  1ZG1 A;  4LFC E;  3BZK A;  4GQU A;  2E34 A;  2Z33 A;  3G2B A;  5JVT A;  2CQX A;  2HS5 A;  2DDB A;  1H73 A;  4DV7 E;  1G3Y A;  4G12 A;  5F0F A;  1JJ8 C;  4X66 E;  3RJP A;  2CMP A;  4PSX A;  1IBK E;  1Y8Q B;  3DLA A;  1WI3 A;  4MDT A;  4X65 I;  2QQ8 A;  4F52 A;  2KP6 A;  2KFD A;  2LY9 A;  3CF2 A;  4KIG A;  3S17 J;  4HQM A;  2E19 A;  1LEA A;  4M3E A;  1ZM4 A;  2JK3 A;  3P9I A;  3J7A G;  5B66 C;  2VE9 A;  2BY2 A;  3K4N A;  4XBF A;  2PQ8 A;  4ZH4 F;  5IT9 Q;  1WSU A;  1N33 E;  4LOC A;  1IZ1 A;  4E7Z A;  1LKX A;  2K3P A;  3CCM I;  5FKK A;  3K4B A;  4YY3 E;  1FNN A;  4ZC3 A;  4EGY A;  3FZV A;  1YIT I;  4EMS A;  4A12 A;  2O1V A;  2EFO A;  3HSR A;  4A0X A;  3D1N I;  3LNQ A;  4M6Y A;  4YHH E;  2O8X A;  4DR4 I;  5D8K B;  2W4S A;  2JEA A;  1RET A;  1VTN C;  4KHP E;  4L5J A;  3M8J A;  4UB6 C;  5L3B A;  2AQF A;  3U1K A;  4DV5 E;  3BLY A;  4U0V A;  1PUE E;  4IL6 C;  3PFI A;  3S2D J;  3LSP A;  2CW0 F;  1KVK A;  1T98 A;  4QNJ A;  1JKO C;  1WJB A;  2KT0 A;  2X6Y A;  1FJG E;  4U87 A;  2JEB A;  4MQV A;  2Z2S B;  2FBH A;  2UUA E;  1V5F A;  3C2G A;  5FRN A;  3ABT A;  3M3Y J;  3QPL A;  2UXC E;  5DCF A;  3W2W A;  4JX4 A;  2FXA A;  3K4J A;  3RQI A;  3ZQ7 A;  4DW6 A;  2KIS A;  2ZJQ F;  2HKE A;  3SXY A;  2CQQ A;  2KLO A;  2VQL A;  2OCC H;  3JTG A;  3CCY A;  2R5Z A;  2ESN A;  1ON2 A;  2P7C B;  3S1M J;  4MFD A;  1X58 A;  4L0Z B;  5ERI A;  2OAZ A;  4DV7 I;  2CG9 A;  1TC3 C;  3A0H C;  4A3K J;  4KFC A;  3PJR A;  3F22 A;  2EK5 A;  4UXN A;  2AO9 A;  2M7B A;  1KA8 A;  3RKW A;  4H0E A;  2H27 A;  3HYI A;  2V1X A;  2ID3 A;  2WAD A;  2RQQ A;  1W5T A;  2VQF E;  2V1N A;  2XSD C;  2H1K A;  4IO9 F;  1OCT C;  5GAH J;  3ZPL A;  4G9Y A;  3GON A;  3BZ6 A;  1Z0X A;  3HJE A;  3KCC A;  3CQZ J;  3F3X A;  4LFB E;  3BP8 A;  4PGG A;  2BY1 A;  3KZY A;  4DR2 I;  4USK A;  2YU9 J;  1XGS A;  1G3S A;  3CME I;  1Y5Y A;  1SAU A;  5LEK A;  5F64 A;  2KIU A;  1Z91 A;  1P9Q C;  2MA3 A;  2W1O A;  2W84 A;  2Y0S A;  1BL0 A;  1BI1 A;  3ECO A;  2Z5C A;  2E2I J;  1ZGJ A;  2CFX A;  4DV2 E;  2MC3 A;  3J81 Z;  2HKO A;  1TQP A;  3RQ4 A;  3CDL A;  2FBI A;  4RAY A;  2BHY A;  1MMN