3GLUA

Crystal structure of human sirt3 with acecs2 peptide
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
274
structure length
274
Chain Sequence
GKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Human SIRT3 Displaying Substrate-induced Conformational Changes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase regulator
molecule keywords NAD-dependent deacetylase sirtuin-3, mitochondrial
total genus 84
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 3gluA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 3gluA01
1ZPDA 2IHUA 2JI9A 2X7JA 4KGDA 3GLSA 4UU8A 4X3PA 2EZ9A 4IF6A 2H4FA 4UU7A 2WVHA 2QQGA 2H2HA 3HWX1 2IHTA 2QQFA 4RJKA 4FEEA 1OZGA 1YI0A 4JU8A 4K9MA 4Y6OA 4RMIA 4IAOA 4BV3A 1SZDA 1J8FA 2EZ4A 4X3OA 1MCZA 2H2GA 4BVEA 3CF4G 2Q27A 5AHKA 1M2NA 4C7BA 4GM0A 4TWIA 1T9DA 1Q17A 1PT9A 2H2DA 2JI8A 1U2DC 5EJ9A 1S5PA 3HWWA 2DJIA 3E9YA 1YC2A 1O96B 2WVAA 2EZUA 3D4BA 2FR8C 2OORC 2VBIA 4J1TC 1PO7A 3IAFA 4L2IA 4ZZIA 2Q29A 1E3TA 1M2JA 2H2IA 1ICIA 2PANA 2W93A 3D7KA 1UPCA 1YC5A 1BFDA 1POXA 4RMGA 1YNOA 1XLTC 2JLAA 1T9BA 3RIYA 2PGOA 2Q5OA 3JWPA 2VK8A 2H2FA 3GLRA 2Q28A 4QELA 3U31A 1DJLA 2PGNA 1T9CA 4JD5A 2EZ8A 4QQ8A 4V1CA 3ZG6A 1PTJC 2AG0A 4K9OA 2C31A 4JT8A 4MZXA 4JU9A 2FRDC 5EJMA 2EZTA 1EFVA 4FVTA 1NM5C 5EJ5A 2V3WA 1EFPA 2VBFA 4J16C 4V1CI 4JUBA 3ZGOA 4JUAA 4RMJA 1YHZA 5IMSA 5MFZA 2IHVA 4IG9A 1PYDA 3FLMA 4BN4A 1Y9DA 1MA3A 3CLSD 3PKJA 4Y6QA 1OVMA 4MPRA 3LQ1A 5FEMA 4K9NA 1OZFA 5DGTA 3FSJX 1YBHA 4F56A 2OD7A 1Q6ZA 4V1CB 3EY9A 2A1TR 2B4YA 3CLUD 4KPUA 4HD8A 3JR3A 2FWNA 2VK1A 4TWJA 5DEIA 5BWLA 2JIBA 4COKA 4BUZA 4RJJA 1M2HA 5MGNA 4GM4A 1JSCA 5K6RA 4JT9A 4KXQA 1V5FA 2FSVC 5EJ4A 1D4OA 4MPJA 1U2GC 4K9KA 4QPZA 2H59A 4GPEA 4RMHA 1T9AA 1V5GA 3D81A 1U31A 3RIGA 3EA4A 3F6BX 5K3SA 4BV2A 1UPBA 2JLCA 5K6TA 3IAEA 4K9QA 1M2GA 4ZP1A 1POWA 2OD2A 4UUAA 5BWOA 1YTLA 2NYRA 5EJAA 5D7NA 4JUCA 1Q14A 1PNQA 4UUBA 4Y6LA 4FEGA 1Z8NA 4D5EA 4UTXA 5DGDA 4O8ZA 1O97D 3ZGVA 4HDAA 4L3OA 1PNOA 2OO5C 2JI7A 2JI6A 3K35A 2H4JA 2NXWA 4D5GA 1YI1A 2UZ1B 3CLTD 5EJ7A 5MFPA 4BVBA 5BWNA 2Q5LA 4JUFA 3OE1A 5FYQA 1N0HA 1YHYA 3U3DA 1QPBA 3PDHA 4R8MA 2H4HA 1PI3A 2BRUC 4K9LA 1PVDA 4GP9A 2AG1A 3FZNA 2HJHA 4UTRA 4UTVA 3PKIA 4FZ3A 5K2OA 4UTZA 2OD9A 4BVHA 1V5EA 2Q5QA 2VBGA 5EJ6A 2UZ1A 2VK4A 4BVFA 2VJYA 3F6EX 4RJIA 3GLUA 4JUDX 1SZCA 4I5IA 4GM1A 4GG1A 4Q9DA 4MQ5A 1HZZC 4MPPA 4BN5A 1M2KA 3CLRD 5EJ8A 1S7GA 4F4UA 1OZHA 2A1UA 2WVGA 3EYAA 5MF6A 1U28C 4BVGA 3GLTA 2FN3A 4JSRA 1UPAA 4UTNA 2Q5JA 4G1CA 1Q1AA 4C78A 4K9PA
chains in the Genus database with same CATH superfamily
3KPWA 2YFHA 3EMVA 1KI6A 2JIQA 1ZD9A 3HEMA 2MSLA 2W6IA 3LQYA 3U4IA 5J59A 4ZFNA 4UE6A 4FOLA 4I2VA 3R44A 2DH6A 4HDCA 2QTWB 1I36A 5I6DA 4DDMA 2OV2A 2VDLB 2W4IA 3A6EA 4I55A 2OBXA 1ZESA 1A82A 2YHIB 1MCZA 2YHIA 1DCKA 2A7XA 3SYMA 3DO8A 3V33A 5G0SA 2GAAA 3VOAA 3ZUPA 4BCBA 1KDOA 3BMNB 4CF7A 2OG1A 1XRJA 1XTUA 5DTRA 1ES9A 5EP1A 1YJBA 3M89A 4J8PA 3WYAA 1PFUA 2IYTA 3LLUA 2YR0A 3EXFB 3MWDA 1HTWA 4CR6A 1JEYB 2XQKA 2JFVA 3PNPA 5J4LA 1T2DA 2CXXA 1OB2A 1NGSA 1PO7A 2GETA 4MB2A 5TVGA 3VBEA 2HJRA 1FP1D 2PT5A 4XTRA 3WDLA 4RPKA 2VPPA 3H5WA 5IANA 3W9UA 5GIPE 1Q0RA 2AL7A 2XWJI 1W581 3CWCA 3MB8A 5JXIA 4RMGA 1PJRA 1CEXA 2GI4A 1RXSA 1LTHR 4N3NA 4MK4A 1FSPA 1Q11A 1EVEA 2F3SA 3M6WA 2WUVA 3VSEA 3WBBA 1GQFA 5IM4A 3D7SA 1X70A 1NG1A 2Z2KA 3AB3A 3AY3A 4DB4A 3PXGA 4N9WA 1VE9A 2DWUA 4L5YA 2PRSA 3ZX5A 4PLPA 4J4BA 5FH9A 1G38A 4TRMA 1WQ3A 4C9BA 3ZZUA 2IUUA 4M89A 1K75A 3DTVD 3A6KA 2IHVA 2PSJA 4PICA 4IXWA 2PH5A 1GPLA 2VH2A 1PNTA 1FCJA 3Q7PA 4FFVA 4R0MA 2VHTA 3B38A 4OHRA 4XIYA 4XWAA 1TM2A 5GGXA 2OPHA 1JLSA 1EK6A 4UCFA 4JLOA 4Z99A 1V5WA 2RMKA 4CIBA 4IJKA 1W36C 2A5JA 1PR2A 3K1YA 4G84A 3ROEA 2RGEA 1AQUA 1VA4A 4MLPA 4MQUA 4BATA 3VM6A 1CUWA 1JSCA 5BR7A 5JIBA 1JILA 2C8KA 1OGYA 3BK7A 1EJBA 3H2HA 3IELA 4Q7EA 3RU3A 4E22A 2CUZA 4DWVA 4ZVTA 1LQTA 3FNBA 3I53A 5KDOA 1TD9A 1YUBA 4HKTA 1NW4A 2OHVA 4Y1RA 3RUHA 3TLKA 3QTLA 4B6RA 4LCBA 1FU4A 4U00A 1SM4A 5B6PA 5B7NA 5HCNA 1RAEA 2OQIA 4IS3A 4LMAA 4NOJA 1ORDA 2P4EA 2XKBA 1ID8A 1V1RA 2ZVJA 4WA8A 1C1XA 4MQEA 5AK5A 1DV2A 1E2EA 1HLGA 4YQYA 3E2IA 4FD2A 4RH1A 5F1OA 2JI7A 4ZHSA 8MHTA 1LI4A 3GVXA 3IT0A 4D9FA 2YRXA 1BHJA 4R1LA 3COPA 2GVZC 2F1OA 5FNZA 1ESCA 1T0JB 2ZBEA 1D07A 4RPGA 2VO1A 3GXBA 4KJZA 3CR8A 1HURA 1NMQA 4C0HA 4U2GA 5JJLA 1QIKA 2F43B 3M49A 4MVXA 1KSHA 1F4PA 4XVCA 3D2LA 1U1DA 4ZQIA 1NBMD 1P5JA 2QVYX 4B7CA 1EXDA 5K4AA 4EG1A 2OB2A 4FMPA 1NX6A 2DSTA 2E55A 2A0XA 3UOWA 1GSIA 2RK3A 4HWKA 1R0SA 5ICCA 4H6PA 5FP0A 2XI4A 2XYGA 3RC3A 1RXIA 1SVOA 2BTQB 3A9VA 3SEFA 4EDFA 5HMLA 3AR4A 2QVCA 5KDLA 4ND1A 3MBIA 4AK9A 4WNIA 1AUVA 3GMTA 4P3XA 5DX8A 1Z25A 4ZCIA 2JJMA 3GB9A 1CK4A 2Q7XA 2R86A 1D1TA 2WDZA 1FJGB 4KN5A 3GVPA 3RVKA 4NCJA 1EHIA 1P1IA 4B85A 5CB4B 5BNZA 4TMXA 4OHXA 1LF5A 2C5LA 4NQZA 3VVCA 3FKQA 1UAYA 2C04A 2JA2A 2Z8YA 4L6CA 2JGDA 1V4BA 4KI7A 1AX9A 3AEZA 4HGZA 4ZV7A 2FR8C 1RWOA 3RS2A 1RM5A 3CB4A 4PTLA 1ZCZA 5K3FB 3FMGA 5TPZA 1PUXA 2B4KA 1M2JA 2BLNA 1OMOA 4PO8A 4YGXB 1EK0A 1DDIA 1BDMA 4RPHA 4EQ6B 3D7KA 3WADA 1A8PA 4OH1A 2OQ2A 4UZEA 5E9QA 3ZHYA 4BVKA 4F3YA 