3GLUA

Crystal structure of human sirt3 with acecs2 peptide
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
274
structure length
274
Chain Sequence
GKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-dependent deacetylase sirtuin-3, mitochondrial
publication title Crystal Structures of Human SIRT3 Displaying Substrate-induced Conformational Changes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase regulator
total genus 84
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 3gluA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 3gluA01
4X3PA 2FRDC 3EYAA 4K9LA 1UPCA 2JI9A 2Q29A 3RIGA 3CLSD 4HDAA 1YHZA 4FZ3A 2JLCA 2H4JA 1YI1A 4GM4A 4JT9A 5K6TA 2NXWA 5MGNA 2PGOA 3GLRA 1PTJC 4RJJA 4MQ5A 2PGNA 4K9PA 4BN5A 4BVHA 2OORC 1T9DA 2H59A 4BN4A 3ZGOA 4JU9A 1S5PA 2UZ1B 4F56A 1EFPA 3K35A 3PKIA 1U2GC 2EZ4A 4K9NA 4I5IA 2NYRA 3CLUD 2OD2A 1HZZC 5EJ8A 3IAEA 2VJYA 4GG1A 5FYQA 4QELA 2H4HA 2A1UA 1E3TA 5FEMA 4UTRA 1PNOA 1OZHA 4L3OA 1OZFA 2EZUA 4BV3A 1SZCA 3PKJA 4KGDA 4IAOA 2FWNA 1OZGA 3U31A 4BUZA 4JD5A 3GLSA 4MPPA 2H2IA 1YHYA 3EA4A 2BRUC 4RJIA 5K6RA 4Q9DA 4KXQA 1XLTC 2UZ1A 1MCZA 1POXA 3PDHA 5EJMA 5EJ7A 5MF6A 2WVGA 4MPJA 1QPBA 4Y6OA 2AG0A 4JU8A 4BVFA 5BWNA 2DJIA 1PO7A 2FN3A 4ZP1A 1SZDA 4G1CA 1JSCA 4BVEA 4C78A 5EJ9A 4BVBA 1DJLA 2Q5LA 4IG9A 2HJHA 4ZZIA 1BFDA 2W93A 4UUAA 3FZNA 1M2GA 4UTNA 2PANA 2Q5QA 3HWX1 4TWIA 1YBHA 4J16C 4IF6A 4JUFA 4UU8A 4RMIA 1YC5A 1S7GA 4UTZA 4UUBA 4MPRA 4Y6QA 4HD8A 3RIYA 4GP9A 4RMGA 2Q5OA 2Q5JA 1V5EA 4X3OA 4F4UA 1PVDA 4RMJA 2H2DA 3CLTD 1O96B 3HWWA 3GLUA 1YI0A 1U2DC 3FSJX 4TWJA 1M2NA 4V1CI 5BWOA 2H4FA 4C7BA 1POWA 1U28C 4GM1A 3OE1A 1N0HA 2VK1A 5MFZA 2EZTA 5DGDA 2JI8A 1YC2A 2C31A 2X7JA 1D4OA 4FEGA 4COKA 4UTVA 3FLMA 4D5EA 3IAFA 4R8MA 1U31A 4O8ZA 1Z8NA 5DGTA 2JIBA 2H2HA 2FR8C 2IHUA 1PYDA 2H2GA 4L2IA 4K9OA 2A1TR 2B4YA 4QPZA 3JWPA 4Y6LA 3F6EX 4MZXA 5DEIA 1ICIA 4K9QA 3E9YA 1J8FA 2OD7A 1T9CA 4JUCA 1NM5C 1YNOA 1UPBA 1PI3A 2IHVA 3D7KA 3LQ1A 3EY9A 3JR3A 3D4BA 5EJ4A 4JSRA 1MA3A 4V1CA 3ZGVA 4GPEA 3ZG6A 5EJAA 3U3DA 2AG1A 3D81A 2EZ8A 2FSVC 2Q28A 4FEEA 5EJ5A 5IMSA 5BWLA 1M2JA 4JT8A 4D5GA 4JUAA 2JI7A 1T9BA 2VK8A 4BVGA 2JLAA 1OVMA 4K9KA 1PT9A 4JUDX 2WVAA 5K3SA 4J1TC 5D7NA 2OD9A 2VBIA 2IHTA 4UU7A 4RMHA 2QQGA 5EJ6A 1Q6ZA 2Q27A 4V1CB 2JI6A 1EFVA 2VBGA 2OO5C 1M2HA 4FVTA 4UTXA 2EZ9A 1UPAA 5MFPA 1Q17A 4JUBA 4K9MA 2QQFA 1Q14A 3F6BX 1YTLA 5K2OA 2VBFA 4RJKA 3GLTA 2H2FA 1Y9DA 1M2KA 1O97D 1T9AA 1V5FA 2V3WA 4BV2A 1PNQA 5AHKA 1V5GA 1ZPDA 4GM0A 4KPUA 3CF4G 2VK4A 2WVHA 1Q1AA 3CLRD 4QQ8A
chains in the Genus database with same CATH superfamily
5EIFA 5FLEX 1X0VA 4X84A 5CBPB 7GPBA 4YACA 3A9VA 1BC5A 1PGJA 1HDRA 1T8TA 4RKFA 5JNSA 1OI7A 2CW5A 5IFKA 3Q7QA 4O4JF 2V5AA 1J0XO 4R2HA 1D2HA 1CCWA 1UWKA 3B20A 1G7TA 5D86A 3WKEA 4EOGA 4DLPA 4HL6A 1PJBA 4Q21A 1FEZA 5AI9A 3ENNA 3LYHA 5JUWA 1D6SA 1M1YE 3I2YX 1AD2A 2TMYA 2VRCA 2C7GA 1QVAA 3ZTWA 1T2NA 1GHTA 4IHKA 3TB4A 4FFVA 3TN7A 4G0VA 4P7JA 1VC2A 1F38A 2EKZA 2VF7A 1M33A 3KSUA 4MA5A 2JFVA 2FHSA 3QUSA 2R6CA 1XMIA 1ZJJA 3F6RA 3MGGA 3HZRA 4IIGA 1Y1QA 3GXOA 3RBVA 1DEXA 1W2WB 3DVRX 3P97A 5JMTA 2YXPX 4XI9A 3STYA 4K9PA 2V98A 4PR0A 4LG1A 3AY0A 3FFAA 1Q2XA 2BFEA 3LMKA 4F85A 3K4HA 1KYWA 5CDFA 1H93A 1ZJWA 2FPIA 2QZZA 4XIJA 5I4IA 1ACMA 5JD5A 3DS8A 1K08A 4X24A 3RTAA 4CT0A 1MPXA 1ZQ1A 4ZCRA 5JJ5A 2AJCA 4M1TA 4Z54A 3ZDFA 3CEJA 4LISA 3G5MA 3PCRB 4L3VA 5IABA 4G24A 1JR6A 2ZI7A 1VHTA 1RC8A 3ZW8A 4RFSA 5MN6A 2HFKA 4BEWA 2CZQA 2JFWA 2B83A 1CUEA 4JLAA 3TXXA 3PC7A 1NQVA 1PSWA 3KUCA 1JQKA 1WMDA 4Q0MA 4HEHA 2VAXA 4RHUA 4WGGA 4X6YA 5CLFA 5LXTA 4LSMA 5BPFA 1BA2A 4D02A 1U7XA 2REXB 3IR7A 1SCQA 1SQ6A 2NO0A 1GTL1 2AFRA 2ZJ1A 3G2QA 4RA6A 4UDNA 5CYGA 1AY0A 5GZ1A 1D1PA 1X9IA 3AHCA 1FFGA 3JQBA 1I7LA 2H8KA 2VJPA 2HA7A 2N3ZA 2QRNA 3S4YA 1ZISA 1K0UA 5IUKC 3INYA 1HDIA 3AEQA 4OV6B 2FFBA 2ZB2A 3KKKA 5EGSA 5CFLA 3I8SA 2QTTA 1P73A 5FX2A 3EQ8A 5M5BA 2BFAA 5D51S 2CNWD 4C0QC 3FYDA 2HPVA 2FQQA 2R5WA 4JFRA 3EDMA 2BE7A 4N6OA 5DF1A 1D6JA 2CJWA 5JWHA 1JTFA 3BA1A 3WR5A 4YRAA 4PE5B 4QPJC 3EYWA 5EAIA 3AHIA 4OBWA 3P5BA 3ZDCA 1O9BA 1ZFNA 2ZUCA 4Q82A 4MHSA 3U1TA 2C77A 1MC4A 2JLQA 1GWNA 2ZWIA 1OZGA 3T1QA 4J9VA 3A0RB 4HWOA 1VJDA 3IFSA 1UINA 5ILQA 4G07A 3R9KA 4ETWA 2D62A 2ZVQX 3DL0A 1IB0A 4E5YA 1L7EA 1DAIA 2WVJA 2GBFA 2QSZA 5C4MA 1YAHA 3E70C 2W43A 2O0MA 3VO1A 4C3UA 5EZYF 3W34A 1Y37A 2GTHA 4GNRA 1I7QB 3KQSA 4B09A 3A6DA 1X3LA 3PENA 1A7JA 3HYSA 1K6XA 3NAQA 4ER3A 2FUKA 1P39A 1BCRA 1OV4A 4CVNA 1IHUA 1G8GA 2WWHA 3IQWA 2BUBA 3GX1A 2GILA 4HNSA 3LKBA 4MUHA 1WXIA 3T5CA 5KTKA 1IK6A 1WO8A 2Q3BA 1VYUA 1ZK3A 3W04A 5AO9A 3V1YA 4TPKA 4XM0A 3AF0A 1KP9A 3KWJA 4CM8B 4QULA 4FYMA 3UV3A 4AK9A 1ZXBA 3GQVA 4FT2A 2I71A 4OQNA 4R7TA 5CK4A 4F5ZA 3HB0A 4ZOLA 1GRCA 2IL1A 4IUYA 1EP3B 5BW5A 1IN1A 1YQDA 1U1CA 4ESEA 4XJSA 5ALRA 3L8YA 4JOQA 4OP2A 4FXOA 1ZQ9A 3MFQA 4O1HA 5TQVA 3VR3D 3O3OB 3CO0S 4O63O 4NAUA 3RIHA 3FGNA 2V4ZA 1VPEA 4AQYB 3U60B 2BRUA 3W6NA 4M1ZA 2V6IA 2KW5A 2QROA 1KDOA 3VPAA 2J9YB 5JW6A 1MTZA 3UAYA 5EZQA 2K7FA 5A6SA 3ZZMA 4JOSA 4F9EA 1P9NA 1XMXA 4EMSA 3AKZA 3W9SA 