3GLTA

Crystal structure of human sirt3 with adpr bound to the acecs2 peptide containing a thioacetyl lysine
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
274
structure length
274
Chain Sequence
GKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Human SIRT3 Displaying Substrate-induced Conformational Changes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase regulator
molecule keywords NAD-dependent deacetylase sirtuin-3, mitochondrial
total genus 93
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 3gltA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 3gltA01
3EA4A 5FYQA 4BN5A 3FSJX 4RMHA 1Q1AA 4FVTA 4IG9A 1OZHA 1JSCA 2IHTA 4K9PA 3ZG6A 2VJYA 4MPJA 4FEGA 1YC2A 1OZGA 1S7GA 3ZGVA 2A1UA 2OD2A 2OO5C 5DGDA 5MGNA 4F56A 5BWOA 4TWJA 2Q29A 4COKA 3D81A 1U31A 5EJ7A 4R8MA 1ZPDA 4JUFA 3GLSA 3JWPA 1O96B 3EYAA 4I5IA 4Y6QA 4ZP1A 4RMIA 4KPUA 2VK1A 1Q17A 2IHVA 2BRUC 3GLUA 2EZTA 2H4HA 4G1CA 5K6RA 1T9BA 3HWX1 4JUBA 4K9OA 4JD5A 3GLRA 4JT8A 1PYDA 3CLRD 1YHZA 1YI1A 3HWWA 2WVGA 1M2GA 4UU7A 4HDAA 2PANA 3JR3A 4GM0A 4JSRA 3K35A 2FR8C 1J8FA 1T9DA 2FSVC 3RIGA 1YBHA 1D4OA 4BVHA 2OD7A 3FLMA 2H2DA 1V5GA 2VBIA 1PNOA 2DJIA 2H2IA 4JUAA 4O8ZA 5BWNA 1XLTC 1DJLA 4F4UA 1UPBA 2JI7A 5AHKA 5IMSA 1T9CA 1YNOA 2Q5OA 1Y9DA 1PTJC 4BVEA 1T9AA 2C31A 2JI8A 2NXWA 5FEMA 2H2HA 4TWIA 4V1CI 4L3OA 3PKJA 4RJJA 4IAOA 1QPBA 2VBFA 4C7BA 1SZDA 1HZZC 5EJ4A 3OE1A 4KXQA 5D7NA 4V1CA 4K9QA 2AG1A 1POWA 2QQGA 4BN4A 1UPCA 2JI6A 2HJHA 3IAEA 5K2OA 1N0HA 4Q9DA 1UPAA 2OORC 4RMGA 1PNQA 3CF4G 4RJKA 4RMJA 4K9KA 2V3WA 4MPPA 2H2GA 1MCZA 2JIBA 2JLCA 2VK4A 2Q28A 2H59A 4BUZA 4BVFA 1OVMA 2WVAA 1PO7A 4MQ5A 2EZ4A 2Q5LA 2UZ1A 3CLUD 2X7JA 4X3PA 2OD9A 4ZZIA 3CLTD 3GLTA 4KGDA 5K3SA 3D4BA 2H4JA 5DGTA 1Q6ZA 4C78A 4GP9A 4UTXA 2Q5JA 4MPRA 1M2JA 3U3DA 3U31A 4UTVA 2JI9A 2Q27A 3F6EX 4FEEA 4K9LA 1MA3A 1O97D 1PVDA 5EJ5A 1S5PA 2H2FA 2AG0A 1YC5A 2FN3A 2PGNA 2VBGA 4V1CB 1YHYA 4BVBA 2EZ9A 1YI0A 1EFPA 4GM4A 5DEIA 1OZFA 5EJ8A 5K6TA 4JT9A 5MFZA 4BV3A 4FZ3A 4UTZA 2FRDC 4K9NA 4GPEA 4K9MA 1SZCA 4UTNA 3FZNA 3CLSD 4RJIA 4X3OA 2VK8A 4GG1A 4D5GA 4QPZA 1M2HA 2UZ1B 1PI3A 1M2KA 2JLAA 5EJAA 4L2IA 5EJ6A 2PGOA 3ZGOA 4UU8A 2H4FA 3PDHA 2A1TR 4J1TC 5EJ9A 1POXA 4HD8A 1YTLA 5EJMA 2W93A 1U28C 5BWLA 1ICIA 2QQFA 4JUDX 1Z8NA 4GM1A 4MZXA 4UTRA 1EFVA 2EZUA 3IAFA 4QELA 2FWNA 5MFPA 4UUAA 1Q14A 4BVGA 1E3TA 2B4YA 4J16C 4JU8A 4IF6A 4JU9A 3RIYA 4Y6OA 3LQ1A 1NM5C 1PT9A 1V5EA 1M2NA 2NYRA 4UUBA 1U2DC 2EZ8A 1BFDA 3EY9A 3F6BX 1V5FA 4BV2A 2IHUA 2WVHA 4QQ8A 3PKIA 4D5EA 3E9YA 2Q5QA 4JUCA 1U2GC 4Y6LA 3D7KA 5MF6A
chains in the Genus database with same CATH superfamily
3ELBA 4WNCA 1ANKA 4TXLA 1QH8A 4WN9A 2O5CA 2VJBA 1Z62A 2IYWA 3G8BA 3O31A 4QWWA 4WEQA 4X7BA 4X7RA 2AWNA 3ANNA 3SQDA 4S05A 4MS4B 1OXXK 1ZI6A 1F06A 2X41A 3C3BA 1K5PA 4JSTA 4WGFA 3R9WA 5EMKA 1RZVA 3F74A 3IJPA 4O2BF 2PSSA 1XC7A 1T0BA 3SQNA 1NSTA 3ZGXA 1GPBA 5KC9A 3KV3O 1X42A 3SJBA 3LY9A 1Z29A 2R44A 4IX9A 4MW6A 4ZXFA 3THXB 2ZKLA 1EU1A 3TBHA 5HM8A 1G38A 2AE1A 2H4HA 3BCRA 5CP8A 1I6MA 2QA5A 2B4AA 1X9IA 1YR2A 5TARA 1IUKA 4RLFA 3WZLA 5I7WA 3OC6A 3ONEA 4FE3A 2GF9A 2UKDA 4DCGA 4DDVA 2F2TA 3N9IA 1C5KA 1D8AA 2VRCA 1XA4A 3OQOA 5TX7A 2CBZA 2GM5A 2RJ3A 2ZSHA 5E1OA 2E4XA 1T5TA 2D00A 3QYFA 2YZNA 5AO9A 2EFDB 2Y27A 2ZIWB 3AV3A 2OE2A 1NRJB 2FSVA 3RBAA 4BBZA 3FI0A 1L9XA 4E1VA 2KQUA 1W96A 1N2XA 3FHLA 2FEXA 4JBYA 4Q4JB 4LDJA 3X1WA 4KR3A 1E4EA 1U1EA 3HBLA 3NTQA 5A04A 4AN1A 2HA2A 3TGPA 4MLDA 1E6WA 2AN3A 3WL3A 2Y3IA 5TC4A 4Y6GB 5CA0A 3QU4A 3GQVA 3UQYS 3CONA 4F4HA 4F92B 1Y37A 2DHQA 4JKYA 5JS2A 1VB3A 1ZSVA 3BIJA 4J0JA 3PTAA 3BWEA 3PZBA 4YO7A 4BP8A 1A96A 3CJTA 4ES6A 4CLRB 5TRTA 3OQ1A 1SIBE 3UH0A 4E15A 3X2SA 1KEWA 2UUCB 1MRNA 3NAQA 1VGVA 1EUZA 3C6KA 3WBKA 3KQLA 2P9HA 1KH3A 4G67A 3AKYA 3OPXA 3L8ZA 3TW0A 3EPHA 3RAFC 3M2PA 4R01A 4TZKA 5HIMA 5DW3A 3H5IA 3HHPA 4U02A 4HSEA 3W5UA 3A6PC 3P27A 2I62A 2YVUA 2QV7A 2IOHA 2PGNA 5I9LA 3DHNA 2Q99A 4G0WA 5EHGA 4BVBA 2JHGA 2ZRNA 3P0HA 2Q07A 2VDKB 3H1EA 3PFNA 4OQEA 3L6DA 5SICE 1IN8A 2HNAA 4R98A 3W2FA 4NZNA 4MGEA 3A10A 1Y6GA 3IQEA 1LFAA 1CR6A 1ZWLA 4KK4A 1UIMA 4PZAA 1D3AA 2CN1A 4QU5A 4F2GA 5JC1A 1NE7A 2Y6VA 2P0AA 3AUSA 4MQFA 4P7JA 4DXDA 4B82A 3SN6A 1QIIA 3EFBA 3LT2A 2VDLB 4NHEA 2HHJA 4ZD6A 3HVHA 4PSDA 5A5VA 1EHIA 4FMCF 1LTQA 4FOTA 5E4TA 1EK1A 1DAMA 4JL6A 2OXIA 1ZHOA 1T9KA 1QANA 4Y6SA 2P6RA 4JZYA 4WE3A 2QMEA 3PCTA 3K5HA 1E3TA 3WHIA 3VMFA 1KU0A 3K2EA 4EM6A 1XV5A 3NHKA 5BRNA 3O4RA 4K88A 4NOJA 1MJGM 2YHUA 1V5IA 2RGRA 3A8TA 3TDMA 3VKFA 4X20B 3WBFA 1E99A 2WG0A 3N2GB 3R41A 1G6OA 1VIMA 5IM4F 2KYRA 4RQTA 3HR4A 3C4JA 4NTZA 1NDQA 1YDMA 5IC6A 1P5HA 1JIXA 1M83A 2GTIA 3OCVA 3R7LA 3HACA 4GBJA 3GA0A 2A9JA 4TWRA 4KOEC 3WGJA 3WTBA 1Q0PA 5T64A 2O6LA 4RMNA 4PSVA 4X1IA 2XEXA 3ICCA 4WXPA 4Y8VA 5SZKB 3UPTA 3R3VA 4P7FA 1AY0A 3LUAA 3HB1A 2O8FA 4TV9F 5JWRA 2A94A 3L01A 3PNPA 1P0CA 1ZJ5A 2Q1SA 4GMGA 2FPPB 4TL7A 3C48A 3EDOA 1NWHA 3TRIA 5K05A 2BAGA 4OQNA 1E9DA 5H59A 5TMEA 1N8KA 2QRJA 3HYTA 4NULA 5CFRA 1QHEA 3GLFB 1S8OA 4DC1A 3TCKA 4QJ3A 1XGKA 2ZZKA 4K28A 5AI0A 1K0UA 4MI1A 5DNAA 2H1FA 4KSBA 4IHAA 5JFOA 4N4AA 2QPLA 3VDRA 