3IHWA 2JLRA 3OTWA 1G5HA 1DMRA 4BMXA 4F3RA 5CTJA 1C9DB 1EVJA 2CKMA 4C0WA 1DBPA 3FHJA 5EP4A 3T41A 1H66A 4YCJA 3KKKA 1P5ZB 1VZ3A 5K0ZA 2V98A 1GG9A 2GBFA 1SBQA 3ZTWA 1Z68A 2B1JA 4IDCA 1DG9A 1SHLA 2WM3A 3PR3A 2D1RA 1ZGCA 3QOWA 4LQDA 4OFBA 5T67A 2FQXA 4Z8YA 3WXBA 1GL6A 3HO6A 4CMEA 2FPSA 3KV1A 2C54A 3FSGD 3SICE 2I65A 3FPJA 4F56A 2WLTA 4QRIA 1IK6A 2DXIA 1UJ2A 4KPUA 1J8YF 1C0LA 1OHHD 4Q02A 1VBKA 1QVVA 1T2FA 2E7ZA 1WNFA 1CG6A 1EFAA 4BBPA 3H65A 4KBGA 4A8HA 4HXEB 1NQVA 3ZGLA 3BXEA 3CU5A 4KHZA 4NFHA 5K3AA 5BVHB 3ECAA 3ZE1B 4ZJPA 1JU9A 3NM6B 1PT5A 3HDYA 1WXDA 1AMUA 2UXCB 4J7XA 4NV1A 3QVTA 4FHCA 3PF9A 2POCA 3O3CA 2FPUA 4EI8A 5LFAA 1JH8A 2ZXFA 2XE8A 2XQGA 3UJDA 3PNYA 2ZJFA 2HBZA 2W37A 2WMDA 4HJRA 3CONA 1JLMA 4NXMB 3GBSA 3G49A 3AHDA 4MV6A 4YBZA 5BV2P 4DV4B 4ZZ1A 1VKOA 2Z9CA 4JEUA 1AUPA 2AFRA 3EGOA 2DBVO 5BWNA 3QFSA 1E96A 3OMLA 1V8ZA 3G17A 2QRUA 2Z8XA 3RVPA 3L40A 4DABA 1NE7A 2GA9A 4TZ6A 2QP9X 4QO7A 5C9ZA 1AGNA 2X9QA 2PXHA 4LYHA 1KZ6A 1YBMA 1CZLA 4DQDA 3KJNA 1ZVJA 2C2ZA 3A9SA 2UZ1A 5BSGA 1C8VB 3L0IB 3F6EX 1X9HA 4ACAA 5CB4A 1ISHA 1CF4A 3E0XA 2JGMA 3TR0A 4C4RA 2KLHA 3IRVA 5K8IA 1DNPA 4E88A 2I8LA 4NATA 1YJXA 3O2NA 3BM5A 3ESXA 5IZ4A 2WJPA 3PZBA 5HF8A 3OY7A 3H5LA 4A91A 5CLHA 1KF0A 4KLRA 3R5SA 4QO8A 4JOBA 4KE6A 1W5BA 1E6LA 3OEYA 1Y3HA 4H15A 1GR0A 4IIEA 2LNDA 5HIKA 1E9SA 5H70A 4AZ3B 2LVBA 3T7IA 3AHGA 2EZ4A 4WX2B 3CIFA 2UUCB 4QVKA 2KI5A 3MSCA 5HK8A 3EPJA 3GR6A 1F9AA 3PGLA 2DT5A 3RSFA 1NT4A 1WV0A 2V59A 1K8ZB 2XYHA 3GDOA 4PYLA 4RBNA 2VZEA 1ZR4A 3DMNA 2R48A 4OL0A 3KB8A 2RHMA 4RVHA 3DAHA 4QL3A 1WG8A 5B57C 1T5IA 2QN8A 3OZIA 1U2PA 3ML1A 4G0ZA 3B1VA 2ZB3A 2G4LA 2MMGA 2XZTA 3EVGA 1FY2A 4MRSA 4KDCA 1M8GA 1U8XX 1CQZA 3BVPA 5KJ1A 2XUGA 3HK2A 5TEVA 1VG0B 1DAOA 5ISMA 4CMKA 1CBUA 1U2QA 3C48A 4ZVQA 1XZPA 1YFZA 4RSMA 4EHHA 1P0CA 1I33A 1P7CA 5KKNB 4E5MA 4Y1RB 1JWLA 4PQFA 2CWWA 4OJQA 5JROA 1PSZA 4GOKA 2QN7A 1USGA 1HYEA 2QPLA 1YVPA 1UQRA 5HIJA 4Q4LA 1X42A 1WXHA 1CQWA 3QMWA 1W85B 1CRLA 2CDRA 3CNBA 4RMNA 4TM8A 3WGMA 5DGTA 3Q9SA 1ZAYA 1CEQA 1BXRA 3C45A 1OTYA 3GRPA 1YXMA 5KTSA 3CX8A 4A8JA 2B4YA 1X80A 2Y1LA 2AK2A 3MCTA 5AK3A 4DYDA 1YRLA 3HQ4O 2OSVA 3R3WA 3S8EA 5JAUA 2PR7A 2R8RA 3EH1A 2JH3A 3E81A 3IDAA 5HZKA 5K01A 1WHSA 3OT5A 1KHTA 4I1SA 3DOUA 3AR7A 1TPYA 3U16A 4KE8A 5B4UA 4QUBA 1JJAA 3O5AA 4RDXA 3G0BA 2GT1A 5IJ0B 1WZIA 2PJRA 4MVJE 2HXGA 4L72A 2C2WA 2NU7A 3CNOA 1QAOA 1WHTA 4HS9A 1RVDA 4XUEA 1WZCA 3VJKA 3WGGA 4BLSA 4EB8A 5T7BA 3VU1A 1UAAA 2YVUA 2H7VA 1MXFA 4Q93A 1IG3A 2IVFA 2FMFA 2HRRA 1FFXA 2QL7A 3EWSA 5AI4A 3WLHA 1IXYA 1F9EA 1ZJ5A 3O82A 4FLMA 2P77A 5EXPA 4IUCS 5JDCC 3VR5A 1VIAA 5F51A 4GEGA 4R8MA 2CMGA 4PN3A 4BNXA 4FK8A 4EPXA 2ZU0C 2H9AA 3MRSA 1G8YA 2POQX 5ADWA 4M2LA 3CEHA 3IX7A 5LQUA 1G60A 2WDPA 4FFMA 4PAWA 5BQXA 3P9RA 3BC1A 2IKSA 1LK7A 1TAHA 2OV1A 3M6FA 3Q98A 4N3BA 3VYVA 4D41A 1HA3A 4F4IA 3J7AC 5L6LB 3G7NA 3EC7A 3ID6C 4TTAA 1NTOA 3JRNA 2PH3A 5IVIA 1C3OA 1OSNA 3WNBA 3H2GA 3P9PA 5HFJA 1FMJA 1PDWA 3TZHA 4F46A 1JKJA 5EA2A 4FDUA 4XH9B 3K5HA 2Z6AA 2O2DA 3SC3A 3U3ZA 3LT4A 1QIGA 4OLHA 1DO2A 3B6KA 1A4IA 5FTMA 3TL3A 4MJLA 1GM5A 3VOBA 4BNYA 1E3WA 3LHDA 4MYUA 3IUEA 2QUIA 3AUJB 3PL1A 4TN1A 4QFBA 2COKA 4Q1VA 3V1UA 4CNBA 1Y6FA 4RL4A 3RC8A 4KFTA 1NZJA 4YCNA 3C87A 5IUJC 2DH5A 1O4VA 1O95D 2ZW9A 2DFDA 3D6UA 2J5KA 1HYQA 1LV8A 2V58A 3ORSA 2O2CA 3PNOA 4QDJA 4GPAA 4FTWA 1FRQA 3EVBA 4JC8A 2JI8A 4DBZA 1R6DA 1N0WA 1OOEA 1NXVA 4OQNA 2RC5A 2FY8A 3WL4A 3L1UA 4G1UC 2V9PA 4GQAA 5I3ZA 3BJMA 5E4YA 4CTNA 4R1SA 1ZOPA 3ETJA 2NSJA 2J87A 2R00C 4RZXA 3WRYC 1W4CA 1QYIA 2DF8A 1YQ9A 4UBNA 2QRHA 4B73A 5SY9A 3BWMA 3C4QA 1M72A 2FPKA 2EKBA 3EWNA 5DHQA 3WWYA 4EHFA 3R5JA 4WFKA 5KSWB 2UUAB 3IOYA 3UPTA 1JBKA 1I3LA 3E9QA 5B4TA 2SBTA 1WU7A 1NMSA 3C1OA 4BMZA 1PX2A 1GV1A 2Z1MA 4E32A 2FPPA 3RFVA 2DHRA 1I3CA 3DHEA 3VDRA 3URMA 1MN6A 4OKSA 4WJLA 4U7HA 4HP8A 1L5WA 5C34B 4JXZA 5EKUA 1YQWA 1DRJA 1XL1A 2Z2YA 3RNLA 2GUGA 1LDYA 5IVDA 1IWBB 1AUOA 4I4TF 4IIYA 4NDNE 1CJVC 3ZWKA 5JSHA 3GLIB 1T5LA 2QZZA 3LUKA 1SCJA 4R7GA 3UAOA 4F8EA 3JARB 2ZYIA 2ODPA 5CK4A 1Z0AA 4NKRA 3QWIA 4PGFA 4N48A 2DRIA 3G5TA 1T6NA 2PWBA 3P9XA 5B30A 3I83A 3WGOA 5JZVA 2A0YA 1ZITA 1UK8A 2J9FA 2YV1A 2YWHA 2YYYA 2NMVA 3NTVA 1ZCJA 2VH1A 1D3AA 4ND4A 2EFJA 4CLRB 4D3ZA 4D8XA 3THXA 1ZEJA 3DDHA 3W7AA 3ZNNA 4M1QA 2EGHA 4HNVA 1RPTA 2E5FA 5KVAA 1Y3BE 5E3JA 1T8YA 5TMPA 1TZJA 5LM3A 3REOA 1QS0A 4M7WA 3ZXSA 3W9YA 4B4UA 1LA2A 3BXOA 1M2WA 1DVRA 4OQLA 4DA0A 4ER5A 2IJGX 2VWQA 1RWNA 5F4ZA 2AE1A 4KWIA 1R50A 4MUHA 2R5WA 3HTXA 1QQ7A 4J2OA 1X7ZB 4BNDB 4G6ZA 1R37A 2PSFA 5K6AA 1LQ2A 4UNIA 3RSOA 4OL9A 1CR6A 1SXJA 4IV8A 1G55A 4PYOA 4Z0NA 1I7DA 2O7RA 3JQEA 3PEWA 2RD2A 2FPIA 4C29A 1L7EA 2FSIA 5CW2A 4OBEA 2OV6A 2Q3MA 3TKAA 2FDCA 1J23A 4OI0A 3ZH9B 4NFYA 2HRQA 1FIUA 2OV3A 1K7EB 2QE6A 3OUUA 5PGMA 9LDBA 3JATA 2CNWA 4QX6A 5I48A 1R15A 3GJ6A 3V1NA 2BBSA 2H54A 3ZW7A 2VBCA 2P68A 2NTNA 1LD3A 3EPPA 4QTTB 3RSLA 3LDFA 4WOPA 3G8BA 3IUNA 4YWJA 2ACWA 1ZLYA 2VH5R 3IKLA 1BYIA 3CSSA 3COWA 1IZ9A 1CJUC 4HK4A 4GPTA 4KREA 2C98A 1VSQA 3BL8A 2CVOA 2K7ZA 5LZ5A 3PQ2A 4LDJA 1U2EA 3IP7A 3AYXB 3TLCA 3U4QB 1WPRA 5FEUA 3P97A 2GN8A 2QLNA 