2GETA 5KSPA 3KFVA 4MVJI 3I39X 4J4BA 3AU9A 2WWYA 3VRHA 1I7SB 1UOOA 3MMSA 5B58C 5DXAA 1U99A 2R7KA 4MAMA 1UKZA 2PZMA 1NNEA 3Q9UA 3P9CA 1ZA2A 3WAJA 1KE2A 1UAAA 3Q1KA 1U3VA 2ZYVX 2P30A 2QMZA 1NBOA 4BS9A 1SBNE 2N1MA 1PNVA 2OGSA 2PBZA 5LBTA 1EEXB 3CEHA 4C4PA 2WT4A 4U02A 1NRWA 3RVMA 1KI7A 1LDBA 1RAHA 1KJ9A 2GZ1A 1H1TA 4N0QA 3ZK8A 3BWBA 3TRHA 4V2IA 1AS2A 1R9MA 1ZH6A 1QRSA 1P2DA 1QWSA 3SU8A 1OLUA 1VSUA 1XEWX 1ZSNA 4TTTS 3IAAA 4ROTA 1O2DA 5EQJB 3TNFA 3LUHA 5FULA 5A5EA 1QJCA 2O7VA 3IT3A 5IKXA 3CH7A 5ISMA 3F6SA 4FI3C 2ODBA 3L7LA 3SFZA 3TZKA 1U0SY 1LNSA 3WHIA 4HVAA 3GEBA 4A4DA 3GUHA 5THKA 2Z2ZA 3OZIA 1IOVA 2FB9A 3GH1A 3A10A 3AFNA 3I1IA 3LLVA 1V8BA 2WAAA 1UEIA 3TM4A 5JRJA 3IO3A 4L5YA 3ITDA 2RBKA 2PM8A 2Z9BA 2I66A 3LPAA 4RVGA 4ZHSA 1I2MA 1Y3AA 1A9XA 4KITB 5EWLA 1JYFA 1C0IA 4YLEA 1PSDA 5DHSA 2H18A 5IBCA 1X80A 2I6QA 4P5EA 4OOEA 3KKNA 5NLLA 3U7FB 4P80A 3SEQA 3DKVA 1JF8A 4E5PA 1P1FA 3BDVA 3ASVA 1FBNA 1QQBA 1PEDA 4RTLA 1N77A 4LYHA 5LP6C 3RT1A 2AGVA 1LTKA 1QG6A 3UUGA 2ZANA 4LOHA 3C15C 2YXDA 3GGGA 3NM6B 5CNJA 1L4UA 2E18A 3BTSA 1F20A 2QM0A 3WZLA 4M60A 1E0AA 1R9JA 4QSHA 1ZNYA 3KXKA 4LY0A 4F21A 4IDPA 3VH2A 4H6WA 2A9QA 3T3MB 5J5CA 3CINA 4KNVA 3GEGA 5DSZA 5BW6B 1JW9B 4JH0A 2NZWA 2JI8A 3MCVA 2B8NA 2P6PA 4J4TA 2RDMA 1J1UA 2F1OA 1CKEA 4P3YA 3DFMA 2I6XA 3I34X 4RCVA 2PY6A 4XUDA 2VQ6A 1RYFA 1LFDB 3C6YA 4ZOCA 3AYZB 4A0QA 4U00A 4QUKA 1Z2PX 4RK5A 1VIDA 4MVJG 4PNEA 3ESAA 1THTA 5ES4B 2NUPA 1Q21A 4XQEA 4AN4A 4ZGWA 2PJRA 1WPXA 3T3OA 3INTA 3EQ9A 1PFYA 1BAPA 3CUTA 4IGIA 1FMCA 4IUDS 2ROQA 1MJGA 4OHPA 2WA2A 4HFJA 3ZY4A 3TMYA 4R8VA 3VR4A 1QIEA 2X42A 2R44A 5I7OA 3E61A 1J8QA 1BMFD 3N05A 3TNYA 2PGLA 3EPKA 1H2RS 3WI7A 3EG9A 2FCRA 2O20A 4PQEA 4IRMA 1B00A 2EOAA 1DQYA 4IV5A 4N0EA 4LNAA 2J07A 1L3IA 5SYNA 2JG3A 1LRLA 5JH7A 3AJDA 1LI7A 1RM5A 5FNVB 2AJ8A 2VDVE 3BGIA 1XAHA 2R7LA 4X7RA 5JVDB 4DVJA 2Q2WA 1YZYA 3P9YA 2CVQA 1R0SA 1Y4DE 2ATVA 2V4UA 1FA9A 3AIOA 3I6IA 5AK3A 5F21A 3RV4A 4DCMA 5BY2A 5EZ5A 1VBNA 1QF9A 3L4JA 1XIVA 4RM3A 4PW0A 2M1XA 3LPNA 3GLKA 4HQOA 1FTNA 2A1TR 2VP4A 4C6RA 2F9LA 2QF7A 3TRDA 4HDNB 2Q1WA 4EJFA 1U0EA 3G0DA 3IXMA 3F49S 1JNXX 1D2RA 1VMIA 2V7XA 3LI2A 2VDWB 4KSCA 1E5VA 3OJFA 4FR2A 3QEJA 4BBAA 4D3SA 1TZCA 4GVXA 1E1RD 3ZHUA 4QWMA 4MGKR 2BDEA 1PLLA 3LXRA 4HS4A 1Y48E 1GSAA 3BFXA 1HZJA 4MA4A 3AW8A 1LPBB 3K0AB 4CLOB 3A27A 3JQ9A 5EEHA 3G3EA 5B1YA 2GN9A 2BGNA 3B5IA 1IOLA 1E4VA 1E6UA 1GU7A 3FVVA 4ZOLF 4E4YA 4P1ZA 1O8BA 1Q44A 1FFWA 2I22A 4ND8A 4WCFB 2X1MA 1Q3HA 1WOMA 1HI9A 1A04A 4MGZR 3ZDBA 1XPUA 4RV9A 1T3HA 1NQ5A 1RYYA 3NG1A 4LHEA 3VSEA 3A4YA 3CNNA 1XTSA 4LQCA 1N0WA 2A78A 5FPTA 2VJBA 3A1SA 1R64A 3KAKA 3VR5A 4D74A 1A96A 2BZSA 3SR0A 4LF6B 3PFCA 1GNRA 4JMPA 2CXSA 3T7JA 3X44A 1MO2A 1WY5A 2XRFA 3ZE7A 4CM5A 1CQJA 3FGPA 3QM1A 4XEUA 5G4KB 4C4ZA 1KEZA 5FF9A 4B7UA 3VFDA 1L5HA 3CUUA 3BIOA 5I5GA 4A23A 2FW7A 4G0MA 3SKXA 3PJEA 1RRFA 4JODA 3OLVA 4DWWA 3EXG1 4BX3A 2D6FA 1KH3A 3JARA 3U4QA 3ZCSA 3ETGA 4RSRA 5AYVA 3K6KA 3PC8A 1C8BA 1MJGM 2ERCA 2G6BA 2XI4A 1F60A 3CWQA 3MLAA 1NR7A 2ZB4A 3GL9A 3OEYA 1MC8A 4FCCA 4TKVB 3FNEA 3TIXB 1JH9A 2M6RA 3CZAA 2NX2A 3LYUA 5LA6F 4OLHA 4MI9A 3TRFA 4YXWA 3CG0A 4EGSA 5IVHA 4PIVA 4DVGA 1IHYA 2K4MA 2O0KA 3GWGA 1X86B 2HREA 3K2QA 1LXCA 3TPZA 2NO7A 4E0BA 4R8LA 2XUQA 3OHMA 1B43A 2HF8A 1KU0A 1FP4A 4FMDB 4NK5A 1AB6A 5ARDA 1CNFA 5JYEA 1Q19A 3QLJA 1QAMA 4A82A 5FPHA 3PGVA 4B35A 2ZRLA 1MAVA 4QPNA 2SHKA 1DS6A 1SBIA 4GPTA 3TSOA 3USZA 3GV0A 1J70A 2CXXA 5AVUA 2PX3A 1YOVA 5BR1A 4DV6B 5G0SA 1LDNA 4BQSA 2KM1A 3IUNA 5JD4A 3R9IA 5KQSA 2GN1A 4WJLA 4TT8A 5IAGA 3E0XA 4G1FA 1SVNA 2JI7A 1BVHA 4WUVA 3KZXA 3NIWA 1ZBQA 3JAMA 4FWIB 3UTCA 3FUWA 1OA0A 4B7XA 3A6PC 4ADSG 1WB9A 3QZUA 5TMDA 2QR3A 3CIFA 3ADOA 3S5UA 4K9KA 3WK4A 5JSZA 1BXRB 2AUTA 3BGVA 3M6AA 4WKNA 2LIVA 3L4KA 5DX1A 4B40A 1Z4LA 3RUHA 4EY6A 2PZFA 3STWA 1L7PA 5BSRA 1TK2A 2ORWA 4BO1A 1IOZA 3DOIA 2UZ3A 3MIIA 4IHJA 4LQ4A 1H4TA 3BC1A 4ZCIA 5EERA 2HV8A 3F46A 2PUAA 2QTHA 5E9WA 5I7HA 1YVRA 3ZXSA 3O8OA 3RLIA 1NONA 3IURA 4TKUB 1P2FA 1GP2A 1J2RA 2CVPA 2ZBDA 3AV0B 4J0HA 1DOAA 2EERA 4EP1A 3LRXA 1DAEA 2NXCA 1QO0A 5ICSA 1A97A 3I12A 4KI0A 3FB4A 2HTEA 3NBXX 3WGNA 3OWOA 3VYUB 4IFTA 4CQJA 1Q6ZA 1XE3A 3VUEA 3X2SA 2VHJA 4NVRA 2JS7A 3IC5A 4LE1A 2BKLA 3DL7A 3QE0A 4QAJA 3TJRA 3QX9A 4B6OA 1SVSA 4G65A 4L15A 1ZCFA 2AW5A 2WMNB 4MWSA 3JVDA 2J5XA 2XF8A 4GX5A 3BL6A 5COQA 4CQNA 4HGNA 1YA6A 4TUYB 2RIRA 1YS9A 3MCZA 1UKAA 2I99A 5MFPA 4F92B 1T1EA 1U8FO 3EF0A 4LJ6A 3KTAB 4JUBA 4K9MA 3PXXA 2QQFA 4IV0A 3GN1A 1KNQA 3E7FA 4UEKA 2RHRA 5JALA 2IDJA 4KMMA 1Q57A 3LE8A 2VZ0A 3ZE8A 2GD2A 2NZ8A 1QRUA 4XYEA 2WTMA 2PSSA 3N0VA 1ZUNB 4MRAA 4G97A 1FYFA 1W75A 2AFIE 2Q1UA 3GEDA 4IH4A 5D3QA 3TUZC 1LJ8A 1FSPA 5IVPA 3H0EA 3SS9X 1T5HX 1H6AA 1U3FA 1NLZA 1FX0A 1RWWA 5F98A 3A1VA 4U63A 1E1MA 2J67A 4N8SA 4G9EA 2FQ1A 3NBMA 4MR7B 5JH7F 1RRKA 4KZKA 4TLLB 1SIBE 4U9HS 3WAKA 3ZHXA 1EKXA 2CVZA 3QBDA 5FNZA 1HLGA 1L4HA 1NIPA 2X86A 4KTTE 4FCTA 5KKCA 4J2HA 1GG5A 2J08A 4PZLA 4C30A 4E4RA 3WMWA 3SE0A 4WZBA 1WHSB 2HK6A 2WD8A 3P2EA 3K32A 3YASA 2YVLA 1E9RA 2W2OA 3DXZA 3I4CA 4Y6PA 4QHYA 