3GLLA

Crystal structure of polynucleotide phosphorylase (pnpase) core
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
544
structure length
494
Chain Sequence
b'LNPIVRKFQYGQHTVTLETGMMARQATAAVMVSMDDTAVFVTVVGQKKAKPGQDFFPLTVNYQERTYAAGRIPGSFFGRPSEGETLIARLIDRIRPLFPEGFVNEVQVIATVVSVNPQVNPDIVAMIGASAALSLSGIPFNGPIGAARVGYINDQYVLNPTQDELKESKLDLVVAGTEAAVLMVESEAELLSEDQMLGAVVFGHEQQQVVIQNINELVKEAGKPRWDWQPEPVAYRITDKQERYAQVDVIKHAIEKNVVRSRVLAGEPRIDGREKDMIRGLDVRTGVLPRTHGSALFTRGETQALVTATLGTARDAQVLDELMGERTDTFLFHYNFPPYSVGETGMVRREIGHGRLAKRGVLAVMPDMDKFPYTVRVVSEITESNGSSSMASVCGASLALMDAGVPIKAAVAGIAMGLVKEGDNYVVLSDILGEDHLGDMDFKVAGSRDGISALQMDIKIEGITKEIMQVALNQAKGARLHILGVMEQAINAPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polyribonucleotide nucleotidyltransferase
publication title Crystal structure of Escherichia coli polynucleotide phosphorylase core bound to RNase E, RNA and manganese: implications for catalytic mechanism and RNA degradosome assembly.
pubmed doi rcsb
molecule tags Transferase
total genus 128
structure length 494
sequence length 544
ec nomenclature ec 2.7.7.8: Polyribonucleotide nucleotidyltransferase.
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
A PF03726 PNPase Polyribonucleotide nucleotidyltransferase, RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.400 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Polyribonucleotide nucleotidyltransferase, RNA-binding domain 3gllA02
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 3gllA03
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 3gllA01
3DD6A 4OO1E 2BA0D 4BA2A 5C0XB 4IFDE 2PO2B 2BA1D 2C38A 4OO1C 3H36A 5K36A 5K36F 2PO0A 2NN6E 4AIDA 5C0XF 4OO1D 5K36B 3M85G 2JEBA 4IFDD 2PO0B 4IFDB 3B4TA 2C39A 1WHUA 3CDIA 2NN6D 1E3PA 2JE6A 2WP8A 1R6MA 2BA0G 1UDOA 4OO1A 2JEBB 5JEAE 3GMEA 4IFDA 4OO1F 1OYRA 2NN6B 4BA1A 3M7ND 4IFDF 2C39B 5JEAC 5C0XC 2JE6B 3H1CA 2WP8B 3L7ZA 2WNRA 2NN6A 2JEAA 1UDQA 2C37A 4OO1B 2NN6F 1OYPA 4BA1B 5K36E 5JEAD 4AIMA 4NBQA 5C0XE 2PNZB 3L7ZB 2WNRB 2JEAB 2BA1G 2C37B 2PO1A 5K36C 5JEAB 2BR2B 3GCMA 3CDJA 1E3HA 3GLLA 2PNZA 1R6LA 3M85D 4IFDC 3HKMA 5JEAA 5C0XA 2BR2A 2PO2A 1OYSA 1UDSA 4AM3A 3M7NG 5JEAF 2PO1B 4BA2B 3KRNA 5K36D 3U1KA 5C0XD 1UDNA 2C38B 2NN6C
chains in the Genus database with same CATH superfamily
3BY6A 4MEXF 3DD6A 2ESNA 1P4WA 4IRGA 4M72A 3PS1A 4DR6I 2EBIA 3ZMSA 3JAMK 1BJAA 2FEZA 1K4SA 3JRAA 2HKJA 3F8CA 4GKJE 2O9LA 1XC5A 4X64E 4U0WA 2JMWA 3SFIA 3GFLA 2UWMA 5H6RA 2ZNZA 3RYRA 1K4TA 2Y69H 5JVGF 1SFUA 1FYLA 3AFHA 2M7AA 4URLA 2WWYA 4PU9A 3QPSA 3I0TA 4KIGA 1BC8C 3A4CA 3EUHA 4WXCA 4ON0A 1RREA 4JI6E 3I9V2 5J4YA 4LB6B 4L5EA 3BCBA 4OO1D 4OU0A 5KK1A 2NRAC 4HOBA 2R7TA 1PIEA 1YH8A 2W24A 3FDYA 3WGHA 5HLHA 4IFDD 1UHWA 2DJNA 4ZZLA 4IRHA 5JVTA 1I50J 2DCEA 4BHBA 1MSEC 5LMNI 3G1LA 1QZZA 1UELB 3GFMA 4NDLA 4A6DA 3QYEA 5M3FJ 3GW2A 4JI5I 3GF2A 1ETYA 3T5XA 4XRSG 2NN6D 1VQ8I 2VQLA 3KEYA 3SXYA 2CFXA 5E17F 4B3TI 2OTLI 1LNWA 2CH0A 1FBUA 1QVTA 3MKZA 4KT6A 1F36A 4DYCA 1R6RA 2VIXA 4BJ5C 4BA1A 3KYCB 3WHBA 2QA4I 1Z77A 4M73A 2AE8A 5FFZA 3HRMA 2V9KA 3M4OJ 1OCZH 2XKPA 2Z5CB 3H35A 4XRMA 4DPWA 2A6HF 3QOEA 2DMPA 3RI4A 1U3EM 1TQMA 1LB2A 1IXCA 4M3FA 2LKXA 1OCPA 2DYSH 3I71A 2L9SA 2ZBKA 5FKMA 2IJLA 4XLAA 1TWGJ 1HSJA 4UT4A 1M1EB 4LK1F 1N0VC 1ETKA 1N34E 1A6IA 4P52A 1UJ8A 1D3YA 1PJRA 4AQYE 3CCJI 2X6OA 2VN2A 1PUEE 1Z67A 3K4LA 2PO1A 1XSVA 3IC7A 2BVLA 3G73A 4DR7E 4YFXF 1SC7A 1BR4A 2ZM6E 5IP7J 4MTDA 1K7AA 3IHUA 1S3JA 2NNNA 3W6JB 3RZDJ 3DPLC 1JTXA 4BKXA 2HDCA 1VQ6I 3R0JA 1HW1A 3HKMA 4DV1E 3BTIA 5DROA 3M7NG 4RLFA 4EJUA 1VNDA 4BA2B 4KHPE 1H8AC 4HF1A 1XDUA 2LBFB 4V2GA 3QPLA 3PIOF 4M3BA 1UDNA 4B3SE 1TBXA 1YFHA 1IXSB 3IAM2 1ZKGA 3REOA 3GZ5A 3ZOBA 2EFGA 5ED4A 2KIFA 4JI7I 2P4WA 4HX7A 5AIPA 2GXBA 1R22A 2HXOA 4IQ4A 1FBQA 4QSHA 4PFPA 4KFCA 2PMZA 4KDPA 4G12A 4XNFA 4BNCA 4JG4A 2OV7A 4PJMA 2V9VA 5ILVA 2ACJA 2O7OA 4PUSA 2PMHA 3JAMZ 4BDYA 3HRUA 5BOXA 2LSOA 2PO0A 1MNEA 4LJZF 5BR8I 3P9KA 3ECOA 2F5DA 2Z33A 1V55H 2F5EA 3S16J 2ISYA 4IZKA 3PSFA 3CO7C 1T6SA 1LJ9A 1U9NA 3ZGKA 4QIWN 1SFOJ 1IAWA 3RKXA 1N33E 5LD2C 3QRFF 2O1TA 1P2FA 2Q1ZB 1YX3A 1Z0WA 1ZTRA 2MLGA 2DFIA 5EL9A 1XD7A 2QKMB 2W85A 3OYIA 2LNBA 3NAUA 5EEGA 2UXBE 5ILSA 2VASA 1IN6A 3P06A 4GKKE 1R36A 1VQMI 1FIAA 1ERDA 1FIPA 3VYSB 4XKWA 3HHHA 1YJNI 2ID3A 1E3PA 4QLCU 4E7JA 3LSIA 3RKQA 4K2EA 3PNTA 2R5YB 2VQFI 5E1ZB 1OJLA 5J1UA 1LDKB 2BY2A 5IP9J 1ZM2A 2CVEA 2XGEA 5CVRA 4OX9E 4X65I 3QODA 3V4GA 2GLOA 1VTNC 3HSEA 1XDSA 4B3MI 2MYSA 1ZRCA 5JEAC 4HV6A 1YRNA 4DR4I 1IBKE 1ZHFA 2KMUA 4G6QA 1K6YA 4ZDLA 5B66C 5DRPA 1T2KA 3VDXA 1ZRFA 5J1YA 4UB8C 4XSXF 2ECBA 4JX4A 2IEKA 4PCQA 5JR3A 4UY8I 3MZHA 4IO9F 1B9MA 2A6TA 4Y17A 5CYVA 4JBAA 3K1PA 3TGNA 4A5NA 2Z5CA 4HG2A 4QNJA 1E17A 2HEOA 2MH2A 4KA4A 4GDFA 2VQEI 3LTOA 2KP6A 2W1OA 3KCCA 3ERMA 2H94A 5FJ8J 4XQFA 3DV8A 1H72C 1IJWC 2IA2A 1MNMC 2BM1A 2F5VA 3OYGA 3GZ6A 4XORA 2XPWA 3TMOA 1NTCA 1FPQA 1WQ2A 1MBKA 2MD5A 4LK0F 1H9TA 2BR2B 2NVQJ 1P42A 1XMKA 2L7FP 4DZPA 1ZGJA 3E6BA 2R0QC 2E1RA 3SJMA 4LFBI 1Z0VA 3S3NA 5IWAI 3M85D 3P7NA 2FSWA 4DXLA 1SMTA 1W4MA 5GAHJ 2XB5A 3RKYA 4YEJA 1KQ0A 5JEAF 4Y13A 3KRNA 4I2OA 4A3JJ 3GTGJ 4MQYA 2VB6A 3OSGA 3L09A 1BR1A 2QVOA 4EVIA 3VYUB 5GAGJ 1IUFA 2R7QA 3ASNH 1Y60A 4RAFA 1QGPA 2L4AA 1YTYA 2PX9A 4BA2A 2H1KA 3S1MJ 1POGA 2IS2A 2LBFA 4F92B 4XLEA 4E70A 2KIQA 2Z16A 1USTA 5FLXC 3G6EI 2HFSA 1SEUA 1G6NA 2E35A 3CCEI 5DUKA 5CVIA 3LSTA 2UUAE 2HOTA 3LWFA 1QRYA 2FF4A 2CW0F 4J19A 3GTPJ 1SAXA 3ERED 2WAQA 2HVRA 2K40A 4RGSA 4P96A 3ISPA 3MQ0A 3VFZA 5M3MJ 3D5SC 4LLNA 3BR6A 5E18F 1MMAA 2YR2A 1Z5AA 1BKNA 1K79A 2UUZA 3ZQGA 1S8NA 2E2HJ 3PO2J 3P9IA 5BMZA 3J7AO 2JEBA 5J4VA 1HKSA 1KQ8A 4FW5A 3CCRI 1B9NA 2DA3A 3HOUJ 5CQEA 5CKTA 5D6EA 2AO9A 5E3NA 4X62I 1JI8A 1W5SA 2KISA 2HQAA 2R7XA 4ZYEA 3FXLA 4RA2A 4MHGA 3HKZN 1K61A 3WU5A 1U2WA 4PRVA 5JFRA 4A3FJ 4DV7E 5GPCA 1BI3A 1MX0A 1S9HA 2GQ0A 3K4MA 2DW4A 5DM7F 2ZSHB 2F2EA 4G9YA 1VZ0A 1OQYA 3JRBA 2FNPA 1MBEA 1ON1A 4UUTA 4D7NA 3H0DA 2R5YA 2HWVA 1R23A 2JJ7A 1XTAA 1RETA 3KETA 2KLOA 2KZVA 2YS9A 2ME0A 5EYRA 3OY9A 2E7WA 2KRCA 3RKWA 1I39A 1X1DA 2BZTA 2I5UA 5L3FA 2E60A 2DPUA 1IRFA 1FOXA 2F4VI 2OI2A 4A69C 4JOMA 2K9QA 4LG3A 3AG1H 4D7MA 3CF5F 2C37B 2H09A 3CTAA 1TWHJ 2X6YA 5JEAB 3S14J 5ELWA 2QQ9A 2O03A 1ETWA 3FMQA 1BR2A 1WFXA 3PL8A 3EPZA 4BE2A 3CJRB 1ZH5A 2DO7A 3DF8A 2QF7A 1W5TA 3CJQB 3BG7A 4HDVA 1P6RA 1T8IA 2E1MB 2HTJA 5D5WB 4WX9A 1KZHA 1XSDA 5L3BA 2BR2A 2K9SA 2IOQA 2JT1A 1JKOC 1J9IA 3ZZ0A 5A2QQ 4LIVA 2LREA 3GTJJ 1IZ1A 5F08A 4S05A 4FCYA 2Y48A 1H9GA 3WU3A 1B4AA 1MH3A 3I4PA 2K27A 2EFWA 1KYZA 2R93J 1T0FC 5ICGA 4JI8E 1IN5A 4FX4A 2CV0A 3GO5A 1CQTA 1VF9A 2JUCA 4OIOF 2BA0D 4W1UA 3PS3A 3HC7A 1FBSA 2LY2A 3JRDA 1BJZA 1MW7A 1X1BA 2NOGA 1ZREA 1Z0EA 4O5VA 1D0ZA 3K2ZA 3T1HE 2OUMA 3ONQA 1U8BA 3FXJA 4LF4E 2KRHA 3LSGA 2JVGA 5LHGA 4NNJA 4U3BA 1LEBA 1E0EA 4XK4A 2HZDA 3ELKA 2PI0A 2K3PA 2XKOA 1ZLKA 1OYIA 4YY3E 3WTVC 1USUA 3LA3A 5D4SA 2LC2A 1W0TA 2RGVA 3MCZA 5IPAA 4HLXA 5CQGA 1P92A 2V1UA 1CGPA 2W82A 4HV5A 2CWEA 3KP3A 3HG9A 1G3YA 4ZDPA 5GAEJ 3EUAA 4O6JA 1IDYA 5ERIA 3J81Q 3E6DA 1VQ5I 1REPC 3J80C 2CRGA 1S16A 2E5LE 4RBOA 1RIOH 2ZC2A 3FHZA 5K5RA 2EZKA 4DR3I 1WJAA 3I4NJ 2E1OA 2X6WA 4K0KE 1IV6A 3TDZC 4KIFA 1IDZA 4G7OF 4FE7A 1ZXMA 4ESBA 3HULA 3M1CA 1R9TJ 4ENMA 4I99C 4JV5E 4UV8A 4M9ZA 2ELJA 1UHSA 4MU4A 1X3UA 2Y9ZA 4A6EA 2WAFA 3L7ZA 3BZ6A 3CWVA 2JEAA 2HFHA 4OO1B 3KE2A 2KDOA 2PN6A 4B3RI 3TO9A 3L7WA 4A3EJ 1YI2I 2CQKA 2FBHA 4G7ZF 3W6KB 4XRFA 2Q0OA 2KHMA 2CMPA 1PP7U 2R7WA 2DA4A 4DV3I 4BQAA 4GYIA 3VPRA 5C0XE 3RPUA 1MMSA 4U7DA 5EGOB 4A3GJ 1IBMI 2IGOA 2ZXJA 5LEJA 4ESFA 1Z0TA 3Q3SA 5IT9C 2VKEA 2BVMA 4ETSA 3ZMTA 4ZJZA 3HDDA 1U6GA 4XOTA 4XLNF 3S1NJ 1AWCA 4I0BA 1HR0E 4Y33A 3ZM7A 5JEAA 1A35A 1MNDA 2FQ4A 4HLYA 2K9LA 1YW9A 3BQZA 6PAXA 4GKJI 3J7ZI 