4UFNA 4CT0A 4AJ9A 2O9JA 1FUYB 4KQWA 1RQLA 4IF6A 2YNMA 2XCSB 2WVHA 2JVKA 4TMTA 5AJZA 4YAEA 2OUIA 4LJ8A 3ZWBA 4Q4HA 4Y6OA 1SZDA 3H04A 5TS3A 1QIEA 2ISSD 4N7RA 4QNMA 5DHUA 2FPRA 1SQFA 1NL3A 1FXSA 1WO8A 2O3RA 3ETEA 4R01A 2C5GA 1L3BA 4JBNA 3EFEA 4A27A 2Y1FA 5IDQA 4XB2A 1EFLA 1GKUB 4IFIA 1PNRA 2FWJA 2VF4X 1XG5A 4JVNA 3K4QA 5F21A 1TUEA 4RGBA 1UJ6A 2FN7A 2PNFA 3ZHQA 2CLLB 3DMHA 3M9LA 4I1UA 1EIWA 2ZLBA 4UUOA 3ESCA 3TO5A 4LBZA 5JARA 3PVSA 4LK2A 4XYBA 4HFNA 4CKXA 4V2UA 5KHLB 4LQCA 4FYPA 4D9JA 3NHMA 3W5JA 1OJLA 3VYSB 3MGAA 1DCMA 1XCLA 4JB2A 2EZ8A 3FMVA 4IIBA 4RS3A 4TMVA 1IK4A 1SUEA 4PPQA 4U7TB 4WOKA 2FX3A 2WE8A 4HGQA 1HK7A 3A2NA 4MMZB 3GX1A 2IC5A 4QUIA 4WAUA 1EEXB 5L53A 4DWWA 4G3XA 1IXKA 1O2DA 2GXUA 2PSSA 1Z8HA 3WWZA 4IX1A 2FUG1 3RIHA 4BN4A 4WJKB 4E5YA 3ZV7A 2REQA 4GX2A 3GJTA 1WSDA 3RPEA 4DWOA 1ODLA 5GZ6A 1NNSA 2Z1NA 1FP6A 5CHEA 5EVCA 3BRWD 2NZ8A 1G3MA 3UGJA 3MW8A 5JBIA 4PCVA 4E51A 2WICA 4D97A 4NU6A 2Y4NA 3EWIA 3IYLW 4Q05A 5AI6A 4CM8A 3IALA 5I8WA 4AQDA 3LU1A 5JNSA 1NN3A 3C8MA 4FDAA 3PHBE 4QYXA 5H81A 4JV5B 3WE7A 4II2A 4IMIB 4YDQA 1TQHA 4FSDA 1XV5A 1C5KA 1CP2A 4K9QA 3WMRA 1W48A 4L57A 2PCJA 1AN9A 1K08A 3NVMB 4BKUA 5JPIA 4CGYA 4XB6B 2I66A 2VLIA 4UUBA 1RVV1 2ZR8A 1KU0A 1YB2A 1PGJA 4TV8F 3LFHA 4V3CA 3ADCA 1UXIA 3HB4X 3KR0A 4JLPA 4M9QA 3TCNA 1PJBA 1PWXA 4E5NA 4YRMA 4Y0NA 5I47A 2GPNA 3T9DA 4AJOA 2WG1A 1XAGA 1E79D 3ZOKA 2HK7A 1Q0LA 1Z6QA 4MUBA 2C7QA 1VLQA 4IICA 4U02A 3E9NA 3JWHA 1UQTA 2HSGA 1PVDA 2Q9AA 1NR7A 1Z5VA 3IE2A 1OY1A 4XA8A 1W19A 2VP4A 4JMLA 4ZQHA 2O54A 1B2LA 4R7TA 5CDHA 3H8JA 2SCUB 3SBOA 4C87A 2VLBA 5AVZA 4AN4A 5KCMA 1F1BA 3T7EA 2CW5A 5DE3A 4QTXA 4DG5A 3GLFA 3SFZA 2OCYC 4QJBA 4TQ9A 4TLCA 3ZQKA 1EDZA 4BEBA 5CP8A 2I6SA 4WV3A 2WMNB 2H29A 4US2R 4NENB 1D2RA 3LE8A 1P1HA 1L7MA 3N2KB 3KAPA 3GLTA 2FGKA 2EQ5A 1PJCA 2O5VA 2GXQA 5JMTA 1UFKA 3WK9A 4UU8A 1XTJA 2PT7A 2QRJA 2XR1A 3GEMA 5ANRB 3IR7A 3D31A 5CW1A 3WL8A 3O03A 4DY6A 1OROA 2IHTA 5AUOB 4D8UA 4GYJA 1U3GA 5AK0A 5DN6A 2WIGA 1DX9A 3RYCA 5JS8A 2YRWA 1K4KA 3F5SA 3UUEA 4XSGA 1JDBC 5A7FA 5AR1A 1DKNA 3BRQA 3AKZA 2BY4A 2ZGVA 2RGNA 2V96A 4GRIA 4S05A 3SHFA 4TRJA 2I2XB 3U4AA 1JR3D 2HC9A 3EE6A 2JJ1A 3AF4A 1MW9X 1O96B 3WK6A 1PVOA 4MJXA 3UPDA 4X91A 1DJQA 2AN9A 3H17A 1ZJ6A 2PGDA 4NTZA 4UJ3A 1EVLA 2YVKA 1KI4A 3HMKA 1SVSA 5IX8A 1JAIA 1K0FA 4IIJB 3C70A 1WCWA 4ZCSA 4IV0A 4OKIA 4IOMA 3L0BA 1G19A 2OORA 4P5DA 5FFFA 3UYLA 3C7DB 3FJ1A 3CX6A 3L46A 1IAVA 3CW2A 5BQ3A 2NU8B 1QH0A 4AJLA 1DKLA 3TZKA 4B9AA 4BQEA 1BOFA 2H9YA 1QYRA 2QTTA 5H8WA 3TZQA 2H0QA 1YZLA 1WOYA 2V5AA 4KUGA 4Y9DA 2ONYA 5CB8A 5KNDA 1XWWA 1I7NA 2WV7A 1RW4A 4LRQA 4Z0PA 2FKAA 2R3SA 1VGRA 4OSOA 1TYEB 2QPOA 2P79A 2Y0CA 4YECA 5LD2C 1R8SA 2C4WA 4CIAA 4JWTA 1BCSB 3QU9A 1RZRD 4BAGA 4V0LA 3UQYS 2DC1A 4LVCA 3FKJA 3A1UA 4Y2UA 4WRRA 3WHLA 5D8DA 1BZYA 2B4RO 2BR3A 3OOYA 3HA7A 3I05A 4H7EA 4M8SA 1EA7A 4EA7A 3PD0A 4EF4A 2G17A 1XSEA 2FMKA 1C0EA 1QFXA 1X13A 3IEIA 1ULAA 4FCVA 3GLGA 4GT1A 4RJTA 2Q3EA 4G36A 5EJEA 1Y81A 3X1DA 3L0YA 1CULC 2B8EA 3ZGNA 2FSUA 4AROA 1Y5MA 3PNQA 1TLLA 1BRMA 4DWJA 2PJZA 3GLHE 3KTDA 1F0KA 4YDRA 3SNKA 4K86A 2PMDA 4ZT7A 1EBFA 4ZVNA 2B5OA 4F3CA 1SUIA 1B15A 3F73A 2OB1A 5F2NA 2XUDA 5LBUA 2WSLA 5HGXA 2TRSB 2UYHA 4C21A 2QG6A 5ITSA 2ZB7A 5FNVA 2PL5A 2HJHA 2VJKA 4OMDA 3UMSA 2J3QA 1KXJA 5ETJA 1ZVKA 1Q0HA 1LB1B 1LJ8A 4IFEA 5DCYA 3BSYA 1QCCA 4MV4A 1BMFA 5A7HA 1I1OA 5JVDF 1LWOA 4MYSA 4Q01A 3OT4A 1D4FA 2F3TA 2Q4DA 4BO7A 5IXSA 4H1WA 2PUVA 3K5PA 3V8RA 5A3SA 2HQ1A 3WLQA 1TAUA 3EOZA 1N9KA 3I23A 2AR7A 2SKDA 1KMHB 2DB3A 3U49A 1KYQA 1P5FA 5G4LA 4DA9A 4DVGA 4PAGA 3MINA 5A02A 2G07A 3W2HA 1QIIA 1GV0A 4H1UA 4WEQA 5I7UA 3EGIA 1ZA1A 3LKVA 1NOJA 1QDUA 4DZZA 3HFRA 2W71A 1RWVA 2AG8A 2P5YA 2J85A 4XDZA 1YR9A 3MCWA 3N0WA 1P2UA 4RMIA 4M37A 1JXQA 3DC7A 3WJ7A 1YMUA 3V80A 4AJIA 1SXIA 2O50A 2OT3B 4V39A 3WLMA 5DVZA 5EERA 2F4NA 2ID9A 1M2NA 4TLEA 5AM0A 5EE9A 3RVQA 4GBED 3GROA 1FC0A 2A5FA 2X5KO 2P2GA 4Z4FA 4QDKA 4RCVA 5DRTA 3CF0A 3LBHA 4YMGA 3HH8A 3RQSA 4B2LA 2G4CA 2WFAA 1SB9A 2Q29A 2XNJA 3HKDA 2II6A 2ZYVX 3VTAA 1SKUA 2H85A 1IFXA 2J0SA 3LT5A 2ZJ7A 5IMBA 5HR5A 4D9CA 3OZXA 2UUBB 5TR9A 4U0JA 1QK4A 2QVXX 4YXFA 2FW1A 1XRNA 3B7GA 3IAUA 1FUKA 1GZ4A 1LRJA 1KJWA 3D5TA 4CKCA 1OFGA 3I5AA 1EFVA 3ADOA 1DB3A 5LWHA 1GTL1 3NMUF 1P75A 3FKSA 3E7WA 1LVUA 1A71A 4UNPA 1QVAA 4GC9A 2BI7A 2HA6A 3SKVA 4K9NA 1P7VA 5JECA 2IIVA 3DVQX 3PICA 4KQEA 4HTAA 3V2GA 4EG5A 2Y76A 3DMRA 1Y89A 2ZTLA 3IBCA 4Y2HA 1Z06A 5D5PA 2QLMA 3KD2A 1XZQA 2DKOA 1D1SA 2BT4A 4UAVA 4G0MA 4AO6A 4LE0A 2AF4C 3LA6A 3PQEA 3VHXB 4R3WA 4FQ8A 4PVCA 4TSKA 4HNGA 4EGCB 4Z4EA 4CIDA 2KBEA 1DPGA 2LKCA 4KQXA 5FTNA 4GPEA 5CCDA 3FGOA 1XDGA 4AU1A 1M2GA 2FFAA 5H80A 2C5FA 3GRUA 4FYWA 4G5XA 2DHEA 2JD2A 1HWYA 7ABPA 2Y1WA 3SJZA 1L4HA 1ZRSA 1YZTA 4CEIB 4X92A 2J3EA 4RIHA 2GJAA 4JQZA 4ZMSA 3IVXA 1KI6B 3WWPA 1IOVA 2G36A 1E9EA 3HL4A 3P7MA 2OGSA 3CLTD 3T52A 4HNTA 4W5TA 2XVYA 1A7UA 2HA5A 3MELA 5TT0A 1Y4AE 1F8YA 1L5ZA 3N7AA 2PUDA 1FOEB 2NZXA 1TVCA 2ZEJA 3DXYA 3LYAA 3FZNA 4N0DA 4E3WA 1NBEA 1DUSA 1QUFA 4LHZA 3FNQA 4XEHA 4LGCA 3ZIAA 2VZ9A 3GUZA 5ADVA 4EHLA 2JJ1D 3HXQA 1QG6A 3V9AA 3VR2A 2YZNA 