4D9CA 3UW1A 2Q5OA 1RLTA 2IGBA 2AOWA 2Q6TA 2OLKA 3IDOA 3K0FB 3RRJA 5KYYA 1FLAA 3RVQA 2NTEA 2N0SA 1FU4A 4H7KA 2QNIA 2FMHA 3STYA 1E5LA 4LX0A 2P2LA 1ZUD1 3DE2X 3I23A 1YE5A 4X1KA 1IU9A 3LUJA 3P2OA 5ALZA 2OORC 3AHHA 1KC3A 5KKAA 3GEGA 1KY5A 1Z6GA 3R9KA 1RTTA 3OHSX 4LQ4A 2W42A 1SO8A 4CMEC 1UC4B 4LHVA 5K4AA 2OV3A 4Y2YA 3TQFA 2JJ1A 1JG4A 1W49A 3BD9A 1A8IA 1WB9A 4PWYA 2Z6QA 3PJEA 4P2BA 3O6VA 2Q50A 4QASA 5DF1A 5AQEA 4U9IS 3KL4A 1YV9A 2DC1A 2FOIA 4L73A 1LWOA 1EB8A 1F6DA 3EXHA 2PS1A 4POAA 4QQKA 1Y0BA 1N4DA 1Z3IX 3B7PA 4HADA 1A27A 5JSZA 2DSNA 2YWGA 4JBWA 1W87A 1L5ZA 1RXSA 2Q4DA 1BMTA 1OLSB 2G6TA 5TB5A 1FUUA 5B4VA 3D6MA 2IU0A 2GM4A 1SD2A 2ZYIA 4YRQA 3O0TA 3UMSA 1OYWA 1SZCA 1XWWA 5AQ1A 3JR7A 2O3UA 4JVLA 3ZN2A 2G40A 2OCIA 5AIBA 3DAHA 1R3UA 1U98A 4NV3A 3Q88A 4M0EA 3EXFA 5GONA 1CEEA 5HGXA 2AKEA 3G7SA 1ICIA 2V97A 4Y9RA 1UFVA 3NYIA 5A4DA 1AZLA 1S8AA 1FLVA 4Q03A 1U8AA 3KC2A 5TQ0B 5DNCA 2UYGA 5AHWA 2GBLA 1VLHA 2GN2A 4I99A 3PHLA 1LX6A 1G17A 4Y2TA 4BBJA 1G4UR 1DKMA 2GR9A 3MGAA 3W9SA 2X86A 4DDMA 4DT1B 5KNDA 1WBDA 1AE1A 4LJAA 3LX4A 1GP2A 4RK7A 3U7QB 4BO1A 4X65B 3DFKA 1N7GA 4BWGA 2ZVDA 2W6QA 4CWAA 1NYLA 2A0YA 1KI8A 3O3MB 4RKFA 5FD8A 4AN4A 5F3WB 1PV1A 3NGXA 4EECA 2JFVA 1GXSB 2LW7A 1UZMA 2ZXFA 4O08A 1HNZB 4GPAA 3CB4A 4IIJF 2IXEA 2WABA 3GPIA 4N8EA 3NVAA 4RZUA 5TQJA 4UD6A 2PIDA 5IJZA 5BR7A 3LHDA 1L4NA 4GZ6A 1N6PA 5JDIA 4DGQA 5JVDA 5FTLA 1H85A 3U44A 1N1GA 4ZRMA 1JLRA 1A5AB 1GL3A 1WVIA 2GBGA 3HM9A 1ZVQA 3EZ9A 1IY8A 5EWLA 5AHXA 3TRHA 3CLSC 3GYBA 4BGVA 5KNCH 2PUBA 5E95A 4Z2AA 4BMSA 2KM1A 4II3A 3ESBA 2RHMA 3P9KA 3RC9A 4JB8A 3S1AA 2JKZA 2BGWA 3VC3A 4BMVA 5B6IA 3OP4A 1Q0UA 2IXBA 4EFLA 3FOZA 3LPCA 4DLUA 1AX9A 4OFWA 2QPTA 3A37A 3E7PA 3V46A 1GL7A 3FUUA 4E5PA 4AQDA 4GKAA 4QUDA 2JFQA 3H2KA 1N9GA 4LNHA 1K9SA 1ZBQA 3MAJA 3GGDA 4B3RB 1C8VB 1E58A 3HP4A 2QTHA 2VBFA 1XXHA 3T5MA 4ZHSA 5SY4A 4F9TA 1X87A 4QBTA 1USGA 2VSFA 1FCJA 1PE0A 3AKCA 2C7VA 3CS3A 3DOCA 4DMRA 4MEAA 3T6KA 1R50A 3N0WA 1Q7CA 1RAIA 4F9GA 4O0LA 2AMJA 1FYVA 2E4YA 1JBKA 1C4XA 2WSYB 4BMZA 4BNIA 4DW8A 1O57A 2I99A 2QTZA 5EIOA 3IP9A 4LHWA 3MJVA 2ZB8A 5M34A 5LCXA 2YMLA 3BAFA 2JDIA 1EFVB 3BFJA 2IBMA 4E4TA 3H5TA 3WLLA 5E9QA 2Z6UA 4LRWA 4GKKB 1C2YA 3DMNA 3FCUB 5FWDA 3QI7A 3N8NA 2F1IA 4BATA 2BHLA 4QUHA 4MLCA 4IV8A 2G08A 2MDTA 2O8DA 3DV9A 1ZP6A 1P1HA 3WGTA 2Z8XA 1II8B 4GZ3A 2Q8PA 4LE1A 1KZHA 2XHEA 2RH9B 3BDVA 3EVAA 5NULA 1V11A 4O4IA 1W36D 5FLKA 4ZT7A 2HT6A 1YBVA 4ZVSA 3IE1A 1EVJA 1DAEA 4TS1A 1MD9A 2G8NA 1BG6A 1H2AS 4X1YB 2NXJA 1MC1A 3V4ZA 1PKEA 1N0UA 1HR0B 5FLXA 1O08A 2C9YA 3STVA 3ZD9A 3FVVA 2VZLA 1A9XB 2FWBA 4UAGA 4PZUA 1ECBA 3F3YA 2UVPA 3VR0A 4QDJA 2H6EA 3B60A 3N05A 2PWPA 4X45A 4EB6B 3KE8A 1I3CA 1XCOA 2B4TO 1ORIA 4KXMA 2WFZA 4H3SA 3FSGD 1EDEA 4KC0A 4OJQA 4V0NA 3KT3A 3TOSA 5CDGA 2ZTHA 3O4VA 3LU1A 1T6BY 1NY6A 2ZPAA 3L6OO 3P2IA 5AI6A 4CHTA 3S40A 2BEVB 2Y1LA 1JJ7A 1SIUA 3SJZA 4JENA 1Z34A 4MUFA 1TU0A 4AZ3A 4D3DA 4F21A 5K8VA 3FIUA 1KWGA 4X60A 3RSFA 5EE9A 3ZU2A 5IAAA 1YRAA 4PBRA 3V5NA 2J41A 1OUMA 1ADGA 3KQWA 3VO2A 4LPSA 4IEFB 3WB2A 3OEED 4PAMA 1OZHA 3IUEA 1ODFA 2DUJA 3CUYA 2Y1EA 4XQCA 1V1MB 2PU5A 2RIPA 5DZSA 4XARA 1H2WA 1RWPA 2D74A 1QR2A 1SXJD 5FRDA 3KSUA 2QYTA 3H75A 4GX1A 3OJFA 5ED4A 1AQUA 1UJ2A 3DP9A 4I1RA 3NIBA 1ZPDA 1E3SA 1OD6A 3EFOB 3R3YA 4DADA 4YPVA 1O96B 2I22A 4YCNA 4MUGA 4IDNA 2HD4A 4KPUA 3CX3A 4OA5A 5FUVA 1KHHA 3PRJA 1YHNA 1Z7BA 3T41A 2I91A 1JFLA 1M1YE 6YASA 3AR3A 3KPJA 5JNVA 2JFFA 3HLYA 3E1GA 3LOUA 2VXCA 1E0DA 4J91A 2OYCA 3WWZA 1Y5LA 3NBFA 5EE3A 3JPYA 3SK0A 2IXFA 5E4FA 3W8RA 4RKQA 4BBAA 5A4AA 3TPCA 4GOMD 3W5IA 1VHLA 2QGFA 1BTOA 4UEJA 4DIFA 3GFQA 1KZ1A 3L02A 1HOXA 5EYPA 1ODSA 1HSZA 4HH4A 1VDMA 4KQ6A 2W48A 2ZZNA 2R66A 3R09A 3Q3CA 1KQPA 5F5XA 2FVYA 1KDTA 4PLHA 4MKHA 3BWDD 1S1CA 4XWOA 3HN2A 2QTVB 1XZBA 1PIWA 3DM5A 1C0PA 4B4OA 4P4NA 1D2RA 2VA9A 1E3MA 2XY4A 2QT9A 2I4LA 3GROA 2KSQA 3WKAA 3CZ4A 4HLNA 3TZBA 4OATA 3F2IA 4L74A 5DX1A 5A4MS 3EVFA 1IBKB 5LP6A 1FEZA 3L8CA 2JJYA 4ENRA 1US8B 2C1XA 1TLTA 3ED5A 4M9ZA 1RYFA 3SHFA 5A03A 1DC8A 3Q6IA 1XCPA 3H16A 4JI2B 3VTZA 3ZIUA 2FA9A 3AF1A 4MP6A 1YH3A 1PEKE 2FN4A 3T4EA 4EFNA 3BXOA 4QGHA 2Q5JA 4FOSA 3CE9A 1A9QA 1R9GA 3BHNA 1YIDA 5J9FA 4J43A 5GAJA 1WP4A 2B1RA 3L0CA 4AO8A 4DUYB 2E9SA 4M88A 2J6BA 2B3DA 2DUNA 2PE5A 2I4NA 3IVMA 3K5WA 4EQ6A 1CF9A 5D5PA 4IGKA 1UBJS 4G89A 2NXCA 3I04M 4HAOA 4OB8A 4XRRA 2GA9A 4LZNA 4R1SA 4UBKA 1VBKA 2ZULA 4KNVA 3BIXA 1OLOA 2ZUEA 3QFHA 3OPVA 5DHUA 2D1FA 3DBHA 5HS4A 1XQ6A 3QX9A 3TEJA 1US8A 2NO0A 1E2GA 2Y1KA 3IXLA 4HOYA 3Q7QA 2XH8A 2H1VA 4PQGA 2IDKA 3HB4X 2F55A 4XB6B 2PY6A 2ZS9A 1JDBC 3RKSA 3UT5A 4A16A 4NJMB 1Z4LA 5KYVA 2KW5A 1R64A 3OZFA 1F6WA 5D2CA 2I6FA 3ROFA 3UGQA 2X9NA 3KPWA 4QPCA 4WY8A 2I6GA 3GFTA 4NE9A 4HNVA 1YE8A 2BFBB 3UV7A 3ND6A 1JLHA 2BEWB 4Z0HO 1F8GA 3K2QA 4KTTE 2W4IA 3SE0A 1A9SA 2H3HA 3O3CA 1RJEA 5AJZA 3L93A 4EYEA 5KVSA 1XF9A 4MDFA 4IVQA 3DH0A 2F4VB 4YRTA 5TF0A 3GFFA 3U1VA 1E6KA 4RK4A 4HRAA 1Q2UA 2AXQA 3EA4A 4M21A 1RWMA 1SXHA 3PXAA 4LHZA 5F1OA 3C2QA 1PK7A 1QRTA 3Q7SA 3F1LA 4HAUA 1Z06A 5G4KB 1CVLA 1Q84A 5I8PA 3REQB 1M6VB 1SNYA 3E1KA 2NU8A 1JHOA 3LUHA 3PGKA 3GLHE 1J7JA 2OAQ1 1N2IA 5DYWA 2XDQB 2K4MA 3WY9A 1RWNA 5G3ZA 4E11A 3VR1A 4PSUA 2X77A 2H7YA 3LZDA 4ZJUA 1HBJA 4FP9A 4EHNA 4PX5A 1PAUA 2GF0A 1R7RA 1U7ZA 2VK1A 3KAKA 4KIFA 4G1CA 4ZI7F 5KTYA 1Y6FA 2BJVA 2WKRA 3GQBB 2B1IA 2QYSA 2X0RA 5ESDA 5I7SA 5KQLA 3U4QB 2B4QA 1JEYB 4J76A 3DAPA 3HXKA 1O5TA 2ZWPA 4IY1A 2MJLA 4GI2A 3WNDA 2YWDA 3PBKA 5HR5A 3ETEA 5DEOA 2AOUB 3LVBA 1GNPA 4QBIA 3KTAB 3VQTA 2QTLA 4YRFA 3H1TA 4F4UA 1GTL1 3G0GA 2FPSA 4EZBA 4B71A 3MS4A 1PFGA 3HP7A 1QP8A 4KUEA 1NUSA 4GVPA 3ZE1B 3R8FA 3GX1A 5GVRA 3GZNA 5HJ7A 3F73A 4LGVA 1H2BA 4RF4A 1Q12A 3SLGA 2VJOA 3F5MA 2D2FA 4D8YA 2WWGA 3EXEB 1VMDA 2ZCVA 1FDOA 3QNMA 5ILQA 4BGIA 3CEHA 4BNWA 5BUQA 7MDHA 1CRWG 2NZYA 4NIMA 3D9QX 2V7WA 3RBXA 1VE7A 1TVCA 4MV6A 1ZJ6A 4ZQFA 5BV7A 1M34E 1XLUA 5D3MB 5M5BA 3HLTA 3OEHD 1O0CA 4I9NA 3V2HA 3IPAA 1RHRA 2J4FA 4IXDA 3AEUB 3DFUA 2PBLA 2WQZA 1IN4A 1KZYC 2CNKA 2ODQA 2DFNA 4JX9A 3AC0A 3MJRA 5ALFA 3IE0A 2B0CA 2VF5X 3OTOB 3P0IA 5JAOA 1LSUA 3I5XA 3OH8A 4B79A 4OTZA 1G7SA 2I6TA 1MXFA 2YJ4A 3JD3A 5DRYA 4CIVA 1RYYA 3A70A 4P54A 5JMTA 1Y42X 3KUUA 1BU8A 3N2ZB 1OBHA 3A4TA 1E7WA 2ZIVB 1G8JA 3NEAA 5MFZA 4F3KA 3E3MA 5LQRA 4ZJYA 2CJPA 2XE7A 4MB6A 2ZBGA 3S55A 1A76A 1PBNA 1WUKS 3VZPA 5SYMA 3WQBA 1P73A 2VP6A 4MVXA 1VI2A 1YASA 2PA3A 2IS2A 4YUWA 1LTKA 3VH3A 3QVKA 4A23A 5FAKA 5JJBA 3DM9B 1GGNA 2XUFA 1U6JA 3R8CA 2JH3A 3E4DA 3ID6C 3S68A 2QEQA 5JQGF 1O8BA 4H6VA 1SUDA 4JKIA 4RVUA 2I29A 1MJFA 1CNMA 1UK6A 3JZDA 3JVIA 4YR7A 2WJZB 4IV0A 4J9VA 4MUEA 1QO9A 1AF4A 1LXCA 3MBOA 2MCFA 3V55A 2IYEA 5B4TA 1WAMA 4W7IA 1I8TA 3QEOA 2Q3DA 3I5MA 4EUEA 3PB3A 1ZNXA 1JFRA 3KJHA 1M67A 5FULA 4YJHB 3KEOA 2A1UB 4ZCMA 2X58A 3FOEC 1KHTA 5EWMA 3P71T 4PSCA 5JISA 2V65A 3EIQA 2KLHA 4V0LA 3PCRB 2R7KA 5BOSB 4CKEB 1JSLA 1KRXA 5DTJA 1X38A 5BSFA 3WO0A 3TOCA 3C3XA 1W88A 3DZBA 4MRSA 1GSAA 3BF7A 3W2IA 4CM4A 1A9OA 4O29A 5WRFA 4E94A 3L8GA 1M6HA 1AB5A 3K32A 2GZHA 3CGWA 2O2ZA 3JQPA 2F59A 2WR8A 4C6RA 4DG9A 3ZIAA 4BP9A 3EIUA 8MHTA 4IQ0A 3MCAA 3RS4A 3PGVA 2YR0A 6ABPA 4JVSB 3FDIA 4Q3NA 4QTTB 1M6NA 1EAYA 1NVBA 1ZK2A 2P7HA 2ERYA 1NLZA 2HFJA 4EATA 2GVNA 3CRZA 4I6JA 4CCYB 1JALA 2QT0A 4MVJM 4MUNA 3F4KA 4HWKA 4M9UA 1KJJA 7ADHA 3ZWCA 2OOSA 2CFCA 1C1HA 5CH5A 4CQMD 4S12A 4XFJA 2V0NA 4KQHA 4ZTBA 1U3CA 2HMYB 2Q0SA 2TS1A 1ZL0A 1X7ZB 3QXJA 1GN9A 1WO8A 2GZRA 3DKVA 2SNIE 2P9GA 3JALA 3IMGA 3FHJA 4NEGA 2QLTA 3F0TA 4UMVA 3IEPA 4JEIA 1ETHA 1AGYA 1KP9A 2OCAA 2BKVA 3UWDA 1BC5A 1F3OA 4H7FA 2AL7A 3ZHZA 5FJIA 1AB6A 1M72A 4UHEA 3Q2OA 3QLEA 2P40A 2RK4A 3F47A 1X19A 1EBUA 3AM1A 4B8WA 3HC7A 1L4YA 2P9BA 4CM1A 2CD7A 4ZVNA 4Y0AA 1TKCA 2G07A 1GOTA 3HYCA 3PGJA 2HRCA 1NBIA 4LY6A 1K5GA 1C9MA 2AF3C 3W06A 1P75A 2BSAA 2BISA 2YJ6A 3E4CA 4IOJA 4P1ZA 3BMNB 5CAEB 1M1YB 4A1FA 2VF7A 3W2EA 1JLMA 1U2QA 2EHDA 4GKJB 2YXBA 1O97D 1C0LA 1Y89A 1AS0A 2I78A 2P8SA 1PUJA 2PT7A 5ALUA 3VHRA 3C16C 2P2ZA 1FFXB 2Y2VA 1BH2A 4JLWA 2H1WA 4ENVA 1T4DA 2I66A 3U7QA 2V7TA 1YQDA 1XZPA 3F7NA 1CUDA 2ZE5A 3F67A 1C9KA 3ED1A 4OQMA 2H2WA 5GOTA 4D9KA 1BSVA 4A6DA 4EB8A 3C39A 5LN1A 1NN5A 2BKUA 2GZMA 3EXG1 5JCOC 2BVNA 2FW0A 1UC8A 1H05A 1SC4A 1DRVA 1ODKA 1T1IA 1W9HA 3QFCA 3R6TA 5JSYA 4BVAA 4DUGA 3B6MA 4JEMA 4TLEA 3V4OA 1U28C 1O94A 1YONA 1GILA 2PKXA 4N03A 4RK1A 4B4KA 2CNLA 1Z7YA 1CVIA 3I9OA 4NESA 3U44B 3GRFA 1BW9A 3WBJA 2ZRCA 4FGZA 2WA1A 1Q1EA 4F85A 4NENA 1JG7A 2IE0A 2Q2OA 1E1YA 3FVWA 4J29A 4NCNA 5JXGA 3MIIA 3FCAA 1V7CA 4IF6A 3H6KA 4G4SO 3D5EA 3N6RA 5C80A 3AJ8A 3CJRA 3LZ6A 1Y3HA 5BSKA 2WIAA 3TM4A 1E3EA 1QNFA 4IDBA 2XMBA 3FKSA 1NP7A 2GAJA 2Z9DA 5CH8A 3VJLA 6ADHA 5CD1A 1CZNA 3IAXA 4JAVC 1MB2A 2CVFA 3F3KA 4X61A 2PAAA 2PQ2A 3NANA 4QRHA 1RYNA 4AYTA 4DNQA 2NAFA 2XB9A 4RVFA 5DLEA 2PH3A 3S2EA 3DMDA 4NZ9A 4FX5A 2VBCA 1JH9A 4RD0A 4FPXA 4BE7B 4HNQA 1T5LA 2X0KA 2PZAA 2EP7A 3O8LA 3IFSA 4KQJA 4HX2A 3HCDA 3M3PA 4IGIA 4R7GA 4DARA 2FMTA 5KYXA 5C8YA 4WRRA 1CSEE 1PJRA 2LPMA 3QIAA 1PS8A 4DBLE 4K9RA 3D6AA 2VDRB 2COKA 4JGIA 4QXPA 4YCJA 1R0YA 2X5OA 4AZVA 1ZH4A 1WETA 4WXYB 5BSHA 4WZAA 4G24A 1ZCJA 2ZAIA 4YRJA 7REQB 1RCUA 3DB2A 1R4ZA 1CUXA 3TNDA 4Y1FA 2ETXA 3K1AA 4NBRA 4WACA 3Q9NA 4BV8A 1ECFA 3IT3A 4GR4A 4DIBA 1IZYA 1KEZA 3H0CA 4XIGS 2QW1A 3INYA 1NQVA 3T7SA 5DNVA 3MTAA 4DR1B 2DWQA 5EZYA 3F9CA 4UXHA 3LBYA 4HF7A 5DM0A 4D25A 4ZICA 1X1TA 3I1YA 5TE9A 2JVKA 5IJ0A 2ODPA 4LOHA 4RYDA 1ECCA 1JMVA 1EQUA 3RSCA 1K98A 1PTJC 3ZZ1A 3FYTA 5AW9A 1Y9AA 3PI6A 2R97A 3ROZA 2J9XB 3ANSA 3DUWA 3QOWA 1M0SA 3ITEA 3L1HA 4CV1A 4Q4CA 4P98A 3S1LA 2P4UA 1DAKA 1VL2A 1NNEA 1AUQA 4OI1A 1CQPA 4G8JA 1XJQA 1ZBDA 1QYWA 1G8MA 2X42A 5H02A 1OFGA 1K97A 5JEDA 1T6XA 3G2IA 1L7OA 3U40A 3ABOB 2WY2D 2JG3A 4JA2A 5J4KA 3MINB 3OKCA 1R4AA 3NM4A 2P9YA 1RPTA 4G25A 3X1MA 2MSNA 3HMQA 1YJXA 1OC2A 5HUQA 5ITZB 1E32A 3CLTD 1Z6XA 5LLTA 3OAAA 5K3SA 4WTOA 4UAJA 5JATA 5ECYA 1FXWF 2PN1A 3DQZA 1CKEA 4O8CA 5FOQA 2ZI3A 4OHXA 2C5AA 3VDNB 3ZBTA 3ZH2A 1H0RA 4LXUA 2GBFA 1ZXBA 1IXRC 3OZVA 3WQSB 1I5RA 1QIJA 1YHYA 2V98A 2VRBA 5FFNA 3PD7A 4CKZA 5DLYA 4BV3A 5C2JB 3ZDBA 1XEXA 2I4TA 3OWOA 3EMVA 3T3PB 5IJ9B 2VEOA 4JFRA 3IUPA 3LUCA 1XI2A 1VTKA 5ALIA 3OQPA 1FTGA 3GARA 5AK3A 1CS0B 2Y4OA 2JGMA 3NBUA 2QLLA 4TX1A 5FI0B 4NJEA 2B20A 1R16A 