3PYGA 3BR3A 3UR3C 3BR2A 4X64I 2LY1A 4AYBN 4CCLA 4BQQA 1I1SA 3K0LA 4F52A 3TL4X 4B47A 3WU0A 4MQVA 4ZYGA 1NH3A 4JI1E 1MDMB 2QENA 4UVCA 3TO7A 3HOSA 2ZCWA 2O3FA 3GEZA 4XR6A 4GGGA 1X1AA 1KQ9A 1B8IB 4IHYA 1PVGA 2LH9A 3TO6A 5E3LA 4RDUA 4JI6I 1XX5A 3OYJA 4IOCF 3ZPLA 1BN5A 5M5XJ 4MU0A 1I5ZA 3F8MA 3H36A 3V42A 3OOUA 1DARA 3K70D 1ETVA 3FKIJ 4HYMA 4I3HA 2DT7B 2PMZN 2QWWA 4AVZA 1Y39A 3KLNA 4B48A 1RHYA 5HS8A 2DDAA 2KDZA 3DCFA 1I1GA 2FBIA 5DV5A 3KYLA 2M2EA 3BLYA 2A68F 2LYCA 1XPXA 2OZUA 1X2MA 4NQWA 4LOMA 2WC2A 2V7FA 3HOTA 2GIZA 4XTJA 3JCUC 3ZN1A 5HS9A 2P7VB 3OR1C 4IRIA 5F6FA 3OYMA 3A2KA 1WJDA 2HXIA 4YIRX 3BOQA 1OJ4A 1N25A 3TP3A 1C0WA 4DBRA 2Z3YA 3LL7A 4ZC3A 1OCTC 3C7JA 1J0RA 4PSXA 2KZGA 3OS1A 2DN0A 2HNHA 4P5OA 2FOKA 3CDIA 1L3LA 1Z59A 3H9JA 2LP0A 3IL2A 3UNGC 3LAPA 1Z0XA 1UDOA 2EK5A 1RUNA 1IRZA 2DFHA 1NHHA 3HHGA 2CQXA 4LF9E 1X4OA 2AQFA 4ZVIA 1GDTA 3EYIA 3QOPA 4P9UA 2XDVA 4DR1E 3E1SA 3G1OA 4DNCA 2JA7J 3KEQA 5LRRA 2D45A 2LKPA 3WG7H 1N34I 1IV8A 2WV1A 2EH3A 4AQYI 4XICA 4MU1A 5FB2A 1D8JA 2VBYA 2GS8A 5IY5H 4DR7I 4A3IJ 2Z1DA 4YG2F 2ZM6I 2HQ5A 4HQMA 1XHKA 1XXEA 4BA1B 3K4BA 4B43A 1FOYA 2DA7A 2M0MA 2HPMA 1BL0A 1H7SA 3R4KA 5JEAD 1OKRA 2CUFA 2A6EF 3PYDA 4DV1I 2K4BA 4FW4A 3V8KA 3W2AA 2ZNYA 3K4JA 2M34A 4LCHA 4P1WA 4KHPI 2EPFA 2P5KA 5JHFA 4UUSA 3CCVI 4LITA 1S7EA 2VXDA 4A2UA 1D1CA 1X3WB 1NG6A 4B3SI 1Y4UA 2MLKA 3T1BA 3FK7A 2ZBKB 1Q1VA 3ZMZA 4RLQA 4DV2E 1R6LA 1XNRE 3B02A 2Y0MA 4HF0A 3K1MA 3IRRA 2YPRA 2XAHA 4XKBA 1UEKA 1KYWA 2EIKH 4M1KA 2DT5A 2KRFA 2LF8A 2JA8J 2PO1B 3K7AJ 1O3RA 4FW9A 4JYAE 4WWCA 3GTMJ 3GBGA 1GVJA 3V5RA 3ZKBA 2HOAA 4L5IA 2GA2A 4BE1A 5L3EA 1WZ2A 5DRQA 1X58A 2EV5A 3U9GA 2OU2A 1Z3XA 4BEHA 5LLQA 4E7SA 3E6CC 1X19A 3H3UA 1RR9A 1GVDA 3BR1A 4HNTA 4DV0E 1N33I 2YU3A 1R1UA 2R7DA 3K85A 4XMYA 1MDMA 2L54A 1OYYA 4PZJA 3K69A 1FEXA 3PUFA 2L7MP 1BW5A 1KTVA 3L1PA 2UXBI 2W84A 2GXAA 3F23A 4HYEA 4IEJA 2VONA 1VQ9I 4X66E 1EH7A 2L7KA 4GKKI 2WAQN 2DOFA 2WTEA 3WTZA 1X2NA 5IP6A 2VESA 1U0JA 1EH6A 1XGNA 3V7SA 5LHHA 4V2FA 4CCOA 3Q6MA 2Z5EA 2GA1A 1J7KA 1WH5A 2W7NA 2MFZA 5CVUA 4C2MJ 4DW6A 3E3VA 4OX9I 1T0FA 4BJTA 2PO0B 4A3LJ 2DBBA 2J5OA 4FASD 3OIOA 1HKQA 3HGGA 4LF8E 1YS7A 2IAIA 2DFFA 4EJWA 4IZKB 5J8FA 5BPIA 1IBKI 1D1AA 1BBYA 3PRYA 4BY7J 1R71A 3LPSA 1R6MA 1VQOI 2XGXA 4MYTA 1FWZA 2X85A 2HKOA 2D1HA 5EEHA 1LUJB 3VSKA 4Y52J 2UUBE 2L9NA 4M6VA 2DA2A 4XLCA 2V1XA 4HSRA 1FYMA 2H27A 5DNLA 5ILUA 2H6BA 3WU1B 2OPTA 2FUG2 5C0XC 2ZITA 2D5VA 4IVNA 3QPTA 4XN3A 3QYFA 4U3DA 2VKVA 1UDQA 2XEXA 2CV2A 4QPOA 4EM0B 3F8NA 3FIWA 3DPTA 2W4SA 4KUMA 1RZ4A 5F04A 2Y9YA 5JLWA 2X1EA 5M5WJ 5LBQA 4IS9A 2HS5A 2X7IA 3GZNB 2ZKZA 2CGPA 4LF5I 1HNWE 4CDGA 3JREA 1YRNB 1N75A 4EATA 1JJ8C 1OR7C 3P3GA 4NXME 4LLLA 1ETXA 5K36C 3VYRB 4UXNA 3HOYJ 4BXXJ 1MBHA 1WSUA 2HQNA 5LGTA 4LB5A 3CMAI 1FT9A 1VQNI 2IW5A 3I5UA 1ETQA 3K9TA 3RCOA 2CQQA 2F48A 2ZSIB 2K3FA 1ZRDA 1TLHB 1QPMA 1E2XA 3F3XA 4JI3E 1RKWA 1MMGA 1GXPA 1OYSA 3F8FA 3AAFA 2FMYA 4AIHA 5FRMA 1R7JA 2BW3B 4M9SA 2HGCA 1FSEA 2JTVA 2UUAI 2XAJA 3ABLH 1SFXA 3ZQHA 1EI1A 4OO1E 2QSGX 1PYVA 3HJEA 1FP2A 3KEOA 2V1NA 3T8TA 3DLLF 5KHDA 4IFDE 4YFNF 1SVMA 5BPDA 2XF6A 3DFGA 4LFAE 2HI3A 2KT0A 5FLXQ 4KICA 2KQRA 1R1VA 2LLKA 4DBQA 1KVKA 4BAYA 1WCMJ 1MKMA 2VBXA 4CYCA 4AYBA 2PJPA 2ZXWH 4R8HA 1B62A 1NHIA 1MMNA 1A04A 5K36F 2O8KA 2NN6E 3PSIA 1FI4A 2DMNA 5GP9A 3WU2C 3I64A 4OIQF 1XMQE 3K1JA 1HSTA 1WPKA 4MQ9F 2LR8A 1MD0A 2VE8A 2WY7Q 1QZYA 1HA8A 4EJOA 4P55A 3L2CA 2KJBA 4LGWA 5LGUA 2XGCA 1RI7A 2E19A 5JHUA 2EWNA 2L4MA 3HPHA 4BBRJ 4CXFA 4DV7I 2WAEA 2UXDE 2NVUB 1BC7C 2VF3A 1ZR2A 4WXHA 5GPAA 3RDIA 2HDDA 5LL6R 2XAFA 3MAJA 2C39A 5LFAA 3BT9A 1BOBA 3KP2A 2IXSA 2XSDC 2WP8A 2FOWA 3ZMVA 2EZIA 2JEBB 4DU7A 3IWZA 2PFBA 2V6EA 1RNLA 1UAAA 1HLVA 3FM3A 2CS3A 2E71A 1YE9A 3V2UC 2K85A 3CCMI 4R79A 2O6GE 5TISC 2DI3A 4UB6C 1Z05A 2G7UA 1ZR4A 1W36C 1QPIA 3KPHA 4CZCA 3WU4A 2E36A 3QT6A 2FX0A 5E8GA 4BBSJ 4WCGA 4A93J 4OIRF 3ROUA 2XF5A 4J01A 5LGNA 2CYYA 2DXIA 2UXCI 1S7OA 3E97A 3D0SA 1TWCJ 1FOKA 3M6AA 2ZMEC 1XCVA 4KISA 4JI4E 4A0ZA 2M7BA 4DGWB 3S1RJ 3FHNA 3V8LA 5ICEA 2NOJB 2XROA 2VBZA 2XSJC 2VXZA 1B72A 1ZM9A 2AJ4A 2EIJH 3BJ6A 4X0GA 3HUGA 2DDBA 4L9JA 1JT0A 4HY1A 2BY1A 1LE8A 3KZZA 3M8JA 2H8RA 3D5LA 1FNMA 4JI8I 3GLLA 2IPQX 3QYBA 4A0XA 1KKHA 1GLNA 4MTEA 5LMUE 2E2IJ 1N78A 1HNZE 3Q1QA 1LVKA 4IZZA 5J1RA 2M0CA 2TRTA 1FTTA 1ZM3A 4JQFA 5E1WA 1G4DA 3WTXC 1JUSA 2F4OB 3VODA 1X3ZB 5FWKA 3EYYA 4HX8A 1B63A 1MJAA 4LF4I 3FMSA 3QWLA 5BS6A 3DBLB 4LD5A 5EZHA 3N97A 2RV8A 2M45A 5ICFA 5E1XA 2X1DA 2GM4A 1R4MB 3LSPA 1JGSA 4YY3I 1LQ1A 2YX4A 5DNXA 2BW3A 1TTYA 3M8EA 2A5YB 2P8TA 5IOYA 1S7AA 2ZJ2A 4GYGA 2OC6A 3I59A 3CF2A 1DDNA 2VJ5A 2R7OA 2QGUA 4U0VA 4RM3A 4ASNA 5J3LA 3ZRGA 1GHCA 3IKTA 2X9DA 1MH4A 4JP0A 2JK3A 4XRSA 4R1FA 3FWEA 2CUZA 2PMUA 1HOMA 3JAMC 1G2HA 2LK2A 1HC8A 4F91B 4L0ZB 3T8RA 5FGMA 4F93B 1PUFB 1E3OC 1D0YA 3S15J 2E5LI 2XVCA 2UV1A 2XF7A 2DA1A 3V7CA 4D1QA 1I27A 1WI9A 4K0KI 2BM0A 4JI5E 1MMDA 3BTCA 4MU3A 4BDZA 1HKTA 2M3AA 1RKTA 1IN4A 3TBIA 1JGGA 4Q5SF 3KZIC 4NXNI 1D0XA 3BJAA 1IUYA 3LFKA 3J80Q 3DLAA 4JV5I 3KYDB 3E5XA 2EFNA 1Z0BA 4E6KG 2OQGA 2Z99A 1H74A 4EQQA 3H92A 1JE8A 1FOWA 1V4RA 1Z0CA 3JR9A 2LF7A 3ABUA 2V79A 1H88C 2V34A 5F0FA 1OYRA 4IHXA 1MU5A 2RVCA 4LPFA 1J2XA 1ULYA 4PJLA 2GXGA 2FU4A 5JI6A 2WY8Q 3OS2A 2XC7A 3BTLA 1F43A 4DU8A 5H2FC 3CP2A 2DFEA 2ICWG 1DPUA 1VQLI 3H1CA 1WJFA 4I0AA 1XNQE 2OA4A 5J6XA 1KGSA 2EA4A 4MIMA 2YUSA 2DMTA 3CCUI 2G7HA 4BHCA 2K5CA 2FE3A 1WJ5A 2P6TA 4DPXA 2PEXA 1HR0I 2DMUA 4HDUA 4RAGA 3OYDA 3I54A 5KAFC 2DT6A 4YHHE 4EGYA 3L7ZB 5HDGA 2BV3A 1Z6TA 2JEAB 4FHTA 3SQNA 2BA1G 5A2QK 1ZLJA 2CW8A 4GQUA 2V4JC 4B4CA 2EINH 1UG2A 5EG0B 1KONA 1IGNA 5IT9Q 1B1BA 2HPIA 2E5NA 3LSJA 5CVVA 3CDJA 1R00A 4PRXA 3BG9A 3PFYA 4M9XA 3HTSB 3H9GA 4DUZI 2YSRA 4RPFA 2M8EA 4Y7NJ 4ENJA 3ESWB 1SFEA 4EJVA 4IFDC 4UUVA 2RC4A 3O6BB 1T98A 5C0XA 2XPVA 1A31A 1VQPI 3NEUA 1HW2A 2DTRA 3PQJA 4IPAA 3CLOA 1SMYF 1XGOA 2H8WA 2C38B 4GRIA 2XIGA 3HBLA 5C3EJ 3MKYB 2NN6C 2LOOA 3HGYA 4G94A 2Y0SA 5D5VB 1EA3A 3GTLJ 3COAC 2QSFX 3L9FA 4XLFA 1Z1DA 2V26A 4V19K 1USSA 3NQOA 1BIBA 2ETHA 4HF2A 2H6CA 3IUOA 5DD8A 1OR7A 1QZEA 5K36A 3B73A 3RQIA 3TKYA 1GT0C 3TW6A 4D0PA 5C4XJ 2MGQA 3BG5A 3DBHB 3HSRA 1Q1HA 1I6HJ 4U0YA 4DV4I 4BL0B 4I09A 3J81K 2QLZA 3W2VA 4ZTJA 4M74A 4W97A 4EGZA 1XMOE 1NK2P 5GTHC 2E1CA 2L5QA 4YFKF 2UU9E 1I94I 4CH7A 3PFIA 4HNUA 4RGRA 2NVXJ 1JHFA 3CQZJ 2VJ4A 3W2WA 1GV2A 2VUMJ 1PUFA 3UHMA 1BI0A 3TDUC 4DR1I 4HZFA 4NQWB 2HYJA 4P7AA 3HPGA 1YX5A 1FP1D 3ZKDA 3AL0C 3NARA 3WHCA 1Y1VJ 2OBPA 4WUCA 3K17A 3D1NI 3LAJA 1FWLA 2BHZA 1ZG5A 4P9FA 4LFCE 1APLC 4QNKA 2QQBA 1NHJA 4JI0E 1IRXA 2DA6A 2Z5UA 3M7ND 2QCOA 4KN7X 2IS1A 2H1LA 2QBYA 4XOPA 1SVOA 4Q47A 2CZ9A 2STWA 3T1YE 4B09A 1H89C 4FT8A 3VEPA 5F1JA 2WNRA 3T0YA 1LPQA 2M30A 4FQGA 3BDDA 2CUEA 3BC8A 3CC7I 3GONA 2JSCA 3C2BA 3Q0UA 2NVTJ 2X36A 2E7XA 1D6TA 2K9NA 4L9TA 3O3KA 2HHHE 4DV2I 1XNRI 1PVEA 3B6AA 3LQRA 3SDBA 2MABA 3WGGA 3WG9A 4F55A 1MSFC 4RGUA 3E0JB 3U1YA 1IBLE 3BR5A 1FMWA 2HU9A 2GQQA 4BACA 2FXAA 2PNZB 4DPYA 2OZ6A 3QU3A 5L3JA 5F0CA 4JYAI 3PS2A 2O0YA 4DR2I 1MBGA 3K4KA 3OR2C 1O57A 3IKVA 4DYQA 2EILH 1HDDC 2GO4A 1IRGA 1Y8QB 1G3WA 1QHGA 2V1DA 4DIQA 4UNOA 2BHYA 2QQAA 3H3ZA 2L2OA 3GTOJ 4YELA 5A2QZ 3JTHA 3NRVA 5D5UB 5EG0A 1DU0A 4DV0I 3ML6A 2K7LA 5TRDA 1IG7A 1R5HA 2PO2A 4RGXA 4PK4A 1R5GA 3LOCA 5K36D 1UMQA 4KN4X 3U1KA 4UUSB 1YHQI 2OCEA 5HLTA 1YIJI 1PDNC 3V8JA 1Z0GA 2HDWA 2LFBA 1T38A 3KP7A 4L9NA 2ZMEA 1N32E 5EEAA 2BXYA 3S93A 4JI2I 4FTHA 3CUQC 2QQ8A 3H0GJ 4X66I 4QWQA 4KJZA 2XAQA 4BYYA 1U5TC 1YW7A 5DD4A 1HXDA 3DTEA 1JT6A 2Y30A 3HB9A 3QT5A 4II2A 2C38A 2I8DA 3DEEA 2M87A 1HCRA 4NC8A 3OIQA 2DQRA 2JPBA 4J3DA 2LVSA 1SANA 3C3WA 3OYLA 4JK1X 1Y4SA 2TCTA 4BEHB 3IWFA 4B3AA 4IOAF 1ELOA 2RNJA 2LKSA 4M6YA 5GMEA 1FY7A 1ZAOA 4M6XA 2WW4A 4ABZA 4X62E 2BYVE 2ID6A 3OTOE 3O8GA 2UUBI 3PO3J 1DP7P 