5K05A 5FUVA 1CR1A 1KORA 3MILA 4YQEA 2PFSA 3AV3A 3AOEA 3OF3A 4MW5A 5ITZB 5HQTA 4IX1A 2FRDC 1F2TB 1UBMS 3LYLA 5L3RA 2FW9A 2HA4A 3ME5A 3FWKA 4CNQA 2JI9A 1GPMA 3V4SA 6GPBA 4MWTA 2P7IA 4MV7A 4PICA 3HEMA 3S81A 1E5XA 1P3JA 3KJXA 5IX8A 3UJ6A 3KOOA 3QPVA 1ZHFA 1H85A 1OGJA 5IW8A 1Z5GA 1Z6AA 2DQZA 3ZU4A 2CF6A 3Q8XB 2IX3A 5AVYA 1Z2OX 4JYAB 4RNDB 2YWFA 1R8QA 4C3OB 3LQ4A 4KB5A 5KHOC 5K6TA 2OV2A 1K8ZB 4EVSA 3MJVA 1JJIA 1EJ6A 3OPQA 2C9OA 2H0RA 1OIXA 4JR2A 4KREA 4RULA 1AGYA 3ZEAA 4UKDA 4Y9SA 4PYRA 4Z7JA 2WWWA 4FFDA 3PEWA 1ONSA 2OKGA 2PGOA 3TOCA 2B34A 2QM7A 5JD3A 3SMQA 2WHPA 3ER8A 4WN9A 3VKWA 1YZGA 3HB7A 3KKEA 2VHZA 4UOQA 1RQNA 3U9TA 3S68A 2UUAB 2CYAA 1HBJA 2ODNA 5DIFA 3UFBA 5HKBA 2R8BA 1ODJA 1CK4A 2VHXA 4YJGB 3OI7A 3QELB 4F56A 2GD0A 3MJHA 3QQPA 1U1EA 2IZ1A 3MRTA 4GKBA 3JXEA 3MJDA 2X0IA 4PQGA 2G6TA 3SJAA 4JQCA 4PLFA 4ZMBA 4GOMD 3ZWMA 3L7AA 4AIRA 2AN5A 1YRHA 2ERXA 2HC9A 3FA2A 3HB9A 4X1YB 2BEVA 1MHPA 5FBRB 3WRYC 4MQEB 5L7WA 2J33A 1XZ8A 5IJ9A 1E2MA 1NQUA 4K9NA 3OT1B 4QXOA 3P7MA 3QEMA 1CUWA 1Z47A 4I14A 1UDAA 2BT4A 3OIFA 1K7SN 4LEIA 4I8DA 4HS9A 1LNZA 1K8XB 3CR3C 5M3BA 3KFXA 5FH9A 5U9CA 1P9WA 4H4DA 4KG7A 1EZ4A 4MW6A 4Q1BA 3RWOA 5NULA 3ZV7A 1T1JA 1DELA 1ZZGA 3H84A 3O7WA 1FZTA 3KXIA 2QM8A 4CN9A 2GEUA 4NU6A 3ZV3A 1L7XA 4MUMA 1A9YA 4ALMA 3PFNA 2GEVA 3ROKA 2GCGA 3NM4A 3CX7A 3GAFA 1NXWA 4BO4A 3HK2A 2VF8A 3UOGA 4MQFA 2ZQ5A 3WNBA 5T41A 1P2UA 1ISPA 4LDAA 1E96A 2CXUA 5BSKA 4UFNA 3QX3A 3TSWA 3QP9A 2IEIA 1GPUA 2YZNA 3VC2A 2PT7A 4PG8A 2MSNA 3SXUB 2YRXA 5CLLA 1B3RA 1JRLA 1Y9EA 3LTNC 3ROFA 3CZ5A 7MHTA 1VDMA 1N5MA 4QVGA 1JBKA 1XO1A 4I46A 2YDXA 3WNZA 4D0NA 4DR1B 2PRIA 1U9CA 4K1LA 2BUAA 2YV4A 3X1YA 3VZCA 1DQRA 4PRZA 5IAAA 4RACA 4HZIA 2HQOA 3LCVB 1K5HA 1TNDA 9ABPA 1DDGA 1KP2A 2WQ7A 1A8HA 1GZ7A 1IY1A 4TYNA 4Q6BA 2WE8A 2OVFA 1PEAA 1TQHA 3NTOA 1XKQA 4Y1GA 3RD5A 4C1BA 1VJ1A 4L22A 4FR5A 4AZSA 4R81A 3IHKA 1N5RA 4DMKA 3UK6A 2Z8ZA 4REOA 3UNXA 1DXHA 1TPZA 5FAXA 5HKAA 3GLIE 3I2IA 3HYTA 3SSNA 4X44A 3V8MA 4BVFA 1Z15A 1XRSB 2HSJA 4QFDA 5B37A 3MN1A 2ZOSA 5GQSA 2ST1A 1NNI1 4WOCA 5A9RA 1A7AA 2YTZA 4CXMA 1EINA 3E8MA 3ECSA 1XXHB 1VL0A 4LGYA 4YAJA 4IVNA 3EGWA 3RODA 4XWAA 1EFUA 3OKAA 5HVNA 1BG6A 3EZXA 5KSOA 2A5LA 4HAOA 5JQGB 3R3UA 2VHTA 3DZDA 2C5LA 2IKSA 1DTWB 2B6NA 1VKOA 1EESA 2G09A 5KVAA 3LGXA 2IPNA 4MMZB 3ZJTA 2C9CA 3FJ1A 4TXLA 3UC5A 1GTJ1 3O4JA 4O4LB 1HKHA 4BXOB 2CCJA 3URKA 1D8AA 1LI4A 4ZKEA 3O84A 3IHLA 1RWOA 1H0RA 3CH4B 1WUIS 2PSJA 5AJWA 2QLTA 3QFCA 4NDAA 3ZH9B 2VQDA 3T1NA 4DLLA 4EWLA 1RXVA 3G8BA 1YJAA 4D81A 3G9ZA 4XAQA 4UUAA 3F4LA 2DFPA 1H2BA 1ZM4A 4HN9A 5YASA 1NL3A 1XVLA 4IMRA 5KNCD 1N4DA 1X7HA 4P4SA 4Y6SA 5FPKA 2YRFA 2AA3A 1EUZA 2YY7A 3Q10A 5K8JB 3REOA 1GZSA 1N6IA 2Q4TA 3HVRA 5KX5B 1ESMA 5C5DA 3GLHB 3PQCA 2J09A 1I4OA 1T8PA 3GJXC 3HEAA 5EJGA 4O0MA 3RFXA 3Q3HA 4WZAB 4E1VA 3IJPA 2G28A 3IMFA 4K1XA 1F9EA 2WC1A 5FRDA 1IY2A 2IF2A 3EIFA 3D31A 3ZWVA 2EIXA 4HO1X 1RKUA 1Y9JA 3MD9A 4Q3CA 2CV2A 1LLFA 1UXJA 4JJEA 4JYMA 3W05A 3RS3A 2F4NA 1ZEJA 1VPTA 1DC5A 2ZU6A 4U5QA 4KXMA 4JGIA 1DARA 2C8JA 2G0AA 3ELDA 2ZJ8A 3LY8A 4B0PA 1CRZA 1WAMA 4GVLA 2G9NA 5B1HA 3T7AA 1BIFA 1P1BA 1OT3A 1W0KA 2OC4A 1LU9A 1WKBA 3EUFA 2FZ5A 1DAKA 1U7HA 3QYPA 5CH8A 2ZP1A 3E3LA 4RMGA 1O87A 2RK4A 5HRAA 4IEIA 3WL6A 4RIEA 2Q5JA 1YQ9A 4FSHA 4C0LA 3UMCA 4E30A 3O3NB 1Z2DA 3ACDA 3DHWC 3IOCA 5FBKA 1ACLA 2JH9A 3GJTA 4PO1A 1Z0AA 1UDRA 4TMXA 3KV1A 1RZ3A 2WJ4A 1N2CA 4U6NA 4FX5A 1P1RA 3ANSA 5IZCC 2A5YB 2YIJA 5JFTA 1Z4KA 1RYNA 2IDMA 3DE5X 1BFUA 2P9CA 3GC6A 2ZRIA 5FO0A 3F8TA 2BFFA 3NWPA 1CEXA 4WCDA 1HLPA 1OKKD 3GFPA 4E5KA 5KDDA 5DGXA 3A6FA 4PONA 2XWJI 1MJ5A 4K03A 2OORA 2BY4A 3TLAA 1T4CA 1ST3A 4MRRA 4ERNA 4G36A 1EB8A 1TTPB 3CH6A 3VKHA 1VZ3A 4KW7A 3CT6A 1A76A 1G4HA 1DWQA 2CNLA 4XB1A 5TQ0B 4CRWB 3JAWB 4K3UA 4CETA 4JEMA 3UJCA 3MC1A 2HF2A 3E5RA 2F1JA 3OFKA 3W8RA 1PS0A 4DC0A 2WMOB 4JVNA 1Z6TA 3ZD9A 7AT1A 1NZFA 4EBBA 1QGAA 1T10A 4X90A 4GUDA 2QVZX 2F3SA 2ZYWX 4CKXA 2AHRA 1VIMA 4G5GA 1FYDA 1KMQA 1P5FA 1GIAA 1SN7A 1YDEA 3GFGA 4JEHA 3T9CA 4COKA 1Z39A 3MWEB 1PV2A 3NJ4A 3QOFA 4G37A 4DZRA 3IAFA 4HFRA 4BKRA 3ZU6A 4JLSA 5LN1A 1ZRHA 4CMAA 4FFWA 3SX4A 1V9CA 4WRRA 1Y89A 2F4VB 4DNFA 5KWEA 1IMJA 2Y9MB 3I3OA 4XYMA 4OH7A 3R7NA 2GB4A 2NN3C 3RC7A 1E3MA 4CFSA 4EG6A 3V5NA 2EL9A 2FEWB 4RHEA 1LKZA 4TN5A 3WHKA 1MOQA 2B4KA 3PGKA 4OBXA 4X7PA 2JGJA 3NO4A 7MDHA 4I66A 3TB6A 2R4UA 1SVOA 4KDRA 2J9FB 3VNQA 1Z6QA 3V4VB 4HAUA 1CR4A 4M8LA 4MWZA 4ZZ2A 3ZQ4A 3FOAA 1M34A 2EX1A 4ZANA 3WDKA 3U80A 1T5IA 4GEKA 4RLHA 4E5UA 5KTOA 2J31A 2XVAA 3RUFA 1P74A 4OFXA 5JEDA 4N3BA 3JWEA 2SKCA 2PEZA 3LCRA 1KZ7B 1YDHA 3PUJA 4FFNA 5IUNC 4BLOA 3KSZO 2B2XA 4BQFA 1ZVKA 2Q9AA 3OM9A 5F2EA 2BL4A 3GO4A 4B3XA 3TQHA 4K9OA 5AVXA 2HLDD 1GAJA 1LBSA 5EMMA 2B4YA 1U3WA 3FMPB 2I4OA 3T0IA 5TV2A 5K5EA 5EQDA 1T1IA 4IMJB 4PIPA 1SO8A 2HRRA 1C9KA 2RJOA 1Y1KE 1Y82A 1Z3IX 5AI6A 5L4LA 4OYLA 2JFHA 4ME6A 4WFQA 1E9BA 3ICPA 3KUXA 3LCUA 4ZT7A 4B73A 1T6YA 1ZH8A 4CHTA 4JP3A 1IJEA 1M72A 4TX1A 4Z4GA 3AVPA 1U8EA 2XMGA 3HUFA 3G17A 1VIYA 1GRVA 3HCPA 4BZZA 2D1RA 1PGQA 1LW6E 2DCUA 3RTDA 3HJTA 3OHPA 3FUTA 1E69A 2VR1A 