A;  4BY1 J;  3J81 Q;  2EZL A;  5FO5 A;  2IT0 A;  4P52 A;  1WQ2 A;  3JTH A;  3L09 A;  5DUK A;  2LDU A;  4BKX A;  4OZE A;  2K9L A;  4FW6 A;  2QVO A;  2J5P A;  1Z1D A;  1TWH J;  2BW3 B;  4FW4 A;  4RB1 A;  5DTD A;  2JN6 A;  2HOE A;  4OO1 C;  2JJ7 A;  4ABZ A;  5LD2 C;  4DR7 E;  5A2Q Z;  1MBK A;  5IOZ A;  5EKW A;  4FN5 A;  3AL0 B;  4MYT A;  4DZJ A;  4LFA I;  4XOP A;  3HUL A;  3I4N J;  4B1R A;  4IOA F;  2CFO A;  2JUC A;  3FMS A;  3CMM A;  2DYR H;  1E3H A;  2R7F A;  2M2E A;  1ZG5 A;  3WE2 A;  5B5E C;  3V8L A;  4AM3 A;  1HA8 A;  4DJA A;  4LF4 E;  2WWY A;  4UNO A;  5H6Q A;  4L9V A;  4Y52 J;  5FKL A;  5FRO A;  1P92 A;  4RBO A;  4KDP A;  1Z21 A;  4BGD A;  4HSR A;  4BQN A;  4F3Q A;  2IES A;  1U5T C;  4HA8 A;  5EYR A;  4LF5 E;  3RI4 A;  2GO4 A;  3P3E A;  1APL C;  3AKZ A;  3KIO A;  3LSH A;  2UXD E;  3MZ8 A;  2FSW A;  3K2Z A;  3GF2 A;  3G1M A;  4Z7Y A;  4G7O F;  1PKP A;  1HNZ E;  3KEQ A;  5E8G A;  4QTR A;  1U0J A;  2QLZ A;  5FLX Z;  1KQ9 A;  5LHG A;  1MIJ A;  2MAB A;  3OOP A;  4DGW B;  4LF9 I;  1T8I A;  4LFB I;  2HVR A;  2MLG A;  4P55 A;  2FU4 A;  4R1H A;  1QU3 A;  2VKV A;  5TIS C;  1DU6 A;  2L0K A;  4EAT A;  4XLP F;  1LVA A;  4F92 B;  3JAM C;  3JAM Q;  1YRN A;  2B9S A;  3HBL A;  5IWA E;  1OQY A;  2LBF A;  4BQO A;  2O03 A;  2DQR A;  4OMY A;  2VLA A;  1EJ9 A;  1BA5 A;  3ABU A;  4LFC I;  3OTO E;  2O1U A;  2JVG A;  4HST A;  1ZLK A;  4DR6 E;  4FCY A;  2ACJ A;  2JA8 J;  3FF5 A;  2UUZ A;  4BXU A;  2JRM A;  1ZTR A;  2Q1Z B;  2UUC E;  5C3E J;  1HBX G;  5E79 C;  2DOE A;  1I50 J;  1JHF A;  1MKM A;  1IBK I;  2CU7 A;  3BPV A;  3CP8 A;  1LPQ A;  1RUO A;  3NRV A;  1KQ8 A;  4XLH A;  3FM5 A;  2HDW A;  1FBQ A;  1W36 D;  4E7S A;  1Z0T A;  4LF4 I;  2RAE A;  3DPL C;  1Q1V A;  4GKK I;  2F2E A;  4OO1 B;  2OQG A;  1EH6 A;  2NS7 A;  3CDH A;  1YE9 A;  2C6Y A;  1MSE C;  5FWK A;  2PNM A;  1Z59 A;  5CVI A;  4BHC A;  1O7F A;  3HSF A;  3I59 B;  4RM2 A;  1YLF A;  2WAQ A;  4JQF A;  4YIR X;  4FWH A;  1U6G A;  1I5Z A;  4PSW A;  3ASO H;  3M7G A;  2IOQ A;  3SZG A;  4XL9 A;  3HZJ A;  2HDD A;  2XKP A;  3S1Q J;  4HYM A;  2LG4 A;  3LFU A;  3VYS B;  1J9I A;  