1VFCA 1XSXA 4C9YA 1TWAJ 4PDKA 4ED4A 1EH8A 3J81Z 3WE2A 2LG4A 1F4KA 4IHVA 2PNLA 2IVMA 3V7RA 3BROA 1TL8A 3PM1A 5FKKA 5LEKA 4N9HA 4BS9A 1OCRH 1N0UA 3FBNB 4JX5A 4DOZA 4KITB 4FE4A 1Y5YA 3ABTA 2BEOA 2P7CB 4DV5E 3C18A 5C4JJ 4FISA 3CMEI 3ULQB 4B1RA 2AQEA 4RB3C 4XSZF 4LIUA 2P0WA 1WRJA 2PG4A 2EJRA 1O4XA 3UKGA 2E34A 1V5GA 3CJNA 2LY9A 2RDPA 4HPQA 5LHIA 2ELHA 2CQNA 1ZM4A 3CCQI 3LQQA 4NXMI 2Y31A 1I3AA 4U7BA 1A6FA 4DZJA 5HNHA 1Z91A 4I01A 3RZOJ 2DK5A 2AXTC 2A2CA 3R60A 3DQVC 2R7ZJ 4MO7A 2P81A 1GUUA 4LG0A 5HDNA 3F8BA 3CMMA 4HNVA 4D5CA 4L5JA 2JA2A 1YJWI 1DGRM 4HA8A 4HRIA 2CSOA 4CCMA 3EUKL 2X0LA 4II3A 1H7UA 4DPUA 3DTKA 4AWXB 3HOZJ 3M3YJ 3RPUD 2V6CA 4BJ6C 4FWDA 1F9NA 3L2VA 2VT3A 4C2UA 3J7AY 2PNZA 3DKXA 4M3GA 1TC3C 4N3OA 2F5CA 1R58A 3I55I 2EV6A 1ENHA 4AVPA 1ZQ3P 1ZXNA 2DA5A 2ME6A 1EKEA 4LFAI 1UDSA 3FXUA 2A05A 1ZYRF 2LTPA 3BG6A 1GXQA 2D2WA 1XMAA 2B9SA 4I7HA 1PP8F 2VODA 3S3OA 3F0CA 3CUOA 1I6XA 2GOMA 2QEXI 1XMQI 2DJIA 3G4SI 2RQQA 3SZPA 1IN7A 3ZQ7A 1F5TA 4EMDA 4DUYE 4HACA 4USKA 3WTWC 2BA1D 4N4OB 3Q9VA 2Q8KA 3CLQA 4BQOA 2R92J 2YU9J 3ABMH 2F5FA 2VC0A 4YIIA 4IHWA 1J09A 2OTJI 2X4HA 4L0YB 1YW8A 3J81C 1JUPA 2UXDI 1NG7A 4BGDA 2OQRA 3M07A 4HAMA 2PNMA 1FLIA 1ZELA 4KMFA 1VISA 1ZK8A 3KZYA 3LA7A 3Q6NA 3JRCA 1UCRA 3WTTC 3PIPF 2MD0A 4XKVA 4RB1A 4NC6A 3E7LA 3GTKJ 4B3XA 1LKXA 3WODF 5H20A 1ODDA 2RAEA 5EJCA 3M85G 1W0UA 5TJJA 3F72A 2MH9A 1FMVA 3ZQFA 4CYCB 1VQKI 4OZEA 3HRTA 1NK3P 3QP6A 3H3VK 3OYCA 2BOLA 2OD5A 5CVJA 2EZHA 4QTRA 1ZN2A 1EA6A 1WHUA 2J7KA 4OOIA 3GFJA 4MLOA 3SHFA 2JE6A 2VPRA 4PJJA 4XLHA 2VT2A 2N8GA 2O1UA 3ASOH 3QT8A 5JEAE 2IP2A 1YO5C 1MJ9A 1TP4A 2GWRA 4ZZDA 2HFUA 3SEQA 3D5RC 2A3SA 4JI4I 3P9CA 1KU7A 3X2QH 2R7SA 3M7GA 4NUBA 1BM9A 1RC9A 3OWTA 2C39B 1O3QA 4E7IA 3A03A 3CC2I 4C3HJ 3W6VA 3Q0WA 1FTZA 3FX3A 2WP8B 1XGSA 2O3ZA 2BV6A 3J7AG 5DTDA 4MFEA 3A01A 2O1VA 5HNFA 3HOVJ 4AIKA 1X4PA 2XRNA 4LF7E 2NXNB 3R61A 3RIRA 3VB2A 2DQLA 3BP8A 4FW3A 3G3ZA 1FSHA 5LMUI 4XONA 4UHTA 1HNZI 3BJOA 2VOOA 4AIMA 3HTUA 3OYNA 2QM3A 4E7KA 2IGNA 3OV8A 2GZWA 1WJCA 1OYWA 2DEIA 1BI2A 2HTSA 2Q2EA 4UVBA 3ZP5A 1DP3A 2L7ZA 2O61A 3J7YJ 3K6GA 3U1DA 2CGEA 1YG2A 4MDTA 2CFOA 2QZ8A 3K4CA 5FKLA 4IL6C 1ZG3A 3CP8A 1Y0UA 4PGHA 2UXXA 2GBYA 2WV0A 4TV7A 1W5CC 3WGIA 1TQIA 5E79C 1B72B 1Z7LA 3GLXA 1W1WE 3OIPA 2I10A 4RS8A 4AU7A 3OYHA 3JRHA 5GMDA 3H4LA 3G2BA 4MGRA 1BIAA 2DOAA 3EETA 2DOEA 3BTJA 3HUGB 3MD2A 3L2WA 2XV4S 1LE8B 5FLXK 4CCJA 4DV6E 1N36E 3BG3A 3IH4A 2O1WA 1AKHA 1KU3A 2VKDA 1TZLA 3BZKA 3FBIB 1I3QJ 3O8HA 1EV7A 4WXDA 2Z2SB 3NZKA 3TQNA 2BY0A 2IA0A 3ECHA 2Y0SN 5DCMA 1GV5A 3OS0A 1Y56A 3A0HC 2C6YA 3AG4H 1VI7A 2L3DA 5CLSA 2W57A 1Z7UA 5DCFA 2A5WA 1U8RA 2M5WA 3JRGA 4G6DA 5CPRB 3JAMQ 1RUOA 5FRNA 3QQAA 5KVRA 5C0XF 4BUPA 2K02A 4A3KJ 4H0EA 3ZZUA 2LDUA 1MZBA 2P5LC 1D5VA 3I59B 4X6AJ 1S4EA 2M4GA 3K1NA 2X1CA 3FXMA 2M9HA 3HJCA 2OAZA 2NVYJ 2RREA 1CF7A 3I3LA 4LMYA 3ABKH 3E5UA 3DEUA 3QP5A 4YIFA 3OL3A 2EIMH 3CUQA 3MKWB 3OMYA 2Z5BA 2ZFUA 5F1RA 4CHUA 1U5TA 4A3MJ 3JSOA 4L18B 2BA0G 1OFCX 1V5EA 2CV1A 2OF7A 1XNQI 4ITVA 1ORKA 2VKHA 4WF2A 2PJRB 2ZJRF 3GMEA 5EZGA 3ZQLA 2LJPA 5FO5A 1LEAA 4CICA 4YRVA 2NYXA 3WTSC 3VOEA 4BHPA 5D4RA 1ZGWA 4C3JJ 2MSYA 3ZQIA 2E2JJ 3DWLE 4E7LA 4YHHI 2CG4A 5HDKA 4E4HA 3LSRA 4G8XA 4DR5E 4IHSA 3A02A 2DMQA 4BH9A 4GFBA 2R5ZA 4HEA2 3HM5A 2NPFA 1QNTA 1R49A 1J5EE 3SZTA 1Z5CA 2HQRA 4LCGA 3FMRA 3CC4I 2VJIA 5GADJ 1K47A 4ZYHA 2HVQA 3K70C 3DU6A 2PBIA 3E6MA 3PNYA 4E7HA 1G59A 3RYPA 2R7FA 2HYGD 2VI6A 5DEQA 4ZDOA 5DUIA 2XPUA 4AUXA 1IO2A 2MA3A 3HXLA 4M71A 1E3HA 1WVRA 2QYOA 2VQHA 1S72I 1DU6A 5GTIC 5AONA 1HQCA 5IT3A 4GO1A 2CG9A 4M3EA 2VLAA 1OMIA 4Q4ZF 2GIVA 2P6SA 3QAHA 3LNUA 2JZYA 1JKPC 3ZMUA 4CA0A 1YHCA 2EQRA 4DV4E 1FJGE 1SD6A 3VSLA 3MKLA 3L2QA 3P5JA 5HVQC 4LF6E 5E8IA 4EMSA 3F22A 2CW7A 2NS7A 4PJNA 3MZ8A 4ANJA 2VBWA 1O3TA 1NZ0A 4BY1J 1VI0A 2EFQA 5FLMJ 1LDJA 1K6OA 2HKXA 3IV5A 3JRIA 4BQNA 4WUDA 2KKOA 1HNXE 2J65A 5C0XB 3HYIA 5FLXZ 2UUCE 1X1CA 2BY3A 4DQ2A 2JQ7A 2XAGA 3SFZA 2ECCA 2XHKA 3OYBA 3FXRA 1Y1WJ 4F7ZA 1OLTA 2CO5A 2WB1A 2JSPA 1XMOI 4RAZA 4FWGA 4RAYA 3RJPA 4A3CJ 2FRHA 2UU9I 1YJ9I 3H5NA 4BU2A 1FC3A 2XASA 2FBKA 3DKWA 2WADA 4N9IA 2X48A 5E20A 4C2TA 1FNNA 1RR8C 1O3SA 2EZLA 1A36A 1SD4A 4NB5A 1KIJA 3T1HI 4DR6E 4Y15A 1ONVA 4LOCA 5B3SH 2K4JA 3J80K 1MBFA 3S2WA 2ZB9A 1SD5A 4FWHA 3M1EA 4EM2A 5K36B 3FXOA 4LFCI 3NWTA 2QSHX 1YITI 1VQ7I 2NNYA 3FZVA 3TP0A 1BOAA 1W7PB 4JI0I 1RPWA 1HBXG 2GOXB 3GX4X 2DK8A 2KIUA 9ANTA 1BW6A 1Y0NA 4A0YA 2E1MC 3CJTB 3KP4A 2RN7A 1JJ6C 3T1YI 4EEFG 4IX7A 1J5YA 3B6CA 3KP5A 3PUBA 4FW6A 3OYEA 1TW2A 4UTGA 4KQVA 4S0HB 1QZRA 4ZH4F 2VC1A 3RQ4A 3TOBA 3BCAA 3HZJA 4IJAA 3KX2A 5F0HA 2MBFA 3HL2A 4GXOA 2HHHI 3FM5A 1WKMA 5LMNE 1IBLI 4OAZA 3I58A 3CZ6A 2PJRA 2F6CA 2R7RA 3MMYB 2LD5A 1EJ9A 4EJTA 4CGZA 4LF5E 3J7AM 4B3TE 2ZJQF 5K7ZA 4Z2YA 3CO6C 2IRFG 1R4NB 2MC4A 3S2HJ 3DKYA 5IT9K 4NHJA 2CQ7A 1YYVA 4CUGA 1HK7A 2BXZA 5HS7A 3S32A 3DP7A 2QBYB 1IC8A 1U78A 4KT5C 2W48A 1EF4A 3S3MA 3MWMA 2WNRB 4B44A 1P7JA 1KU2A 5FROA 4ZYDA 1IN8A 5ICCA 2GAUA 4IQJA 2EV0A 2LMDA 1V3FA 1G3TA 2DYRH 3HOWJ 2P5VA 1N32I 2W00A 1Z9CA 1LFPA 3CCSI 2DAOA 5F64A 5DDGA 2HKEA 4Z7YA 4IHTA 3H9QA 2FA5A 2Y75A 3M8FA 4RM2A 5E3MA 1RRJA 1DUXC 3KP6A 3MVPA 2IT0A 3MN2A 1QHHD 1D5YA 1T95A 4MFDA 3DTIA 4MYUA 4IF4A 3DU5A 1WWXA 4BXFA 4ISAA 2KL4A 3BR0A 5FD5A 2R3VA 2IESA 2IOPA 4MEYF 2O5RA 3VYTB 2ESHA 3TOAA 1X1PA 2PO2B 5DYMA 4CCNA 4CSWA 4JI1I 1VQ4I 3M9AA 4OO1C 1P7IA 2COBA 2VE9A 4E7ZA 2JN6A 3OTOI 4LLGF 1WUUA 1LDDA 2AXLA 2DEJA 2ZMEB 2AS5F 1O7LA 2HVSA 3E5QA 3GTQJ 2E5ZA 4JX6A 4JI7E 3OYFA 1Y6IA 4FETA 2IGMA 2JVHA 5FLVA 2KFDA 1Z6RA 1LFUP 4IZJB 5BNGA 3QT7A 4CYDA 2FD5A 5BQTA 1UZCA 4DV5I 3CCYA 2B7EA 4PGGA 4XN0A 3IP4B 2R42A 1N77A 2DTZA 3B78A 4ENKA 2R4GA 3CDHA 2V9PA 3J80Z 4G6TB 5BR8E 1USVA 1FX7A 3TEDA 2CU7A 3GUDA 3S17J 2NS8A 3F21A 1STZA 3H5RA 2R3SA 2VQGA 3KLOA 1XS9A 1W7PA 2L9RA 1IF1A 3QPHA 2F4MB 4UV9A 3VWBA 2M4KA 1YOVB 3F6VA 1XG1A 1JXSA 4L9VA 4OO1F 1JUMA 3MZYA 2XGDA 4DJAA 3WTUC 2UXCE 3I53A 4IFDF 1QBJA 1Y6ZA 1XB4A 3MEXA 4OMZA 5EF6A 3SDGA 4LF9I 1K78B 4UVAA 2A2DA 5K5QA 3SEZA 5FD6A 1B6AA 1K83J 1PKPA 2L0KA 4AD9A 3ZQQA 2DODA 2VQFE 3PQKA 2PQ8A 2NN6F 2VPLA 1FWKA 1TQPA 3FK6A 4X65E 3JTGA 4CCKA 2OJED 2F1DA 4OAYA 4B3ME 4OWRB 3K2AA 1ON2A 3O2PE 3TW7A 1Y8RB 1O7FA 4I02A 4DR4E 2A61A 3MFKA 1A6QA 1T08B 1L0OC 3LSKA 1SD7A 4OIPF 1MG7A 1TW3A 3L2UA 1HDPA 5IT9Z 3A0BC 4PFOA 3LNQA 1JKQC 3IRQA 2HYFA 3RSNA 5K7HA 1AOYA 4USMA 2AHQA 3GCMA 1TT0A 3OYAA 4HSTA 4S04A 3DBRB 4I76A 4Y4RA 2L9VA 1FKAE 3EUHC 2V2VA 2R7UA 2VQEE 3QU6A 2B63J 4LG0B 1B59A 2X51A 3AG2H 3JRFA 2HK2A 1YLFA 2NAZA 1D8KA 4DUYI 4FW7A 3CMYA 4AM3A 3GWZA 3C2GA 5D5XB 2J5PA 2D1VA 1KA8A 2QKLB 2JWTA 1A5JA 3F0NA 5C0XD 1R5ID 1T56A 4I98B 4XLPF 1OISA 4HW0A 3R6SA 1KU9A 4HBLA 1XCBA 4C30A 3I56I 2Z9OA 5DRRA 5K7FA 4LFBE 3LMMA 2DLLA 3SYTA 5IWAE 5HLIA 5HODA 1FZPB 1UB9A 1R1TA 2R7VA 1XGMA 3U21A 3ZCOA 3KIOA 1WGXA 2FQ3A 5IYDJ 1QU3A 4Z6YA 3GFIA 4AC0A 4RB0A 3WU6A 3JW4A 1LFBA 4RB2C 4BXUA 5DM6F 4HXZA 2ZXHA 4DPTA 5KNLA 1F1ZA 2VOPA 2NS0A 2BBYA 4XL9A 4XBFA 4HX4A 3F6OA 3C2HA 3DXJF 3GYHX 1YQAA 2ZJPF 1YIOA 1W7PD 4R1HA 5J8CA 2HK3A 3PYFA 1DGWY 4HACB 4NXNE 3G71I 2QUFA 1IXRC 2V8PA 3Q0VA 2XB0X 4IXAA 2BGCA 2IGKA 3S8PA 4F3QA 2PLYA 5IOZA 2CUJA 1DQUA 2COMA 2FMLA 2OCCH 4U88A 4CZZA 5TGTA 3SZGA 1WI3A 3OL4A 2X6XA 1QO0D 4IZJA 2A69F 4IFDB 2JT2A 1D1BA 1RESA 2E1NA 3IH3A 5FKNA 4H4KC 5IYBJ 4RMNA 4OINF 2KJCA 5JLXA 3FXQA 4LF8I 4CO8A 1ZGAA 1NHAA 4I6ZA 4LF7I 4M3DA 1TNTA 3OYKA 4G7HF 2NN6B 4O3MA 1H0MA 4FX0A 1SVLA 1ZARA 2F4IA 3FXKA 3BZCA 2UXNA 1QVUA 1WH7A 3AKZA 2JE6B 3P3EA 3HSFA 4MNUA 2C37A 2WA0A 3N05A 5CJ9A 4QPQA 1IW7F 4B8XA 1G8XA 5EKWA 2KIMA 5L3GA 1K78A 3ZQCA 3PNVA 4A3BJ 5K36E 4WK8F 2MW8A 3PYEA 4J00A 4EV0A 1YS6A 2IS6A 2M1BA 4NBQA 4WUBA 3NWSA 2ELKA 1ZG1A 1BA5A 3CESA 4KMUX 1ACIA 2GO3A 3A01B 4DUZE 4LFUA 2EB7A 4IKFA 2VJJA 1JKRC 