3OTGA 3OFNA 2OHGA 1EX1A 4OAQA 4ENTA 4AJJA 2C0PA 3ETGA 1NBAA 4JP8A 3OQPA 2C00A 1JFFB 3MQ2A 1H2WA 4I81A 1UDCA 2Z5FA 4MEBA 3EUEA 3PT9A 4W8OA 5CX1A 2V65A 3U62A 4BKOA 2VK2A 5LMCA 2WWXA 5BV0A 1MW8X 1IM2A 2BCJQ 3U4MA 1AD2A 1RWXA 2QI9C 2R2GA 1MRZA 5EQDA 1PR1A 3S3TA 1GGNA 1G8AA 1M34A 2DPLA 1XMVA 3HSYA 3ZZMA 1QU3A 3HYLA 2EW8A 3KVYA 5J5CA 1II0A 2VXOA 3A6HA 4LYAA 4IILA 2JH9A 3R76A 4HDOB 3UG6A 4BO9A 4BO8A 1Z7BA 5I7FA 4GQIA 1GO2A 1OTHA 4PX2A 3ZHVA 3KWLA 4P32A 4GOND 1W76A 4AY3A 4OXQA 5HX7A 1DTSA 1M7BA 4GZ3A 2CT8A 1EUYA 1YV9A 2NZWA 4OP2A 4OGFA 4BRWA 2IYYA 1I6KA 4RZHA 3THWA 4FP9A 1V16A 3H9UA 2XCTB 1PQYA 4A16A 3RF7A 5KYTA 2R7KA 1TM3E 3OQIA 3INYA 3SCZA 3S70A 4LY3A 1D8TA 2OBBA 2WP8J 4J94A 1FMCA 1MR3F 2BGUA 2JVJA 3BL5A 1L7PA 3G5UA 1KQFA 2Q28A 2VSOA 3KELA 3OFVA 4ZXFA 1P7PA 3A6GA 3RFTA 3M3DA 2QAGC 3OCYA 4WN9A 4OK6A 1L7RA 4M54A 5EEGA 3I3OA 2ONJA 2XUFA 4I9NA 3KM0A 1SD2A 4M7RA 3IHTA 3GT0A 1VG8A 2D7JA 3QPCA 4J03A 4P7KA 4X95A 1WXWA 4FS3A 4ZVLA 3QUSA 3K09C 3W9BA 1QGYA 2O2EA 4PEVA 1IUOA 1RZVA 1WF3A 4NFLA 3TB4A 1SUWA 4A0GA 1CE8A 3VRHA 4D3SA 4DEVA 2I03A 4B34A 4BZQA 3E8SA 5J4VA 2XMBA 2YZMA 1QK5A 2JFQA 3NKLA 1BW9A 4IGKA 2XF2A 1ZRHA 3UKDA 3CC8A 3S28A 2WP0A 3E23A 3THOA 3U7IA 1DQRA 4NCBA 2ID4A 1JHOA 4EHAA 4EJSA 5C8DA 5CNIA 2ZRMA 2D4HA 4L28A 2BD0A 3D3WA 1K9VF 4FMCB 1MEEA 4A0HA 3HHEA 3JQRA 2A5YB 5BWOA 2DR0A 2ID8A 1AKNA 2Y6UA 2O0KA 4G1MB 5FBVB 2NQ2C 3F4BA 3G1TA 3OLZA 4Q3LA 3SP1A 3HFGA 1P6QA 4MW6A 1D9ZA 3IJEB 3CY6A 1FFCA 3B70A 4FYXA 5G53C 3K92A 2ZUSA 1RQPA 2XGOA 4KLNA 4I1YA 3LCJA 2GN4A 1E0DA 1CETA 2MWMA 3IODA 4DLXA 2A9KA 1GEEA 3HACA 1XTIA 1OFTA 1XDUA 3DV2A 4MW0A 4EYSA 5GIOE 3VKGA 4IYRA 4ZOLB 3OU7A 2QVGA 3GEEA 4KMOA 4RTJA 2NXJA 2WBLC 1CQXA 4NJEB 5THQA 4O0LA 4RTNA 3LXMA 1T2UA 5CH8A 1OLSB 3RKRA 5BOSA 1CS4C 2C03A 1K92A 1UBSB 1XMPA 3D2CA 4PVDA 1E3DA 4RGQA 4AB1A 3PLAE 5EFZA 5T64A 5AVWA 3EZ7A 4IPTA 5HIMA 1WHTB 3DXFA 3GMSA 1HSZA 2R8PA 3ZWOA 1NURA 1SRRA 4AP5A 2CV2A 2W4QA 1T3LA 3PIDA 2VHEA 2ZVDA 3GT4A 3OQIB 1EX9A 4ZYVA 4DUGD 2GO1A 1DGQA 1C9NA 2N1BA 3EGEA 4HV4A 5TF4A 4LZWA 5B6JA 2F9LA 1DHTA 4BY9E 2ZCVA 1GCAA 3TTYA 4CF5A 2OL4A 1NUHA 1YO6A 1C81A 3BGDA 4JX9A 4MKXA 3R9XB 5KC9A 1K98A 4NF2A 1DP4A 2NU9B 5LQKA 3PKZA 2VDWB 3GAZA 1H3EA 1DAIA 4M1YA 1NI3A 3FPEA 1GIAA 2RGBA 1I2MA 4PSKA 4MGYR 4Y2GA 3H0CA 4V02A 4K3VA 1T8TA 2XCLA 1QO0D 3EEIA 1A72A 2QGFA 3IIJA 3JZFA 2HSDA 1J2JA 2HDNB 1OW3B 1T34A 3G9XA 5MN5A 1U94A 2DJIA 1RRVA 4EYEA 2WTUA 1RE1A 2P7IA 2RJOA 2VC2B 2GA8A 2X6QA 4EW6A 3JD0A 4BFUA 4BB9A 5JNRA 3UPUA 4KKXB 3N7TA 2YN4A 2Z6UA 4HRVA 2WUDA 2D8MA 4FC6A 2BKLA 2JGRA 2WF8A 5ER9A 3VU9A 5BN3A 2OAEA 3L4EA 1DHRA 1M1YA 5DASA 2YY7A 3UA3A 1CDOA 2XDQB 3I32A 3JATB 4YJ3F 2B8NA 2O1WA 3HDGA 5C5IA 2P3LA 4JQOA 4O4LA 2AQ8A 5BW4A 5JTTA 3L8FA 1SVIA 3CCCA 1JIKA 4HZGA 1XT6A 2YWJA 2ZIWB 2ZRIA 2WHXA 4Z4QA 4C4PA 3PWTA 3UV6A 1XHLA 3CKMA 3FH0A 1NW7A 1W59A 3U3XA 2XB8A 4Q1FA 1OZFA 1Z2CA 4TLLB 2Q46A 4I9UA 4HB4A 1S2DA 1VL0A 4UDOA 4IOLA 4PYIA 3C5WP 4UMDA 5DYGA 2IHJA 5E9JA 3MS7A 5CNKA 2RBKA 3UB2A 1KK0A 4FLFA 2GLUA 4OHYA 2Z98A 1QGDA 2E2WA 2QTVA 2X3UA 1IY1A 1KI7A 3ACBA 4I2NA 4MIOA 3W6PA 1J4AA 3FI9A 3G9UA 2P2YA 1D4OA 2GRAA 4LX0A 1VDMA 4LY9A 4BTLA 4O2AB 2PL1A 4ROSA 3S2YA 3K1ZA 1KIMA 3OM1A 1K6EA 1XHEA 4R84A 1ODKA 1VSVA 1L5OA 1T35A 1TIBA 3FPBA 3OZWA 3B9RA 1E2IA 1Z26A 5EWMB 3PBKA 2BGNA 2OBNA 2W2KA 3LX6A 4OMUA 1Y3CE 1JI3A 3AINA 2WUFA 4OQDA 4CLXA 4D5EA 4YUXA 3IL2A 1IN4A 3C5HA 1W1UA 5FBQB 3TI7A 3E82A 5JANA 1VPEA 5JYEA 3OFKA 3KO8A 1RJ9A 4DDTA 1O57A 4BNVA 3W79A 1SQ5A 3MXOA 1E1QD 1SKMA 1VE6A 4FXOA 4RS4A 3GQBA 2FJUA 2IS4A 1KEVA 3Q85A 5ARCA 1C7QA 2AJTA 3AFIA 3GVCA 3VR6D 3F4LA 3MTIA 2GEFA 2P6MA 4FLEA 1X8JA 4BKPA 2GBIA 1RHMA 3O4IA 4IZHA 4WBNB 4WSOA 4B6QA 2AUTA 2P4QA 3A32A 3ONDA 2GZHA 3OF5A 3BDIA 2CMFA 4DT1A 1ONNA 3NTOA 2ZBGA 3VI3B 1Q7BA 3BXHA 3UJBA 2P9ZA 4BJ5A 1GG8A 4X44A 2ZU6A 5D01A 2ZTHA 3VDXA 3ZWMA 5LDHA 1SXJE 1G7SA 4OOFA 3PITA 4PPNA 2BFPA 4DANA 4KHPB 1XCPA 1SKQA 1TB4A 4OI4A 2M1XA 1MZVA 3AVPA 3ZDXB 3BJRA 5JHGB 2I76A 3NO4A 4NQRA 1SC3A 3G88A 3GFQA 1ZSVA 1XAJA 4J3JA 5KPJA 3AUSA 1UDWA 3IQXA 2H9IA 4KH0A 4MWEA 2WSSD 3ZTYA 4IDFA 1SBCA 9ATCA 1PD0A 3KUXA 3WXMA 4JL6A 5I4BA 5JMOA 2RAPA 3SJAA 1FDRA 4UD2A 3HXOA 1QNFA 2JF0A 2HU5A 1G7CA 5KJ6A 5IVHA 4V0ME 4TUYF 5HIIA 4CKWA 1EUCA 3QRWA 4X1YA 5AW7A 1EXWA 4Z51A 5K5EA 5IJWA 3KXKA 2FK7A 4U7PB 1QO0A 2BMFA 2V0CA 4LX8A 3KT3A 3ZLTA 5K6AC 4CM4A 5AVVA 1UBEA 3V2IA 1IZ0A 4RK0A 3DMYA 5CEJA 2XBLA 1ZKMA 1TTTA 1JPUA 5D1HA 3C6XA 5DM1A 2IDMA 16PKA 3MJRA 4AG3A 2YV4A 4MDYA 4MRVA 4QECA 4C2UA 3U31A 1O03A 4DSUA 1QHNA 2D8AA 3AHHA 1T8WA 4UBMA 4UVHA 3AZOA 2BV3A 1P4AA 1GPWB 2PO5A 2FRDA 2FF5A 3E9CA 4G1VA 2XVXA 2X1LA 4R54A 4DUGA 4E11A 1NRIA 3OP4A 1LSJA 3TPFA 5LYJB 2JFUA 1UP4A 1XP5A 4C22A 4G9BA 1MBZA 5IMSA 2C8JA 1OT3A 2NV6A 1G20A 1PN3A 3D6AA 4JA2A 1JQ5A 3T5MA 3U09A 3KQKA 1FFHA 3P2YA 4X8OA 1MMFB 1VYTA 3ZJ5A 2J07A 2VJCA 3T7JA 2VL7A 2VDRB 3GEGA 3KLPX 2ST1A 2HWYA 4HAYA 3L4KA 2UU9B 2CHVA 3DEYX 4N6NA 4G5HA 3DQPA 1B93A 2OY0A 2ZAOA 1F2VA 3P2IA 1VMKA 1G2QA 1P1JA 1VDZA 3HN7A 3M3PA 3DZHA 4H7KA 3ZGZA 1RNLA 1PKXA 1SHKA 4C05A 1W4ZA 2G6BA 2V74B 