3D5TA 2OCXA 4NMLA 4O4HA 1NE7A 2XNSA 3CS3A 2O5EA 4RA9A 4B3RB 5F73A 2OECA 4E2XA 1K5PA 2FPLA 4MW0A 4R1NA 1YNOA 2QY6A 2D2XA 2IHVA 3LWNA 3WZMA 1CRWG 1F0KA 3KXLA 3M5CA 2Q45A 2QVLA 8GPBA 4ZDJA 5DYYA 5JWRA 2JEYA 3CKYA 1UAYA 4JLVA 3JR3A 1C2TA 4B31A 1Y1LA 1R0YA 4KBGA 2UZ0A 3TD9A 2JGRA 4QDJA 2ZUTA 1XK6A 1QCCA 2EW8A 1FVOA 1WXEA 1SPXA 1Q0HA 1MABB 1NVVR 2C94A 3GRCA 3JYNA 4F97A 1F06A 4DL9A 1G0OA 1QC5A 2JHAA 4PINA 1MAWA 2GZHA 3R6LA 5EVCA 4WXMA 4EZBA 2C3YA 1O4VA 3QU4A 4Z8XA 1K92A 2QL6A 2CJYA 1NNSA 5A4JA 5ADUS 5BP7A 3KK0A 1G0NA 3LFTA 4ZO7A 1X7XB 2XGMA 3TOVA 3QE3A 3WL3A 4TMTA 4HNTA 2FAXA 5DM0A 1KC1A 5EJAA 3PFBA 4L16A 1RI5A 1W0JD 1ESNA 3HV0A 3ZGXA 1XZIA 3KT3A 1PLKA 3NAMA 1QMGA 5K0BA 5CT8A 5CTJA 3ZWWA 4BC1A 4MRMB 3FOEC 1NN5A 2AUMA 5ABPA 4L6CA 2X15A 3DDWA 5FPPA 1PP4A 3IULA 5KCZA 1GAXA 1JG7A 5ALTA 3COZA 4Q4HB 4EYGA 1DHRA 5FUBA 4PANA 3AL0C 2BFCA 4F8JA 1UBJS 3WLMA 1MQ8B 1D5CA 3Q9NA 2FZWA 1RPJA 2NPFA 2HDWA 2INGX 3KE9A 4MGEA 3RHTA 3SE7A 3V3KA 1UC8A 4RADA 3RVSA 1N2OA 1YS6A 2ZLBA 3DFFA 3JQGA 5CLQA 1YBFA 3LDGA 3QXCA 1VLMA 2GERA 4II2A 3EPLA 4DWJA 5KTTA 2N0SA 1WP9A 3RPEA 2O1SA 3H9JA 2D59A 4I5EA 4ASUA 4D8VA 1U9YA 4HEA1 4I9UA 5GIPE 4DV4B 1FF9A 1RPNA 2QTLA 3KXPA 3HKCA 5DX8A 2WMYA 1HNZB 2ZTSA 4KN9S 1Q83A 2PLFA 2QI9C 5P8WA 5IXSA 3LT0A 5LYJA 2C2WA 3NTUA 4HB3A 1YVPA 3CUSA 4IH9A 3UG7A 3QLUA 2AS0A 4AMGA 5AW7A 4YIHA 2YHUA 3VGPA 4EDFA 3MA0A 1O9HA 3D4IA 3MW8A 4X7MA 4JX8A 1E3JA 1RXEA 4CIYA 3OPYA 2REBA 1JYEA 1DIRA 3BTUA 4MV5A 2CCKA 4R1OA 4HGOA 4JQOA 2YXNA 4CF4A 4CMHA 3K0FA 2W4MA 4C0SA 5IBPA 1W36D 5I7FA 2BFMA 3EZNA 3FYUC 5FWAA 3PWTA 2BSAA 2XZPA 4IG4A 1JDZA 1U2DA 1NBWB 3AGPA 3SVTA 4G1EB 4A16A 1WDKA 2ODTX 4IZHA 3O31A 2YFKA 4C0HA 1I2DA 4AECA 1G1MA 2HUNA 4UPVA 5ITVA 1EZ1A 3OX1A 2VJQA 3I0NA 2GR9A 3FZYA 4J0IA 2OKCA 2WYHA 4GC5A 5CCEA 3NWOA 4QTUB 1DRVA 1ILWA 2CK3D 2ZTLA 2BGKA 3TJZA 4MP8A 2GM5A 4WZ6A 3G2NA 5F5XA 1C8KA 5TC4A 3PEUA 2G08A 1EWTA 2MHCA 2RGNA 2VDRB 1OF1A 3TK1A 4ZYYA 3KC2A 4LJKA 2BMFA 1F5SA 2ATEA 3K31A 3LG2A 5DWVA 3WGYA 3RSZA 4UD6A 5HJ7A 4MUKA 4OQEA 1HNNA 4O02B 4R5HA 1Y3HA 1PHPA 2EBWA 2M98A 4MQBA 4JI4B 2I7VA 2CDBA 3EVEA 3OJWA 4NZ9A 4TKZA 5FTLA 3W8NA 4XCQA 4TLMB 5KC8A 4M0CA 3DWIA 1PZFA 1NTOA 5AVKA 2JBAB 2DLDA 2VBFA 1UADA 3JVIA 5TMBA 4BEBA 1Y4AE 4WKCA 5K0ZA 5AESA 6AT1A 2ZXEA 1Z18A 1Z5UA 3QJ5A 4XOIA 3VU1A 1T9GS 4DLXA 1E4EB 2VDLB 3RSHA 4XA8A 5CG1A 1UBRS 3ON5A 3PXDA 4LRQA 1M1ZA 3QWAA 4CKBA 4EI9A 2ZWVA 3IA2A 1Q16A 2B98A 4EHJA 1JDBB 2QAIA 2WEKA 3F6PA 1V5GA 3QVLA 3HS3A 3C3WA 4FLFA 4J7XA 2H92A 4JY7A 4JYPA 1TAQA 1NSYA 2Q1XA 3QHPA 4ZI7F 3WV4A 4Q15A 1AQLA 1C3VA 1E8MA 3D5QA 4FKZA 3CM0A 5EXXA 3ZV6A 4EVRA 3RV3A 3FMGA 4D8YA 4F86A 2WU4A 1IN7A 4XIFA 4DKJA 3SF8B 3O8QA 2CL6X 3GK3A 3WMGA 5KQPA 1SU7A 4RORA 3FNBA 2CJXA 2OG1A 3WTCA 1FU4A 3RRBA 5FTJA 5IXYA 1U7ZA 2XCOA 3ZBUA 1JKXA 5BRAA 1F0PA 1JBQA 2RFLA 2V6FA 4MOWA 1RS0A 1WZNA 1E6MA 2DUWA 4H7PA 4KQJA 3OUTA 3ESCA 4OGWA 2HMYB 2BDTA 4DYVA 2E55A 4P5DA 1QIDA 2H5JA 2QZ9A 3V42A 3NGLA 3NEYA 3T3IA 4DRZA 2JLXA 4XD2A 3BHIA 2XSZA 2PMKA 4K6OA 1E7MA 4UAVA 5IVKA 3CEPB 4RKWA 3K9NA 1EE2A 1A9QA 5IANA 1YR7A 4QWWA 3FPHA 2AC2A 5JZBA 3SJCA 5B7GA 3IPAA 4QDKA 1S02A 3HRIA 3KJQA 3DUFB 4HX5A 5EJIA 1YIOA 3VPBA 4JJFA 3ZZ1A 1HMYA 3EXIB 2J6BA 3GEIA 3OZBA 2D1SA 2P69A 3W5JA 4DJ5X 1GILA 9MHTA 2ZUWA 2CMKA 4DSOA 1NVMB 3QKUA 3L01A 2C0QA 3JV7A 3OJOA 5LUBA 3VHXA 1QKKA 2ZJ6A 2YMLA 3MOSA 1X7DA 1XRRA 2IDKA 4XWGA 4F4DA 5JJIA 4WW0A 4CM7A 4KXXA 4YCCA 1FMFA 3V4PB 2CHGA 2Q3CA 1RBMA 1EFPA 2OESA 3FDIA 5C34B 3VAAA 5CG2A 1QCDA 3C24A 3FSGA 4HYTA 4CT4B 1E1CB 3O74A 4F0JA 4R6XA 5C7OO 4YMUA 3JZFA 3L84A 2LD4A 5LQCA 1H4QA 4P08A 4FEAA 2FV8A 2QD2A 3GCDA 4Q4DA 3ZDEA 4W1RA 1NP3A 1NVFA 4PQYA 5IT5A 1YJBA 2N42A 2IZOA 3RASA 3KT6A 1IHOA 5K8IA 3UHPA 4BE4A 2XB2A 3P2YA 2VP3A 3I1JA 2DUJA 1UOPA 3A2MA 3H3XA 3DOUA 5CNIA 2BHTA 1WDWB 1HTBA 4FILA 1GN8A 1J2YA 3VR2D 2YHSA 3N2GA 3T1TA 3GD5A 3DBLB 4OJYA 5HIJA 3WK9A 4EW6A 1CWUA 2Y1WA 5J1TB 4FBMA 4ZAXA 1RJDA 5D1NA 1P7ZA 3G1TA 2NV2B 3G2HA 5HM8A 2YWRA 5J2TF 1APBA 4WFIA 2OFFA 2J0UA 2VNKA 1HFJA 2VPZA 3GW8A 4HP8A 1YRYE 4NZMA 3OA0A 3PWKA 4BV3A 1LDYA 4V0ME 3NPAA 1ND6A 3GFQA 3B1FA 4CTMA 2WWIA 1DV2A 2FFQA 2OQRA 1IBCA 3LX4A 4CU2A 3LKVA 4HXEB 5LYJF 2C3PA 3VH1A 3IJRA 4Q34A 3OZSA 1G8KA 1TD9A 4HUTA 4QNNA 4DLRA 4JVOA 4MUFA 1MIOB 5IWAB 5BSUA 3CONA 2ZSHA 3L7CA 4G5RA 4X3CA 1NURA 3RTBA 4PSDA 5JHGB 2O19A 4IH1A 3EZFA 3LK6A 1KAGA 2NU8A 1Z5ZA 3KVVA 2QUAA 1YVUA 1JHOA 1RRVA 4R51A 3D2AA 2MYUA 2NVOA 3PDIB 1H2YA 1YHYA 4MHOA 5EWMA 4BRWA 1QCYA 1YJ5A 4LZZA 3P4XA 1TGVA 1YA4A 2O2CA 3KLNA 2OM2A 1IUKA 4M1EA 3WWYA 4U3JA 2PMWB 4US2R 1MU0A 1WV1A 4CV2A 1H2WA 3OLZA 4MDEA 4AUNA 3BRWD 5JSKA 4JI2B 4CF6A 4UU1A 2B1IA 3PV0A 3R3YA 5CDGA 5FI3A 2R00C 1W9MA 3N6VA 1NZDA 1OXUA 2IA5A 1IATA 2OOSA 2Z4SA 3MJRA 3JWGA 3DAGA 3W5HA 2JLYA 1EMDA 3JQ8A 1MX3A 1B93A 2OB2A 1A9SA 5E6UB 3D1JA 2Q4DA 1NX6A 3QXXA 4IJVA 1PUJA 3PKZA 4DCJA 1ZI9A 4UAUA 4V0OA 1ZMBA 2ZI3A 1JDTA 1FS6A 1V11A 3NEPX 1E3DA 1V8PA 4A8PA 4BLUA 4MW1A 3PEEA 1TTHA 2ZIVB 4FFBA 3WQBA 2BFNA 3S1LA 3ZU3A 1C50A 1TZKA 1YL5A 4QRHA 3OP1A 1E1KA 1QS0A 2WSLA 