1HT2E 1QS0B 4W1RA 3ZHYA 3GUUA 4I5FA 4BLRA 5ES4B 3DL0A 5EJMA 4F1WA 2D2XA 3B52X 1HO3A 2IEZA 1I6LA 1Q77A 3TIFA 4PYJA 3NBKA 3IPRA 2EFHB 1HTBA 1IDOA 3HU1A 4F2PA 1WUIS 3OZBA 1PQPA 2OGUA 1LCIA 2QRNA 3O94A 2W43A 1KZ7B 2IEGA 1JMYA 3N8DA 4HX5A 2HCRA 1LJUA 5FHQA 4ETIA 3QVGA 2FWMX 3GJSA 1X15A 1NKVA 4R2HA 4AECA 3W05A 4HUQA 4TM7A 3T4PA 4P80A 2WNHA 1NUPA 1XX6A 3FSEA 4L7QA 5FUXA 1ST3A 1M2FA 4AP5A 4AZ0A 5FUWA 1QZUA 3I9LA 4OXQA 3SZGA 5KNBH 1NPTO 1ZY2A 3RCBA 1YF3A 2G83A 3D8BA 1HQYE 1U5BB 3BE5A 4ILEA 3EEOA 2AZXA 1Q6YA 2HIHA 5KI6A 4QDXA 3ROGA 3CRW1 3AVPA 1GTMA 2I34A 1Q83A 1EFAA 2C0CA 3KV1A 5J63A 1BH6A 3EQ7A 1YJQA 1NU8A 1HLDA 3TQIA 1FMFA 5H81A 2JZCA 4YDSA 2C4TA 1MV5A 1CS4C 3V7NA 4BAUA 2EZTA 3E9NA 3LUKA 2WBLC 1J8VA 2HM7A 1KO7A 4K9OA 3IJRA 2HFKA 2BM8A 2WOJA 1EVEA 3BKXA 3QE2A 5CB4F 4HNTA 3FHTA 2JLVA 1OW3B 1Z0UA 3EMKA 1W4BA 2ON6A 1FQOA 4PV7A 3PQ7A 3I2FA 4OPMA 4MYHA 1TKBA 4MIEA 1Q1GA 2DKFA 4C05A 1AJEA 3WHLA 1W5BA 1CQJA 2I71A 2O05A 3HXTA 4HYEA 1SK9A 3NS7A 3A3KA 3TZEA 4BFSA 4XR4A 2WYIA 5ETJA 4D9FA 1R4MA 3A4MA 4LKRA 4YP0A 1LS6A 1LVGA 2Q9CA 4Q9JA 4FOOA 1QQ5A 1IB0A 4GLOA 1W0JA 4IQ4A 4TSFD 3E3LA 1SUIA 5CT5A 3QYPA 3PC2A 4QDTA 3STTA 3QEJA 2PHZA 4DM7A 1XXLA 2RI1A 4GWLA 1POWA 1GPYA 3B3QA 4R1PA 2ZIXA 1GFSA 3VOSA 3EW9A 4A10A 1AKRA 1C8KA 1E62A 1NUQA 2IEAA 4M36A 3TTXA 4M8KA 5ITZA 5KJ1A 2IS6A 1PJZA 1XO1A 2JARA 2Q4BA 3QHAA 3HL4A 4M98A 4LF5B 1KRWA 2G4VA 1VE5A 2Z2IA 2VUIB 1TEVA 3EUFA 4I2VA 1FP4B 4TMKA 2H63A 5I51A 4GDMA 1XTUA 5KCZA 1N5OX 4I1IA 4QECA 2Q2NA 4QYWA 5E9AA 2Q1TA 2XGMA 3DF9A 3NC4A 5K8CA 2P5TB 4JB0A 5IASA 2HPZA 5JYDA 3DZKA 1H4VB 1YNSA 1T2AA 2C5FA 2HA3A 3UNXA 1S5PA 2ORIA 4J07A 1PQWA 1NXVA 1JUDA 3IA2A 3OY2A 3DZHA 1H3EA 3F3SA 3CA8A 3PC6A 5K6AA 1P81A 1UIRA 1P1BA 2G71A 3SYRA 4NCAA 2NV2B 5E1DA 1E5VA 3GLIA 3A26A 3KZCA 5L8VA 4PLWA 3DC7A 3QG1A 1GTJ1 1J8YF 1FRNA 3HFSA 1MJ5A 1XMOB 1H2XA 4FBGA 1HGXA 3DJYA 2ZVPX 1P7VA 1REQA 3H2ZA 2XLCA 1I1OA 4QYXA 1N2CE 4CT4B 4DAOA 4Q9AA 3TUZC 2IH4A 4JYPA 3ZHXA 1EWVA 1NJ1A 4MW1A 4I14A 5J2TA 2BHSA 1MJGA 1SBTA 4H3HB 2G1JA 1EA5A 1W59A 4NKRA 4UCQA 2IH2A 4R6XA 2O4CA 4WCFC 5C81A 3FDJA 3HG7A 2GRJA 4IDPA 3GC6A 4N82A 3C6YA 2EDCA 4JU8A 3RUEA 2RH5A 3HVRA 3AJEA 4Q93A 2FVXA 3G68A 5JBNA 4FYVA 3PYLA 5F51A 3H5LA 2P77A 3OFJA 1YUBA 3QE0A 4L6AA 3TF5A 4C20A 4ZOLB 3O3NB 1HYGA 3IT2A 4X6XA 1O5OA 5KAPA 1BN6A 3G5TA 4GD3Q 4D26A 1JJIA 1JRLA 5CU7A 4EGAA 1BXKA 4UVHA 3HCBA 4OQDA 4MKIA 1ZI9A 4P82A 3RFXA 3ZHSA 5JADA 4CCAA 2F9FA 4EJSC 3C5HA 3KKZA 1XD8A 4JYMA 3RH0A 2QTAA 1U8EA 2VPYA 4IDOA 1C8BA 5EKXA 2P67A 1O4VA 3W3ZB 4UMDA 1PZHA 1ONNA 3URKA 4MGYR 4RXMA 1M0WA 3IIMA 4TYNA 1TAHA 3GLUA 2WK1A 3O9ZA 2IUYA 5HKKD 3IUQA 2JL1A 2QRVB 3EQ8A 4UVEA 3L6BA 2KX7A 3O8RA 3F5FA 5AVRA 4HLDA 1ZJYA 4F93B 4UU7A 2IW3A 1T5HX 3ETDA 3F5DA 2BM0A 3ASYA 4FI3F 3RS0A 2FRXA 5KU7A 3J7AC 3DKRA 4W8HA 1E2BA 5D5HA 3FLMA 5TS2A 4DIDA 1PV2A 1S3SA 2QORA 2V3VA 3JVUA 3DBIA 4WZBA 4XSGA 2D1SA 3T95A 4K7JA 1CHNA 1BDJA 3MSCA 4N0PA 4UBOA 4YJFA 2EBHX 1KVQA 4D45A 1ZK3A 1Z4PX 1GQYA 1K68A 1ULZA 2EBUA 3GV0A 2EFJA 2GK4A 3DL7A 4CDMA 2PTGA 4N54A 2UZAA 4ZOBA 4C7VA 1I3NA 3CUWA 3E58A 2YVKA 3IJEB 4PF1A 1E3IA 3WL5A 2FFAA 3SXJA 4EA9A 3THWB 2OGZA 1TMYA 1Y9EA 3HU3A 3LWBA 4V39A 4HQ6A 2DHRA 3ZXXA 1U8ZA 5LOVF 4I1VA 3BEOA 3AG6A 3DL4A 2CFTA 1GZSA 3OD5A 1DGQA 2GNOA 1MC4A 2G8LA 2GN6A 4YRBA 1S01A 3DCNA 1WSBA 1N0IA 4Y6PA 4RA9A 3D4BA 3GLHA 3PF9A 4BXOB 4ICIA 4JXXA 1K7EB 3JCZA 4IX1A 1JXOA 2VDWA 5HCIA 1PR5A 3K70D 3C3MA 3HFGA 3S44A 5FO1A 4E0BA 3TTWA 2P9FA 2QAIA 3RR2A 3F6PA 3K1JA 2CLCX 4MV8A 1KGDA 4OIMA 2NU9B 4WADA 1QBKC 1IDN1 1OGIA 1OZFA 2VH1A 3IQWA 3M6IA 1TZJA 4WN3A 4E4YA 2Z1NA 1GQOA 3DEIA 3LLMA 3OZSA 4MWZA 1MFPA 2OXRA 5KTTA 5CURA 3TRJA 1IN1A 2GHIA 3USES 2H65A 1FNNA 3BTOA 4QUIA 1FVHA 3FRIA 4MS3A 1EJ0A 4BO3A 2P65A 3IP5A 4CDNA 5C1DA 4D98A 2JIZD 4I3FA 3G5AA 4BC0A 4DA9A 3ZJTA 5CDUA 2PZGA 5JSQA 3VPXA 3Q98A 2TMDA 3HCNA 3THOA 3FBWA 2PT6A 4A0RA 1CLEA 2ZSDA 4YWJA 3FNHA 1NZDA 3E27A 1ZN2A 2QN1A 2OUIA 3GN1A 4UHJA 2NU6B 1E69A 3OMXA 3QKRB 4DSZA 1S3GA 1H1LB 2B69A 3WLMA 2HIAA 3K8OE 1TD1A 4NPAA 4PSAA 4MUXA 2YUTA 3H11A 3CN7A 4WLUA 4C4XA 5HTOA 1Q14A 3SVLA 1UKZA 4JLKA 5ALRA 5KVCA 4PE5B 2HDNB 4J90A 4GX2A 4L50A 3WK9A 5A4IS 4DA4A 1QRDA 1P2SA 4GC9A 2R4QA 1J5EB 4DBZA 5D87A 3AXTA 3B1FA 3ZHBA 5FYQA 1U7DA 1Y4ZA 3VOAA 5BPHA 5IVKA 4U2GA 4EY4A 4QGFA 4B6JA 3RK1A 1CJSA 3AB7A 3CPJB 4LI0A 3SC6A 1LBSA 4BNDB 4CUJA 4EI2A 4A92A 4CTNA 2JIOA 2XYQA 3ZVLA 4KNYA 2WILA 3WLAA 2J0SA 3C1AA 2HH9A 3GAZA 2W6NA 4GGPA 4H6PA 1YWGO 2TECE 5JLAA 2ISCA 3TDNA 3W5JA 3KWFA 3EYAA 3G59A 2EARA 4LHXA 2C83A 1W581 1RD4A 3BWYA 3FNIA 3ZW7A 1ZUWA 2DBQA 2IU4A 3QIVA 4ASUA 1RKQA 4BO9A 4LC9A 2FJPA 5LM3A 1SUEA 4HDSB 1P74A 2VP2A 1Q16A 5DYTA 2QOEA 2DUUA 2WUFA 2GEDA 1FXSA 3OLCX 1XNRB 2YHAA 3VJRA 1ZINA 1Y1TA 4N9WA 1BDMA 3SS9X 1G59A 5ECDA 4C5CA 5KQMA 2ZUFA 4QYSA 3EY4A 1SVNA 1T34A 1ZGGA 3G6WA 5LQCA 2JAPA 4MGZR 4AJJA 4OH1A 3HYNA 2C94A 2DKOA 4HAVA 2B30A 3HZHA 4OHWA 2V7PA 1DQSA 1JFFB 5COBA 2HMAA 4OYRA 4KTVE 3KJFA 3SBDA 2RFLA 5AW0A 2QQ0A 4KWHA 4K6HA 4TLBA 4CLOA 4KE9A 2PSFA 4JIGA 1YKSA 4KZPA 3NJ8A 1Q95A 3SF0A 1NZFA 1TJ4A 3SS8A 3A9TA 2W0SA 4GBED 