5HOOA 5FKOA 2L02A 5HLGA 2IA1A 4XIDA 4KIBA 4KYWA 2V2QA 4DV6I 1N36I 1HNWI 3GVAA 1ETOA 1MJBA 4PSWA 2JA6J 2JA5J 3S2DJ 3LA2A 5F27A 1P9QC 2F4VE 1WJBA 2BE5F 3AG3H 5B5EC 2JRMA 2XRLA 3LSHA 3AL0B 3CD6I 2VL8A 2XUBA 4LCFA 4OKGA 2Q2EB 2WBMA 5A2QC 4N4NB 4ESJA 5K1YA 1LVAA 1U2RA 1W36D 3IAS2 5IYCJ 4D9JA 2MC3A 4A5MA 1XN7A 5H6QA 3CDLA 1Z3YA 4ZYAA 3ZZTA 4JI3I 4N0BA 2DPDA 4GCVA 1TWFJ 3ZMDA 5DS9A 3D4JA 3ZXSA 1MBJA 5EDNA 3OSFA 2IBDA 1UHMA 5D8KB 4PJ0C 5C44J 2K86A 5K5OA 3FKJA 1TNSA 3EDPA 1S6LA 1DPRA 5KAIC 3JSPA 2ADUA 3BPXA 4X1EA 3U2RA 3HOXJ 4XKCA 1AKHB 2WB1N 4D5FA 2A07F 4IZJD 3LFUA 2L01A 4AIDA 1I94E 3CCLI 4A3DJ 2FNAA 2ISZA 1OCOH 5DCMB 1J59A 1P4XA 2KPMA 5D6FA 2EFPA 1QQIA 2ZFWA 3S1QJ 5AIQA 4Q48A 2IERA 3FISA 2XAUA 1WJEA 3C1DA 3N4MA 3BPVA 3G1MA 2O8XA 4DYRA 2IS4A 4C3IJ 5J40A 1SAUA 2G0EA 5B1BH 1BI1A 1RR7A 4XM3A 5L3CA 3B4TA 3HKZA 3B82A 3RPQA 4U87A 3FF5A 2RKHA 1AU7A 4DR5I 2W25A 1S29A 4ENNA 4OO1A 1T33A 3PJRA 5M5YJ 1J5EI 5FFXA 1CF7B 1Z5BA 1FJLA 4IFDA 1S5LC 3A1YA 3Q5FA 2UZKA 3DEWA 2HOEA 2ZO4A 3CUQB 2Z5BB 3I4MJ 2JPCA 1JTYA 3OOPA 3DPUA 3HEFA 1G3SA 1U5TB 2TDXA 2K9MA 1JHHA 1OCCH 1OPCA 3P3CA 3WTYC 2G9WA 5EGOA 1MGTA 2NN6A 4DR3E 1XMXA 2HR3A 5L3DA 3Q9SA 4AIJA 4ZTFA 5E3OA 1MIJA 4OMYA 3HRSA 3P76A 1Z21A 1OYPA 3IH2A 3EQLF 2Y2ZA 1AHDP 1QA6A 2VQCA 5B1AH 1V5FA 4DR2E 2M8GX 2MG4A 2STTA 1FYKA 3L00A 3RTRA 1T39A 3HIFA 4Z7CA 2JRTA 1FJGI 5KCMA 4A12A 2JUGA 3H5AA 3K4NA 3WE3A 4EM1A 4LF6I 2R5ZB 3ZN0A 1J75A 5LRSA 1ITYA 4JYKA 3LSMA 3ZR8X 1H73A 1P4AA 1TT5B 2DU9A 2FJ1A 2EA2A 4B3RE 3F9KA 3B8HA 1U9OA 1UFMA 1V54H 2YX7A 4NC7A 2LRDA 3GXOA 4FN5A 5J47A 1HW5A 4BE0A 5D8LB 2CJJA 3R0AA 3W3CA 2HZTA 2EFOA 2RNGA 4HQEA 3BQYA 1HF0A 1B8IA 4DV3E 1HNXI 2V2ZA 3L2RA 2UUCI 1AA7A 2B0LA 4JI2E 1IBME 1SFKA 4Y3OA 3BWGA 3KFWX 4KNYA 2RQPA 3K10A 1UG0A 2ZXIA 2HOSA
chains in the Genus database with same CATH topology
3DD6A 4OO1E 2BA0D 4BA2A 5C0XB 4IFDE 2PO2B 2BA1D 2C38A 4OO1C 3H36A 5K36A 5K36F 2PO0A 2NN6E 4AIDA 5C0XF 4OO1D 5K36B 3M85G 2JEBA 4IFDD 2PO0B 4IFDB 3B4TA 2C39A 1WHUA 3CDIA 2NN6D 1E3PA 2JE6A 2WP8A 1R6MA 2BA0G 1UDOA 4OO1A 2JEBB 5JEAE 3GMEA 4IFDA 4OO1F 1OYRA 2NN6B 4BA1A 3M7ND 4IFDF 2C39B 5JEAC 5C0XC 2JE6B 3H1CA 2WP8B 3L7ZA 2WNRA 2NN6A 2JEAA 1UDQA 2C37A 4OO1B 2NN6F 1OYPA 4BA1B 5K36E 5JEAD 4AIMA 4NBQA 5C0XE 2PNZB 3L7ZB 2WNRB 2JEAB 2BA1G 2C37B 2PO1A 5K36C 5JEAB 2BR2B 3GCMA 3CDJA 1E3HA 3GLLA 2PNZA 1R6LA 3M85D 4IFDC 3HKMA 5JEAA 5C0XA 2BR2A 2PO2A 1OYSA 1UDSA 4AM3A 3M7NG 5JEAF 2PO1B 4BA2B 3KRNA 5K36D 3U1KA 5C0XD 1UDNA 2C38B 2NN6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DD6 A;  4OO1 E;  2BA0 D;  4BA2 A;  5C0X B;  4IFD E;  2PO2 B;  2BA1 D;  2C38 A;  4OO1 C;  3H36 A;  5K36 A;  5K36 F;  2PO0 A;  2NN6 E;  4AID A;  5C0X F;  4OO1 D;  5K36 B;  3M85 G;  2JEB A;  4IFD D;  2PO0 B;  4IFD B;  3B4T A;  2C39 A;  1WHU A;  3CDI A;  2NN6 D;  1E3P A;  2JE6 A;  2WP8 A;  1R6M A;  2BA0 G;  1UDO A;  4OO1 A;  2JEB B;  5JEA E;  3GME A;  4IFD A;  4OO1 F;  1OYR A;  2NN6 B;  4BA1 A;  3M7N D;  4IFD F;  2C39 B;  5JEA C;  5C0X C;  2JE6 B;  3H1C A;  2WP8 B;  3L7Z A;  2WNR A;  2NN6 A;  2JEA A;  1UDQ A;  2C37 A;  4OO1 B;  2NN6 F;  1OYP A;  4BA1 B;  5K36 E;  5JEA D;  4AIM A;  4NBQ A;  5C0X E;  2PNZ B;  3L7Z B;  2WNR B;  2JEA B;  2BA1 G;  2C37 B;  2PO1 A;  5K36 C;  5JEA B;  2BR2 B;  3GCM A;  3CDJ A;  1E3H A;  3GLL A;  2PNZ A;  1R6L A;  3M85 D;  4IFD C;  3HKM A;  5JEA A;  5C0X A;  2BR2 A;  2PO2 A;  1OYS A;  1UDS A;  4AM3 A;  3M7N G;  5JEA F;  2PO1 B;  4BA2 B;  3KRN A;  5K36 D;  3U1K A;  5C0X D;  1UDN A;  2C38 B;  2NN6 C; 
#chains in the Genus database with same CATH topology
 3BY6 A;  4MEX F;  3DD6 A;  2ESN A;  1P4W A;  4IRG A;  4M72 A;  3PS1 A;  4DR6 I;  2EBI A;  3ZMS A;  3JAM K;  1BJA A;  2FEZ A;  1K4S A;  3JRA A;  2HKJ A;  3F8C A;  4GKJ E;  2O9L A;  1XC5 A;  4X64 E;  4U0W A;  2JMW A;  3SFI A;  3GFL A;  2UWM A;  5H6R A;  2ZNZ A;  3RYR A;  1K4T A;  2Y69 H;  5JVG F;  1SFU A;  1FYL A;  3AFH A;  2M7A A;  4URL A;  2WWY A;  4PU9 A;  3QPS A;  3I0T A;  4KIG A;  1BC8 C;  3A4C A;  3EUH A;  4WXC A;  4ON0 A;  1RRE A;  4JI6 E;  3I9V 2;  5J4Y A;  4LB6 B;  4L5E A;  3BCB A;  4OO1 D;  4OU0 A;  5KK1 A;  2NRA C;  4HOB A;  2R7T A;  1PIE A;  1YH8 A;  2W24 A;  3FDY A;  3WGH A;  5HLH A;  4IFD D;  1UHW A;  2DJN A;  4ZZL A;  4IRH A;  5JVT A;  1I50 J;  2DCE A;  4BHB A;  1MSE C;  5LMN I;  3G1L A;  1QZZ A;  1UEL B;  3GFM A;  4NDL A;  4A6D A;  3QYE A;  5M3F J;  3GW2 A;  4JI5 I;  3GF2 A;  1ETY A;  3T5X A;  4XRS G;  2NN6 D;  1VQ8 I;  2VQL A;  3KEY A;  3SXY A;  2CFX A;  5E17 F;  4B3T I;  2OTL I;  1LNW A;  2CH0 A;  1FBU A;  1QVT A;  3MKZ A;  4KT6 A;  1F36 A;  4DYC A;  1R6R A;  2VIX A;  4BJ5 C;  4BA1 A;  3KYC B;  3WHB A;  2QA4 I;  1Z77 A;  4M73 A;  2AE8 A;  5FFZ A;  3HRM A;  2V9K A;  3M4O J;  1OCZ H;  2XKP A;  2Z5C B;  3H35 A;  4XRM A;  4DPW A;  2A6H F;  3QOE A;  2DMP A;  3RI4 A;  1U3E M;  1TQM A;  1LB2 A;  1IXC A;  4M3F A;  2LKX A;  1OCP A;  2DYS H;  3I71 A;  2L9S A;  2ZBK A;  5FKM A;  2IJL A;  4XLA A;  1TWG J;  1HSJ A;  4UT4 A;  1M1E B;  4LK1 F;  1N0V C;  1ETK A;  1N34 E;  1A6I A;  4P52 A;  1UJ8 A;  1D3Y A;  1PJR A;  4AQY E;  3CCJ I;  2X6O A;  2VN2 A;  1PUE E;  1Z67 A;  3K4L A;  2PO1 A;  1XSV A;  3IC7 A;  2BVL A;  3G73 A;  4DR7 E;  4YFX F;  1SC7 A;  1BR4 A;  2ZM6 E;  5IP7 J;  4MTD A;  1K7A A;  3IHU A;  1S3J A;  2NNN A;  3W6J B;  3RZD J;  3DPL C;  1JTX A;  4BKX A;  2HDC A;  1VQ6 I;  3R0J A;  1HW1 A;  3HKM A;  4DV1 E;  3BTI A;  5DRO A;  3M7N G;  4RLF A;  4EJU A;  1VND A;  4BA2 B;  4KHP E;  1H8A C;  4HF1 A;  1XDU A;  2LBF B;  4V2G A;  3QPL A;  3PIO F;  4M3B A;  1UDN A;  4B3S E;  1TBX A;  1YFH A;  1IXS B;  3IAM 2;  1ZKG A;  3REO A;  3GZ5 A;  3ZOB A;  2EFG A;  5ED4 A;  2KIF A;  4JI7 I;  2P4W A;  4HX7 A;  5AIP A;  2GXB A;  1R22 A;  2HXO A;  4IQ4 A;  1FBQ A;  4QSH A;  4PFP A;  4KFC A;  2PMZ A;  4KDP A;  4G12 A;  4XNF A;  4BNC A;  4JG4 A;  2OV7 A;  4PJM A;  2V9V A;  5ILV A;  2ACJ A;  2O7O A;  4PUS A;  2PMH A;  3JAM Z;  4BDY A;  3HRU A;  5BOX A;  2LSO A;  2PO0 A;  1MNE A;  4LJZ F;  5BR8 I;  3P9K A;  3ECO A;  2F5D A;  2Z33 A;  1V55 H;  2F5E A;  3S16 J;  2ISY A;  4IZK A;  3PSF A;  3CO7 C;  1T6S A;  1LJ9 A;  1U9N A;  3ZGK A;  4QIW N;  1SFO J;  1IAW A;  3RKX A;  1N33 E;  5LD2 C;  3QRF F;  2O1T A;  1P2F A;  2Q1Z B;  1YX3 A;  1Z0W A;  1ZTR A;  2MLG A;  2DFI A;  5EL9 A;  1XD7 A;  2QKM B;  2W85 A;  3OYI A;  2LNB A;  3NAU A;  5EEG A;  2UXB E;  5ILS A;  2VAS A;  1IN6 A;  3P06 A;  4GKK E;  1R36 A;  1VQM I;  1FIA A;  1ERD A;  1FIP A;  3VYS B;  4XKW A;  3HHH A;  1YJN I;  2ID3 A;  1E3P A;  4QLC U;  4E7J A;  3LSI A;  3RKQ A;  4K2E A;  3PNT A;  2R5Y B;  2VQF I;  5E1Z B;  1OJL A;  5J1U A;  1LDK B;  2BY2 A;  5IP9 J;  1ZM2 A;  2CVE A;  2XGE A;  5CVR A;  4OX9 E;  4X65 I;  3QOD A;  3V4G A;  2GLO A;  1VTN C;  3HSE A;  1XDS A;  4B3M I;  2MYS A;  1ZRC A;  5JEA C;  4HV6 A;  1YRN A;  4DR4 I;  1IBK E;  1ZHF A;  2KMU A;  4G6Q A;  1K6Y A;  4ZDL A;  5B66 C;  5DRP A;  1T2K A;  3VDX A;  1ZRF A;  5J1Y A;  4UB8 C;  4XSX F;  2ECB A;  4JX4 A;  2IEK A;  4PCQ A;  5JR3 A;  4UY8 I;  3MZH A;  4IO9 F;  1B9M A;  2A6T A;  4Y17 A;  5CYV A;  4JBA A;  3K1P A;  3TGN A;  4A5N A;  2Z5C A;  4HG2 A;  4QNJ A;  1E17 A;  2HEO A;  2MH2 A;  4KA4 A;  4GDF A;  2VQE I;  3LTO A;  2KP6 A;  2W1O A;  3KCC A;  3ERM A;  2H94 A;  5FJ8 J;  4XQF A;  3DV8 A;  1H72 C;  1IJW C;  2IA2 A;  1MNM C;  2BM1 A;  2F5V A;  3OYG A;  3GZ6 A;  4XOR A;  2XPW A;  3TMO A;  1NTC A;  1FPQ A;  1WQ2 A;  1MBK A;  2MD5 A;  4LK0 F;  1H9T A;  2BR2 B;  2NVQ J;  1P42 A;  1XMK A;  2L7F P;  4DZP A;  1ZGJ A;  3E6B A;  2R0Q C;  2E1R A;  3SJM A;  4LFB I;  1Z0V A;  3S3N A;  5IWA I;  3M85 D;  3P7N A;  2FSW A;  4DXL A;  1SMT A;  1W4M A;  5GAH J;  2XB5 A;  3RKY A;  4YEJ A;  1KQ0 A;  5JEA F;  4Y13 A;  3KRN A;  4I2O A;  4A3J J;  3GTG J;  4MQY A;  2VB6 A;  3OSG A;  3L09 A;  1BR1 A;  2QVO A;  4EVI A;  3VYU B;  5GAG J;  1IUF A;  2R7Q A;  3ASN H;  1Y60 A;  4RAF A;  1QGP A;  2L4A A;  1YTY A;  2PX9 A;  4BA2 A;  2H1K A;  3S1M J;  1POG A;  2IS2 A;  2LBF A;  4F92 B;  4XLE A;  4E70 A;  2KIQ A;  2Z16 A;  1UST A;  5FLX C;  3G6E I;  2HFS A;  1SEU A;  1G6N A;  2E35 A;  3CCE I;  5DUK A;  5CVI A;  3LST A;  2UUA E;  2HOT A;  3LWF A;  1QRY A;  2FF4 A;  2CW0 F;  4J19 A;  3GTP J;  1SAX A;  3ERE D;  2WAQ A;  2HVR A;  2K40 A;  4RGS A;  4P96 A;  3ISP A;  3MQ0 A;  3VFZ A;  5M3M J;  3D5S C;  4LLN A;  3BR6 A;  5E18 F;  1MMA A;  2YR2 A;  1Z5A A;  1BKN A;  1K79 A;  2UUZ A;  3ZQG A;  1S8N A;  2E2H J;  3PO2 J;  3P9I A;  5BMZ A;  3J7A O;  2JEB A;  5J4V A;  1HKS A;  1KQ8 A;  4FW5 A;  3CCR I;  1B9N A;  2DA3 A;  3HOU J;  5CQE A;  5CKT A;  5D6E A;  2AO9 A;  5E3N A;  4X62 I;  1JI8 A;  1W5S A;  2KIS A;  2HQA A;  2R7X A;  4ZYE A;  3FXL A;  4RA2 A;  4MHG A;  3HKZ N;  1K61 A;  3WU5 A;  1U2W A;  4PRV A;  5JFR A;  4A3F J;  4DV7 E;  5GPC A;  1BI3 A;  1MX0 A;  1S9H A;  2GQ0 A;  3K4M A;  2DW4 A;  5DM7 F;  2ZSH B;  2F2E A;  4G9Y A;  1VZ0 A;  1OQY A;  3JRB A;  2FNP A;  1MBE A;  1ON1 A;  4UUT A;  4D7N A;  3H0D A;  2R5Y A;  2HWV A;  1R23 A;  2JJ7 A;  1XTA A;  1RET A;  3KET A;  2KLO A;  2KZV A;  2YS9 A;  2ME0 A;  5EYR A;  3OY9 A;  2E7W A;  2KRC A;  3RKW A;  1I39 A;  1X1D A;  2BZT A;  2I5U A;  5L3F A;  2E60 A;  2DPU A;  1IRF A;  1FOX A;  2F4V I;  2OI2 A;  4A69 C;  4JOM A;  2K9Q A;  4LG3 A;  3AG1 H;  4D7M A;  3CF5 F;  2C37 B;  2H09 A;  3CTA A;  1TWH J;  2X6Y A;  5JEA B;  3S14 J;  5ELW A;  2QQ9 A;  2O03 A;  1ETW A;  3FMQ A;  1BR2 A;  1WFX A;  3PL8 A;  3EPZ A;  4BE2 A;  3CJR B;  1ZH5 A;  2DO7 A;  3DF8 A;  2QF7 A;  1W5T A;  3CJQ B;  3BG7 A;  4HDV A;  1P6R A;  1T8I A;  2E1M B;  2HTJ A;  5D5W B;  4WX9 A;  1KZH A;  1XSD A;  5L3B A;  2BR2 A;  2K9S A;  2IOQ A;  2JT1 A;  1JKO C;  1J9I A;  3ZZ0 A;  5A2Q Q;  4LIV A;  2LRE A;  3GTJ J;  1IZ1 A;  5F08 A;  4S05 A;  4FCY A;  2Y48 A;  1H9G A;  3WU3 A;  1B4A A;  1MH3 A;  3I4P A;  2K27 A;  2EFW A;  1KYZ A;  2R93 J;  1T0F C;  5ICG A;  4JI8 E;  1IN5 A;  4FX4 A;  2CV0 A;  3GO5 A;  1CQT A;  1VF9 A;  2JUC A;  4OIO F;  2BA0 D;  4W1U A;  3PS3 A;  3HC7 A;  1FBS A;  2LY2 A;  3JRD A;  1BJZ A;  1MW7 A;  1X1B A;  2NOG A;  1ZRE A;  1Z0E A;  4O5V A;  1D0Z A;  3K2Z A;  3T1H E;  2OUM A;  3ONQ A;  1U8B A;  3FXJ A;  4LF4 E;  2KRH A;  3LSG A;  2JVG A;  5LHG A;  4NNJ A;  4U3B A;  1LEB A;  1E0E A;  4XK4 A;  2HZD A;  3ELK A;  2PI0 A;  2K3P A;  2XKO A;  1ZLK A;  1OYI A;  4YY3 E;  3WTV C;  1USU A;  3LA3 A;  5D4S A;  2LC2 A;  1W0T A;  2RGV A;  3MCZ A;  5IPA A;  4HLX A;  5CQG A;  1P92 A;  2V1U A;  1CGP A;  2W82 A;  4HV5 A;  2CWE A;  3KP3 A;  3HG9 A;  1G3Y A;  4ZDP A;  5GAE J;  3EUA A;  4O6J A;  1IDY A;  5ERI A;  3J81 Q;  3E6D A;  1VQ5 I;  1REP C;  3J80 C;  2CRG A;  1S16 A;  2E5L E;  4RBO A;  1RIO H;  2ZC2 A;  3FHZ A;  5K5R A;  2EZK A;  4DR3 I;  1WJA A;  3I4N J;  2E1O A;  2X6W A;  4K0K E;  1IV6 A;  3TDZ C;  4KIF A;  1IDZ A;  4G7O F;  4FE7 A;  1ZXM A;  4ESB A;  3HUL A;  3M1C A;  1R9T J;  4ENM A;  4I99 C;  4JV5 E;  4UV8 A;  4M9Z A;  2ELJ A;  1UHS A;  4MU4 A;  1X3U A;  2Y9Z A;  4A6E A;  2WAF A;  3L7Z A;  3BZ6 A;  3CWV A;  2JEA A;  2HFH A;  4OO1 B;  3KE2 A;  2KDO A;  2PN6 A;  4B3R I;  3TO9 A;  3L7W A;  4A3E J;  1YI2 I;  2CQK A;  2FBH A;  4G7Z F;  3W6K B;  4XRF A;  2Q0O A;  2KHM A;  2CMP A;  1PP7 U;  2R7W A;  2DA4 A;  4DV3 I;  4BQA A;  4GYI A;  3VPR A;  5C0X E;  3RPU A;  1MMS A;  4U7D A;  5EGO B;  4A3G J;  1IBM I;  2IGO A;  2ZXJ A;  5LEJ A;  4ESF A;  1Z0T A;  3Q3S A;  5IT9 C;  2VKE A;  2BVM A;  4ETS A;  3ZMT A;  4ZJZ A;  3HDD A;  1U6G A;  4XOT A;  4XLN F;  3S1N J;  1AWC A;  4I0B A;  1HR0 E;  4Y33 A;  3ZM7 A;  5JEA A;  1A35 A;  1MND A;  2FQ4 A;  4HLY A;  2K9L A;  1YW9 A;  3BQZ A;  6PAX A;  4GKJ I;  3J7Z I;  3PYG A;  3BR3 A;  3UR3 C;  3BR2 A;  4X64 I;  2LY1 A;  4AYB N;  4CCL A;  4BQQ A;  1I1S A;  3K0L A;  4F52 A;  3TL4 X;  4B47 A;  3WU0 A;  4MQV A;  4ZYG A;  1NH3 A;  4JI1 E;  1MDM B;  2QEN A;  4UVC A;  3TO7 A;  3HOS A;  2ZCW A;  2O3F A;  3GEZ A;  4XR6 A;  4GGG A;  1X1A A;  1KQ9 A;  1B8I B;  4IHY A;  1PVG A;  2LH9 A;  3TO6 A;  5E3L A;  4RDU A;  4JI6 I;  1XX5 A;  3OYJ A;  4IOC F;  3ZPL A;  1BN5 A;  5M5X J;  4MU0 A;  1I5Z A;  3F8M A;  3H36 A;  3V42 A;  3OOU A;  1DAR A;  3K70 D;  1ETV A;  3FKI J;  4HYM A;  4I3H A;  2DT7 B;  2PMZ N;  2QWW A;  4AVZ A;  1Y39 A;  3KLN A;  4B48 A;  1RHY A;  5HS8 A;  2DDA A;  2KDZ A;  3DCF A;  1I1G A;  2FBI A;  5DV5 A;  3KYL A;  2M2E A;  3BLY A;  2A68 F;  2LYC A;  1XPX A;  2OZU A;  1X2M A;  4NQW A;  4LOM A;  2WC2 A;  2V7F A;  3HOT A;  2GIZ A;  4XTJ A;  3JCU C;  3ZN1 A;  5HS9 A;  2P7V B;  3OR1 C;  4IRI A;  5F6F A;  3OYM A;  3A2K A;  1WJD A;  2HXI A;  4YIR X;  3BOQ A;  1OJ4 A;  1N25 A;  3TP3 A;  1C0W A;  4DBR A;  2Z3Y A;  3LL7 A;  4ZC3 A;  1OCT C;  3C7J A;  1J0R A;  4PSX A;  2KZG A;  3OS1 A;  2DN0 A;  2HNH A;  4P5O A;  2FOK A;  3CDI A;  1L3L A;  1Z59 A;  3H9J A;  2LP0 A;  3IL2 A;  3UNG C;  3LAP A;  1Z0X A;  1UDO A;  2EK5 A;  1RUN A;  1IRZ A;  2DFH A;  1NHH A;  3HHG A;  2CQX A;  4LF9 E;  1X4O A;  2AQF A;  4ZVI A;  1GDT A;  3EYI A;  3QOP A;  4P9U A;  2XDV A;  4DR1 E;  3E1S A;  3G1O A;  4DNC A;  2JA7 J;  3KEQ A;  5LRR A;  2D45 A;  2LKP A;  3WG7 H;  1N34 I;  1IV8 A;  2WV1 A;  2EH3 A;  4AQY I;  4XIC A;  4MU1 A;  5FB2 A;  1D8J A;  2VBY A;  2GS8 A;  5IY5 H;  4DR7 I;  4A3I J;  2Z1D A;  4YG2 F;  2ZM6 I;  2HQ5 A;  4HQM A;  1XHK A;  1XXE A;  4BA1 B;  3K4B A;  4B43 A;  1FOY A;  2DA7 A;  2M0M A;  2HPM A;  1BL0 A;  1H7S A;  3R4K A;  5JEA D;  1OKR A;  2CUF A;  2A6E F;  3PYD A;  4DV1 I;  2K4B A;  4FW4 A;  3V8K A;  3W2A A;  2ZNY A;  3K4J A;  2M34 A;  4LCH A;  4P1W A;  4KHP I;  2EPF A;  2P5K A;  5JHF A;  4UUS A;  3CCV I;  4LIT A;  1S7E A;  2VXD A;  4A2U A;  1D1C A;  1X3W B;  1NG6 A;  4B3S I;  1Y4U A;  2MLK A;  3T1B A;  3FK7 A;  2ZBK B;  1Q1V A;  3ZMZ A;  4RLQ A;  4DV2 E;  1R6L A;  1XNR E;  3B02 A;  2Y0M A;  4HF0 A;  3K1M A;  3IRR A;  2YPR A;  2XAH A;  4XKB A;  1UEK A;  1KYW A;  2EIK H;  4M1K A;  2DT5 A;  2KRF A;  2LF8 A;  2JA8 J;  2PO1 B;  3K7A J;  1O3R A;  4FW9 A;  4JYA E;  4WWC A;  3GTM J;  3GBG A;  1GVJ A;  3V5R A;  3ZKB A;  2HOA A;  4L5I A;  2GA2 A;  4BE1 A;  5L3E A;  1WZ2 A;  5DRQ A;  1X58 A;  2EV5 A;  3U9G A;  2OU2 A;  1Z3X A;  4BEH A;  5LLQ A;  4E7S A;  3E6C C;  1X19 A;  3H3U A;  1RR9 A;  1GVD A;  3BR1 A;  4HNT A;  4DV0 E;  1N33 I;  2YU3 A;  1R1U A;  2R7D A;  3K85 A;  4XMY A;  1MDM A;  2L54 A;  1OYY A;  4PZJ A;  3K69 A;  1FEX A;  3PUF A;  2L7M P;  1BW5 A;  1KTV A;  3L1P A;  2UXB I;  2W84 A;  2GXA A;  3F23 A;  4HYE A;  4IEJ A;  2VON A;  1VQ9 I;  4X66 E;  1EH7 A;  2L7K A;  4GKK I;  2WAQ N;  2DOF A;  2WTE A;  3WTZ A;  1X2N A;  5IP6 A;  2VES A;  1U0J A;  1EH6 A;  1XGN A;  3V7S A;  5LHH A;  4V2F A;  4CCO A;  3Q6M A;  2Z5E A;  2GA1 A;  1J7K A;  1WH5 A;  2W7N A;  2MFZ A;  5CVU A;  4C2M J;  4DW6 A;  3E3V A;  4OX9 I;  1T0F A;  4BJT A;  2PO0 B;  4A3L J;  2DBB A;  2J5O A;  4FAS D;  3OIO A;  1HKQ A;  3HGG A;  4LF8 E;  1YS7 A;  2IAI A;  2DFF A;  4EJW A;  4IZK B;  5J8F A;  5BPI A;  1IBK I;  1D1A A;  1BBY A;  3PRY A;  4BY7 J;  1R71 A;  3LPS A;  1R6M A;  1VQO I;  2XGX A;  4MYT A;  1FWZ A;  2X85 A;  2HKO A;  2D1H A;  5EEH A;  1LUJ B;  3VSK A;  4Y52 J;  2UUB E;  2L9N A;  4M6V A;  2DA2 A;  4XLC A;  2V1X A;  4HSR A;  1FYM A;  2H27 A;  5DNL A;  5ILU A;  2H6B A;  3WU1 B;  2OPT A;  2FUG 2;  5C0X C;  2ZIT A;  2D5V A;  4IVN A;  3QPT A;  4XN3 A;  3QYF A;  4U3D A;  2VKV A;  1UDQ A;  2XEX A;  2CV2 A;  4QPO A;  4EM0 B;  3F8N A;  3FIW A;  3DPT