4W7HA 1KY3A 3FCAA 2Y0PA 4DQVA 3L0CA 5IAEA 4DWVA 1QH8A 4PHHA 3TDMA 2VQ3A 1Q0SA 4E7PA 4BVBA 1VLLA 5K3EA 1AH2A 3PNSA 1HT0A 4E09A 4DV1B 3DMTC 1LPPA 1RHMA 3AH8A 4ZK6A 1SXJC 4GQIA 1A8QA 1MAAA 3L4EA 3L1HA 1SXJD 5CX1B 1LRJA 5BOSB 1GG2A 1A82A 1TM1E 2PLAA 4UNPA 5CGQB 1QFSA 1VIAA 1G21E 3QY9A 2W93A 1XRLA 3SSAA 5BVGA 4HWPA 3LDFA 2XUFA 3FOWA 4XSVA 2YICA 2J5KA 3KE8A 2XE8A 1PR0A 2X0RA 2QD5A 3PLRA 2KE5A 2XQJA 1L8XA 4JLDA 4NECA 5DM2A 3WQQA 1L8AA 2H1SA 4F4JA 1I3CA 2GBLC 2FPXA 4P3KA 3E4DA 3GLFB 1H5NA 2A9VA 2ZSAA 3IDAA 1M1NB 3MQ4A 5AJZA 5EUCA 4AX4A 5JXIA 1NVAA 1MF7A 3ZI7A 2IH2A 3CW2A 3AERA 3OLWA 1P4AA 2CLKB 3GPIA 5C4GB 4BMNA 2HBQA 1HMPA 2J0VA 3BFPA 4WECA 1D1TA 1WB5A 2GHTA 2QQ5A 3BXXA 3ZIDA 1H2HA 4QZVA 1IBKB 2JGDB 3CW9A 4KKVA 3WQSB 2H9IA 2DXIA 2ZUUA 4BUCA 1GTVA 3KZOA 1KI2A 3UANA 2G17A 3GWZA 3BWMA 1IN6A 1K6MA 1LK7A 2JJ2A 4HAWA 5IM5A 1CFJA 3D4NA 4IRXA 4D3XA 3WNCA 2QRJA 1SUDA 3R3ZA 4O33A 5EFOA 4WACA 4DY6A 3KEMA 4EUFA 4OK3A 1W47A 5A0VA 2QE7D 4PAQA 1DKPA 3D8SA 1Z45A 1LLQA 4UQOA 3WKAA 4NC9A 4EEZA 3AZPA 1CR0A 3TF5A 1P61B 2W8BA 3OLYA 3KCNA 1TU3A 2EYUA 4GP6A 5L3ZA 3HUDA 5E7IA 5TPWB 2DHRA 1XEXA 1B74A 4I55B 5GADl 2YIVX 4MUXA 5KTPA 4BQIA 5ALZA 3GLUA 1W5TA 1JHZA 2QW0X 2BMWA 2FLKA 3C8DA 4AICA 4DZZA 5B1EA 5BV7A 3T7SA 2PJUA 1HT1E 5BWOA 1ZGBA 2OM6A 1BMDA 2BISA 1X14A 2PSHA 4PHCA 2A84A 3RK1A 2JRLA 2NTNA 4LZPA 4XLZA 4JLNA 1WULS 3DDZX 1CULC 4IQ4A 4D8UA 1IULA 1KPHA 1O3YA 4BNUA 2CFIA 1FSFA 5J1SB 4UCFA 4R01A 5KNDH 1N0HA 4TWBA 4P4UA 3BE4A 1OLXA 5C8YB 3OZEA 2WWVD 3WKBA 1PRYA 1NG1A 1TCBA 1OYYA 1UP7A 3JD2A 4LTMA 5COAA 3X1WA 4F8EA 5B7QA 1OB5A 4D56A 2JFQA 4U39A 4YRQA 1VE1A 1QTNA 5BQ5A 1X94A 3F9CA 3NORA 4HYYA 3O4GA 3RYHB 4MWOA 1G8SA 1QTRA 2IIPA 3QE4A 4UTVA 3LT4A 3PL1A 2P0AA 3ELWA 1M2OA 1N1GA 4BMCA 5B30A 2SBTA 4DBVO 4WVFA 1TMKA 4BUJA 1K97A 3DVAA 3EGXA 4ND5A 1DAGA 2YVUA 4HTFB 4OQPA 5HKOA 1U2ZA 2AZXA 4E88A 1H1LA 2VJKA 5IK2D 1D03A 1P4RA 3FPLA 2YOGA 3T5BA 1C1XA 5EE9A 3BD6A 3AZOA 2NXNA 3OTGA 2HMAA 1HDZA 2E4YA 2ODEA 3TW0A 1JMVA 1FLNA 1W4ZA 3CNOA 2WHRA 3ZBQA 4AZ0A 4IR7A 1DRKA 3GCGA 2IYPA 3GG2A 3PX7A 1RZVA 5F51A 3IPRA 5CW1A 5D5HA 2JLUA 3OOSA 1DOZA 2D1YA 2TYSB 4I7EA 1WKCA 1KGDA 4OYYA 5CYPA 3IKMB 2J3EA 1IN4A 4DQLA 5JATA 2A14A 1OXBB 1AO0A 3MGAA 4ROSA 2O06A 1IVNA 2XITA 2EKDA 2QA5A 1V7CA 4K05A 4O6VA 4XSHA 2O8EA 1DKOA 3GUCA 2QVGA 4EL0A 3DGFC 4EGJA 2GN6A 2Q0QA 1PUXA 3IAHA 4R1PA 4WNAA 2FE1A 3L0PA 1K7CA 3QX8A 1L3CA 3ZH2A 3F7MA 5CNMA 4EW2A 2LCQA 4Y2VA 4URVR 2Z6VA 2FSUA 4GD3Q 4GRDA 1N2JA 5HF5A 3TI7A 3RRNA 2JVIA 1MC5A 3P96A 1BE0A 1WCWA 2WICA 3D3EA 5J2UB 5GZ3A 1O97C 4MS3A 3KWFA 5FWDA 3CRRA 2WD7A 2WW8A 2BMEA 4MVCA 3RC8A 5E4JA 3LUPA 5LDGA 1NWHA 3O8DA 1N32B 3NDPA 2VXYA 1YMVA 2V5VA 1KJIA 1T25A 1GCUA 1OLSA 1V3UA 3JQAB 2ZJ0A 4N18A 4PRKA 4HUQB 1WNTA 3AF1A 1C4KA 3CZ4A 2Z98A 3N53A 4DXAA 4JQSA 2BGJA 3TQTA 1T43A 3G5TA 1C1YA 2VSOA 1UMDB 2W0MA 5TSDA 4YT8A 1GA1A 1RKBA 2NO6A 2BONA 3D7LA 3CFYA 4HSGA 3WK7A 1MH9A 4BJ3A 1T4MA 3CX3A 3LQ1A 1X42A 5JLJA 2QTVA 2C5SA 3DTVD 3TCXB 3K9WA 1KK1A 2HU2A 2EGHA 3UT0A 2QBYA 4ARBA 4ZHQB 5H83A 3LC2O 2AFIB 3LX5A 1P7VA 1E8NA 3R6TA 3A7EA 2VHWA 3UC9A 3BFJA 2CJPA 4D3ZA 1EFHA 2YWGA 3LF2A 2FVXA 4NNJA 1CS0B 2OBBA 1PR2A 2HWXA 4RTNA 1HPLA 1N8TA 3D0RA 1TKCA 4DTCA 4HAZA 4WESB 3OSUA 3ESXA 1KSFX 2H65A 1PFVA 1T3GA 3G9QA 4HWGA 1QRRA 4RH1A 4Q4CA 2VCHA 3TI9A 3IQHX 4B45A 2IWRA 4CM4A 1F6BA 3V1LA 4ZYWA 1S2GA 1A5AB 2AXEA 1TJ4A 2FA9A 4WBXC 4UNIA 3CU5A 2C4TA 3GLGA 3EEIA 1L4GA 4OQDA 4PLPA 1QK4A 1OYVA 3O9VA 3PRKE 4MKHA 3ZHQA 4CCYB 1OYOA 1KDYA 1IUNA 5HOEA 2EZ8A 1PX2A 2Y2UA 3IPYA 2VT6A 5K3DA 3KRTA 4CF3A 2ZTVA 1IL0A 1ETHA 2BM8A 2QN3A 3ID6C 4B7AA 4HCJA 2CLFB 3H86A 1A2OA 1WXWA 2EG9A 4AF6A 2IVFA 4KUEA 1EAMA 1KJQA 3MPOA 4J16A 1YMUA 5SV2A 3CX4A 5REQA 3UK2A 1PDVA 3FFWA 1ISIA 2DH6A 3CKMA 4YECA 4KIGA 5LBUA 1FNCA 3RG8A 5IDQA 4TUYF 4TRRA 1PJTA 1D0SA 2ZKIA 1XKLA 5JRZA 2VPXA 4PCLA 3G89A 1DADA 5A5FA 1SXHA 3KR1A 2II6A 5D85A 3L93A 3TLJA 5EUBA 1M2VA 3GIDA 3KSDO 4BP9A 3CTPA 3DCJA 1B15A 1E9CA 3MUEA 2VH1A 4GGPA 5EXTA 5CLHA 1I5OA 4HDRB 2HU7A 2QE6A 5LOVF 2BYTA 2DR2A 2B7LA 4L5BA 4UMVA 1SJ9A 2IUYA 3C4JA 3HNPA 2HPZA 3H9QA 1IHDA 1WOYA 1ZCJA 4UAGA 4K81B 4KZPA 3VJRA 1JAYA 3GMSA 3ZUGA 3VV2A 5A71A 1CV2A 4BO0A 1WF3A 4MA0A 1ADGA 3JASA 3LNCA 2HIGA 3ZS9A 5DN6D 1U4OA 5C80A 3BDIA 1JA0A 2WT8A 3ONEA 2AL7A 1YE3A 3G6KA 1DCFA 3LSYA 5HIAA 2GPBA 3SBEA 1XNRB 4RTRA 1IM5A 4BNJA 1QVVA 4FYWA 4BZPA 1QDUA 4C43A 3HBFA 4AAYA 4UBKA 5AJTA 2Q2QA 1QHHB 2KBFA 3FNHA 5ADWA 1FDOA 3S2ZA 4CIAA 5HS4A 1EFVA 2XUIA 1HYQA 5HQ3B 1TU0A 1WQ4A 1P3Y1 4BWYA 4CODB 5JY6A 4ERXA 4R68A 5HZGA 3SC6A 2OWDA 1T1GA 4FT4A 3C5EA 4LRUA 4N12A 3I9LA 4QRDA 4REQB 5LC1A 3V6MA 3WLNA 1NW6A 1P80A 1WX1A 1UPAA 4EJSB 4XQCA 4YJDA 3DQQA 3ISVA 2VUSA 3WB1A 4KQ2A 3V2IA 1FYEA 2VG8A 4P9NA 2WJPA 5FL3A 2ZAMA 3FLBA 4Y2UA 1FNBA 1ZVQA 3O2SB 4WE3A 2QV7A 4XCVA 4A7PA 2GSWA 4G84A 4H35A 2BCJQ 1IZ0A 4M99A 2D1TA 2PWPA 2O2HA 3Q7PA 4MP6A 3MELA 4Q3DA 3T94A 4H3HB 2ZJAA 5FLXA 3C8ZA 2TMDA 1A71A 1JR3E 3E3AA 4RJKA 1CQIB 2P1ZA 2UVPB 3CRZA 1Y9DA 3LVFO 3STHA 1OCEA 3PNYA 1X2BA 2O0LA 2IYFA 1P0IA 3DEYX 4L4SA 