4K26A 4NZPA 3P1JA 4H6WA 3OC0A 4KI0A 3QP9A 1RKXA 3EXAA 4MX8A 4DVGA 4EMUA 5AVXA 5JECA 4EHDA 1ZD8A 2R84A 2FK8A 2HXGA 4AJNA 4AWXA 3IQGX 3L7BA 4WBNB 3ECAA 1GLVA 2JW5A 1DJMA 5HZHA 3ZKAA 1VHJA 2Z30A 4J7CA 4BCCA 1E92A 3SLRA 3VR3A 2BGTA 3EZ2A 4LYFA 5ALPA 3ZS9A 4JVMA 3DBVO 2DBRA 2Y1CA 1JN0A 5AHRA 1LX7A 3V1UA 3CUTA 3PNSA 3PR3A 4CXMA 3ICPA 4ZQGA 1PK9A 3GVIA 1JF8A 4XW2A 2OQRA 2P4QA 1CR1A 2OKGA 4C4TA 3VC7A 3ZCRA 3QUAA 4JJAA 3RT7A 1PT7A 2C3UA 1LK0A 2I3BA 3ZI0A 1V16A 5BSGA 4XSVA 4YRRA 4OX9Y 3B85A 1B73A 1TGYA 2GCNA 2H51A 2PPVA 3ONWA 3PKZA 3SQWA 1L6IA 1II9A 1RQNA 1YL7A 4Q24A 4XH9B 2Q7OE 1OWOA 4ND4A 1EAMA 1XTJA 5EJAA 4EKGA 1OXBB 1E2PA 1X7WA 2A5YB 1L4EA 3KTDA 1XZFA 1KEUA 1VPVA 1YZLA 1JL3A 4ASUD 5BUCA 1K9VF 1UQTA 1Y98A 1MDFA 3LUBA 1XT6A 3ONNA 3QZUA 1NXWA 3NORA 1K2VN 3R3HA 4H4CA 2HHAA 5JO9A 3MK31 3TRKA 4BQOA 4COOA 4EDFA 5BN4A 4P0PB 3MWJA 1ZRSA 4OEHA 4CDRA 1D6SA 2FWNA 4YMUA 2ISSD 7REQA 3TXYA 5DNEA 3BGVA 7YASA 4RX1A 4QOGA 4L8LA 3WMRA 3AUFA 3D1JA 1KAEA 2H48A 2CY0A 1VOTA 1RS0A 3EY9A 2HK9A 4C4YA 5JVDF 2BFEB 2BFCA 2W6IA 4EKYA 5JLJA 2CXOA 1I0IA 2E87A 4HN4B 1GGFA 3TVYA 5KSOA 5KPJA 2BZ0A 3HCAA 4I9UA 2E1RA 5JAIA 1LC0A 2CE2X 4YT2A 2QJRA 3WL7A 3U4CA 2WZCA 3I73A 1VSUA 3ICOA 4KOAA 4QOJA 4P2GA 4CTJA 4TV8B 1ILWA 4N9QA 4ER0A 4F3YA 1CRLA 1NASA 1CRPA 2HBQA 4YV0A 3QBVA 3AEQB 1E1DA 1FYDA 2XB6A 3PT5A 1YJ5A 5KB3A 1JR6A 2P9ZA 1V3VA 1B7GO 5AUNB 4OL0A 3ORYA 8ATCA 2D7DA 1XPJA 4E31A 1CZHA 5J2UF 4PQFA 5IKXA 3K94A 1EE1A 3EULA 3QQPA 1WB4A 2QQEA 4PW0A 4X85A 4CL2A 1NF8A 2XCSB 1LW7A 4KFCA 1Z45A 2HO4A 2ZR8A 4NECA 2PXCA 4W5HA 1ZH0A 4A0FA 4CV3A 5BWMA 4YP7A 1PFUA 5HK9A 5L51A 4HLCA 4LC0A 1L1RA 4YP6A 2HAEA 2OXTA 3SYNA 1GV0A 2VXOA 1C4KA 5IARA 3RIGA 3WGIA 3VV2A 4QEZA 5CR9A 1KAMA 2R60A 2QMYA 4HQFA 4X92A 3T5BA 5ADVA 3L7DA 3B7GA 2A3RA 2QTGA 2OM6A 3P45A 4C0QC 3VZDA 1TAUA 2WPNA 1Y9DA 1QHHB 1M2VB 3CO5A 1WQ3A 4IH9A 5LIPA 2IYFA 2CUZA 4LZZA 1DIGA 4V1CI 2GKOA 2RH8A 3IKTA 3SX4A 2OB2A 3FOCA 1DZ3A 1FTSA 3QPCA 1KRHA 2I87A 1QV9A 1R0SA 1CJKC 1RU3A 2RAPA 4PLFA 3CKYA 4WKNA 3PQ2A 3HJRA 4ACBA 3K0AB 5A9SB 5JWOA 5K8LA 2F64A 2OCXA 3TW8A 5CEJA 5KOYA 1MO4A 4RE5A 4UUNA 1C1XA 4OU4A 3STXA 4RMJA 3HNRA 1DTSA 1U3WA 3MTIA 2A33A 1KY4A 3JYOA 4HGPA 4PLGA 4MS4A 4Q9NA 2ARKA 2XAUA 3DLIA 4RY9A 1OSNA 3VUFA 5AW2A 3O26A 5JRZA 3AF6A 3TCNA 2JFWA 3E7XA 2LCQA 3ZWPA 1J2UA 1IBCA 1A8HA 2RGAA 4A2CA 2C7BA 5I4KA 5JPDA 3VUEA 1MXHA 1TRKA 4DDTA 2WLSA 3LW8A 4OVKA 2WUGA 4DDHA 1KK1A 1HFJA 1M2VA 1QG0A 4GI7A 2R8BA 4YACA 1O9BA 5T3YA 1DIRA 2A84A 3LDGA 5IVIA 4B2PA 4FHDA 2E4WA 1N5DA 2JGNA 3HCEA 4Y30A 1WIWA 5CJPA 1UKAA 2CLLB 5T4FA 3T8YA 5A9RA 4OYLA 3R9IA 2YXLA 1SVUA 1A9YA 1NX9A 1XJWA 4MUMA 4K9NA 4YMGA 1IWPB 5T6BA 1MB0A 3D3JA 3W04A 3EZYA 1P1IA 1R1DA 3KELA 3OX2A 4YRMA 4QG3A 4TTQA 1Q0TA 1IEWA 1P3DA 1PP4A 2K6GA 1QH8B 4WN9B 3I8SA 5BYBA 2FE4A 2OCLA 3RIEA 3PGXA 1P29A 1JDJA 1NLFA 4UJ3A 4HD8A 1KYYA 2DWOA 5BWLA 1LK7A 821PA 2ZRKA 4F5EA 3C4VA 3HKCA 5CA0B 5H9VA 3OOWA 3HGTA 4NMLA 1L5LA 1A5BB 1EPUA 1YDGA 2D8AA 1BS9A 1R5NA 4QELA 4D57A 5LZ9A 1FQJA 4CKCA 1NW7A 4E7PA 5JZBA 3U5TA 2XXAA 3N2LA 1YR6A 2ZW9A 4ZYZA 1V9CA 3VRHA 1X74A 2ECPA 4XQ9A 4UUBA 4TVOA 5DGIA 2AN4A 2Y05A 1NE2A 5JC8A 2LWIA 4GSYA 1G8AA 2AJ8A 5HF5A 2Z2KA 2XRYA 3F7MA 3FMIA 2JK1A 3CCFA 3H2GA 2QRGA 3IS3A 3GGJA 2FFQA 2XGGA 1RPNA 2C7GA 4M9CA 1QDEA 3I6BA 2PXHA 2C2ZA 1Z5UA 3CZAA 2Y71A 4U6SA 5H82A 4ZZ0A 1FPMA 1ZWKA 3EVNA 3SHVA 1JGTA 2F3SA 3D6TB 4RPCA 4X1OA 1W46A 1FLNA 1NQTA 2HZ7A 3ZU4A 2AZ4A 3T1VA 2C92A 2Y9MB 4Z0PA 4G2NA 5T3UA 3MRVA 5DIZA 2FR1A 1DLJA 3DNFA 3KOZA 1ZGJA 4QXOA 1OX4A 3OCCA 2PMEA 1MKYA 3GH1A 3SYMA 2VDPB 4AICA 3QVJA 4X44A 1C7QA 4CLEA 1JQBA 4Q9HA 4NZYA 3JALB 4LRQA 4C7OA 4OJYA 1EUYA 3BJZA 4N3AA 2ZSFA 1P17A 1DQZA 3GCGA 2Q5HA 2VNKA 5K8JB 4Q1AA 5JS6A 2GA8A 4UAUA 1CJCA 5KQPA 4PO1A 1BXRA 2X0NA 5DXFA 5LA6B 4FFVA 2WYUA 4XLLA 5GTDA 4JJ8A 3T1OA 2W2NA 1CTQA 3QH4A 2CBGA 4R0VA 2IHJA 3PC4A 4BY9E 2I3DA 5CK5A 3CRNA 1D0VA 3PQ5A 1P7ZA 3P0RA 2P0YA 4UMEA 1QYDA 4FW8A 1ID8A 1O6CA 1M8PA 3VGPA 1GCOA 1KVTA 4Y18A 3WTCA 3NP7A 1QBGA 1IBLB 1BMFA 1HMPA 1KS9A 2DZDA 2O3QA 2OBLA 3OZIA 1OXTA 1O7JA 5AIAA 3HSKA 4N5HX 1ORVA 1U1IA 2O7QA 3IP7A 4RGBA 1BWQA 2I80A 4FLEA 3HS3A 4WY5A 4H7JA 2VTEA 1XU4A 3N5CA 4UZEA 5IBQA 3WVNA 3AFOA 4AS3A 4EG0A 5C3MA 4KLNA 4MDYA 4AY6A 1Y3AA 4WAUA 3PC8C 1SY7A 4W63A 1PT6A 3T15A 4ZO4A 1XZIA 3DUFA 4BAGA 4IV5A 4YUXA 4WBXC 3UAGA 4DL9A 1GTZA 2V7EA 2EV9A 4X54A 1EMDA 2FMFA 8GPBA 4EJMA 1YFJA 1QQAA 1REQB 2EKQA 4ME6A 3VYSB 4TN1A 3UY4A 4E2FA 1FNMA 1L5OA 3TSYA 1U1CA 1UBMS 4Y9SA 5K3OA 2WM9B 3GRUA 4W99A 1GEGA 4B3CA 1R6BX 3HADA 1OC4A 3U31A 1E7SA 5FPTA 1NVAA 3K1ZA 4QHSA 3GY0A 1KMHA 5CBPA 4RKRA 4YNBA 5IUKC 4KIJA 3A28A 4UNQA 2A9RA 2E1PA 3QKIA 4QUJA 3VAYA 3PX7A 4A2QA 1OA1A 3O74A 2MSWA 2IYLD 1C7IA 4QRDA 5F7OA 4X9XA 3RVDA 1XPOA 3FDFA 3PQ8A 4RFVA 1UJMA 2X7HA 2WT9A 5J4VA 5LKAA 4LQDA 2HK8A 4MUIA 4L78A 3MPOA 1WW8A 1PWYE 2XBMA 1RPJA 4I7EA 4L76A 1PI3A 4FFBA 4R84A 4P9NA 3VX4A 4G4GA 1T13A 3PDHA 3E70C 3CZQA 4RD1A 4RHCA 3PNQA 9ATCA 1LSOA 2P9CA 3GDHA 3OFND 1G21B 1QQ7A 1U3TA 1ZD1A 2FEOA 2DFTA 4ITUA 1V25A 4OHPA 2AB0A 4O3FA 4TV9B 4TRMA 4EPYA 2R9VA 3D8SA 3P9ZA 5CX1A 