1U8R A;  3EUH A;  3HEF A;  3ZMT A;  4JI0 I;  2DLL A;  3R60 A;  3C3W A;  2HFS A;  3COA C;  4Y4R A;  4ESJ A;  3UNG C;  4D1Q A;  1YW8 A;  4DYC A;  4XR6 A;  2TDX A;  4L9N A;  4DV2 I;  1B62 A;  1JTX A;  1P42 A;  2MW8 A;  1BC7 C;  1Z6R A;  4B3X A;  1KON A;  4IRG A;  4PU9 A;  4ZTF A;  2JVH A;  3JAM Z;  4E70 A;  5J3L A;  3WTW C;  2VJI A;  1Z67 A;  3T1B A;  2RGV A;  2WB1 A;  4F93 B;  5FLX K;  2LD5 A;  3QRF F;  2M8G X;  2AXT C;  3GX4 X;  4E7I A;  1Z5C A;  1TWF J;  4PUS A;  2R3S A;  1LE8 A;  2EZI A;  4A3E J;  2O5R A;  5FB2 A;  5HOD A;  1VQO I;  2K4B A;  2V1U A;  1DQU A;  1N36 I;  1FX7 A;  2DMP A;  2KJB A;  1MNE A;  3CCQ I;  3CC7 I;  4Q4Z F;  2M0M A;  4M3D A;  4BYY A;  4CZC A;  5KAI C;  1RRE A;  5DDG A;  3ZQQ A;  1OCR H;  1ETW A;  2Z3Y A;  5HVQ C;  1K4S A;  4M3B A;  1VI7 A;  2XHK A;  2DFF A;  4UB8 C;  2VOP A;  3T5X A;  2YX7 A;  5C0X F;  3IUO A;  3MAJ A;  4S04 A;  4C3H J;  4MO7 A;  4CCO A;  3LSR A;  1AOY A;  1ZK8 A;  4G6T B;  4Y33 A;  4LF5 I;  4V2G A;  1Y1W J;  2W25 A;  3FBI B;  3I3L A;  2K86 A;  3EET A;  4XMY A;  3WG7 H;  1IC8 A;  1AKH B;  2AHQ A;  2NN6 C;  3K17 A;  1O57 A;  2UXD I;  1ULY A;  2ME0 A;  5LRS A;  5EEH A;  3Q9V A;  4DV0 I;  2L4A A;  4Z7C A;  2G9W A;  4HRI A;  2V2Z A;  2ME6 A;  2YUS A;  1S7E A;  1GXQ A;  1JXS A;  3IP4 B;  4MU1 A;  2F5F A;  2LYC A;  3PQK A;  1T95 A;  4IFD E;  2Z5E A;  3IAM 2;  3QP5 A;  3FXR A;  5B1A H;  4IEJ A;  1WKM A;  2MC4 A;  2BM1 A;  5C0X D;  1K83 J;  3JRD A;  1IN7 A;  2DA3 A;  2VXD A;  2VBW A;  4ENJ A;  5IWA I;  2R7R A;  3AG4 H;  2OUM A;  3OTO I;  5GTH C;  3BWG A;  2DMQ A;  4UV9 A;  4UHT A;  2EBI A;  4DYQ A;  3D4J A;  4LK1 F;  4OMZ A;  3VWB A;  4IF4 A;  2UUC I;  4J01 A;  1B63 A;  1IUF A;  1D1A A;  3CCJ I;  2UV1 A;  3Q3S A;  4RB0 A;  3D5R C;  1ZM3 A;  4KUM A;  3ZMU A;  1CGP A;  3UR3 C;  4BS9 A;  1JUP A;  3AL0 C;  2EFW A;  2IW5 A;  2E2J J;  2E1N A;  2ETH A;  2XRN A;  4R8H A;  1X4P A;  5L3D A;  5DM6 F;  2R5Y B;  2EFN A;  4XNF A;  4DR1 I;  1FSE A;  3QT5 A;  4KJZ A;  3ABK H;  1KZH A;  2C39 B;  2ELK A;  3JRC A;  2M87 A;  4QWQ A;  3E5U A;  3B4T A;  4EM1 A;  2V6E A;  2X4H A;  2Z16 A;  5B3S