3DEZA 5DHRA 4DWOA 3D6MA 4BLSA 4BPRA 2XR1A 2H51A 1NKSA 2WUEA 1J20A 3SFVA 2JKVA 4ZVVA 3AX6A 1VJ5A 1ZPDA 4GM0A 4J7AA 3PHJA 4QC2A 1Q7CA 5ALQA 5A5VA 3GJZA 3HJHA 5DFAA 5FD8A 5KYYA 5FTNA 2BHNA 4BYGA 5I4CA 3LHDA 1FLDA 3V4LA 4ZARA 1G2PA 4OAOA 4OGGA 4YAGA 3CJQA 4RIHA 4ZT3A 4LRWA 1KAQA 4WN3A 3MWGA 1RMTA 1KA9H 1BS9A 1OPXA 1YJXA 2HQSA 3EYAA 4IIDA 5E1DA 3I6ZA 2DCMA 1OBHA 5J5AA 2AZ4A 5AKZA 1Y6QA 3W3ZB 5TJ9A 1GZVA 1MJHA 1TYCA 4JA2A 2W2NA 3FTPA 5L7TA 4EUSA 3GLIB 2FRXA 3RKRA 1EWKA 4FZ3A 2H7YA 3D59A 5TARA 4B75A 2Z6QA 3TQFA 4A3SA 3VBEA 3VZRA 2HDOA 3C16C 4ND4A 2XVXA 2XEXA 3ZHOA 4BC0A 1UMCA 5DTQA 2J0SA 4F2GA 4JDUA 4Q5IA 1DQSA 1EEHA 4R0VA 3VMFA 2R7NA 4YP6A 1G4UR 2A0WA 3VHRA 4DYHA 4YV0A 5CFMA 1J21A 3I9MA 4P7GA 3RVDA 3QVGB 3C4VA 3RS0A 3E15A 4EG7A 2QUHA 4OXIA 1CU1A 1PTJC 3G2PA 3E2PA 1FNMA 2FMIA 2JC3A 5DYNA 4MVJM 1HT2E 4C0BA 1BROA 2AYXA 4NDNE 4JP8A 4Y2XA 3FWZA 2DRIA 3FCCA 5GZ6A 1WCYA 5JCJD 2JZCA 2QL5A 2D5AA 5JNVA 2X5NA 4P53A 1ZOPA 3DG9A 3MS7A 1MH1A 4QXRA 2I54A 3GDHA 3ROXA 4D2IA 2JA2A 3WXMA 3MAGA 1YGPA 3ZGOA 3H9BA 5K01A 2F43A 3P4YA 3HO8A 5BNWA 1NSTA 1NQAO 3OCJA 3LXUX 2IUFA 2O3TA 5ENVA 4AJ9A 4ZICA 2AFHA 2UYOA 3G7UA 2ANBA 1MKYA 2VHVA 4YNBA 2ORIA 3WNQA 4BP8A 5KYUB 4Z0HO 1OXXK 3WRVA 2BI7A 5LP1A 2VA8A 4UM5A 1MT0A 2NUTA 4B2LA 1EUDB 4MEBA 3OSZA 3CLUD 4DIKA 4UFPA 2CC2A 4C4SA 3LIIA 2HU5A 2QX4A 2XNDD 3DULA 3DV0A 3GRPA 4NYMQ 4Y2HA 2IEAA 1QK5A 1AGNA 4IXMA 3P52A 1TJ3A 1N7GA 1QQ6A 3RVQA 4WT7A 5G53C 2ET6A 3OEHA 1U8XX 3QUBA 1OAOA 1FSSA 1VKNA 5AOVA 1KYVA 5JECA 3HNOA 1XRJA 1XXLA 2NZJA 3W5SA 1VCMA 2BMVA 3ABQB 5K4AA 2B1JA 4FGLA 3B52X 2ZIEA 1I4LD 2WTBA 3NTLA 3OIUA 4UTRA 4L50A 3L79A 3RSOA 4ENRA 2LGJA 8ATCA 2CJFA 4XLLA 1CDDA 4UUPA 2ZBRA 1BEEA 5IEBA 3AXTA 3N74A 4BX2A 1UIMA 1T3ZA 3UAGA 4PLZA 1LPMA 2GZSA 3T38A 3QU9A 4B6GA 1N9KA 2PZJA 4U9UA 1SZCA 1JSXA 1ZXXA 3NHYA 4P22A 4XM2A 4O5AA 2JCYA 4X20A 1W44A 4PZEA 4M0DA 3VOAA 1AKYA 3DM5A 3BMCA 1R5OA 3GJYA 4YY3B 4ER6A 4MUJA 5CB4B 3AVQA 3NVMB 1NGSA 3L1JA 1BCSB 4N5MA 4P5PA 1EFAA 2GHRA 5LB2A 3J81k 4L4ZA 2PZGA 1ENPA 1UEXC 1XVIA 4GUAA 1WV0A 3PHHA 1SQSA 4J1TA 5FOTA 3AUFA 4MGYR 2JLZA 4RZHA 1Y3IA 1YZNA 3EA4A 3GBPA 4GWGA 5CIQA 4ZRNA 4IXNA 4CM1A 4F4CA 1S4QA 2BOVA 5ED4A 3O38A 3QJYA 5DYWA 5DBHX 1NV9A 1SA0B 3EVBA 4GU5A 1Q1NA 1XLTC 3O1LA 2Q46A 4QXQA 4S12A 3SQMA 1T24A 1DTEA 3FB1A 4A26A 4MGHA 1POXA 4INPA 3HL4A 3PRHA 1Z17A 4IJUA 1SY7A 3SZRA 4YRDA 3RQSA 3SKYA 4ZAVA 1MO5A 5T6BA 4OL0A 1TL7C 4CGZA 3WY9A 2AF4C 1ZRSA 3QITA 4H6XA 4XASA 3MVEA 4PWZA 4DBZA 3GJ0A 2XQVA 4QOIA 4U7WA 1CHNA 2HCJB 4DR7B 1JEQB 3O2QB 5JXGA 2OO5A 3LOQA 4FE4A 4G9BA 1F1JA 3A1EA 5SY9A 3T8YA 1K66A 1T2CA 4X63A 4UVIA 3TTUA 2FSSA 4B1FA 1IWPB 2C9ZA 4EGAA 3NIDB 1VYVA 1JALA 3P9PA 1VKRA 1ZJ5A 3BXHA 3VNSA 1JA9A 3I45A 3VPCA 3EULA 3U3JA 1YI8A 1KXZA 1I8TA 2AOXA 2IOQA 4KK4A 1UFOA 3FBTA 4I50A 4L6IA 4OQLA 4Q3LA 1IE3A 4OJMX 1XLUA 5GP1A 3TSYA 4YRBA 4IJMA 4ZI5A 1MGOA 3HCNA 4CQLB 3VPHA 1DJLA 2QX8A 3RS7A 3ZIAA 4B6RA 1G42A 1GUDA 2FPUA 2JARA 4KQFA 4YV7A 2XMDA 3M81A 4RD1A 4FSXA 3K15A 2H48A 2PX2A 3TLGA 2DMRA 2JFZA 1J7KA 2KX7A 3HCWA 2XCRB 3B6ZA 2IELA 3UJ3X 4YPVA 3FVRA 3H9GA 3IEIA 1AKEA 1U6JA 3OCZA 5J23A 3RVLA 2WFLA 1W7AA 4LDQA 1A69A 2CNBA 3L0ZA 2ZITA 3BL5A 1L3BA 1UZMA 3CSSA 4GW3A 2FHPA 2B4QA 3BEDA 3G23A 3TLZA 2EAUA 2VNJA 1KBZA 3NV7A 1U9ZA 1NBHA 3RG2A 5MN4A 3D6TB 4MRVA 1RQXA 2Q41A 4OMCA 3K6SA 4GLJA 3BWEA 3O0TA 3VR3A 3GBSA 1RQRA 4XVRA 1HLFA 3FHLA 4NCKA 1NP6A 2BGUA 2W42A 2H52A 4UDOA 3RU7A 3QWBA 4HDSB 5EXDA 1J1ZA 1G8HA 1IDN1 4TMKA 4R9UC 3UXYA 4RMIA 3V33A 4E7OA 1Z37A 4EQ6B 1FW6A 4JV5B 4Q3AA 2RGAA 4QBTA 2E4WA 1XA4A 2E87A 5AH0A 3AESB 3EE6A 3NRBA 4DLWA 2MTBA 1ESCA 4MPRA 5IKMA 4Y6QA 2IY9A 3ASZA 3S7ZA 1RM4A 4C7OA 3NVDA 2BBWA 4RDXA 3QUQA 1B6TA 3A1TA 4RE6A 3I4LA 3S2SA 4KXVA 3S1AA 1ISFA 3V9AA 1ZNWA 2XRYA 4QYSA 1OH7A 5BURA 1VG0B 3I32A 2HJWA 4NCIA 5L4NA 1V5EA 3DFIA 1NUTA 5BW4A 3IUBA 5HA5A 2GAFA 2ZSIA 1U63A 4E5SA 1OHHD 3VJMA 3CLTC 5KYNA 2VLBA 3T4UA 3EFHA 3CLTD 4ZAFA 2AG6A 4EPYA 4CBVA 4HRYA 4YRTA 2Q3LA 2QVXX 3TIFA 1PR3A 4H9GA 3SBOA 3BMOB 1C81A 1E6LA 1SCUB 1B7GO 3ZE9A 2GPWA 2SCUA 4IDOA 2IH4A 2PQ2A 4MSUA 2AOVA 1USGA 2WD9A 3OFNA 4NENB 3CNEA 1I4WA 1X1DA 2HMTA 3GR6A 3S8MA 3OE1A 4BLPA 3HVIA 4IGAA 1FNNA 4FKMA 3U81A 4DNQA 3BCHA 4A2CA 3AHFA 1UT8A 1WBJB 4LNUA 5TT1A 2XXAA 5CDFE 1KYZA 4EFKA 1Z13A 5MFZA 3GGSA 4LBZA 2DFDA 3UA3A 4BFTA 3O75A 2H29A 2WNSA 1KJJA 2VJAA 5AW8A 4ARCA 1DWUA 1NUSA 3KOWA 3JQFC 5DXFA 4UHCA 1G2IA 2EC5A 2QLMA 2AYYA 3K9GA 4PSAA 2YJ5A 3DXFA 5BN3A 3IR6A 4X85A 3KPJA 3W1EA 2RD2A 4IJ6A 4L78A 4YPFA 5K0TA 2WNIA 4D5EA 1AHHA 3IAXA 1F2UA 4FS8A 1CW2B 4O8ZA 4US0R 3CE6A 4IO0A 2J3HA 5F7ZA 3VDRA 3WFIA 3CSDA 1U81A 5AW0A 3OFJA 2ZRJA 3KAQA 2LP4Y 4B33A 2EFDB 2TMGA 1RR6A 3ZHCA 5JO0A 1A4XA 2EARA 2QAGC 5EPOA 4JMLA 4NS4A 4BNZA 2GZ3A 3IIIA 1Z0IA 3DT8A 4OP3A 4NFSA 4U2CA 3WGKA 1GTMA 2GK7A 3T9DA 4X97A 1HKUA 1Z34A 2BE9A 2VWHA 1W2HA 3FRHA 3KVOA 3LPMA 3BMQA 4BASA 2QRQA 3HLTA 4H0NA 2VN8A 4GGMX 5HX7A 3AL2A 4BFXA 2GXAA 1KI3A 2IPLA 2GO1A 1HTTA 1UXIA 4R8RA 5B55A 4CMKA 3SHOA 3G8AA 5EN4A 3N2LA 3FHTA 3IP7A 5EP1A 4Q1FA 1SR8A 5JMOA 1PK9A 2ZSDA 