A;  2W4S A;  4KUM A;  1RZ4 A;  5F04 A;  2Y9Y A;  5JLW A;  2X1E A;  5M5W J;  5LBQ A;  4IS9 A;  2HS5 A;  2X7I A;  3GZN B;  2ZKZ A;  2CGP A;  4LF5 I;  1HNW E;  4CDG A;  3JRE A;  1YRN B;  1N75 A;  4EAT A;  1JJ8 C;  1OR7 C;  3P3G A;  4NXM E;  4LLL A;  1ETX A;  5K36 C;  3VYR B;  4UXN A;  3HOY J;  4BXX J;  1MBH A;  1WSU A;  2HQN A;  5LGT A;  4LB5 A;  3CMA I;  1FT9 A;  1VQN I;  2IW5 A;  3I5U A;  1ETQ A;  3K9T A;  3RCO A;  2CQQ A;  2F48 A;  2ZSI B;  2K3F A;  1ZRD A;  1TLH B;  1QPM A;  1E2X A;  3F3X A;  4JI3 E;  1RKW A;  1MMG A;  1GXP A;  1OYS A;  3F8F A;  3AAF A;  2FMY A;  4AIH A;  5FRM A;  1R7J A;  2BW3 B;  4M9S A;  2HGC A;  1FSE A;  2JTV A;  2UUA I;  2XAJ A;  3ABL H;  1SFX A;  3ZQH A;  1EI1 A;  4OO1 E;  2QSG X;  1PYV A;  3HJE A;  1FP2 A;  3KEO A;  2V1N A;  3T8T A;  3DLL F;  5KHD A;  4IFD E;  4YFN F;  1SVM A;  5BPD A;  2XF6 A;  3DFG A;  4LFA E;  2HI3 A;  2KT0 A;  5FLX Q;  4KIC A;  2KQR A;  1R1V A;  2LLK A;  4DBQ A;  1KVK A;  4BAY A;  1WCM J;  1MKM A;  2VBX A;  4CYC A;  4AYB A;  2PJP A;  2ZXW H;  4R8H A;  1B62 A;  1NHI A;  1MMN A;  1A04 A;  5K36 F;  2O8K A;  2NN6 E;  3PSI A;  1FI4 A;  2DMN A;  5GP9 A;  3WU2 C;  3I64 A;  4OIQ F;  1XMQ E;  3K1J A;  1HST A;  1WPK A;  4MQ9 F;  2LR8 A;  1MD0 A;  2VE8 A;  2WY7 Q;  1QZY A;  1HA8 A;  4EJO A;  4P55 A;  3L2C A;  2KJB A;  4LGW A;  5LGU A;  2XGC A;  1RI7 A;  2E19 A;  5JHU A;  2EWN A;  2L4M A;  3HPH A;  4BBR J;  4CXF A;  4DV7 I;  2WAE A;  2UXD E;  2NVU B;  1BC7 C;  2VF3 A;  1ZR2 A;  4WXH A;  5GPA A;  3RDI A;  2HDD A;  5LL6 R;  2XAF A;  3MAJ A;  2C39 A;  5LFA A;  3BT9 A;  1BOB A;  3KP2 A;  2IXS A;  2XSD C;  2WP8 A;  2FOW A;  3ZMV A;  2EZI A;  2JEB B;  4DU7 A;  3IWZ A;  2PFB A;  2V6E A;  1RNL A;  1UAA A;  1HLV A;  3FM3 A;  2CS3 A;  2E71 A;  1YE9 A;  3V2U C;  2K85 A;  3CCM I;  4R79 A;  2O6G E;  5TIS C;  2DI3 A;  4UB6 C;  1Z05 A;  2G7U A;  1ZR4 A;  1W36 C;  1QPI A;  3KPH A;  4CZC A;  3WU4 A;  2E36 A;  3QT6 A;  2FX0 A;  5E8G A;  4BBS J;  4WCG A;  4A93 J;  4OIR F;  3ROU A;  2XF5 A;  4J01 A;  5LGN A;  2CYY A;  2DXI A;  2UXC I;  1S7O A;  3E97 A;  3D0S A;  1TWC J;  1FOK A;  3M6A A;  2ZME C;  1XCV A;  4KIS A;  4JI4 E;  4A0Z A;  2M7B A;  4DGW B;  3S1R J;  3FHN A;  3V8L A;  5ICE A;  2NOJ B;  2XRO A;  2VBZ A;  2XSJ C;  2VXZ A;  1B72 A;  1ZM9 A;  2AJ4 A;  2EIJ H;  3BJ6 A;  4X0G A;  3HUG A;  2DDB A;  4L9J A;  1JT0 A;  4HY1 A;  2BY1 A;  1LE8 A;  3KZZ A;  3M8J A;  2H8R A;  3D5L A;  1FNM A;  4JI8 I;  3GLL A;  2IPQ X;  3QYB A;  4A0X A;  1KKH A;  1GLN A;  4MTE A;  5LMU E;  2E2I J;  1N78 A;  1HNZ E;  3Q1Q A;  1LVK A;  4IZZ A;  5J1R A;  2M0C A;  2TRT A;  1FTT A;  1ZM3 A;  4JQF A;  5E1W A;  1G4D A;  3WTX C;  1JUS A;  2F4O B;  3VOD A;  1X3Z B;  5FWK A;  3EYY A;  4HX8 A;  1B63 A;  1MJA A;  4LF4 I;  3FMS A;  3QWL A;  5BS6 A;  3DBL B;  4LD5 A;  5EZH A;  3N97 A;  2RV8 A;  2M45 A;  5ICF A;  5E1X A;  2X1D A;  2GM4 A;  1R4M B;  3LSP A;  1JGS A;  4YY3 I;  1LQ1 A;  2YX4 A;  5DNX A;  2BW3 A;  1TTY A;  3M8E A;  2A5Y B;  2P8T A;  5IOY A;  1S7A A;  2ZJ2 A;  4GYG A;  2OC6 A;  3I59 A;  3CF2 A;  1DDN A;  2VJ5 A;  2R7O A;  2QGU A;  4U0V A;  4RM3 A;  4ASN A;  5J3L A;  3ZRG A;  1GHC A;  3IKT A;  2X9D A;  1MH4 A;  4JP0 A;  2JK3 A;  4XRS A;  4R1F A;  3FWE A;  2CUZ A;  2PMU A;  1HOM A;  3JAM C;  1G2H A;  2LK2 A;  1HC8 A;  4F91 B;  4L0Z B;  3T8R A;  5FGM A;  4F93 B;  1PUF B;  1E3O C;  1D0Y A;  3S15 J;  2E5L I;  2XVC A;  2UV1 A;  2XF7 A;  2DA1 A;  3V7C A;  4D1Q A;  1I27 A;  1WI9 A;  4K0K I;  2BM0 A;  4JI5 E;  1MMD A;  3BTC A;  4MU3 A;  4BDZ A;  1HKT A;  2M3A A;  1RKT A;  1IN4 A;  3TBI A;  1JGG A;  4Q5S F;  3KZI C;  4NXN I;  1D0X A;  3BJA A;  1IUY A;  3LFK A;  3J80 Q;  3DLA A;  4JV5 I;  3KYD B;  3E5X A;  2EFN A;  1Z0B A;  4E6K G;  2OQG A;  2Z99 A;  1H74 A;  4EQQ A;  3H92 A;  1JE8 A;  1FOW A;  1V4R A;  1Z0C A;  3JR9 A;  2LF7 A;  3ABU A;  2V79 A;  1H88 C;  2V34 A;  5F0F A;  1OYR A;  4IHX A;  1MU5 A;  2RVC A;  4LPF A;  1J2X A;  1ULY A;  4PJL A;  2GXG A;  2FU4 A;  5JI6 A;  2WY8 Q;  3OS2 A;  2XC7 A;  3BTL A;  1F43 A;  4DU8 A;  5H2F C;  3CP2 A;  2DFE A;  2ICW G;  1DPU A;  1VQL I;  3H1C A;  1WJF A;  4I0A A;  1XNQ E;  2OA4 A;  5J6X A;  1KGS A;  2EA4 A;  4MIM A;  2YUS A;  2DMT A;  3CCU I;  2G7H A;  4BHC A;  2K5C A;  2FE3 A;  1WJ5 A;  2P6T A;  4DPX A;  2PEX A;  1HR0 I;  2DMU A;  4HDU A;  4RAG A;  3OYD A;  3I54 A;  5KAF C;  2DT6 A;  4YHH E;  4EGY A;  3L7Z B;  5HDG A;  2BV3 A;  1Z6T A;  2JEA B;  4FHT A;  3SQN A;  2BA1 G;  5A2Q K;  1ZLJ A;  2CW8 A;  4GQU A;  2V4J C;  4B4C A;  2EIN H;  1UG2 A;  5EG0 B;  1KON A;  1IGN A;  5IT9 Q;  1B1B A;  2HPI A;  2E5N A;  3LSJ A;  5CVV A;  3CDJ A;  1R00 A;  4PRX A;  3BG9 A;  3PFY A;  4M9X A;  3HTS B;  3H9G A;  4DUZ I;  2YSR A;  4RPF A;  2M8E A;  4Y7N J;  4ENJ A;  3ESW B;  1SFE A;  4EJV A;  4IFD C;  4UUV A;  2RC4 A;  3O6B B;  1T98 A;  5C0X A;  2XPV A;  1A31 A;  1VQP I;  3NEU A;  1HW2 A;  2DTR A;  3PQJ A;  4IPA A;  3CLO A;  1SMY F;  1XGO A;  2H8W A;  2C38 B;  4GRI A;  2XIG A;  3HBL A;  5C3E J;  3MKY B;  2NN6 C;  2LOO A;  3HGY A;  4G94 A;  2Y0S A;  5D5V B;  1EA3 A;  3GTL J;  3COA C;  2QSF X;  3L9F A;  4XLF A;  1Z1D A;  2V26 A;  4V19 K;  1USS A;  3NQO A;  1BIB A;  2ETH A;  4HF2 A;  2H6C A;  3IUO A;  5DD8 A;  1OR7 A;  1QZE A;  5K36 A;  3B73 A;  3RQI A;  3TKY A;  1GT0 C;  3TW6 A;  4D0P A;  5C4X J;  2MGQ A;  3BG5 A;  3DBH B;  3HSR A;  1Q1H A;  1I6H J;  4U0Y A;  4DV4 I;  4BL0 B;  4I09 A;  3J81 K;  2QLZ A;  3W2V A;  4ZTJ A;  4M74 A;  4W97 A;  4EGZ A;  1XMO E;  1NK2 P;  5GTH C;  2E1C A;  2L5Q A;  4YFK F;  2UU9 E;  1I94 I;  4CH7 A;  3PFI A;  4HNU A;  4RGR A;  2NVX J;  1JHF A;  3CQZ J;  2VJ4 A;  3W2W A;  1GV2 A;  2VUM J;  1PUF A;  3UHM A;  1BI0 A;  3TDU C;  4DR1 I;  4HZF A;  4NQW B;  2HYJ A;  4P7A A;  3HPG A;  1YX5 A;  1FP1 D;  3ZKD A;  3AL0 C;  3NAR A;  3WHC A;  1Y1V J;  2OBP A;  4WUC A;  3K17 A;  3D1N I;  3LAJ A;  1FWL A;  2BHZ A;  1ZG5 A;  4P9F A;  4LFC E;  1APL C;  4QNK A;  2QQB A;  1NHJ A;  4JI0 E;  1IRX A;  2DA6 A;  2Z5U A;  3M7N D;  2QCO A;  4KN7 X;  2IS1 A;  2H1L A;  2QBY A;  4XOP A;  1SVO A;  4Q47 A;  2CZ9 A;  2STW A;  3T1Y E;  4B09 A;  1H89 C;  4FT8 A;  3VEP A;  5F1J A;  2WNR A;  3T0Y A;  1LPQ A;  2M30 A;  4FQG A;  3BDD A;  2CUE A;  3BC8 A;  3CC7 I;  3GON A;  2JSC A;  3C2B A;  3Q0U A;  2NVT J;  2X36 A;  2E7X A;  1D6T A;  2K9N A;  4L9T A;  3O3K A;  2HHH E;  4DV2 I;  1XNR I;  1PVE A;  3B6A A;  3LQR A;  3SDB A;  2MAB A;  3WGG A;  3WG9 A;  4F55 A;  1MSF C;  4RGU A;  3E0J B;  3U1Y A;  1IBL E;  3BR5 A;  1FMW A;  2HU9 A;  2GQQ A;  4BAC A;  2FXA A;  2PNZ B;  4DPY A;  2OZ6 A;  3QU3 A;  5L3J A;  5F0C A;  4JYA I;  3PS2 A;  2O0Y A;  4DR2 I;  1MBG A;  3K4K A;  3OR2 C;  1O57 A;  3IKV A;  4DYQ A;  2EIL H;  1HDD C;  2GO4 A;  1IRG A;  1Y8Q B;  1G3W A;  1QHG A;  2V1D A;  4DIQ A;  4UNO A;  2BHY A;  2QQA A;  3H3Z A;  2L2O A;  3GTO J;  4YEL A;  5A2Q Z;  3JTH A;  3NRV A;  5D5U B;  5EG0 A;  1DU0 A;  4DV0 I;  3ML6 A;  2K7L A;  5TRD A;  1IG7 A;  1R5H A;  2PO2 A;  4RGX A;  4PK4 A;  1R5G A;  3LOC A;  5K36 D;  1UMQ A;  4KN4 X;  3U1K A;  4UUS B;  1YHQ I;  2OCE A;  5HLT A;  1YIJ I;  1PDN C;  3V8J A;  1Z0G A;  2HDW A;  2LFB A;  1T38 A;  3KP7 A;  4L9N A;  2ZME A;  1N32 E;  5EEA A;  2BXY A;  3S93 A;  4JI2 I;  4FTH A;  3CUQ C;  2QQ8 A;  3H0G J;  4X66 I;  4QWQ A;  4KJZ A;  2XAQ A;  4BYY A;  1U5T C;  1YW7 A;  5DD4 A;  1HXD A;  3DTE A;  1JT6 A;  2Y30 A;  3HB9 A;  3QT5 A;  4II2 A;  2C38 A;  2I8D A;  3DEE A;  2M87 A;  1HCR A;  4NC8 A;  3OIQ A;  2DQR A;  2JPB A;  4J3D A;  2LVS A;  1SAN A;  3C3W A;  3OYL A;  4JK1 X;  1Y4S A;  2TCT A;  4BEH B;  3IWF A;  4B3A A;  4IOA F;  1ELO A;  2RNJ A;  2LKS A;  4M6Y A;  5GME A;  1FY7 A;  1ZAO A;  4M6X A;  