H;  2EZK A;  2VKE A;  4B3T E;  4C2M J;  2P5V A;  3IH4 A;  2V9P A;  4WK8 F;  3CC2 I;  1IRF A;  1ERD A;  5H6R A;  5ICC A;  1Y6Z A;  2HYG D;  1JKP C;  2JE6 B;  1YJ9 I;  3KE2 A;  2BA1 G;  3E5X A;  3WTV C;  1QVU A;  2HK3 A;  3SYT A;  1XGN A;  3M9A A;  1A36 A;  2HQA A;  2JSP A;  2F48 A;  2H8R A;  4GKJ I;  3TED A;  1WJF A;  3CES A;  3R0J A;  2DI3 A;  2GZW A;  4NQW B;  4U0W A;  4ZJZ A;  3KET A;  3RKQ A;  5EGO B;  2VF3 A;  5IOY A;  1VQN I;  2PMZ N;  3CMA I;  5ILS A;  2STT A;  4M6V A;  2EJR A;  2PO1 B;  5F0C A;  4WUB A;  3JSO A;  2NVU B;  4KIS A;  3A03 A;  5HOO A;  1R22 A;  1OYW A;  2E5N A;  5C0X B;  3C2B A;  1IUY A;  3AAF A;  3T0Y A;  4B3S E;  2A69 F;  3OYK A;  3BTC A;  1EA6 A;  1ZQ3 P;  4DBQ A;  1R1V A;  4PJJ A;  2JT1 A;  2CGE A;  5LEJ A;  4R1F A;  3KZZ A;  5E1W A;  2CV1 A;  1O3Q A;  4ZDO A;  1V55 H;  4HAC B;  3K4M A;  3ABL H;  2E1M C;  3I64 A;  3BG5 A;  2W57 A;  3GTG J;  4B3R I;  4KNY A;  1OR7 A;  3PQJ A;  1F5T A;  1UDO A;  2KIM A;  2DEJ A;  3PS3 A;  4DR5 E;  5D6F A;  1T33 A;  1WJD A;  4X6A J;  2D1V A;  2FJ1 A;  3U21 A;  1N78 A;  1WJ5 A;  3GTL J;  2NN6 A;  1I27 A;  2O8K A;  2LSO A;  4CO8 A;  3KYL A;  1AWC A;  5EDN A;  3QT8 A;  3C2H A;  4ENM A;  2HPI A;  1XS9 A;  3OSG A;  3AG1 H;  3ULQ B;  5K36 A;  3GFI A;  5IP9 J;  3CJN A;  5K36 D;  2VT3 A;  3B6A A;  3BG7 A;  4M9Z A;  5CKT A;  2NVY J;  3ZZ0 A;  1SD5 A;  4JI3 I;  1I39 A;  1A6I A;  1YW9 A;  2DYS H;  3WOD F;  2UXB E;  1D0Y A;  3LWF A;  2PNZ A;  2R7T A;  1P7J A;  3LA3 A;  3KP6 A;  4C9Y A;  3QT6 A;  2CQK A;  2OPT A;  2XGD A;  4ZTJ A;  3DKW A;  5CPR B;  1UEK A;  3BZC A;  5CVR A;  2F4V E;  2DN0 A;  2DAO A;  2X1E A;  1N0V C;  2KPM A;  2A2D A;  3V7R A;  1OIS A;  1XCB A;  2O6G E;  4JI7 E;  3GZN B;  3QOP A;  2A6E F;  2BVL A;  4OIQ F;  2F5C A;  2L02 A;  4HF1 A;  3K9T A;  1T6S A;  4LF7 I;  3ZMS A;  2YU3 A;  3ZMD A;  2ZJP F;  5D5U B;  1ITY A;  4MIM A;  4B8X A;  2W7N A;  2HYJ A;  4LF8 I;  2VB6 A;  1YIJ I;  2F1D A;  1KYW A;  1S6L A;  2A3S A;  3OS0 A;  1R1T A;  3QU3 A;  2A05 A;  4QSH A;  3LQQ A;  4MTE A;  2A5Y B;  2Y48 A;  3ZMV A;  4EQQ A;  3EUH C;  3F21 A;  2QEX I;  4LFA E;  2Q2E