1JXQA 5CPBA 1HR0B 1ZGGA 1QYRA 2AQIA 4JP2A 3ST7A 4L2IA 3SVZA 3VX3A 3FLAA 4QUJA 4V0SA 2LPMA 1WNFA 3KD3A 4BB0A 3OD1A 1GPWB 1V1RA 3C3EA 1QVZA 4YCSA 3UAWA 1SIOA 4W9NA 1UBGA 2W2LD 1EK1A 1UXOA 4XWKA 1RAEA 2I65A 2EEZA 2NSYA 4CLRB 2BFOA 4MZXA 5H4GA 1P2SA 1CEQA 5JZSA 3IBFA 2NU9B 5ESRA 4C5BA 4D82A 2JFFA 3G0OA 2C2BA 3ICEA 1XTQA 1UKVY 1BMFA 1JTEA 4M3NA 3IT0A 2GH1A 1AXRA 1LSJA 4HXFB 3RC9A 2IPMA 2CBXA 3ZKAA 3C6XA 4CKZA 3KR0A 4ILEA 2HDHA 4JWTA 4WLFA 4LXIA 3TEFA 5AM3A 1E3WB 4CLOA 1G6OA 4BAGA 4PG4A 4BEVA 1Q7TA 2PUWA 3DA8A 1AS0A 4NTZA 3KR2A 1E18A 1PI3A 1QQTA 2PH3A 3A9TA 3EXHA 1TCVA 2OV4A 2VQEB 2OR3A 5F9HA 3FJYA 1ADBA 1ZG3A 2AXPA 3DOCA 1N3BA 4B85A 3I83A 4ALIA 1U1GA 4Z9FA 2BP7A 4FNGA 1ZYUA 2NGRA 3T3PB 4MLZA 5B3AA 5LD2B 3AHDA 2Y93A 4AZ3A 1DL5A 1ECGA 4MKIA 1TW2A 3RARA 4YCMA 3PIIA 4LTNA 4Y98A 3D8NA 2I9PA 2B8TA 2C92A 3T9EA 2ZG6A 3RYCB 1KHHA 2O8BB 2Q2NA 3KZMA 1MA3A 3OH8A 5GIOE 1JGTA 3ZGVA 4KAJA 2EKLA 3CVUA 4CMJA 1QV7A 3QF7A 3FGOA 1HV8A 3DLAA 1Z0DA 2M2IA 4AX8A 3FUVA 4BNXA 1R15A 3D8HA 4QGAA 3GRKA 1C14A 4JVSB 4JR0A 1YCHA 3JQBC 3LL4A 4JI1B 1QVRA 2CGEA 4OHXA 1N5JA 2EWVA 4NBRA 4DB2A 1CJMA 1YV9A 3OQIB 4DCOA 1VMEA 3MWFA 1OAAA 1V4BA 3HSKA 4B4UA 2GEFA 4CKYA 4KWIA 4F04A 2VEDA 4EGFA 1XGKA 2PVPA 2A0YA 4PLCA 2IP2A 1WD7A 2ZRAA 1JLKA 4OO3A 4TLCA 4KPGA 1D3AA 3X1DA 1KZ6A 2IOHA 4A6PA 1OW3B 2EYQA 2QT0A 3SHFA 3GQBB 3EIWA 2G1KA 3NOVA 4L0MA 2VS1A 3IKJA 3MD0A 3QPWA 4DMCA 1LV7A 3DOHA 1M0TA 4HHEA 5TX7A 2HPAA 1X0XA 3MT0A 3AR4A 4LK2A 4D3YA 5T4BA 1KKUA 1FU8A 5K6AA 1J5XA 1E2EA 1GXSA 2VUUA 4MDYA 3TWOA 4ECAA 2HWWA 4EHIA 2OXCA 2FWRA 2X22A 3AIMA 2OV1A 3JALA 4MICA 3AUUA 1N4AA 3WK8A 4DA6A 3SR4A 3R3WA 1Y8CA 5GTDA 3REFA 4X62B 2ON6A 2FUG6 3LC1O 3IP8A 5B6PA 3KYIB 1N92A 1Z5WA 2R5FA 3H1FA 4JSTA 4FPXA 4OCZA 2ETVA 1W59A 1E20A 2Y1LA 2G07A 3H3FA 1BRTA 4Q3KA 2H07A 5CPFA 4ZQCB 3TRJA 3WO0A 4C7VA 2PL9A 1FSGA 2IHKA 1RWNA 1SCAA 3AQIA 3ESQA 3TRKA 1W88A 3UH1A 4MO2A 2HBZA 4M46A 4DPKA 4ABYA 4FI3F 3MZ0A 1RWKA 2FQWA 2L2QA 4OVKA 5F1YA 3WYAA 5A9SA 2UXBB 3AIIA 2DUUA 1FX1A 4L27A 4OF4A 4K6FA 5FOUA 5LNK6 4Z3DA 4NXNB 4BMYA 2P1RA 3DC2A 2HRBA 1KEWA 2QTBA 4MYTA 2PS3A 2K7ZA 2VDNB 3HLKA 3NP9A 4UE6A 3UAVA 2YWHA 3M0EA 4NATA 5IM4A 4Z4FA 4QJ4A 1NMSA 3GVXA 3UHJA 1VI5A 4BNKA 2Z3VA 1Z74A 4WA8A 2JAXA 4OKIA 4JGGA 2ZRHA 3PX3A 1PSZA 3CMMA 4S0ZA 3CNBA 1EM6A 4S1TA 5F76A 1X2EA 2D0DA 2DBVO 2IITA 5KOJA 3B3AA 3R5JA 3M4JA 4BFYA 4OGLA 2JIDA 3G0IA 3NHFA 4NPAA 1RJGA 1HDOA 1M7BA 1U02A 2CMHA 4NFLA 4IFEA 2NU7B 4EJMA 5LP6F 1J23A 5LU9A 3FNFA 3AEUB 3VU9B 2BM1A 2QRLA 1NVEA 2W2VA 4YTEA 3U7GA 1NHGA 4RXMA 2P3QA 3AF3A 3C1UA 4A36A 1J99A 2D2VA 4XX0A 5KWVA 2I7TA 4HRAA 1WZEA 4B4OA 1M6EX 3RVJA 3TEJA 1IFXA 2WKWA 3AUXA 3UT5A 3NHWA 2J32A 1A1SA 4BV2A 3HDJA 2JJ8A 2C3UA 2JW5A 1QQ5A 5HOQA 4ETNA 2HSDA 2Y0CA 3I1YA 3REGA 4F3TA 3H9EO 1DDIA 4Q3NA 1BX0A 4GMFA 3H11B 2P40A 4MAAA 1YR8A 4QTXA 3ADDA 2NVUB 1TO1E 2HN9A 4ZYXA 2HADA 3A1NA 4F4IA 5B4UA 5AWFC 3KV3O 2H17A 3O92A 3GAMA 2IXFA 2Z95A 5A2GA 4KXFB 4DQDA 5C1PA 3LSTA 4GR5A 1E59A 1BWQA 4D57A 1UZAA 4NAHA 1ORHA 1U8UA 3B13B 2O14A 3CEMA 2GRUA 4M8SA 3NBKA 3NXKA 4MR9A 1D1SA 1S3GA 1AMOA 4LF5B 4BO2A 1R8JA 3REQB 3M5WA 3RYFA 4ZK2A 1W4CA 2AVDA 5AJYA 4AMBA 4RTMA 3SNKA 2LNDA 2CDRA 3HKDA 2OHHA 4MUNA 1GU0A 2EP8A 2V7EA 1G1AA 4FYHA 3UTDA 4DNXA 4KVFA 2AXNA 4MYCA 1NQOA 4E94A 4QYMA 4EHBA 1J07A 3MLBA 3AYXB 1MORA 2OP0A 2VDQB 1R4ZA 3KZNA 3RT7A 1Q1ZA 2C8LA 3A31A 3ORRA 4ZA2A 4ZVTA 4JI6B 3SZUA 4YRNA 5KNBH 3O83A 3GG9A 5K3FB 1Q74A 2JIRA 2QL7A 3OZ7A 4RJJA 1I2ZA 3RAPR 4WDQA 4QUDA 1FUYB 4M8IA 4BECA 2BI8A 2FFJA 1IRXA 5EYPA 2ZIWB 4F45A 2C88A 2ZTMA 1QIMA 2RGWA 2Q0XA 3H5AA 1SG9A 1WWKA 5C31A 5BN4A 1XJWA 3VC7A 1G21B 1T6NA 4RW0A 2AX4A 1WIWA 4KXLA 3U7IA 2O2XA 5DE3A 3D0KA 4M7WA 4RY8A 3WOVA 3T5GA 3RSLA 3LVQE 1L0BA 3GVCA 4NU8X 1MVLA 1QP8A 1RCTE 1NP7A 5CITA 2IWHA 3MHPA 3O4HA 1L2TA 3NP7A 5MN5A 4RD6A 4L8VA 3CF0A 4Z7NB 4XRRA 1E9VA 3UICA 3MTIA 3VOTA 5LQKA 1FSZA 2XYGA 4K46A 5I5EA 4OU5A 1NDHA 2QMQA 2YASA 3OOYA 1ZGAA 5CXUA 5CBPA 3WDMA 4CDGA 5IU6A 4KR9A 3K0KA 3K6RA 2BCGY 4PF1A 3SQLA 1ORWA 4LF7B 3VR4D 3IIJA 3KOXA 1G3IA 4C76A 4E70A 1IN8A 2WK1A 1JU9A 2WI8A 4V02A 3WWOA 1L5FA 1NRJB 4QLBA 2OCDA 1MG0A 4LMBA 1CHDA 2DFVA 4IS2A 2VNAA 5DYIA 4BFUA 2IP4A 4KOAA 3T1OA 4DMGA 2C3OA 3M6LA 1OX6A 4N3NA 2DPYA 2F3PA 4UVEA 3OE4A 3IIMA 2J3QA 2NQ8A 3T7TA 3T35A 1T2EA 2C84A 1K6EA 1ECFA 2CYBA 4OIMA 3I09A 1SWVA 1IIBA 5CFOA 2C7RA 1DAOA 1JG6A 3G0HA 3PHGA 3ZGNA 2ACWA 1QQAA 2C3MA 4LIPD 4EUHA 2Q3HA 4MARA 1C9EA 3EQ2A 1FVHA 2QQ0A 3KL2A 4IFBA 3RTEA 3U2QA 3UJ8A 1XALA 2H1HA 2Y1XA 1ZOOA 1R6DA 2JZNA 1LJUA 3QLTA 1FFHA 1XQVA 2QEQA 1T5BA 2FZVA 3SOPA 5K45A 5MGBA 2GJ4A 2O1XA 4J0KA 2WTEA 2GHIA 3HMKA 3LO8A 1A0OA 3VHQA 1DCTA 4PX5A 5C1DA 3WA7A 3QPCA 4BAUA 5AJXA 2QP9X 2IOYA 1CQXA 1J06A 3JQ9C 5EJMA 4CU5A 2FEAA 5JYCA 3W5IA 1T5DX 2VTEA 2VHYA 4YR7A 2NO1A 2F00A 4JI0B 5EY5B 3W6OA 3AEKB 2OV8A 3PDUA 1K98A 1UZLA 1W5SA 3R0QA 2EHDA 4IW3B 4HJXA 4TMFA 4JQZA 3HM2A 3UB4A 1RWPA 3HCAA 3Q98A 2WF7A 3UMSA 5IF9A 3PYMA 4KLRA 1W96A 5TQ2B 3RT9A 1ZO8A 2QV0A 4C0JA 5EZSA 1OREA 2NZVG 4C3ZA 4D4HA 2DGDA 3W8DA 3WHPA 3HM9A 