2VT3A 3GGPA 1KEEB 3K8OE 4YJHA 1U1GA 3CBQA 4NHOA 3H5AA 2EDAA 3LZDA 3UXMA 1MO2A 1DEAA 1EWRA 3MTGA 1DO8A 4R40A 2IYLD 5BYBA 1Q1ZA 2V5VA 3EFOA 1DTWA 3OMXA 1Q16A 1D1QA 4OAPA 1Q14A 2ZUDA 4X60A 4HUQB 4ZQEA 4UTXA 3CZQA 3ESQA 3DMDA 4TT8A 2BW0A 3CLSC 4J43A 3LQKA 4F2PA 2QZ9A 5K3OA 3WTBA 4ZI7F 1W9MA 1WKVA 1U1IA 3BERA 3KR2A 4PQGA 5GZ1A 3WGIA 1E9BA 1ETUA 1KAGA 1NN0A 3FLBA 5IDVA 3SLKA 4DB2A 1ADYA 1T3HA 1PT6A 1MABA 3D3KA 3OLXA 2PU5A 4TSFA 1F60A 3OUZA 5JWOA 5KEIA 1TE2A 1XLTA 1YR2A 3TZBA 3F7MA 3H4VA 4JL8A 4U1RA 3SG0A 5DNDA 3ZV3A 3DAYA 4Q4JB 2HHJA 1YZNA 4D3DA 5KVSA 3K8YA 5GV7A 4BASA 1IEWA 1QIMA 1S8AA 1ZD5A 2DQSA 2IU3A 2PQMA 3DQQA 2JRLA 4UMFA 5KJEA 1UC4B 2DQKA 3VR4D 5KNCA 1NMYA 1VBMA 3MYYA 1KQOA 3PR1A 3MN1A 3BZUA 5AVYA 3I2JA 1LBQA 2C95A 3D6MA 3EC1A 3WWOA 5ALTA 1VG1A 1W2GA 1H1DA 5FTJA 3ILSA 5HK9A 1Q0TA 2JK0A 4HB2A 3U4DA 4D4JA 4BO0A 1DIGA 4QQNA 2JGEA 2FLKA 2QGZA 1P81A 1Q83A 1XQ9A 2VJNA 3IPXA 4P1ZA 3RFFA 4W5QA 5JCJD 2ZBFA 1CU1A 3V7UA 5H3CA 3K2BA 1I2CA 1XPUA 4PZAA 3ZWQA 1K3TA 1ECFA 4BV8A 3WIBA 4DCMA 3VV2A 1ZNZA 4OHZA 3UBTA 1O54A 2DOKA 2L82A 2FUEA 4FFWA 1HG0A 3PSHA 2OK7A 4GHWA 1B1CA 1W94A 3T5TA 2XVAA 4E1VA 5ARDA 2JA1A 3JQ9C 3HDTA 4HEA1 4C2BA 4DUYB 3JTEA 3GLIA 1EX7A 2X0KA 5EL0A 3L06A 2OYCA 1Y4DE 4HQRA 1G9TA 2M9MA 2FG6C 5CDUA 1U4OA 5LXTA 1Y8ZA 2J8ZA 3F3KA 4ABTA 4J1TC 3OIDA 3FIUA 4H77A 2GM3A 4OXXA 4NENA 1SUSA 4M4SA 4D45A 3PFWO 4K40A 3U80A 5EIXA 3LTEA 2Y0DA 3EMDA 4ENSA 1N75A 4Q0MA 4ACBA 2MSCB 2ADFA 5K51A 6REQA 2OYRA 4X7RA 1KPHA 3VZRA 5IC4A 4DMCA 3IAXA 2ZDQA 4E5VA 3DMTC 3RYHA 4LXYA 2AR9A 2V3VA 1I4LD 1GNLA 4CR8A 1EFPA 3V1YA 4DYHA 1FDVA 3PC3A 3EAGA 4ZHQA 2GK6A 1Y4UA 4FOOA 3GAAA 3GYGA 4KFUA 4N5MA 4F6RA 4F6RB 1NXSA 2QR2A 4FHDA 1Y9DA 3IHLA 3FF1A 4WDQA 4R51A 2XODA 4LYDA 3CN7A 3LLVA 4E15A 4YRKA 3O4FA 4TROA 3LVBA 3SS7X 1E8DA 4A8TA 2CXSA 5BNWA 1DWPA 1HT3A 1O95C 4I7EA 4Z9AA 5H5JA 3RWMB 3JY6A 4CHGA 4AQ7A 3BT7A 4Q7QA 3M4YA 4YRIA 4HCJA 2PX3A 2YX1A 4JNCA 1RADA 2A8YA 3M0EA 4XJVA 2GM5A 1OHHA 2HY7A 3MINB 4JR1A 4B3IA 1KI1A 3LWBA 3OE7A 3BIFA 4ZT5A 4MRRA 1OLUA 2JASA 3AK4A 4E5DA 4CU2A 3FSGA 1R3UA 1JKJB 2PYDA 3FYTA 3QLVC 1V5GA 4G81A 4JGIA 3CUYA 1XEFA 3ZY5A 2R7NA 4KDFA 3SMVA 3M4ZA 2OCBA 1HQYE 1SB8A 2JZCA 3B12A 1JKIA 5EMNA 4E7PA 5CA0F 1IY2A 3QX8A 1E18A 1FTGA 1Y6ZA 1X7GA 4MQEB 5TQ0A 4G67A 3TMAA 1P74A 1T4CA 3NI2A 4TVOA 4E03A 4TT3A 3I1IA 4J16A 3T06B 4L3OA 1NNEA 1N78A 2ESRA 2CC2A 3HWRA 4QJ4A 3WJ1A 5KYNA 2ZI4A 2AEEA 1AK2A 1JR2A 1PK8A 4OFXA 1NI4B 1VBNA 3PQ3A 3SU8A 1GPBA 3UXEA 4CEHA 1QPBA 2JJQA 3U5ZB 2PLNA 4HYEA 1VKRA 1KJQA 3R3YA 2ZKIA 4QLOA 3HI6A 2ALJA 5TPZD 4FZ3A 1L4UA 3BH0A 3F6CA 1GA4A 4L16A 4BB0A 3QE4A 3NRCA 1CZOA 3IV6A 3MLBA 2B98A 4MJ3A 2QHXA 2XQJA 1QPGA 2NTVA 4ZT2A 5T8KA 3TGLA 4P83A 1YL6A 2DUMA 5CR9A 2XTAA 2FYTA 2YVQA 3PS9A 4BQFA 5CVJA 3F4KA 4EHDA 3UQZA 2PKQO 3ST7A 3TQRA 3UJ6A 4EG8A 3L6EA 2Q3LA 3ENVA 2O8EB 3GFPA 3KHKA 3V4RA 1IB0A 2BTEA 3IMFA 1JQAA 3DTNA 3IKMB 3L07A 3PQCA 4YP5A 2IHNA 1FSFA 1FNNA 3WO1A 5AXCA 3BE4A 3AHFA 4CQLA 2D13A 1H69A 3B20A 1X38A 3F9CA 4KGVA 3S4YA 3PUZA 2CXRA 1E66A 1AU9A 2WAAA 3UF0A 2OO7A 3KETA 1Y6QA 5KWSA 1XNHA 3MTQA 3LYLA 1K5GA 4FT2A 4PPYA 4RPLA 3GNSA 4XPIB 4ZWNA 3UMRA 4R31A 3WSVA 2Q27A 1TOAA 3KUDA 1YQTA 4HFRA 4DV7B 1O94A 3R6GA 4YRAA 3TSCA 1X7WA 5CIWA 3IURA 2YYZA 1Z7EA 3LQ2A 2AIRA 1X7YA 4XQ9A 1DE0A 2ZANA 3AG6A 3KOMA 5ALXA 2GCEA 1EQ2A 1U3VA 3WV5A 2QUHA 2ZJ1A 4J9UE 3QPUA 1RCFA 1XRQA 3BICA 3VU0A 4LFCB 4BO1A 5CTAA 5CB0A 2PANA 4ZARA 1VPVA 2YCLA 5CJ2A 5B1HA 4EA8A 2JBHA 2WD9A 4HVLA 4AY6A 4G4IA 2SNIE 4TMKA 5C1PA 1ZJYA 2QTCA 3BMQA 4URFA 1Q7CA 2H2FA 1NQOA 4II7A 1VOTA 2ASEA 3K9BA 4J7AA 4NU0A 4QELA 4TMFA 5AVUA 1WMSA 2ILTA 3IHKA 4NS1A 2IXEA 2VJMB 2C7PA 1U8FO 3KJIA 4U2FA 4E09A 1YL5A 4LNUA 1QH9A 3CBGA 4LMBA 1VCIA 3OIVA 4REQA 1AK1A 5EYPA 1JDPA 1KP3A 3BQMB 2IDZA 2YXDA 1J20A 2BBWA 2HFKA 3AHJA 4DDHA 3LQ4A 3EDCA 1LBEA 4HLUA 4Q21A 4XX1A 4X62B 3IQZA 3MJSA 2IYRA 4NJMA 4BB6A 4GMHA 5TVKA 5TPWB 4FYMA 4LXXA 3N8DA 4UEOA 5ALOA 2PV0A 4LGYA 3GUUA 3UANA 3FR8A 4BFTA 5A5GA 1YULA 2JIBA 3O6VA 5HIAA 3A05A 2PS3A 1PNVA 4MVYA 4TWRA 1AF7A 2BGKA 2D74A 2P9TA 4OK5A 3MUNA 4YAKA 2BYTA 1SH7A 3JZAA 2HFJA 3L79A 4LVNA 4ZAYA 3KR9A 4Q16A 5JS1A 2AEJA 2Q6LA 1U81A 4ZEMA 2OYSA 1PFYA 3AFGA 3GF4A 3L02A 3NBYC 3R0IA 1PQ4A 4XCXA 3KAKA 1FZTA 1CUXA 1LW7A 3MRTA 3OH8A 2XY4A 1GQ2A 2R8YA 1TYBE 1GZDA 3AR8A 3WAJA 3GPDG 2FDRA 4V03A 3QLUC 2Q1WA 1IY0A 1WB6A 3HYNA 4F6CA 4AYWA 4IKPA 5HDQA 2F8TA 4NAVA 2C59A 1XCOA 3PWKA 1RIIA 4W99A 4U4AA 1MB9A 3DDWA 2C8LA 1RPJA 2FB9A 3V46A 3EG9B 1UZAA 1JHQA 2BRUC 2VRCD 4FGUA 4YS6A 3VOSA 2XJ9A 4D0RA 5A62A 2NW6A 1ZK3A 2WYUA 4WK4B 3W5SA 3A06A 3BIWA 5ES4B 2XA2A 2B3TA 1JN0A 3U3OA 5B12A 4R4JA 3PG5A 3P2EA 5CAEB 4Z4HA 3MMPA 2MCFA 4CM3A 3HO1A 1YU9A 2NO5A 2QB5A 3W78A 4CMGA 1WCV1 3AU9A 1J2YA 3O2JA 4MPPA 3AG5A 4ASUA 2WU1A 1DC6A 2EFHB 3QKTA 4PR3A 1QHIA 4KTVE 3WG9A 4P2BA 2J3KA 1YNSA 3K8ZA 3MJVA 3JD2A 4B47A 3O2SB 1Z0ZA 3SY8A 3QHAA 4HQ0A 4INOA 1H2HA 1NY6A 3I6QA 5CLQA 5K0TA 2CK3D 5TDHA 3KD3A 3FYHA 4JEHA 3QELB 4RTPA 5E4JA 3MPUA 2Q50A 4ZKEA 3IDOA 1L5KA 4RY0A 3ZHTA 1ICEA 3HMQA 3OZTA 3Q9UA 4QUDA 2YWEA 4B80A 4GZLA 4GDFA 4RA6B 