B;  4A6D A;  4QPQ A;  2X6O A;  2V9V A;  2FBK A;  3W3C A;  2DT5 A;  2WY8 Q;  3BJO A;  5GPA A;  1TW2 A;  2MH2 A;  4HOB A;  5IYC J;  4DV6 I;  2Y9Y A;  2M4G A;  1USV A;  2WV1 A;  2EIM H;  4RGU A;  4ZYH A;  1BKN A;  2E7X A;  2XF7 A;  1IV8 A;  1XG1 A;  2NNY A;  1HC8 A;  3VSL A;  1HLV A;  1I6H J;  2HWV A;  3VOD A;  5IYD J;  2R93 J;  1KYZ A;  5FLV A;  3WE3 A;  2QGU A;  4B09 A;  2PG4 A;  3TOA A;  4C2U A;  3F0C A;  2HKJ A;  1SMY F;  1LE8 B;  2XPW A;  4RMN A;  5JR3 A;  1R58 A;  2CO5 A;  5IT3 A;  1R23 A;  3MZH A;  4IS9 A;  1ZG3 A;  1Z3X A;  3BG6 A;  4K0K E;  3I0T A;  4KMU X;  4ZDP A;  5FD6 A;  5K7F A;  4ESF A;  1GV5 A;  2EQR A;  2V9K A;  4HBL A;  4M3F A;  1IF1 A;  3V42 A;  3K10 A;  1H72 C;  3ZKB A;  3CUQ C;  1GV2 A;  1MH3 A;  4BAC A;  1FIA A;  2KQR A;  2IOP A;  1PVE A;  4E7H A;  3ZQF A;  1EKE A;  3VDX A;  3T1Y I;  3CJT B;  1L3L A;  3LST A;  1SAN A;  4L9T A;  4OX9 E;  3HOS A;  4NDL A;  3CO7 C;  2CV2 A;  3FIW A;  2VAS A;  1R1U A;  2W24 A;  2GO3 A;  3M85 G;  3R61 A;  4HNT A;  1MD0 A;  4HAM A; 
#chains in the Genus database with same CATH homology
 1R6L A;  5C0X D;  2WP8 B;  5K36 A;  3H36 A;  5K36 D;  4OO1 B;  3GCM A;  5JEA F;  4IFD D;  2BR2 A;  2PNZ A;  2WP8 A;  4AID A;  5JEA C;  3M7N G;  2PO0 B;  2C39 A;  2NN6 D;  4OO1 D;  2PO1 A;  2PNZ B;  5C0X E;  2BA1 D;  5C0X C;  2C39 B;  2BA0 G;  5JEA A;  3B4T A;  2WNR A;  4OO1 C;  5JEA D;  4IFD F;  4IFD B;  2NN6 B;  3DD6 A;  1UDQ A;  4OO1 E;  2JE6 B;  2NN6 E;  2BA1 G;  2JEA B;  2NN6 F;  5K36 C;  1E3H A;  1OYR A;  1E3P A;  3CDI A;  4AM3 A;  1UDN A;  4BA1 B;  4OO1 A;  1UDS A;  2BR2 B;  3CDJ A;  3H1C A;  5K36 E;  2C37 A;  5C0X A;  2JE6 A;  3L7Z A;  2PO0 A;  2PO2 B;  4IFD A;  5K36 B;  2C38 A;  4BA2 B;  2PO1 B;  4OO1 F;  1OYP A;  2JEA A;  4NBQ A;  2JEB B;  5C0X B;  5C0X F;  3U1K A;  3HKM A;  1WHU A;  2C38 B;  2WNR B;  3M85 D;  2C37 B;  2NN6 C;  5K36 F;  3L7Z B;  2JEB A;  4BA2 A;  5JEA E;  4IFD C;  2BA0 D;  4BA1 A;  1R6M A;  4IFD E;  1UDO A;  3GLL A;  2PO2 A;  5JEA B;  2NN6 A;  3M85 G;  1OYS A;  4AIM A;  3GME A;  3KRN A;  3M7N D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...