1MORA 1PX0A 2GI4A 2F00A 4JP2A 4J3NA 1WDLA 3AOGA 4J7XA 4YV7A 3BJIC 5GONB 1WR8A 2P6UA 3ELUA 1LDMA 4A0HA 2PQ0A 2QJOA 3JAKB 3LWZA 4N7RA 5KYXB 4JMLA 3U49A 1Z28A 2GMWA 3PTLA 4KXXA 5LJLA 2QK4A 1KDYA 5LMZA 4QHTA 1OT5A 3PPYA 4MGIR 4RAQA 4R7TA 2FCAA 1MGOA 4LOKA 3RYFA 4JT2A 1YZKA 5LYJF 3I76A 4P34A 2VUTA 4KAFA 1SBYA 3T7KA 2FUCA 1J9GA 1R8QA 1Q20A 2WKPA 2OO5C 3WIOA 2NXEA 4AJ4A 2IYPA 2H07A 3ML1A 4TWJA 4PQEA 3UJBA 3D81A 1JPVA 3E1SA 3B6JA 1N2SA 4BFLA 1JTEA 1UUFA 2Z2XA 1ZAKA 4OSOA 3Q12A 4B4DA 1AUPA 3CCCA 4P4TA 2IP1A 4L5CA 4RDCA 4M7PA 4XEHA 3TRDA 721PA 1MO6A 5E2BA 4MI6A 1K66A 4M87A 4Y7DA 3AYXB 3LGAA 4TXMA 5LXTA 4P4LA 4BEWA 1DELA 2BGMA 3JVDA 1M7BA 4NJMA 1ZOOA 3M5PA 1TPZA 1RPAA 3S70A 3K0CA 4REQB 1X1BA 3CM0A 1VG9B 4L5YA 4WI1A 5FUBA 3FB4A 2BFBA 2EU8A 4WVLA 4Y6RA 3KZVA 4U7TB 2X7XA 1FS4A 4B3DA 1NOJA 1BEEA 3EDQA 1C9YA 4MUKA 4EO4A 5F2KA 3MJTA 4WXHA 3JD2A 1NJGA 3KWJA 4OMCA 3MLEA 4FJ1A 5DB4A 1N34B 4R8LA 4JBXA 5F21A 3R7SA 4EW1A 2JHCA 1GN8A 2BONA 1JI3A 2HXSA 2WWTA 4BNNA 1GUZA 4MS3B 2FTKE 3G88A 4NNJA 3RD5A 1F3LA 4CHGA 4FZRA 3H5NA 1QVZA 3D6NB 3GFPA 4D74A 4G0UA 5D84A 2HDWA 5GQSA 4KLAA 3VZRA 2PPLA 2R8YA 5FO0A 4EPWA 3U3OA 2PR2A 1NQ5A 1O4WA 1EWRA 1VKRA 5F4BA 4QPJC 3BZBA 3ABQB 2J59A 2QAGA 3WISA 5I9IA 2QT1A 1CS0A 2V3CC 1X14A 5DGTA 2QX6A 3M6VA 3GVXA 1I80A 1N5LA 4IDGA 5DJ5A 3X1DA 5ICGA 2H7XA 4WWHA 3EG9B 2P11A 5HJ5A 1DP4A 5KKNB 4C6TB 5B55A 2VA8A 4PFQA 3BQNB 1KQ3A 3BFKA 2BMWA 3P9NA 4MHSA 1X3SA 3TJMA 2HCJB 4YI3A 4YXFA 5HKOA 5L7TA 1D2NA 1R2QA 4CQNA 3KKKA 3FN4A 5EXSA 4QOFA 4ZVVA 1RXWA 1DAIA 4FFSA 1JEAA 1MGPA 5AP9A 2VK8A 4ZEMA 2Y1OA 1UH5A 2UUAB 3EXEA 1LRKA 4IDFA 4QU0A 4YP1A 2ST1A 4PLYA 4N6OA 1AZSC 4GYWA 3LLVA 4JL5A 3LCUA 1T5OA 5EXEA 1DCTA 1J90A 1XCGB 4HDRA 1G63A 2CKDA 4RPHA 4D0LB 4RF5A 5CVCA 1WW2A 3QY9A 4K87A 2NSJA 2YW2A 3ETHA 3GJ3A 1PDWA 2PYDA 4QBFA 2QZ9A 4ARAA 2IWRA 5IHPA 5K01A 2FEAA 2OT3B 3CEMA 3L04A 4F06A 1HQCA 2C4HA 2ZJ7A 5K0LA 1VMKA 2FZKA 2XDAA 3QM1A 3OM9A 5GPBA 1R88A 2QE6A 1U0OC 3OP1A 2H1OA 1VG0B 5MF6A 3S1AB 2AVDA 5SY6A 4GNRA 3RW9A 1DU4A 2IIBA 4MVCA 3UHJA 4OJTA 1UPXA 1Z2PX 1BWSA 4UM9D 1UEIA 4D4MA 3MMSA 2HU8A 3TQSA 4DCMA 4Q9LA 4N7BA 3UN1A 2FDRA 4KG7A 1BOOA 1IPFA 4U7GA 2HQ1A 2CL0X 5JANA 1G9TA 5REQB 1FSFA 3GAMA 1G5TA 2PX8A 2WJGA 2APJA 4M7WA 1G8SA 3OZGA 3F2VA 4B48A 4ZAZA 3IT1A 3QA3E 4JNKA 1UBSB 1I4DD 2IFTA 2JH9A 1P72A 4YAIA 2QD1A 3OZCA 4UOZA 2SICE 1YHZA 3OJCA 3PLAE 1U3FA 2ZG6A 4L0CA 5E6UA 4HDAA 3DOUA 3KLNA 2R4TA 3CF2A 1GGKA 1RYDA 5DWVA 4CF3A 4ZVLA 2FGKA 3ZTYA 1QOPB 3JVVA 3W8FA 3B9RA 3ND5A 2WYWA 2X5XA 4KWIA 3BAZA 2DT5A 3A6FA 3NONA 4MW0A 3KYIB 4DMKA 4EELA 5K0CA 1RI3A 3Q4GA 3EOAI 4FJ2A 2AW3A 4QUGA 4KQFA 3AHEA 4CE6A 1TOAA 3T99A 3PL5A 5CIYA 1RYMA 3UVEA 1HEIA 2X6RA 4GE0A 1D7AA 2QU8A 1WXHA 3MPUA 2C59A 5DNDA 4C0AC 1EDBA 4XQGA 5GGYA 1BHSA 1ULTA 2I7VA 4EUKA 4KPYA 1SZDA 2B8EA 2GDZA 2VZ0A 2D1QA 5K2OA 4DWWA 4EVIA 3N3AC 3VAAA 3TI7A 4HC4A 4MVJD 1TPYA 3UTDA 5AW1A 2ZJ1A 4PGFA 3H1BA 4WLVA 5ENDA 3KZXA 2YIJA 3NWBA 1KK0A 3GEDA 4KFTA 1SVWA 2EHJA 3NPAA 2WTAA 3GWGA 4BZXA 3MBIA 4NYJR 1TJPB 4HWPA 2W7TA 4ILKA 1AN0A 2ZT5A 1WTCA 5AVOA 4A8JC 3OX3A 1XK7A 2E5FA 1GZDA 4ZU6X 2Q2WA 3RS2A 3WRXA 1OASA 4I1PA 2ZTUA 3IBCA 2F3UA 1YVPA 5I8WA 2ORVA 2BF7A 4E5VA 2QL6A 3H5RA 2AFIE 4OM8A 5F2NA 1PL6A 2F1RA 6NULA 4FOPA 4PO3X 1VXRA 5A9TA 1KBOA 3CX8A 1CETA 1KJ8A 5DWDA 5DEIA 1TO1E 3TD6A 3M6LA 4S24A 4RKEA 5BV0A 3KS9A 4GT1A 1XZAA 5DXAA 3TH5A 5AW7A 1WPXA 3K8ZA 1K7SN 2HRQA 3ZE7A 5C8XA 2CHVA 5JNTA 2P1RA 4Y67A 1U04A 2NG1A 4OQPA 1JEDA 1WZIA 3GJ5A 1D2AA 1E3WA 1Z2NX 2R7NA 4L0MA 1I4LD 1MT0A 5CVEA 1AQNA 3FTDA 4EL0A 1W8DA 2BKLA 4UU8A 5K45A 2YJ5A 1XCMA 1QIEA 3CUSA 3H05A 5J5CA 4BYGA 5AVSA 5KWEA 1AF7A 1A2BA 4L9RA 4QNRA 3LYLA 4U7JA 4AJ1A 3VKUA 2EFYA 4JI0B 1FTYA 2Q3BA 1Y8AA 4LJLA 2AD5A 5JZOA 3BDIA 1RWQA 3B3JA 5TGTA 1GQQA 3WYAA 2VZ8A 1I14A 3LTEA 3WYGA 4BNDA 1O94C 1N1MA 1WUHS 1DWPA 1RW4A 3NM6B 3PJRA 1DB3A 3A36A 3SKXA 3KZKA 5G02A 4ID9A 1I51A 2H5JA 4IZOA 2XUOA 4KITB 4G56A 1NBAA 4LHSA 4Q4HA 2XSZD 3GEBA 3W34A 1KI7A 2OXEA 4AXXA 4DNFA 2JIZA 1DKLA 1YVDA 1N8SA 1V71A 3BBPA 1JHYA 1PJTA 2YJ3A 1I2CA 5T5QA 2AUTA 1ZGCA 4AO6A 1KK2A 2VHXA 4XIYA 1N6HA 1OX6A 3EZLA 3KXDA 3BC1A 1PEDA 4DUGD 2C88A 5LJIA 4BRSA 2VSQA 3CKLA 4TLAA 3LGXA 2GKGA 4MR7A 1QPZA 3KZOA 4YT4A 4MW5A 4MDEA 2IITA 1J22A 2QVCA 1PQ4A 2QUAA 4AYXA 4OQYA 1XDDA 2OQ2A 3H04A 1B6SA 3B9QA 5EXTA 4FZ5A 4LJ6A 2IUEA 1VP3A 4UFPA 1RMYA 3VSCA 5FOTA 2VYCA 1NYQA 2WMDA 2ZQZA 3H6GA 2R5FA 5DCLA 1TM1E 1VECA 4GM0A 4FDAA 4US0R 4J0FA 2NO4A 4KE6A 4YQEA 5KINB 3ISJA 2I6UA 2PDAA 2V5VA 3PXCX 3WK6A 1FFDA 4XCVA 4N40A 4PZ0A 2EKBA 3R23A 3SI7A 3UWMA 2RK6A 2MTBA 3Q3GE 5AVWA 1IXYA 3CUEF 2J87A 4HAIA 1GDHA 2X9QA 4WK4B 4RA9B 5H83A 4WOJA 3IO3A 4BZWA 5AM5A 2Q5CA 2GPAA 2OILA 3MUFA 4FWBA 1DC5A 1D4FA 3FTFA 2EFEB 2QY6A 4IQFA 2A5GA 2DFDA 4UE2A 4KPFC 3MCUA 3MJEA 1TB4A 3B3FA 4Y1RB 2FSSA 2I3AA 2QM8A 5HQ3B 3IIKA 2H5EA 2ONCA 5EIHA 4KR9A 5AVZA 1EINA 2UUOA 1LNZA 3EXG2 4BVFA 3G8CA 1FP7A 1LJLA 1FMTA 1BS2A 1UKEA 3SC4A 1R4NA 3DZCA 4QLAA 1NXTA 4Q0MA 2WWRA 4XVHA 3C3PA 3IL2A 4C4AA 1N1DA 2O23A 4EF6A 5ER9A 1AXRA 4UTXA 4R2LA 2X6TA 1CT9A 4DNXA 3FD8A 1X7YB 4IHQA 5GM2A 