2WW4 A;  4ABZ A;  4X62 E;  2BYV E;  2ID6 A;  3OTO E;  3O8G A;  2UUB I;  3PO3 J;  1DP7 P;  1VFC A;  1XSX A;  4C9Y A;  1TWA J;  4PDK A;  4ED4 A;  1EH8 A;  3J81 Z;  3WE2 A;  2LG4 A;  1F4K A;  4IHV A;  2PNL A;  2IVM A;  3V7R A;  3BRO A;  1TL8 A;  3PM1 A;  5FKK A;  5LEK A;  4N9H A;  4BS9 A;  1OCR H;  1N0U A;  3FBN B;  4JX5 A;  4DOZ A;  4KIT B;  4FE4 A;  1Y5Y A;  3ABT A;  2BEO A;  2P7C B;  4DV5 E;  3C18 A;  5C4J J;  4FIS A;  3CME I;  3ULQ B;  4B1R A;  2AQE A;  4RB3 C;  4XSZ F;  4LIU A;  2P0W A;  1WRJ A;  2PG4 A;  2EJR A;  1O4X A;  3UKG A;  2E34 A;  1V5G A;  3CJN A;  2LY9 A;  2RDP A;  4HPQ A;  5LHI A;  2ELH A;  2CQN A;  1ZM4 A;  3CCQ I;  3LQQ A;  4NXM I;  2Y31 A;  1I3A A;  4U7B A;  1A6F A;  4DZJ A;  5HNH A;  1Z91 A;  4I01 A;  3RZO J;  2DK5 A;  2AXT C;  2A2C A;  3R60 A;  3DQV C;  2R7Z J;  4MO7 A;  2P81 A;  1GUU A;  4LG0 A;  5HDN A;  3F8B A;  3CMM A;  4HNV A;  4D5C A;  4L5J A;  2JA2 A;  1YJW I;  1DGR M;  4HA8 A;  4HRI A;  2CSO A;  4CCM A;  3EUK L;  2X0L A;  4II3 A;  1H7U A;  4DPU A;  3DTK A;  4AWX B;  3HOZ J;  3M3Y J;  3RPU D;  2V6C A;  4BJ6 C;  4FWD A;  1F9N A;  3L2V A;  2VT3 A;  4C2U A;  3J7A Y;  2PNZ A;  3DKX A;  4M3G A;  1TC3 C;  4N3O A;  2F5C A;  1R58 A;  3I55 I;  2EV6 A;  1ENH A;  4AVP A;  1ZQ3 P;  1ZXN A;  2DA5 A;  2ME6 A;  1EKE A;  4LFA I;  1UDS A;  3FXU A;  2A05 A;  1ZYR F;  2LTP A;  3BG6 A;  1GXQ A;  2D2W A;  1XMA A;  2B9S A;  4I7H A;  1PP8 F;  2VOD A;  3S3O A;  3F0C A;  3CUO A;  1I6X A;  2GOM A;  2QEX I;  1XMQ I;  2DJI A;  3G4S I;  2RQQ A;  3SZP A;  1IN7 A;  3ZQ7 A;  1F5T A;  4EMD A;  4DUY E;  4HAC A;  4USK A;  3WTW C;  2BA1 D;  4N4O B;  3Q9V A;  2Q8K A;  3CLQ A;  4BQO A;  2R92 J;  2YU9 J;  3ABM H;  2F5F A;  2VC0 A;  4YII A;  4IHW A;  1J09 A;  2OTJ I;  2X4H A;  4L0Y B;  1YW8 A;  3J81 C;  1JUP A;  2UXD I;  1NG7 A;  4BGD A;  2OQR A;  3M07 A;  4HAM A;  2PNM A;  1FLI A;  1ZEL A;  4KMF A;  1VIS A;  1ZK8 A;  3KZY A;  3LA7 A;  3Q6N A;  3JRC A;  1UCR A;  3WTT C;  3PIP F;  2MD0 A;  4XKV A;  4RB1 A;  4NC6 A;  3E7L A;  3GTK J;  4B3X A;  1LKX A;  3WOD F;  5H20 A;  1ODD A;  2RAE A;  5EJC A;  3M85 G;  1W0U A;  5TJJ A;  3F72 A;  2MH9 A;  1FMV A;  3ZQF A;  4CYC B;  1VQK I;  4OZE A;  3HRT A;  1NK3 P;  3QP6 A;  3H3V K;  3OYC A;  2BOL A;  2OD5 A;  5CVJ A;  2EZH A;  4QTR A;  1ZN2 A;  1EA6 A;  1WHU A;  2J7K A;  4OOI A;  3GFJ A;  4MLO A;  3SHF A;  2JE6 A;  2VPR A;  4PJJ A;  4XLH A;  2VT2 A;  2N8G A;  2O1U A;  3ASO H;  3QT8 A;  5JEA E;  2IP2 A;  1YO5 C;  1MJ9 A;  1TP4 A;  2GWR A;  4ZZD A;  2HFU A;  3SEQ A;  3D5R C;  2A3S A;  4JI4 I;  3P9C A;  1KU7 A;  3X2Q H;  2R7S A;  3M7G A;  4NUB A;  1BM9 A;  1RC9 A;  3OWT A;  2C39 B;  1O3Q A;  4E7I A;  3A03 A;  3CC2 I;  4C3H J;  3W6V A;  3Q0W A;  1FTZ A;  3FX3 A;  2WP8 B;  1XGS A;  2O3Z A;  2BV6 A;  3J7A G;  5DTD A;  4MFE A;  3A01 A;  2O1V A;  5HNF A;  3HOV J;  4AIK A;  1X4P A;  2XRN A;  4LF7 E;  2NXN B;  3R61 A;  3RIR A;  3VB2 A;  2DQL A;  3BP8 A;  4FW3 A;  3G3Z A;  1FSH A;  5LMU I;  4XON A;  4UHT A;  1HNZ I;  3BJO A;  2VOO A;  4AIM A;  3HTU A;  3OYN A;  2QM3 A;  4E7K A;  2IGN A;  3OV8 A;  2GZW A;  1WJC A;  1OYW A;  2DEI A;  1BI2 A;  2HTS A;  2Q2E A;  4UVB A;  3ZP5 A;  1DP3 A;  2L7Z A;  2O61 A;  3J7Y J;  3K6G A;  3U1D A;  2CGE A;  1YG2 A;  4MDT A;  2CFO A;  2QZ8 A;  3K4C A;  5FKL A;  4IL6 C;  1ZG3 A;  3CP8 A;  1Y0U A;  4PGH A;  2UXX A;  2GBY A;  2WV0 A;  4TV7 A;  1W5C C;  3WGI A;  1TQI A;  5E79 C;  1B72 B;  1Z7L A;  3GLX A;  1W1W E;  3OIP A;  2I10 A;  4RS8 A;  4AU7 A;  3OYH A;  3JRH A;  5GMD A;  3H4L A;  3G2B A;  4MGR A;  1BIA A;  2DOA A;  3EET A;  2DOE A;  3BTJ A;  3HUG B;  3MD2 A;  3L2W A;  2XV4 S;  1LE8 B;  5FLX K;  4CCJ A;  4DV6 E;  1N36 E;  3BG3 A;  3IH4 A;  2O1W A;  1AKH A;  1KU3 A;  2VKD A;  1TZL A;  3BZK A;  3FBI B;  1I3Q J;  3O8H A;  1EV7 A;  4WXD A;  2Z2S B;  3NZK A;  3TQN A;  2BY0 A;  2IA0 A;  3ECH A;  2Y0S N;  5DCM A;  1GV5 A;  3OS0 A;  1Y56 A;  3A0H C;  2C6Y A;  3AG4 H;  1VI7 A;  2L3D A;  5CLS A;  2W57 A;  1Z7U A;  5DCF A;  2A5W A;  1U8R A;  2M5W A;  3JRG A;  4G6D A;  5CPR B;  3JAM Q;  1RUO A;  5FRN A;  3QQA A;  5KVR A;  5C0X F;  4BUP A;  2K02 A;  4A3K J;  4H0E A;  3ZZU A;  2LDU A;  1MZB A;  2P5L C;  1D5V A;  3I59 B;  4X6A J;  1S4E A;  2M4G A;  3K1N A;  2X1C A;  3FXM A;  2M9H A;  3HJC A;  2OAZ A;  2NVY J;  2RRE A;  1CF7 A;  3I3L A;  4LMY A;  3ABK H;  3E5U A;  3DEU A;  3QP5 A;  4YIF A;  3OL3 A;  2EIM H;  3CUQ A;  3MKW B;  3OMY A;  2Z5B A;  2ZFU A;  5F1R A;  4CHU A;  1U5T A;  4A3M J;  3JSO A;  4L18 B;  2BA0 G;  1OFC X;  1V5E A;  2CV1 A;  2OF7 A;  1XNQ I;  4ITV A;  1ORK A;  2VKH A;  4WF2 A;  2PJR B;  2ZJR F;  3GME A;  5EZG A;  3ZQL A;  2LJP A;  5FO5 A;  1LEA A;  4CIC A;  4YRV A;  2NYX A;  3WTS C;  3VOE A;  4BHP A;  5D4R A;  1ZGW A;  4C3J J;  2MSY A;  3ZQI A;  2E2J J;  3DWL E;  4E7L A;  4YHH I;  2CG4 A;  5HDK A;  4E4H A;  3LSR A;  4G8X A;  4DR5 E;  4IHS A;  3A02 A;  2DMQ A;  4BH9 A;  4GFB A;  2R5Z A;  4HEA 2;  3HM5 A;  2NPF A;  1QNT A;  1R49 A;  1J5E E;  3SZT A;  1Z5C A;  2HQR A;  4LCG A;  3FMR A;  3CC4 I;  2VJI A;  5GAD J;  1K47 A;  4ZYH A;  2HVQ A;  3K70 C;  3DU6 A;  2PBI A;  3E6M A;  3PNY A;  4E7H A;  1G59 A;  3RYP A;  2R7F A;  2HYG D;  2VI6 A;  5DEQ A;  4ZDO A;  5DUI A;  2XPU A;  4AUX A;  1IO2 A;  2MA3 A;  3HXL A;  4M71 A;  1E3H A;  1WVR A;  2QYO A;  2VQH A;  1S72 I;  1DU6 A;  5GTI C;  5AON A;  1HQC A;  5IT3 A;  4GO1 A;  2CG9 A;  4M3E A;  2VLA A;  1OMI A;  4Q4Z F;  2GIV A;  2P6S A;  3QAH A;  3LNU A;  2JZY A;  1JKP C;  3ZMU A;  4CA0 A;  1YHC A;  2EQR A;  4DV4 E;  1FJG E;  1SD6 A;  3VSL A;  3MKL A;  3L2Q A;  3P5J A;  5HVQ C;  4LF6 E;  5E8I A;  4EMS A;  3F22 A;  2CW7 A;  2NS7 A;  4PJN A;  3MZ8 A;  4ANJ A;  2VBW A;  1O3T A;  1NZ0 A;  4BY1 J;  1VI0 A;  2EFQ A;  5FLM J;  1LDJ A;  1K6O A;  2HKX A;  3IV5 A;  3JRI A;  4BQN A;  4WUD A;  2KKO A;  1HNX E;  2J65 A;  5C0X B;  3HYI A;  5FLX Z;  2UUC E;  1X1C A;  2BY3 A;  4DQ2 A;  2JQ7 A;  2XAG A;  3SFZ A;  2ECC A;  2XHK A;  3OYB A;  3FXR A;  1Y1W J;  4F7Z A;  1OLT A;  2CO5 A;  2WB1 A;  2JSP A;  1XMO I;  4RAZ A;  4FWG A;  4RAY A;  3RJP A;  4A3C J;  2FRH A;  2UU9 I;  1YJ9 I;  3H5N A;  4BU2 A;  1FC3 A;  2XAS A;  2FBK A;  3DKW A;  2WAD A;  4N9I A;  2X48 A;  5E20 A;  4C2T A;  1FNN A;  1RR8 C;  1O3S A;  2EZL A;  1A36 A;  1SD4 A;  4NB5 A;  1KIJ A;  3T1H I;  4DR6 E;  4Y15 A;  1ONV A;  4LOC A;  5B3S H;  2K4J A;  3J80 K;  1MBF A;  3S2W A;  2ZB9 A;  1SD5 A;  4FWH A;  3M1E A;  4EM2 A;  5K36 B;  3FXO A;  4LFC I;  3NWT A;  2QSH X;  1YIT I;  1VQ7 I;  2NNY A;  3FZV A;  3TP0 A;  1BOA A;  1W7P B;  4JI0 I;  1RPW A;  1HBX G;  2GOX B;  3GX4 X;  2DK8 A;  2KIU A;  9ANT A;  1BW6 A;  1Y0N A;  4A0Y A;  2E1M C;  3CJT B;  3KP4 A;  2RN7 A;  1JJ6 C;  3T1Y I;  4EEF G;  4IX7 A;  1J5Y A;  3B6C A;  3KP5 A;  3PUB A;  4FW6 A;  3OYE A;  1TW2 A;  4UTG A;  4KQV A;  4S0H B;  1QZR A;  4ZH4 F;  2VC1 A;  3RQ4 A;  3TOB A;  3BCA A;  3HZJ A;  4IJA A;  3KX2 A;  5F0H A;  2MBF A;  3HL2 A;  4GXO A;  2HHH I;  3FM5 A;  1WKM A;  5LMN E;  1IBL I;  4OAZ A;  3I58 A;  3CZ6 A;  2PJR A;  2F6C A;  2R7R A;  3MMY B;  2LD5 A;  1EJ9 A;  4EJT A;  4CGZ A;  4LF5 E;  3J7A M;  4B3T E;  2ZJQ F;  5K7Z A;  4Z2Y A;  3CO6 C;  2IRF G;  1R4N B;  2MC4 A;  3S2H J;  3DKY A;  5IT9 K;  4NHJ A;  2CQ7 A;  1YYV A;  4CUG A;  1HK7 A;  2BXZ A;  5HS7 A;  3S32 A;  3DP7 A;  2QBY B;  1IC8 A;  1U78 A;  4KT5 C;  2W48 A;  1EF4 A;  3S3M A;  3MWM A;  2WNR B;  4B44 A;  1P7J A;  1KU2 A;  5FRO A;  4ZYD A;  1IN8 A;  5ICC A;  2GAU A;  4IQJ A;  2EV0 A;  2LMD A;  1V3F A;  1G3T A;  2DYR H;  3HOW J;  2P5V A;  1N32 I;  2W00 A;  1Z9C A;  1LFP A;  3CCS I;  2DAO A;  5F64 A;  5DDG A;  2HKE A;  4Z7Y A;  4IHT A;  3H9Q A;  2FA5 A;  2Y75 A;  3M8F A;  