2OWDA 4PGGA 1ZNWA 3P45A 3WKCA 1JR3A 4WUVA 1KSJA 1Q1QA 4REQB 1W7AA 1TYCA 4LRSB 5KSYA 4NULA 1OLUB 4YIHA 1HNZB 1YRHA 1TVKA 2CUKA 2IX9A 1QB8A 2IY9A 4ZVOA 3RD5A 3FTCA 2GM9A 4MV8A 4QQ8A 4YRPA 1A8SA 3CEPB 3KHTA 4WERA 4L2IA 5ALKA 1FP4A 7REQA 1K27A 2AX4A 1N2CE 3HEBA 1SBHA 1OZAA 1UPTA 2OXCA 3C16C 3QPVA 4LRWA 4OJTA 5HS4A 5JJKA 3G89A 2MSKA 2RB4A 4R2MA 3MWEA 4U7FA 5AOBA 3UUGA 3WOHA 1KWGA 1JHZA 2F9FA 3N2ZB 1N6PA 5D6NA 3UWMA 1NBWB 4NCIA 4BMOB 1RJWA 3DFFA 3DDUA 2FLWA 1I6LA 5LR6A 4FHEA 4OP1A 1L7VC 1AZTA 2XGSA 4YQEA 2WU8A 3U13A 3U7QA 4CLDA 2AJDA 3NC0C 2ZE8A 5AICA 2CVHA 5KYKA 1G18A 4IJUA 3NH6A 2QTHA 3MUEA 3CVXA 3K6JA 3VH4A 3WBKA 5AH0A 1CFJA 2Y2VA 2PEYA 4N8DA 5JSYA 2X0DA 4BMDA 3MTEA 2RKOA 2RK6A 4RVSA 1JHYA 2C4VA 3AVQA 2WHYA 4BWFB 2IH4A 1MO3A 4DLNA 1YBHA 4L6AA 4QASA 3EEQA 3HLKA 1DMSA 2Q5CA 1LBSA 2C29D 2LTAA 3DP7A 3CUVA 3KBOA 4OYLA 4OBBA 3U4GA 3ZTTA 4D82A 4HLNA 3RYCB 2B82A 4H18A 4WXPA 4U6QA 4QEKA 3HP4A 4URHA 1CEYA 1TQ4A 4HN9A 2LD4A 3JASB 4KXYA 1R5BA 3QTBA 3LT2A 4N39A 4Q1BA 3P96A 2G6TA 4UCXA 2X86A 4DF3A 4ZZ2A 1BNCA 1NKTA 2D59A 5TARA 2OP1A 5U9CA 2X22A 1ZICA 5KTNA 3H1FA 4QDOA 1U65A 2YOFA 4TS9A 3WIOA 4H3SA 5IAOA 5KQRA 5GM2A 4YROA 1RABA 3FAZA 3K31A 3FWPA 1OBOA 3JQDA 1EM8A 1NSTA 3HVHA 1DLJA 4F3NA 1NU6A 2B7LA 3IOBA 1R2QA 4IDHA 3ZQUA 1YE8A 3CTMA 1JS1X 2DUJA 4RZIA 5AHOA 4DLWA 2ZIEA 3PTZA 4P0PB 4QPPA 1UKEA 4CKZA 1G2IA 1PFGA 3DBVO 3PWZA 4RHFA 4KRXA 2C5AA 3Q1LA 2N42A 2FHSA 1UKBA 4GGOA 2I1VB 2DWCA 1FQJA 3KXLA 4FYVA 4Q4CA 2ZM6B 3G02A 1JNYA 2F43A 3BMNA 3QI7A 4AZVA 3C2QA 4HFMA 2HBRA 3BMXA 4J0DA 3NGMA 1P2FA 4G24A 5IAKA 5LUAA 2AW3A 2CBXA 4GM1A 5CGQB 3FYUC 5CIYA 4XRGA 4LE1A 5F64A 5FUBA 4A0SA 1IBKB 1E2PA 4CL2A 1NHWA 3O9MA 3F8WA 4XWKA 3B1XA 5BR8B 2ODNA 4CTMA 3T0IA 1E3WB 1Z17A 1RYDA 1TF5A 4EHJA 3GLSA 5DXFA 1JZSA 1A96A 4AULA 2QDXA 4LV8B 1TGVA 2I6GA 3EMBA 3EBPA 3KZ1E 4EB6A 2ZJZA 1JJ7A 4IJMA 2A88A 2X5JO 4LOJA 1TEVA 3JQBA 1N1GA 1ZUD1 4UNNA 4X8MA 5K8UA 1J8FA 1OWLA 3DW3X 3KYIB 1PTKA 3MM4A 3Q87B 1DDGA 5AKJA 2JATA 2C9CA 4MR9A 1JHRA 4R1UA 3TNFA 1HFEL 5IG2A 1TJNA 1VMEA 2W70A 4TQUS 4A5OA 3R0ZA 1X8KA 1REQA 2PXAA 3Q4GA 4CLRA 4KPEC 1JRLA 2NZYA 2E5LB 2DSNA 4YV0A 1IBCA 2FOIA 4ZOBA 1HLPA 3B9PA 1V9CA 2R1VB 3C3MA 1QIJA 3GUVA 3RS7A 4S04A 1XL0A 1ZYUA 5K8TA 3TVYA 2YNMD 3AWIA 5LLSA 1RTTA 4L7QA 1XN4A 4ALKA 3KC2A 3ND5A 4DIEA 3ESBA 4OMFG 1AA6A 1VLMA 3VR1A 3QVJA 1W29A 3UK2A 3FXAA 2EDCA 3ND7A 4MV3A 1DINA 2FRDC 4I0WB 2E1PA 3L77A 3BA6A 1II9A 3BGWA 3NVAA 4EZEA 3WNCA 3BXPA 3EVDA 2Q3CA 5DT2A 3GLKA 4E5KA 2CLEB 3BMOB 3LYUA 4JBYA 4MPRA 4MDHA 1KVTA 4NBWA 3L0DA 1UBGA 4CIYA 2WFLB 1T1IA 4B17A 4OPMA 2C2HA 3G2LA 2EEPA 3S6JA 1WU8A 2FRXA 2CSUA 2YTZA 4JVOA 1VIYA 1D5CA 3P19A 3TQFA 4LYGA 4L08A 3S40A 4EPVA 3WNQA 2GRUA 1NIPA 5A5FA 1XKXA 3CLUC 2KM1A 3QXGA 5JCOC 1UMDA 2MR5A 4P22A 4UDXX 4NMWA 3VSCA 2OCDA 1GADO 3E9MA 2WD7A 4FFNA 4QPZA 1VJGA 2MYPA 2OXIA 3TK1A 4EFMA 3TRKA 4E08A 5C5CA 1ZKDA 3EGWA 2NO7A 4UFOA 2A4KA 2XUQA 4AWAA 3AR3A 3EVAA 1ZUNA 4QPJC 3UATA 5IN5A 3KU1A 2QYTA 3N1UA 4RFVA 1IOZA 4Y6LA 1KORA 3SSMA 4JVMA 3RC2A 3T8YA 5BURA 1RU3A 4L5JA 1RKXA 1YZUA 2G25A 3RK1A 1JMVA 2M98A 2RH8A 1K7CA 3N0XA 3PNKA 3TAUA 4CIWA 3Q8KA 2IT1A 1Y6GA 3HBMA 2GH1A 4F2GA 1LZKA 1RYFA 1Q3HA 1P44A 4A8JC 4XLTA 4TL8A 2C1EA 2B69A 1Q3TA 3TJRA 3UJ9A 3Q2KA 4HMQA 2HCJB 3DOEA 4BL5A 1APBA 2V0GA 3QE0A 1L5SA 1PQPA 1PS8A 3KXIA 3NTQA 3OY2A 2B7CA 2TMYA 1KARA 2OZVA 3BDVA 3QMVA 2FW9A 2XTZA 3OIFA 3PDIA 1MJHA 1NWCA 1DZ3A 5E1OA 3SFTA 1SCUB 1E9DA 4O33A 5ITZB 4EELA 1N9GB 1I6MA 4NDZA 3PX3A 3DVAB 5ELLA 1TCAA 2OFXA 4NBVA 5KINB 1QP7A 1U8ZA 4HDRB 2IEDA 2XIQA 1ULHA 3FFTA 2WJYA 1K1EA 1Z5GA 1W44A 2JCSA 4F8YA 1ZZGA 1OILA 3IB6A 1FPMA 3UKJA 2CLIB 1BGWA 3BQ9A 3FNEA 1RJ9B 1PQWA 2G8LA 1YMVA 4O25A 1E1NA 2GEKA 3R6LA 3CF6R 4GMXA 1KE2A 1I6WA 1T5SA 3T7DA 1BA2A 2IXFA 4XYEA 3LY7A 4CM9A 4MP8A 4UTOA 5F73A 3G0IA 1J5PA 3L1HA 1BOOA 2WJ4A 1AF4A 1F4VA 4FEAA 2L17A 5IK2D 1U28A 4D57A 1E32A 1L5GB 1E99A 3EOBI 2Z09A 1SELA 3NYIA 4UQOA 1S02A 1MT3A 3S2ZA 3LPAA 3B1YA 5KI6A 1GVNB 2I2WA 3JASA 3ZU3A 1AKYA 1VHQA 2P75A 2I4RA 4GE3A 3BWVA 2P0YA 2P2CA 2JIDA 2PQ2A 3NQ41 3LM8A 4YRQA 5HCUA 3EIFA 4ESHA 1M2VA 4FFDA 4KL8S 3S2GA 2H1IA 2XMDA 4LHXA 2YZ2A 5F9MA 3G82C 3TQTA 2OG2A 1GTG1 1AKVA 2C88A 5GJVC 3ZW8A 3WRXA 3AZPA 4RU1A 1V8DA 4MIEA 3TZCA 4ND8A 1OC4A 4ALNA 4UVGA 3FVTA 2BEWA 3KVVA 1XPJA 2V7QA 4JLVA 4JXJA 4U2EA 3I5XA 3KQNA 2PMEA 3UV3A 3WQQA 1JJBA 1PD1A 3DM9B 1LFAA 5J2TA 1QRUA 3HHPA 3K0AA 5A1TA 1Z36A 3DEIA 5JWHA 3KQQA 3W7BA 4AJ2A 1KR5A 4IR7A 3ETNA 4EJMA 4TWJA 2ORYA 1NC1A 2KHZA 3LKDA 4YTEA 4ZKDA 1YBFA 4GO1A 4PANA 4XOIA 4ADSG 3PK0A 3LCRA 2ZE5A 4UEKA 5JXHA 3D5QA 1JEAA 1W49A 3L9XA 3TAXA 2ZJBA 2IP1A 4TXHA 3LPDA 4Y2YA 3JS5A 5FHRA 4PXSA 3UC5A 4ASUD 4EY3A 1QMGA 3FFAA 3MLEA 1J22A 1HM5A 2GCOB 1C4KA 3NHUA 4YJDA 1IRXA 1U8CB 3DKRA 3WICA 4FONA 1KZ9A 2P9GA 5IEBA 3P9QA 5FTLA 5JCZA 3I9NA 3JYLA 3R09A 4M1EA 2K7FA 1FNSA 3EDQA 1T6XA 4HEQA 2D2XA 3TH5A 4V0RA 3VYWA 4DTCA 5E2IA 2FWPA 4MMXB 3RROA 2VRCA 2Z2JA 3NR2A 4QUEA 1PG0A 1JIQA 3Q3VA 4YCSA 5ALVA 3OZVA 1MAWA 3KIPA 1PI3A 4U3JA 4U9IS 4DUPA 1QLJA 4BFLA 3SOPA 4LGVA 5J63A 2GK3A 1Z82A 3EUFA 3LL7A 3LP5A 