1AKNA 2BTOA 2QG6A 1B8OA 1T3SA 1CUEA 5EHIA 5FP0A 2C4VA 2OEPA 1Q0LA 1IOVA 1KYQA 3RK0A 3KJGA 5L40A 3IC5A 3JATA 4A1OA 1J9EA 2XVMA 2VQ6A 3RIHA 2OOKA 1EB9A 4X3OA 2AJBA 2ZLBA 3Q85A 1ZHHA 1QK3A 1IBSA 1ZGZA 3GFBA 4RZ3A 4B17A 1FA9A 1JFTA 3N5KA 1NLYA 2C3OA 3IDSA 3LXXA 4K46A 4MGKR 4PYNA 1GQRA 4ZOEA 4E32A 3UJCA 4Z4CA 2J5RA 3KSZO 4YYEA 1V8FA 1PDVA 2IPXA 3J81A 3SSAA 2Q9UA 3KR0A 4G1BA 4MP8A 3CG4A 1GA1A 2O20A 3I92A 3WYBA 1NBEA 1G16A 2L17A 3HB9A 3LC7O 4EPTA 1OAOA 3AETA 3GA7A 5JCXA 4JU9A 2B4YA 1EFRD 2IOYA 2WFMA 3EPPA 3F90A 3Q9SA 1PZMA 3R5SA 2VSOA 1QZZA 4GI1A 4HFRA 3V34A 5L7WA 1JEEA 4IOLA 5AVTA 3AVVA 3HKBB 1MMFB 1P6UA 2C00A 2O2JA 3ENNA 4TMZA 2J85A 4X8HA 5DULA 5E4YA 4QG7A 3KWMA 4BLUA 5E6RA 1O58A 5JYEA 1EM6A 2HQSA 1D2CA 4BN5A 1UJBA 3FGZA 3P7MA 2C7RA 3W9UA 2W2QA 3OY7A 2IGTA 2WNIA 5KNCD 1CU1A 2CYAA 3F4LA 4B4WA 1IHYA 1N7HA 1ULSA 3K7EA 4JT4A 1ORWA 1A9ZA 4QJ4A 2P68A 5AKLA 2G76A 2HWYA 5EZSA 5K3EA 2DPHA 3QE3A 1YJAA 3WIEA 1VP9A 4PYLA 1IVYA 3IOYA 2NM0A 1E7MA 2FN8A 3K5PA 2NU7A 4IUDS 3JQ7A 4WASA 2GCGA 4RZXA 2CV2A 4XTRA 3H4TA 4RK5A 1JTVA 4KJXA 4PNHA 2H7VA 5HG0A 1VGQA 1RRMA 2WM3A 3TDKA 4F96A 3EFHA 2GWHA 1JX6A 2AI2A 3Q40A 5DYIA 2SKDA 3F7TA 1U1DA 4C4SA 3AVYA 2ACKA 3NHBA 3LT4A 3VSAA 5B1EA 1GZVA 1E2MA 2F48A 1NPYA 3MMNA 4BMDA 3RC7A 1OY1A 4E70A 1HX7A 2RGWA 3K9NA 2VPZA 3DEZA 2CD9A 3S6JA 3H0KA 3HDVA 3VDMA 1FS6A 2A9PA 2DJIA 1UM8A 2JB9A 2QLMA 3JRWA 4NCJA 5BV8A 5A5DA 1HE3A 2DECA 4XOUA 2VHTA 3NTOA 1ONSA 1Y8RA 4ZPXA 2NXWA 3I9V6 4F2WA 1A72A 2GERA 1P9OA 1VLVA 1S2DA 2WSLA 5CM2Z 3W4KA 2H5LA 3IEUA 1KMMA 1LV7A 4TM8A 3KU1A 1U2ZA 5B7QA 2E49A 5C51B 3VM6A 2GVZC 3W1EA 1TL7C 1JPJA 2WHXA 2WSMA 3IAEA 3Q87B 4GECA 4L8GA 4FYJA 1UPAA 2C2BA 1JFFA 1HK7A 4M2LA 4XFDA 5JMPA 1FQWA 1U80A 1VCHA 2G28A 2W2VA 2XVAA 3L05A 3H6HA 1FDTA 3LRPA 3PIDA 4U00A 2UXDB 3UHAA 3KOUA 5BQ3A 4FCTA 2PUAA 1YL5A 3CB2A 2DPXA 2EZ4A 4JQSA 4V3CA 5BSRA 1Q7BA 1YZUA 3FMOB 3KKOA 4WW0A 2CZCA 2C42A 3E0XA 3OEWA 3ZG6A 2FAXA 4OIFA 2CVZA 2CB0A 3PEFA 4IHJA 4M60A 3ZKWB 4K3UA 2AC4A 3SDZA 3I5UA 3JWHA 5EIAA 5FUYA 3COWA 5P8WA 5C46F 2QB5A 1WMSA 3MMXA 3L1VA 4NBKA 3WGNA 1XZLA 3ELWA 3EIFA 4WXEA 1XTTA 4WA7A 2A5FA 2D0PB 2PUVA 5KTMA 4KR6A 1CW2B 1XU7A 4DNOA 2WUWE 2PX0A 4FKBA 4I4LA 4Z9AA 2B4RO 1NW8A 1QZXA 1JDTA 3KL2A 1TJ3A 4U63A 3GPDG 3MAAC 5EI5A 2BFEA 1KDZA 1SC3A 3VZSA 1C7EA 1SCNE 5TEVA 2QM0A 1K6IA 1UODA 2JD1A 3N87A 4HS4A 3NTVA 3OWXA 5J4LA 3Q9LA 1GNSA 5THKA 5U9CA 2RG1A 4RXTA 4AG3A 1Q0HA 1Y4DE 3Q3HA 4DLZA 1VE3A 2EZUA 2UZ4A 2QUZA 2G1UA 2V7XA 2VJDA 4IP0A 2LR0A 3SX2A 1GWNA 1ATZA 3RU7A 2H92A 3ORFA 5LD2B 4L02A 2RHHA 4JQZA 4NE2A 2O19A 4MARA 4KQ2A 1QTIA 3TZ6A 3N39C 1T3GA 1IIBA 1G8YA 3RBZA 1F9AA 2FZ5A 5BN3A 2NIPA 1X39A 1TQ4A 3QFTA 2FPPA 1G21E 4X24A 2JGIA 1DCFA 1II0A 2FW7A 5JAZA 2WJ6A 1L5WA 1UBGA 4U7PB 4BFYA 1U0RA 1GLGA 1H93A 2PJDA 3ESYA 3JQ9C 4YXWD 3QEAZ 2XNDA 4FX2A 1Q74A 4WKCA 3NWEA 1MO3A 1PT8A 1J21A 1UM9A 2YN4A 1XRLA 3RHTA 4URUR 3ZWMA 3ESDA 1VHDA 1J07A 2O2DA 1LVHA 2J3HA 3E9DA 4JB2A 4R8MA 2ZREA 4TOIA 2PUHA 4FYMA 2YFHA 3HDHA 3DEJA 1BFKA 1MW8X 2QRLA 3NETA 3IEKA 1R0CA 2NSDA 4RFLA 1WDWB 1TEZA 1LVUA 5F9HA 2ZYWX 4HBGA 1QV6A 4UBJA 1OF1A 4MRPA 4WXMA 3H8VA 4X1KB 2CHQA 6PFKA 1G20E 4YQZA 3PA8A 3JR3A 1H6DA 3O1JC 4O4IB 1ECGA 2OK8A 1G6Q1 1QFMA 4WEOA 1X7XA 1Z6QA 5DI3B 4ENQA 3I6IA 3RSGA 3HA2A 4C30A 3T3IA 4E2ZA 1N92A 2JPDA 3NHUA 1DDOA 1VCMA 3I1JA 4G5GA 4X41A 5JDCC 2BMEA 1YK1A 2HBZA 2XGSA 3GOQA 3PQ4A 4RZ2A 5B1SA 1WKCA 4NWIA 3SPXA 4QOSA 4YMVA 5MN6A 3DZDA 3U3RA 3AI7A 4IAOA 3K8YA 4AJHA 4BNVA 5JV5A 1GPUA 2W2XA 2C84A 3PL1A 2PX2A 1FFAA 3KQPA 4OB7A 4BBPA 2W2MA 5A2QA 3MXOA 1FY2A 2AYXA 4B2YA 3ZI4A 3NT4A 1D6NA 1MJHA 4MO2A 3CE6A 3NBMA 3BZUA 4MYCA 3CR8A 1WB6A 4Z9FA 5KYGA 4F84A 2A78A 4BUZA 1C1DA 2ECKA 2ECOA 3NFRA 3PUVA 3Q6MA 4MRMA 4ZU1X 5JD3A 4CLHA 2UZ1A 1JPNA 1W29A 2YZGA 4EH1A 3QPWA 1WLYA 5K3BA 1BQEA 2ZBUA 1RM3A 1GZ6A 2GLUA 2YN0A 4WKOA 1OI4A 2E37A 2PNJA 2VT7A 5BSTA 4XWKA 3M6UA 4NFLA 4MUYA 3V2IA 5EGSA 3FLBA 1QE3A 5LU9A 1XRRA 2OCPA 4X20A 1Q1QA 2P78A 5DBIA 4X64B 4B6PA 1ESEA 4E14A 1LA2A 3JXEA 1V26A 4PG7A 4GFDA 2DLCX 1OYYA 2OCYC 2WFLB 2XXBA 4R1UA 2C54A 2PUCA 4XGRA 4IDQA 1TVKA 3CT6A 3BMOB 3L7JA 3NDPA 4E3ZA 4LF4B 1Z4MA 3EGXA 4Q3KA 1XRPA 3W4JA 1VYTA 5KYTA 4HZUA 1ENYA 1G20A 1PFQA 4MEJA 4R68A 3IMCA 5CM9C 3RI3A 2GD6A 1KIFA 1ML3A 3QENA 1C50A 1QGAA 1X94A 1X70A 2ACWA 2H16A 4O25A 4WMLA 4EOGA 1J2TA 4Q9IA 4YREA 2M6RA 1TJ5A 1EK0A 4ARVA 3THWA 1SQFA 2O5RA 2X6QA 3OCUA 5BW6B 5BQOA 1JAXA 2GBPA 4P92A 5C5EA 3TZCA 3IIEA 4CMGA 1WMBA 2PLWA 1TT7A 3ND8A 3RSHA 4C89A 1ISRA 1Q0SA 1WUYA 3EW7A 5LZ8A 1YUNA 1V8BA 1XKQA 2ASEA 2N47A 2IYXA 4Q3CA 2VH2A 5J2TF 4UEWA 5JYCA 1K4MA 3R0JA 3ZV7A 5GZ1A 1TMOA 4KIGA 4TYWA 2HU5A 1SURA 2IHUA 1U0FA 2EX0A 2WFLA 4WECA 4RIIA 2JGDB 2JIRA 2OBYA 3BYZA 5EE1A 5EZQA 3HA3A 3E9CA 5B7PA 4J1TA 1MAVA 4KAXA 2V0GA 5AVQA 1ULBA 3LPLA 2PL9A 2WJJA 1YQ9A 4MTCA 1E0AA 2FRDA 5J1TB 4ALKA 3E9EA 3CNOA 1HYQA 2R751 4IDDA 2WQ7A 3NTLA 3ZWYA 4LZPA 2LGJA 3IUSA 4UDYX 3HY4A 1QHGA 2ZSAA 1GRVA 2PGXA 3AF3A 4Y6QA 3A0RB 4IKPA 4LRSB 2IPAB 4YWHA 3W2TA 5DTRA 3C14C 5K0GA 1DFHA 1RTKA 4X0EA 1JXMA 1WSWA 2QTWB 9GPBA 5KTKA 4WNAB 2JAOA 2CNBA 4E1BA 