4RM2 A;  5E3M A;  1RRJ A;  1DUX C;  3KP6 A;  3MVP A;  2IT0 A;  3MN2 A;  1QHH D;  1D5Y A;  1T95 A;  4MFD A;  3DTI A;  4MYU A;  4IF4 A;  3DU5 A;  1WWX A;  4BXF A;  4ISA A;  2KL4 A;  3BR0 A;  5FD5 A;  2R3V A;  2IES A;  2IOP A;  4MEY F;  2O5R A;  3VYT B;  2ESH A;  3TOA A;  1X1P A;  2PO2 B;  5DYM A;  4CCN A;  4CSW A;  4JI1 I;  1VQ4 I;  3M9A A;  4OO1 C;  1P7I A;  2COB A;  2VE9 A;  4E7Z A;  2JN6 A;  3OTO I;  4LLG F;  1WUU A;  1LDD A;  2AXL A;  2DEJ A;  2ZME B;  2AS5 F;  1O7L A;  2HVS A;  3E5Q A;  3GTQ J;  2E5Z A;  4JX6 A;  4JI7 E;  3OYF A;  1Y6I A;  4FET A;  2IGM A;  2JVH A;  5FLV A;  2KFD A;  1Z6R A;  1LFU P;  4IZJ B;  5BNG A;  3QT7 A;  4CYD A;  2FD5 A;  5BQT A;  1UZC A;  4DV5 I;  3CCY A;  2B7E A;  4PGG A;  4XN0 A;  3IP4 B;  2R42 A;  1N77 A;  2DTZ A;  3B78 A;  4ENK A;  2R4G A;  3CDH A;  2V9P A;  3J80 Z;  4G6T B;  5BR8 E;  1USV A;  1FX7 A;  3TED A;  2CU7 A;  3GUD A;  3S17 J;  2NS8 A;  3F21 A;  1STZ A;  3H5R A;  2R3S A;  2VQG A;  3KLO A;  1XS9 A;  1W7P A;  2L9R A;  1IF1 A;  3QPH A;  2F4M B;  4UV9 A;  3VWB A;  2M4K A;  1YOV B;  3F6V A;  1XG1 A;  1JXS A;  4L9V A;  4OO1 F;  1JUM A;  3MZY A;  2XGD A;  4DJA A;  3WTU C;  2UXC E;  3I53 A;  4IFD F;  1QBJ A;  1Y6Z A;  1XB4 A;  3MEX A;  4OMZ A;  5EF6 A;  3SDG A;  4LF9 I;  1K78 B;  4UVA A;  2A2D A;  5K5Q A;  3SEZ A;  5FD6 A;  1B6A A;  1K83 J;  1PKP A;  2L0K A;  4AD9 A;  3ZQQ A;  2DOD A;  2VQF E;  3PQK A;  2PQ8 A;  2NN6 F;  2VPL A;  1FWK A;  1TQP A;  3FK6 A;  4X65 E;  3JTG A;  4CCK A;  2OJE D;  2F1D A;  4OAY A;  4B3M E;  4OWR B;  3K2A A;  1ON2 A;  3O2P E;  3TW7 A;  1Y8R B;  1O7F A;  4I02 A;  4DR4 E;  2A61 A;  3MFK A;  1A6Q A;  1T08 B;  1L0O C;  3LSK A;  1SD7 A;  4OIP F;  1MG7 A;  1TW3 A;  3L2U A;  1HDP A;  5IT9 Z;  3A0B C;  4PFO A;  3LNQ A;  1JKQ C;  3IRQ A;  2HYF A;  3RSN A;  5K7H A;  1AOY A;  4USM A;  2AHQ A;  3GCM A;  1TT0 A;  3OYA A;  4HST A;  4S04 A;  3DBR B;  4I76 A;  4Y4R A;  2L9V A;  1FKA E;  3EUH C;  2V2V A;  2R7U A;  2VQE E;  3QU6 A;  2B63 J;  4LG0 B;  1B59 A;  2X51 A;  3AG2 H;  3JRF A;  2HK2 A;  1YLF A;  2NAZ A;  1D8K A;  4DUY I;  4FW7 A;  3CMY A;  4AM3 A;  3GWZ A;  3C2G A;  5D5X B;  2J5P A;  2D1V A;  1KA8 A;  2QKL B;  2JWT A;  1A5J A;  3F0N A;  5C0X D;  1R5I D;  1T56 A;  4I98 B;  4XLP F;  1OIS A;  4HW0 A;  3R6S A;  1KU9 A;  4HBL A;  1XCB A;  4C30 A;  3I56 I;  2Z9O A;  5DRR A;  5K7F A;  4LFB E;  3LMM A;  2DLL A;  3SYT A;  5IWA E;  5HLI A;  5HOD A;  1FZP B;  1UB9 A;  1R1T A;  2R7V A;  1XGM A;  3U21 A;  3ZCO A;  3KIO A;  1WGX A;  2FQ3 A;  5IYD J;  1QU3 A;  4Z6Y A;  3GFI A;  4AC0 A;  4RB0 A;  3WU6 A;  3JW4 A;  1LFB A;  4RB2 C;  4BXU A;  5DM6 F;  4HXZ A;  2ZXH A;  4DPT A;  5KNL A;  1F1Z A;  2VOP A;  2NS0 A;  2BBY A;  4XL9 A;  4XBF A;  4HX4 A;  3F6O A;  3C2H A;  3DXJ F;  3GYH X;  1YQA A;  2ZJP F;  1YIO A;  1W7P D;  4R1H A;  5J8C A;  2HK3 A;  3PYF A;  1DGW Y;  4HAC B;  4NXN E;  3G71 I;  2QUF A;  1IXR C;  2V8P A;  3Q0V A;  2XB0 X;  4IXA A;  2BGC A;  2IGK A;  3S8P A;  4F3Q A;  2PLY A;  5IOZ A;  2CUJ A;  1DQU A;  2COM A;  2FML A;  2OCC H;  4U88 A;  4CZZ A;  5TGT A;  3SZG A;  1WI3 A;  3OL4 A;  2X6X A;  1QO0 D;  4IZJ A;  2A69 F;  4IFD B;  2JT2 A;  1D1B A;  1RES A;  2E1N A;  3IH3 A;  5FKN A;  4H4K C;  5IYB J;  4RMN A;  4OIN F;  2KJC A;  5JLX A;  3FXQ A;  4LF8 I;  4CO8 A;  1ZGA A;  1NHA A;  4I6Z A;  4LF7 I;  4M3D A;  1TNT A;  3OYK A;  4G7H F;  2NN6 B;  4O3M A;  1H0M A;  4FX0 A;  1SVL A;  1ZAR A;  2F4I A;  3FXK A;  3BZC A;  2UXN A;  1QVU A;  1WH7 A;  3AKZ A;  2JE6 B;  3P3E A;  3HSF A;  4MNU A;  2C37 A;  2WA0 A;  3N05 A;  5CJ9 A;  4QPQ A;  1IW7 F;  4B8X A;  1G8X A;  5EKW A;  2KIM A;  5L3G A;  1K78 A;  3ZQC A;  3PNV A;  4A3B J;  5K36 E;  4WK8 F;  2MW8 A;  3PYE A;  4J00 A;  4EV0 A;  1YS6 A;  2IS6 A;  2M1B A;  4NBQ A;  4WUB A;  3NWS A;  2ELK A;  1ZG1 A;  1BA5 A;  3CES A;  4KMU X;  1ACI A;  2GO3 A;  3A01 B;  4DUZ E;  4LFU A;  2EB7 A;  4IKF A;  2VJJ A;  1JKR C;  5HOO A;  5FKO A;  2L02 A;  5HLG A;  2IA1 A;  4XID A;  4KIB A;  4KYW A;  2V2Q A;  4DV6 I;  1N36 I;  1HNW I;  3GVA A;  1ETO A;  1MJB A;  4PSW A;  2JA6 J;  2JA5 J;  3S2D J;  3LA2 A;  5F27 A;  1P9Q C;  2F4V E;  1WJB A;  2BE5 F;  3AG3 H;  5B5E C;  2JRM A;  2XRL A;  3LSH A;  3AL0 B;  3CD6 I;  2VL8 A;  2XUB A;  4LCF A;  4OKG A;  2Q2E B;  2WBM A;  5A2Q C;  4N4N B;  4ESJ A;  5K1Y A;  1LVA A;  1U2R A;  1W36 D;  3IAS 2;  5IYC J;  4D9J A;  2MC3 A;  4A5M A;  1XN7 A;  5H6Q A;  3CDL A;  1Z3Y A;  4ZYA A;  3ZZT A;  4JI3 I;  4N0B A;  2DPD A;  4GCV A;  1TWF J;  3ZMD A;  5DS9 A;  3D4J A;  3ZXS A;  1MBJ A;  5EDN A;  3OSF A;  2IBD A;  1UHM A;  5D8K B;  4PJ0 C;  5C44 J;  2K86 A;  5K5O A;  3FKJ A;  1TNS A;  3EDP A;  1S6L A;  1DPR A;  5KAI C;  3JSP A;  2ADU A;  3BPX A;  4X1E A;  3U2R A;  3HOX J;  4XKC A;  1AKH B;  2WB1 N;  4D5F A;  2A07 F;  4IZJ D;  3LFU A;  2L01 A;  4AID A;  1I94 E;  3CCL I;  4A3D J;  2FNA A;  2ISZ A;  1OCO H;  5DCM B;  1J59 A;  1P4X A;  2KPM A;  5D6F A;  2EFP A;  1QQI A;  2ZFW A;  3S1Q J;  5AIQ A;  4Q48 A;  2IER A;  3FIS A;  2XAU A;  1WJE A;  3C1D A;  3N4M A;  3BPV A;  3G1M A;  2O8X A;  4DYR A;  2IS4 A;  4C3I J;  5J40 A;  1SAU A;  2G0E A;  5B1B H;  1BI1 A;  1RR7 A;  4XM3 A;  5L3C A;  3B4T A;  3HKZ A;  3B82 A;  3RPQ A;  4U87 A;  3FF5 A;  2RKH A;  1AU7 A;  4DR5 I;  2W25 A;  1S29 A;  4ENN A;  4OO1 A;  1T33 A;  3PJR A;  5M5Y J;  1J5E I;  5FFX A;  1CF7 B;  1Z5B A;  1FJL A;  4IFD A;  1S5L C;  3A1Y A;  3Q5F A;  2UZK A;  3DEW A;  2HOE A;  2ZO4 A;  3CUQ B;  2Z5B B;  3I4M J;  2JPC A;  1JTY A;  3OOP A;  3DPU A;  3HEF A;  1G3S A;  1U5T B;  2TDX A;  2K9M A;  1JHH A;  1OCC H;  1OPC A;  3P3C A;  3WTY C;  2G9W A;  5EGO A;  1MGT A;  2NN6 A;  4DR3 E;  1XMX A;  2HR3 A;  5L3D A;  3Q9S A;  4AIJ A;  4ZTF A;  5E3O A;  1MIJ A;  4OMY A;  3HRS A;  3P76 A;  1Z21 A;  1OYP A;  3IH2 A;  3EQL F;  2Y2Z A;  1AHD P;  1QA6 A;  2VQC A;  5B1A H;  1V5F A;  4DR2 E;  2M8G X;  2MG4 A;  2STT A;  1FYK A;  3L00 A;  3RTR A;  1T39 A;  3HIF A;  4Z7C A;  2JRT A;  1FJG I;  5KCM A;  4A12 A;  2JUG A;  3H5A A;  3K4N A;  3WE3 A;  4EM1 A;  4LF6 I;  2R5Z B;  3ZN0 A;  1J75 A;  5LRS A;  1ITY A;  4JYK A;  3LSM A;  3ZR8 X;  1H73 A;  1P4A A;  1TT5 B;  2DU9 A;  2FJ1 A;  2EA2 A;  4B3R E;  3F9K A;  3B8H A;  1U9O A;  1UFM A;  1V54 H;  2YX7 A;  4NC7 A;  2LRD A;  3GXO A;  4FN5 A;  5J47 A;  1HW5 A;  4BE0 A;  5D8L B;  2CJJ A;  3R0A A;  3W3C A;  2HZT A;  2EFO A;  2RNG A;  4HQE A;  3BQY A;  1HF0 A;  1B8I A;  4DV3 E;  1HNX I;  2V2Z A;  3L2R A;  2UUC I;  1AA7 A;  2B0L A;  4JI2 E;  1IBM E;  1SFK A;  4Y3O A;  3BWG A;  3KFW X;  4KNY A;  2RQP A;  3K10 A;  1UG0 A;  2ZXI A;  2HOS A; 
#chains in the Genus database with same CATH homology
 3DD6 A;  4OO1 E;  2BA0 D;  4BA2 A;  5C0X B;  4IFD E;  2PO2 B;  2BA1 D;  2C38 A;  4OO1 C;  3H36 A;  5K36 A;  5K36 F;  2PO0 A;  2NN6 E;  4AID A;  5C0X F;  4OO1 D;  5K36 B;  3M85 G;  2JEB A;  4IFD D;  2PO0 B;  4IFD B;  3B4T A;  2C39 A;  1WHU A;  3CDI A;  2NN6 D;  1E3P A;  2JE6 A;  2WP8 A;  1R6M A;  2BA0 G;  1UDO A;  4OO1 A;  2JEB B;  5JEA E;  3GME A;  4IFD A;  4OO1 F;  1OYR A;  2NN6 B;  4BA1 A;  3M7N D;  4IFD F;  2C39 B;  5JEA C;  5C0X C;  2JE6 B;  3H1C A;  2WP8 B;  3L7Z A;  2WNR A;  2NN6 A;  2JEA A;  1UDQ A;  2C37 A;  4OO1 B;  2NN6 F;  1OYP A;  4BA1 B;  5K36 E;  5JEA D;  4AIM A;  4NBQ A;  5C0X E;  2PNZ B;  3L7Z B;  2WNR B;  2JEA B;  2BA1 G;  2C37 B;  2PO1 A;  5K36 C;  5JEA B;  2BR2 B;  3GCM A;  3CDJ A;  1E3H A;  3GLL A;  2PNZ A;  1R6L A;  3M85 D;  4IFD C;  3HKM A;  5JEA A;  5C0X A;  2BR2 A;  2PO2 A;  1OYS A;  1UDS A;  4AM3 A;  3M7N G;  5JEA F;  2PO1 B;  4BA2 B;  3KRN A;  5K36 D;  3U1K A;  5C0X D;  1UDN A;  2C38 B;  2NN6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...