2WJ3A 2J45A 4ZMRA 4KV7A 3O21A 2ZWAA 2VJYA 2R8XA 4C07A 1JU3A 3CUUA 4IRXA 4TYYA 4Y2SA 4GW3A 2VHXA 1H9BA 4XR9A 3EGVA 2WG0A 3P4XA 3RRJA 2A1TS 4U0KA 2DBZA 1AHNA 1T0PA 3KEFA 4DNXA 4BVGA 4GPBA 1B43A 4YHHB 1F5NA 4M36A 3H5IA 4QE3A 4YP7A 3I1JA 5BQ5A 1TQ2A 4WESA 2BSQA 1PSDA 2PZEA 4MROA 5AKYA 2AEMA 3ZK7A 1ZPDA 4JENA 1YZHA 3ZU2A 1UFRA 1QYWA 1ISSA 4LJ4A 2Q2NA 3EAQA 1M74A 2I3BA 3DEHA 3NP9A 3AOGA 4PAOA 2H2GA 4EZIA 1NNLA 3IBFA 3H1BA 1WS6A 5BQPA 4CQJA 3R24A 1C4XA 3ITEA 2H92A 3C3CA 5BPFA 1OCEA 1SCQA 4D0SA 3B89A 3NZEA 3SNHA 3SN6A 3PPXA 1MJ5A 4PFQA 4QU8A 4JIMA 2N1MA 1SXGA 1L9XA 5C7IO 1MGOA 5J2UF 3PPWA 4R98A 4EVRA 4WZZA 2DLDA 3GO4A 4MKHA 4JYPA 5AM4A 5H3HA 2O8FB 1Y3IA 2PTGA 2UYYA 5I5EA 4U2CA 4JLWA 4H0NA 1GQOA 2ONZA 2ZSBA 3TFQA 3QF7A 3U1BA 1UMBA 1CYDA 1G8JA 2Q7DA 4YT2A 3V9PA 2YWXA 3LK6A 2C2YA 5DB4A 3RC7A 4F86A 1LVHA 4EJFA 1A9TA 3Q40A 4J0FA 4NLLA 4D1YA 4BGDA 1LZLA 1NVAA 3BUSA 3C3YA 1VPLA 4IEIA 5JZBA 2VHUA 4DUZB 3P9NA 1P31A 2OGWA 5HRCA 2ZAGA 3H11B 1IY8A 3KL4A 1VHTA 1AZWA 3CS3A 3TPCA 5LIRA 2XRZA 2J9FB 4UHJA 4MDEA 2D5CA 2EX4A 2VK1A 2Y77A 2GFQA 3FZEA 4HNSA 3W8DA 2ZJOA 2FKNA 3GUYA 1ISIA 1GAQA 2LRHA 4OI2A 1CIVA 3AHIA 3H9GA 5K4GA 1U0RA 2RH5A 1M6VA 4RK7A 1NC3A 2UYCA 2HM7A 2ZYTX 2YY5A 3DTTA 4F4JA 3C7TA 4DIKA 1I2DA 2AI3A 1WDLA 3K8QA 3AF6A 3A1NA 3QITA 2O8DA 2VN8A 1IJEA 1J6UA 4HB3A 4ROTA 1M9NA 2GD2A 4HL6A 4WA7A 3C6KA 4DCGA 1DLIA 5JRZA 1TVEA 3DR3A 3UTCA 4Q18A 5CRIA 1KAOA 3QEMB 4RPIA 2SICE 3M6XA 5KYUA 3W8EA 1J06A 1O94D 2NM0A 4BLUA 4MNTA 3HKEA 2V97A 1TA0A 3K2IA 4JVLA 4TKUB 3ZBPA 3DCJA 3GPIA 1PV1A 3R3ZA 4KXXA 3FLAA 5JEDA 2AFIE 2R1TB 3LIIA 4JFAA 3TLEA 1GTMA 1NBME 3KXDA 1KIFA 2FVYA 3AFMA 2LPMA 5EGSA 5F78A 1GLNA 4PN7A 3QKRA 2XCIA 4CFSA 3RC1A 5ADHA 1EWVA 1L4KA 3DCIA 2OZKA 3TE6A 3A3OA 2B9VA 1GITA 1US8B 4P81A 4PZPA 4JB0A 3KYDB 3PEUA 1T6YA 2GZMA 1C1DA 2ZDGA 4TT3D 1TYAE 5LBTA 3N6VA 3CEAA 3ESDA 2Z4TA 4YFVA 1H22A 2YFKA 3I6ZA 5FLEX 4WKCA 1RP1A 5CT4A 5AKHA 1EPUA 5PNTA 1KS2A 3RTCA 5J5VA 2WHQA 4LJ9A 1SZCA 4C3UA 4MQ5A 2G88A 2NO9A 1E62A 3NCTA 1HDRA 1GPJA 1QRAA 2GYVA 4N3GA 4X65B 1THTA 4BMPB 4EPWA 2E3JA 1TF2A 4XWWA 1L4LA 4G1CA 2ZUVA 2JHFA 421PA 3MRXA 2H4WA 1R9MA 2FP3A 4KO8A 4OGGA 3WIUA 1DIHA 5E1MA 4EECA 3E1KA 1SC6A 1ZIPA 4R2WA 2P5UA 1D6MA 2ORIA 3LAWA 4PSUA 5BVHA 1NBIA 3D3JA 5DO9A 4DLPA 2FX5A 4YXWD 4WXHA 3C4JA 2OA0A 1UFQA 4YCCA 4PLWA 2GAFA 4CFYA 2FCRA 3IAS6 4UULA 3ANXA 2C8VA 3QX3A 3PSAA 4Z0TA 2OQVA 4YUZA 4BQOA 3IIMA 3OX4A 4IG4A 5CITA 5EESA 3O73A 4ZCQA 1DJMA 3FZYA 4DMHA 1YTUA 4DLZA 2FP4B 5HUQA 4XVUA 1V37A 2O7SA 5AOCA 4Q6BA 3TOSA 5DOVA 4IY1A 5L3SA 2J9XB 2UVDA 3D8SA 2H06A 4EY4A 3FROA 4BXOA 4QDUA 4LY6A 1U3UA 2O4UX 3G6KA 4W5WA 1J0AA 4CKEB 1WEKA 5B58C 4COOA 1HT2E 2QU8A 2YIDA 3LYHA 4NG5A 1U4NA 4Z9YA 4YLYA 3T4PA 1TCUA 1LC0A 1SBNE 2OBMA 1FW8A 4N82A 2I9KA 1LK0A 1U80A 4DCTA 1RPZA 4MYDA 1JQKA 1DFGA 2VKTA 1FVOA 4YK7A 5E4TA 1OBCA 3QU4A 4R8VA 4JUBA 2HJSA 4AMUA 4MR7B 5KQGA 3THWB 2J9ZB 1ZM7A 2BHTA 4KVFA 4LBWA 2OCIA 4QBKA 4JBLA 1UJ4A 1X9GA 3C1UA 5C8ZA 4QBIA 1GG5A 4QOIA 1JA9A 1QCDA 2JIPA 1K6JA 2NO4A 1EQUA 7AT1A 5AXAA 2O5RA 5JAIA 5JUWA 1DCFA 1W25A 2XZDA 4TS1A 1ZN2A 4V0MA 4COKA 4Y9TA 1S01A 1DEOA 2WU0A 2X5XA 4L9SA 3NIGB 2YZKA 1E1MA 1L4BA 2KBFA 2ZI6A 2VTEA 3O0TA 3OPYB 5FJIA 3ROKA 5EJ4A 2HWWA 2Z56A 2YW9A 3B3FA 3L84A 3HYRA 5ESRA 4D7AA 3KJGA 1IN7A 1X92A 2A59A 1EWTA 5CCXA 4H7JA 4INZA 3SQXA 1N2OA 1DSSG 2DE0X 4R9VA 3L7DA 4H4CA 4IM7A 4DSOA 5HF5A 5JMPA 4GKJB 4KQ2A 1QIDA 3NBQA 3ZDYB 2IH5A 4JIGA 1QJCA 4XB1A 4M6WA 2NTEA 1L4YA 3MWKA 1O97D 3ZBQA 3ZUGA 4QEDA 5LN1A 2PUWA 4AL4A 4BP8A 1H4TA 3AEKB 3GLHB 1K8YB 2BR5A 5E95A 5C1DA 2ZSUA 1UOQA 3VZQA 3BWEA 4MUEA 4AXXA 1YUNA 2HREA 1SVUA 3RAJA 4D98A 4EYKA 3OE1A 2HTFA 4U6SA 1W0CA 3PDHA 2ZJ8A 1QZTA 4UU0A 1GPMA 2Q07A 2ERYA 2ES4A 1NFRA 2IU6A 2WKQA 3RG2A 1EUDB 1YZFA 1J56A 4HNAB 2OD9A 4NRDA 1JI0A 2XMRA 3I2GA 2D06A 2O8BB 3QVVA 4HWPA 4I66A 3TF5A 4ER3A 2P30A 3E6AA 3NTUA 3SMQA 4JL5A 7GPBA 2TYSB 3R7NA 4BZZA 4ZEVA 4BQNA 4CEIA 5E38A 3L4BA 3H4TA 2WVGA 1N3YA 1BVRA 1P2VA 3IAAA 2ZQYA 3KWMA 3RIMA 3VR4A 1B1AA 1E60A 3QG5A 3FDXA 3ZS9A 2X7XA 1BDHA 1SK9A 1KJJA 4R2XA 1EQAA 3EQZA 2AWNA 5DM0A 3SVZA 3ZNOA 4TSFD 3KOXA 4AIRA 3KQHA 2CF5A 4HH4A 2G04A 1FS6A 1KYTA 1M34E 1PRYA 4MUIA 3BULA 5GV8A 2IXBA 1M1NA 3WLNA 3VNVA 5H83A 1OZGA 2CNDA 3C3XA 1KDTA 3OA0A 3LUPA 2CDCA 4HH0A 4J1NA 5AFSA 3D0RA 1XZLA 1U7DA 4FKZA 5C1OA 3HI4A 3VTFA 1Y82A 2D62A 1QQ6A 3CR3C 1XMSA 1YGPA 1EVQA 1W5FA 3R74A 3VO2A 2Z08A 4NY1A 4DMMA 3SZOA 2FZKA 4X45A 2VDVE 3HNOA 1D4ZA 2DTDA 4G07A 1OYWA 4G0PA 4OYYA 5CA1F 2FA9A 1JEQB 4ZVSA 1S2IA 4ZJYA 3PDCA 1E2NA 3FCSB 4PLZA 5FA6A 8GPBA 5CVDA 1R0LA 2CVZA 3RO7A 1L7NA 3IE0A 4F06A 2Y0EA 1N2CB 5THKA 4KFCA 5IT5A 5IHXA 2PLRA 4I50A 2GKSA 1MD9A 3OHSX 3Q6NA 4FGSA 4LRTB 3A9CA 1XYVA 2ZSAA 3F6YA 1E3JA 3DEJA 1CW2B 4B3JA 2XE7A 3AJ8A 3CXRA 2R60A 4N65A 3ZE6A 1LBIA 1Z9BA 2PMFA 1ULSA 1V7ZA 4L8WB 2O3QA 2IEGA 4GGPA 4QHSA 4XFDA 1EXVA 3TOXA 1RAFA 3C7AA 4ND3A 3MRVA 2Q6KA 5LLTA 1TVMA 3F7OA 3NLLA 1KP9A 3QXHA 3ZCQA 5KB3A 2QT9A 1MA3A 1T3ZA 1H4SA 2W7TA 4Q3OA 2NZUG 2ZUCA 3PD1A 4ENVA 1GKYA 4BJ6A 4W9MC 4JXXA 2QRKA 2ZYHA 4RZSA 4O4HB 1P2BA 4O4HA 2I6TA 