5AVYA 5KJCA 1PYDA 3P5BA 1TO6A 4FEAA 3K4QA 1GT91 2GGSA 3DE3X 3EAGA 4Q7LA 2XOKA 1SKYE 2OZPA 1FSZA 2G0TA 3BE6A 3BMCB 1NJ8A 3QUBA 4N5DA 4RTKA 3EJWA 4N3NA 4NOMA 3UM9A 2PSHA 3ZJUA 3BWCA 2CYBA 1ESDA 1U8FO 4XI9A 4ZAYA 3W0LB 3C87A 3UPUA 1U7UA 1UEJA 4DSTA 3PVZA 4KVGA 1RVV1 3MUEA 4V24A 3LZCA 5JOQA 3JQBA 4PU0A 5GVSA 2J9FA 1GAEO 2PT5A 4TZ6A 1FNDA 2H9YA 1UXHA 2G88A 3LWNA 3SSMA 1P9LA 2CNWA 2W8BA 3COSA 3OE7A 3EE6A 4LUCA 1I1QB 3WWOA 1F8UA 1XCLA 5EY5B 3K9FC 1IRIA 1UJ4A 3DOEA 4AZ0B 4C43A 2LCFA 3JQEA 2JLBA 4OI2A 5DV9A 2TMYA 3E53A 1M0TA 1GU1A 3QU2A 1ZX1A 4L8WB 1MC8A 3CH6A 1GCGA 1YVRA 4UNRA 4H3VA 2W2OA 5I4CA 2L42A 1ZMOA 3QFRA 5FWAA 4LV5B 1NURA 4OHCA 1S0UA 2QN9A 2DMRA 4GAEA 1WDTA 4J75A 2R8RA 1U7PA 2DBZA 1U02A 2IPOA 3L49A 1Y5RA 4DY4A 1J2EA 3UATA 1H9CA 1D5WA 3OJWA 1V2HE 1SKMA 3GGCA 1OXUA 2AW5A 2EJBA 2NNWB 1QCZA 2ONZA 4KBFA 1MDBA 1NL3A 2WP8J 3D1VA 2XF2A 4FD3A 2EW8A 1G7RA 4KFUA 4LWZA 2MINB 1NI5A 4HEA1 5BYAA 3JPWA 1CVRA 1YCGA 2ZR0A 4S1WA 4LX8A 1N25A 1S8FA 2YWEA 3K0BA 2ZJ2A 1E20A 2IXAA 4MVJG 4F6LA 6REQA 3AB8A 4W5QA 1FW8A 4O1IA 4DV3B 2D8MA 3A7DA 2DFPA 3ZJ5A 4B6GA 2DERA 4EI7A 1FP6A 2WIFA 3F9IA 2R1UA 1BHJA 5A1JA 1RT9A 2QD5A 3A9WA 4JHXA 5CJ2A 1KWKA 3G5MA 3KDSE 2WPDD 2QTBA 5AM0A 4CETA 4F3CA 2G5CA 1TLLA 1BYUA 3LCCA 4NICA 3E2MA 3V1MA 2VJNA 2YS6A 2AEEA 4CMIA 3WB1A 2NOAA 5A3SA 1C7FA 3B89A 1DOAA 3QWBA 3PWTA 4YT8A 2B8NA 3LHSA 2NZ2A 1PL8A 1PN3A 4LPKA 2X76A 5DYNA 3R5HA 1H1DA 1V4NA 1MBZA 1WPGA 1W1IA 2NYRA 2G0AA 2LV8A 2AFHA 2V7GA 5ALNA 2XADA 2XYGA 1JKJA 2BTQA 4M0LA 2PVCA 4TMFA 1JWAB 5D01A 3TOVA 4BB0A 5KWSA 4FS8A 1GGEA 3V1LA 2ABWA 1WOYA 2IOQA 3DCJA 2EWVA 1V43A 3LX6A 2BEJA 4Z8XA 2ODAA 3Q6NA 1MC5A 8ADHA 5KMGA 5JNWA 1S02A 3RO7A 3D8UA 3SVZA 3N7UA 4LISA 4QWMA 1TW3A 1VHQA 2PO5A 2G7ZA 3T7EA 3NHZA 3M9LA 1XF1A 10MHA 5IAEA 4KO2S 5KVQA 2EEPA 1FBNA 1TIKA 1HTWA 2WTNA 4HVAA 4V02A 1Z6ZA 4AKTA 2I2FA 4JIMA 4C0WA 1IZ0A 1SUSA 3HJHA 4HWRA 4KPEC 2PMCA 4B9AA 4BJ5A 3INTA 2HJ9A 1EFKA 2IYUA 4MRNA 4BX3A 4JNCA 4ZVQA 3NEPX 1A9XA 1TQ6A 2DUMA 2XV1A 1WDKA 4EMTA 3A0UA 3EBLA 5JFTA 2XQGA 1Q0ZA 1V8ZA 3H2HA 4X94A 3OSZA 3UO8B 2YMQA 4FDTA 1ZL2A 3IILA 3MD0A 4DM4A 1T6NA 4LJKA 1V11B 4G1UC 1DXYA 4G5HA 3WQQA 1QFZA 1ZC4A 2W2LA 2COEA 4P33A 1XLTC 1X7YA 4H7DA 3LP8A 2H57A 1GADO 5EJEA 2B61A 3A6EA 3ACDA 1NA5A 4EQ6B 5I7RA 1ZICA 3PUXA 1Z5OA 1ZYUA 3N76A 3FOBA 3IMEA 3DTVB 3U4DA 1NBHA 1PTJA 3FDZA 1UXKA 1FDIA 3NW9A 3CKKA 5D7NA 3BXEA 3PPIA 1QR6A 2R79A 2PBFA 3DZ8A 3RIXA 3I4FA 3UHFA 3UMJA 3UMBA 3VPCA 3VO9A 4D81A 3JZAA 5BMOA 4G5FA 1OI3A 1IZ8A 1A2OA 1RLMA 1T4CA 3HWSA 3VDXA 1JDVA 5C18A 3RNOA 3KCQA 2IKQA 3AX6A 3TE6A 5IK2A 1TT5A 2HN9A 3DBRA 3QW2A 4V03A 1J00A 2J0UA 5ALWA 1W48A 2MYNA 3DS8A 5BSWA 1M76A 3NOOA 3DLCA 3PJGA 3ILYA 1WXIA 3FG9A 1JDZA 1R0WA 4Q7KA 5IF9A 4HWOA 1RFLA 3FNRA 4FHGA 1NLMA 2W6MA 1DKRA 3NC1C 4H16A 1MRSA 1OROA 2QNBA 2VYQA 2MIIA 1H66A 4K0RA 5JJCA 4H7IA 5BN1A 5CLJA 1QHSA 4AMZA 5FWXA 1NPDA 1UXIA 1IUPA 2H9IA 5F3RA 3VU0A 3GRYA 4Y2VA 4G5OA 5SYAA 5DHPA 5IDQA 5JHHB 3QKSB 2ZEJA 3P9RA 3F7OA 1T4CB 3LJKA 4DLTA 1XQYA 3QA9A 2J32A 4QZVA 1W8IA 1APBA 1CULC 3QXHA 4JOCA 1R0BA 2PKCA 3QNUA 5C5DA 5KEIA 1TTHA 2VYNA 1PNTA 1RLUA 2XDQA 3I30X 3HXMA 5B3AA 3RG2A 5JXJA 4WJLA 5FH9A 3WDMA 1K06A 1IN5A 1KFEB 3SZLA 4A26A 1ECJA 4EUFA 5LSAA 3OZEA 5FBRB 4CMHA 4ZI5A 1CBUA 3MT0A 3O8QB 3VR5A 3RQIA 4C2UA 2A3NA 3EN0A 5AI5A 1AMUA 1QDLB 2AMVA 3DDCA 4TKLA 3TFQA 4A36A 5EHXA 3FWPA 3WC4A 3HB0A 4RTLA 3DMRA 3T1YB 3PKIA 1E1RA 1G291 2CNNA 4JP8A 5K51A 1U94A 2QRVA 1I9GA 3L6RA 1KJWA 1ACLA 5CLFA 1N5RA 5IM5A 5AW4A 3DTNA 3L7AA 1FK8A 2B5WA 4LS3A 4PICA 4XYGA 2A5JA 2KLBA 5AMXA 1FXWA 2IWHA 3CRMA 1G7TA 3SR3A 3M6FA 1E9VA 9LDTA 1X8KA 3I37X 3QOYA 3CTPA 2ZUWA 4L3WA 3SQOA 3I6QA 3V4RA 2YBEA 1GITA 1C3XA 1H42A 4DPLA 3AP2A 1RC0A 1GUBA 1VJRA 1KETA 4R83A 4ZV4A 2BDEA 4YASA 1H94A 2O9JA 3VYWA 3BWVA 5HQJA 3O8QA 1VSVA 1K6EA 4CI9A 1ISPA 2NADA 2XMSA 2M6LA 4H6XA 4JUBA 4Q4DA 4FI3C 3MNFA 1VJGA 3RS5A 5HZKA 2HWXA 1J06A 2OV8A 4MVWA 1EI9A 4BZPA 2FLWA 1NW6A 1FF9A 3OE4A 1N4AA 2PZFA 3ZJ4A 3DLBA 1E1QD 4I36A 2X13A 2XXAB 1TYDE 3PWZA 1WY5A 3DHEA 3M6MD 3PXXA 3QOXA 4I50A 1Y3CE 4OKSA 5AUPB 3GLGA 3ER9A 1DG1G 1HH4A 1B76A 3H9GA 4YRKA 3GP8A 2CXHA 4XXHA 3TLAA 1JSRA 3G0HA 2D2VA 2Z6AA 1X7GA 3BTUA 2AJLI 3HM2A 3SDBA 1R5OA 4IYJA 2FEKA 3LXMA 4FB4A 3W5CA 3Q0TA 5D6NA 3V4PB 4DA6A 1DFGA 1U3UA 2H18A 3ODGA 4TLDA 2O8NA 3KOOA 3NCTA 5TF4A 3WA7A 5LXTB 1IC6A 3OAAD 4Q34A 3WSTA 3T61A 5LD2C 3ZWOA 3NHMA 5AK0A 2IIQA 1IY1A 4BEBA 5IANA 5IP5A 4ZVKA 4MB2A 1YRWA 3U9LA 1IQPA 1RCTE 1GKUB 3GFRA 1OVMA 4U3JB 1W2WB 1IVSA 4XQ0A 4J0DA 2JFUA 2X2FA 3JQAB 3WYNA 3E22A 5CGQB 1E6CA 3W78A 1SUAA 3MRSA 3WLEA 3AERA 2V6MA 4JJEA 5IW8A 3U7IA 3KHKA 5IULC 2AOTB 4DMGA 1QF6A 3H9QA 1ZJJA 2BZSA 2Q3CA 2INGX 4RIFA 1ZG3A 1O77A 3RFUA 4CL0A 4DRXA 3ITNA 1GZHB 1QB7A 3IELA 3BQMB 2CJFA 3DAGA 4LYHA 3ZW9A 2VNHA 3UJ9A 1SBHA 2FPOA 3GNQA 1DKPA 1RRKA 5H7XA 2G9QA 2HJWA 3KJIA 1EDZA 1WKVA 4MIKA 5TSDA 1XDZA 1O0BA 1OTHA 2DCUA 1MR3F 4QNNA 3QXXA 2HWKA 3G9UA 3Q5DA 4RW0A 4X00A 2CB9A 1I3KA 2G17A 3ENQA 3OICA 1KZ4A 1A97A 2YV2A 5EWMB 3TB6A 4NRDA 2LXNA 1CQXA 4HPJB 4P5PA 3SHWA 3TTSA 3AY6A 3PUIA 4XX1A 1SUCA 2VAPA