3WLPA 2KPOA 1XPOA 1U8YA 4N01A 3RI3A 4WZBE 4ZOLF 5D2CA 1L5VA 1NVMB 3ZE7A 4F92B 5JH7F 2RGRA 1ZP6A 4BC1A 2EIHA 4AZ0B 2QQ0A 3NUZA 4AX8A 2AZ4A 1T43A 4F45A 4MVCA 3NBZC 5AJHA 3DPIA 3ZDRA 1U3FA 2Y71A 2CXQA 4F3KA 3USZA 3QU5A 3QOYA 3IMEA 3BIJA 5AP9A 3BGSA 5F7ZA 2H00A 4TV8A 5KTOA 4FEGA 4HPJB 2P62A 1TC2A 2E18A 4IQFA 4TTIA 2EKLA 1VXOA 2FETA 2R8OA 3C41J 1TGYA 1W0KA 2XB4A 4MRNA 3FHCB 4ARUA 4ZGGA 2O19A 1Z4OA 1V2GA 1VCOA 2O2JA 1C2YA 1EINA 4PLVA 5E9AA 1KOLA 4NMHA 2HYDA 2WSSA 3NOQA 3QHQA 2QVBA 3IQEA 4EUNA 1JALA 3DF9A 1J9EA 2R9VA 2NO1A 5JLAA 1YOVA 4QYTA 1E1QA 2J3LA 1N6RA 4IDNA 3NC4A 4DG9A 3WLIA 4K6CA 1JGTA 5FNVB 4UASA 3RYHB 5KTRA 3L8MA 1SQGA 2C4TA 3MHPA 3UENA 1XJ0A 4CM7A 1AJEA 4Z9BA 5JZOA 3ROPA 3RM3A 2C9BA 2XEDA 2W48A 3H5TA 4WCVA 2QX7A 2IOYA 3FOZA 1LPMA 1J8DA 4OXIA 3LBYA 4I5IA 4K8RB 1K8RA 3NBMA 1F8FA 4AM8A 2K5UA 1UWKA 3GEPA 3PF8A 1WCIB 1PWZA 3WOVA 3A10A 2X1HA 3G2MA 1Q7TA 1TQ6A 1Z3CA 2EJUA 3KTOA 4JYZA 3WIEA 5KKAA 3VR6A 3FZQA 3K9WA 4WWHA 4NH0A 2QM0A 1DOAA 5AOAA 1YCHA 4DPKA 1V0JA 2QUZA 3HN2A 4DV5B 4AMZA 1C3JA 3VTKA 1CZKA 1JYFA 4Q3BA 3ZI0A 1TAQA 4LMPA 3FTDA 4FZ5A 4O2LA 3WS7A 1JG3A 3DAOA 4RE6A 1RRGA 4NYIQ 4DR1B 1P9OA 1PT9A 2ICAA 3JPYA 3OCCA 4LWPA 4EGQA 8ABPA 1AQNA 1QFMA 6YASA 2EVWX 2ZK7A 2IEAA 5BT9A 4WLEA 1XF1A 3ABIA 4BZXA 2IW3A 3BMCA 5EAIA 3N8HA 1DIAA 4ZD6A 1N34B 2Q8NA 4WT7A 3KKZA 4Q9JA 4R71A 6ADHA 3AT1A 3MD9A 1GDDA 3OO0A 3HKCA 4R1QA 4ES6A 5ALRA 3IAHA 1YBAA 1L4FA 3W6ZA 5LOVB 4JD5A 3EHDA 3MWFA 4YLGA 4A2CA 4RUKA 5KOJB 1UPFA 1Z2PX 1H05A 4G4JA 1NUPA 1P73A 3BQNB 3TW6A 4BU0A 5DSTA 3FWYA 1JEDA 5K03A 3ZLJA 2F00A 3CX4A 3LPLA 4JLAA 4UHEA 5GM1A 1A9SA 2ZBRA 4E6EA 4UTPA 5BT8A 5KNBD 2F67A 1A9ZA 1A8HA 4Y9SA 2WD7B 1RZUA 4MVJF 1MNAA 4II3A 4QNNA 5F4BA 4ARSA 1CJMA 3HR8A 2GTHA 4RF5A 3EXAA 5FA8A 1FTSA 4CM5A 4WDRA 4RV9A 3MS4A 2WTXA 1RI5A 3QE2A 3CWZA 3ZNPA 5AM3A 4HUTA 2VJBA 2O2IA 3QV2A 4QNRA 1JKXA 4OLAA 1IWPB 1F14A 1KETA 2P9BA 2Y4OA 3WNZA 2PX5A 4BQIA 3LA8A 1X19A 3D4OA 1KI3A 4ZI5A 3L7IA 3I62A 5A0FA 3EVTA 3MMSA 3O1HB 4PZZA 2Z9BA 3SYNA 3THXB 3HU2A 2NYRA 4N0QA 4J3NA 2IHBA 3B1ZA 3I2KA 4NPCA 5EHQA 3HB9A 3RRMA 4EI7A 5GVSA 3E3LA 2I87A 5J4KA 1X39A 5EP2A 5KTKA 4DMKA 1R8JA 3QH4A 3JAKB 4JWKA 2CVQA 5BPHA 2CNKA 5B3LA 2G3YA 3JX9A 2H4JA 1T8PA 1PWHA 1UXGA 2NPFA 2QWXA 3NAMA 5LCXA 4D3FA 4B33A 4LDZA 3PA8A 3ROZA 4B3GA 3MPOA 5DNEA 4HDNB 4RK6A 1YQQA 3CLTC 3L7YA 3I5YA 2P4UA 2OFWA 3ELUA 5LB2A 1A9XA 2VDPB 2PMBA 2VHZA 3QUTA 4UBJA 5KTMA 4EENA 5F2OA 2AA3A 4DLKA 1QP0A 4OO3A 3G2PA 4FE7A 3WKAA 1A5BB 2R0QC 4FE4A 1A5AB 4FCCA 4BNKA 3R9IA 1L5MA 3H6HA 4IQ8A 1BDIA 2Q5JA 4AYTA 5L3SB 1A9YA 4PC3A 2V9ZA 1G4HA 3VXKA 2PZMA 3LHFA 4D4HA 3W5CA 4ED9A 1COWA 2EC5A 2FXVA 2Z6VA 3GV0A 4EG6A 4DM3A 3VPSA 4QXPA 3R7BA 4BDTA 3T95A 3WDKA 2D00A 1N5KA 1ML3A 3QVLA 3BE5A 1K4MA 1I4EB 1VG9B 2JH8A 1UBNA 2ZP1A 3QNUA 4DMGA 1M5UA 2R4QA 3CF4G 2B34A 2I4LA 3PB3A 3Q2IA 3RSGA 4U2DA 5JCXA 3K9GA 1JEOA 1QOZA 3CRNA 4I6EA 3I09A 5E1DA 2VHVA 2GNPA 3ORFA 4CEJB 4DR6B 1E0SA 1LTKA 1V11B 3S2UA 1YC2A 2HUPA 2EZUA 2ZRKA 4PHGA 1U9JA 2ANBA 1GGEA 2AOWA 2LR0A 3WQHA 1H23A 2QD3A 1YC5A 1ZLXA 4LISA 2R6GA 4NYJQ 3KV3O 1I1QB 2KWIA 3TJMA 2OHXA 3L41A 5J47A 3B6MA 1S89A 1T9CA 3DL0A 4TYPA 2R47A 5IXJA 4L4XA 2F64A 1CUIA 3RV3A 4GPD1 5DBEX 1BN6A 5LC1A 1I5EA 3FVWA 5BSRA 2DFLA 2XDYA 1TYDE 4NK5A 4Y9UA 4F7WA 1M1YE 1FLVA 3BHJA 3ZIUA 1YOVB 5IUKC 1UM9B 1VL6A 2B1RA 4GI1A 4LJAA 1Z33A 4Q3NA 4YASA 1X1TA 4LHYA 3IP8A 2GCGA 4MCJA 1WXXA 3CXUA 3DAPA 2I3AA 1MB3A 3VO1A 4MV5A 3KKOA 4RE5A 4EARA 3DDNA 1U9ZA 2BM1A 4AYXA 5I7AA 3RGWS 2RC6A 3QU7A 5FWAA 3UAXA 1Z22A 5LZ4A 4IUDS 1YZKA 4BO6A 2DQYA 3K9NA 1AK9A 2NVOA 2FHPA 2XUHA 1W5SA 5C32A 1AB6A 4QBHA 3T9FA 4UW9A 1YUMA 4JC4A 4IJWA 5BORA 4TV9A 2RGCA 2G9UA 3ITDA 4F12A 4EKGA 3FCEA 4IO1A 1YVEI 5JMWA 2FW6A 5K8JB 4P36A 2YMQA 1Q74A 2PLFA 2PMWB 3P0IA 2C4KA 2X4LA 2D1TA 5EKSA 1EXMA 1WRBA 1OLXB 1G291 4DJFC 4YONB 4Z5XA 1N7HA 1BCRB 4ND6A 2C3YA 3T38A 3OD1A 1EG2A 5EY5B 3MOSA 3PFHA 1MABB 1LS1A 4V24A 4R5MA 4YRFA 1KQGA 3L6CA 2D2FA 3F2VA 3T4UA 3T5PA 2OP0A 4R1TA 2IYVA 3CG0A 3U7QB 2GSDA 3HXMA 4WOBA 4JP1A 2ZUTA 3STHA 2FW8A 3W2GA 2ZRHA 2ERXA 3HSSA 3QLVA 4RJIA 1VL1A 5C4MA 3NRBA 5SZIA 3ZU5A 4KXMA 1UDXA 5I7SA 3H3XA 3K70B 3OTHA 3MWEB 4C0AC 2ZT8A 3HB7A 2IYSA 4UBLA 3CLRD 2L19A 3NT5A 1C9YA 3OFND 5G41A 4CT4B 1GRCA 3FMFA 5FR2A 3LC0A 4JK3A 2IZ7A 3BMCB 4BBJA 3VSAA 4OU5A 5AKLA 5F1PA 1QVZA 4K9DA 1FBNA 1H2FA 2P9YA 4OHPA 4F11A 3AM1A 1P9LA 3E48A 3NNDA 3K6RA 4AO7A 4ZK2A 1N2BA 2QX4A 1T1JA 3O9VA 4GL4A 4E5UA 1PGOA 4Z6KA 3TGPA 5KYUB 1JA1A 1N2CA 5CXQA 3RVSA 1Z4MA 4EABA 1SA0A 2UUOA 1P45A 4J6EA 3WKEA 3JSAA 4HZUA 4QPCA 1U0HC 2UKDA 4LDPA 1U0BB 2Q3DA 2Q49A 10MHA 1E1RA 4PYKA 1CP3A 3TSZA 1K68A 1FZQA 1WMBA 3BCSA 4NCKA 4O5AA 5DP2A 4Q1DA 2O1EA 4XIIA 3VVBA 1UKVY 2TMGA 2ZRDA 5DIFA 2WT4A 2WVAA 1C0IA 1RM3A 4FMBB 4AMYA 1E0JA 3AESA 2ZDHA 1O5TA 3U1TA 3H1GA 4KWHA 1OIWA 3SHTA 1OAAA 3WIVA 2C9YA 3PGMA 3PNBA 4QKQA 4HBZA 4YJKA 3G5MA 3RAPR 4B6OA 3AGQA 1FDOA 2BFDB 1IZYA 5E8RA 5FA5A 4Z3OA 2EBHX 5ILQA 2H1OA 3QW4B 3ZCTA 5D3QA 1QOPB 1DRWA 2BHLA 2QF7A 4WLNA 2O2HA 2Q3HA 5CXXA 1XMIA 2WJHA 4EP1A 4Q3EA 1YA8A 3WIDA 3G0DA 4B3SB 4NFSA 1ABFA