4U1RA 4EM6A 3NHLA 4R2LA 5HCNA 2C5FA 4WWHA 3EEBA 4J3NA 3GFSA 2QLBA 1TQ2A 3C8MA 2DWPA 2PFKA 3PC8C 1CJTC 1MENA 1OTYA 4RE5A 3ZW9A 4RK0A 2BGIA 4MGIR 4E33A 4Q9IA 5CEJA 1BDIA 5E95A 3L0DA 4RH0A 4YC7A 3U39A 3QUCA 4D9BA 3THYB 1GQQA 1R0WA 4YMIA 5CFZA 2Y1OA 5FBZA 4ENPA 3N1UA 1N5IA 2E2WA 2XMBA 4FHZA 4V3BA 3CVVA 1N8KA 2AWNA 3E84A 1K1EA 3L8ZA 4MRNA 4NABA 2EV9A 2Q7XA 1K3UB 4J8PA 2HLNA 4KHZA 4DT1A 3H19A 1UANA 2O8DB 3ZY6A 1V25A 2IU6A 2FVYA 1Q5PA 3UWOA 2NLOA 3FZNA 3RJZA 5KREA 3FOFC 2UYHA 1V2HE 4DBLE 3EAGA 5AK6A 4EA8A 1KJNA 1GEGA 1W5AA 2BKXA 2GJ9A 4YHBA 4CEIA 1GSHA 3H2IA 1J5PA 3TTTA 3DEFA 2FXVA 5EPUA 2NVWA 3SAJA 1GDDA 5BVHB 2AZDA 4DIBA 1EVQA 2C95A 5JWOA 2PUEA 3FW1A 1N0IA 3MWKA 1GUAA 2CHQA 4GX1A 3CX8A 4JBXA 1LW7A 4BKQA 3DAOA 4C4OA 4ZJUA 5C9ZA 3F4KA 4M9CA 2PRYA 5AK5A 1I01A 4OHMA 4CM6A 4R98A 5D7BA 4MULA 4M98A 4G0PA 3VZSA 2PXXA 3D7SA 3EAQA 1ODFA 1YDMA 3QUTA 2MR6A 3ZIUA 3L8DA 3L46A 4QJIA 1GPBA 3M3PA 3AR3A 3LBHA 4CGYA 5KJ6A 4NARA 2H11A 5ALNA 2R2AA 2WDPA 2AH5A 3M9LA 1VSTA 4OU4A 5CURA 2VPQA 3DNPA 1RWMA 4NAVA 5D3MB 1E1YA 4N6GA 2UUOA 2BR3A 3O8BA 3DNMA 1AN0A 1JQ5A 1LVGA 2VSNA 3HJAA 5KNCA 1NJFA 1JI0A 5KYXB 5KJEA 2GD1O 2VTBB 4WINA 3R41A 2W6MA 3M6VA 4PC2A 5ECDA 4MHTA 2GPJA 4CR6A 1OFHA 3G1WA 5BWCA 1YB5A 2VXBA 5JAUA 1XDBA 1NYLA 2CLMB 2RAUA 4ZI7A 4J1NA 3EVDA 3OOHA 3FSJX 4H16A 4TZTA 3OX3A 2NW6A 3ZQ6A 2LRHA 1P1JA 4BB9A 5JEEA 1LTQA 1SWWA 4DANA 3WO1A 4FIDA 4GM1A 1V41E 4HLDA 4A0RA 4HC4A 1Z22A 3SOZA 1PYOA 1NF9A 3WGZA 2C9YA 1JZSA 3DZFA 2JGIA 3PPIA 4R16A 3SGLA 1YQQA 4UVDA 2UZ4A 1IAQA 4D0LB 1JHVA 1OVGA 3VNVA 3IHWA 1L5GB 5DEOA 4C1NA 5KQRA 3AVOA 2A5FA 2WAMA 3JRWA 4KLAA 1U2GA 2X6RA 4X66B 2YQ4A 4DSZA 1DBSA 3NALA 5BMOA 1N3IA 5LZ8A 4I08A 5IEJA 1CE8A 1QAOA 4C7KA 1JNYA 4ZEOA 1KY4A 3BSFA 5SYAA 1O57A 3BQ9A 3DP7A 1LC3A 4RCZA 3Q88A 1D4OA 1KSHA 3A4VA 1L5LA 1YJQA 4Q48A 5LKRA 5AXAA 3T7CA 4AZWA 4EKIA 4PPYA 2G3YA 2WJJA 4KFTA 5JDCA 2JD0A 3WICA 1N5DA 2QR5A 5KI6A 1N2XA 1CP2A 4I8XA 3ORSA 2AN1A 4XQ0A 2R5NA 3LQRA 1ICEA 3VDXA 4HWRA 2Q6LA 3COPA 3L9XA 2IHYA 3FXAA 2W7TA 2ZYTX 1CETA 2VYFA 3M6UA 2ONZA 1Y3FE 2GLTA 2BEWB 2P9EA 3GHYA 3CPJB 4Q19A 5DHFA 2ZUSA 1GT91 3JQRA 3GI1A 4O1IA 1TUBA 3DM9B 5LJLA 1Q1GA 1QNFA 3T1VA 3T3DA 4LBVA 5LZ9A 2ISQA 3IILA 2WLSA 5BNFA 1KKMA 2W90A 2A6PA 4OXNA 1J0AA 4PXYA 1C1DA 4WCVA 3OM0A 4TTIA 3ZY5A 5AM5A 3FFXA 3AOEC 2DTXA 1Z33A 4C9BA 5JNUA 4QKQA 2QWXA 4CKWB 1S8AA 2XMZA 2NU6B 5DMXA 3FVWA 4X5OA 5CXXA 5D8DA 5PNTA 1JX6A 2VJOA 2OK7A 1XZLA 1NW9B 2OK8A 3BHJA 1DAMA 4R1UA 4RS4A 5HGXA 1P7WA 4CV3A 4H1TA 1P62B 3HFRA 2D2FA 2I6SA 2IY7A 4JLOA 2PNJA 4LYDA 2PUTA 1W93A 1XU9A 1E9DA 1UP4A 1AK2A 3LP8A 4GYYA 3E9YA 4YJHB 1J8FA 5HJEA 3PQ8A 2DEUA 2XX3A 3WLKX 2PK3A 1QIGA 2PN1A 2VJMA 3CW8X 5IMSA 1GFWA 1E9EA 1HC7A 3C39A 4MMYB 5AHRA 3SJ7A 5IN4A 1JWLA 1A1VA 4P38A 3N6XA 1V8OA 3LHKA 3IB3A 1FJXA 4KFSA 4M36A 1L4KA 1ZSYA 4UBJA 3B2NA 4CIXA 4XFJA 3TIVA 1D4AA 1JTVA 1XZBA 4EZEA 3H9CA 3ZNPA 3E2MA 1ZITA 4MJXA 5T4HA 3L7JA 3V9PA 1MUUA 3QE2A 1JIIA 2DR3A 4RXTA 5JANA 1D0VA 1JXAA 3HVUA 5ALKA 1R0LA 3G2MA 4KX3A 4MNTA 1L5NA 2ZUBA 1AM4D 2ZBUA 1IC6A 5DIZA 3VI4B 1EUYA 4N5LA 5J3JA 4DPLA 2HLDA 3TZCA 4NCHA 5EL0A 3URMA 4RD0A 2R7MA 1UDBA 1NKTA 4ZREA 5FQNA 5IJWA 2O50A 1W2GA 1YRWA 2HKIA 4PSCA 2PIAA 3L02A 5LLTA 1OI3A 2P5YA 3IPXA 4KR3A 2WQ6A 1CRQA 4ZT4A 4PG6A 1E1DA 5BV1A 4EW1A 3BCUA 4NEQA 5EKSA 1GA4A 5AVSA 1NYQA 1TM2A 4MH0R 1GEEA 5ALFA 3UMMA 4Z3OA 1OWOA 2J1LA 4UBLA 2O7NA 4U2FA 4YJ3A 3O95A 1UXKA 1KMCA 3PRJA 4RABA 4BO6A 1B2LA 3ZKWB 3HJBA 2WLTA 3LQQA 3O9ZA 5FNVA 3WYEA 4IBOA 3TECE 3AONB 1JFLA 2ZZKA 4AUMA 3HXPA 1OV6A 2V3VA 1MO3A 3F2VA 3DW1X 4YBRA 3ACCA 2JBWA 1H22A 2PS1A 3D6HA 4A92A 3HCOA 4FIZA 4B3GA 1T29A 3JPYA 4FDAA 3WG9A 1T0IA 1VJ0A 3IDQA 4R1MA 2R3SA 3GZ4A 5BWLA 4PC6A 3RUPA 1TVEA 5DYTA 3ZOKA 3P2MA 4GS5A 5BQPA 2G82A 2HA6A 3AL3A 1P72A 3BFKA 2NG1A 3O2NA 3KKZA 3ODGA 2Z0MA 1TE2A 3IT1A 4BOYA 4TT3D 4DXHA 1P5HA 1AXGA 3KQUA 3K0AA 2VZ9A 3R3SA 4PM4A 2GQ0A 2FZKA 2J5BA 2QTZA 3H0CA 3IELA 4XQGA 4O4JB 3BRCA 3IRUA 1DX4A 3DHEA 4E22A 1REQB 1U6KA 2I76A 4NEGA 4WCFA 1SUSA 1TK9A 1R2QA 1I6MA 2DFKB 2FMXA 3A1DA 3ZZTA 4DQKA 3CV3A 1D1QA 1ZKDA 4ESHA 4U2DA 5JC1A 3OD5A 1UMBB 3I23A 3TLEA 3ICVA 2B82A 5FFFA 2VP2A 4F6CA 3B9BA 3VU8A 5DLDA 1FBTA 2G5TA 4RAQA 2VHEA 1GDTA 3Q4GA 2Q50A 4B4KA 3WHLA 2H2AA 3CVJA 3TGLA 3HUUA 3BH0A 5MHTA 3G82C 2JHFA 1N6KA 1CNEA 4AZVA 4EVIA 1G55A 4M9RA 5HZHA 5D00A 1EDBA 4S2UA 1X1TA 2DBYA 2I1VB 4G5SA 4XPIB 2GMWA 2HM7A 3BF8A 3OZCA 1US8A 2HNBA 3FOZA 3T34A 2ZREA 1G5PA 3OZAA 3K8ZA 3QRWA 5ELLA 2GHQA 4DCPA 1I2CA 1M0SA 4W63A 4OIFA 3C3MA 4L5IA 3UMYA 2O07A 1I7NA 4L6AA 5HWSA 4URFA 4J6FA 4I4TA 3LRTA 1EXDA 3TMAA 4B4DA 2Q8NA 3PXBA 4COOA 1KI4A 4C2TA 1Z08A 3SYKA 1QIIA 2GUGA 5JTUA 4FJ0A 5LBIA 1T35A 3JWHA 1PCXA 1U98A 1OD6A 1GN9A 2HWYA 3E7WA 2J6IA 3PHIA 4GVPA 5AK0A 4C14A 4E6PA 5EESA 1EGAA 3U3XA 4ZCMA 1RMYA 5JS2A 3GMIA 4XFKA 5CVTA 1R0ZA 2OXIA 2G06A 3DD5A 3FN4A 3GLTA 1UWCA 4H3KB 5BYAA 4X9XA 2QLLA 4RKQA 3MWDB 1NXOA 1T13A 1XDDA 4HEJA 4GZ5A 1CUYA 2NV0A 2R8PA 3IHTA 3ZGYA 1FQWA 1IU9A 2OL4A 4X8MA 1IXRC 2O4CA 3NX4A 2ZJOA 3FOBA 5CT9A 3ZCXA 4R0MA 2I4MA 2J3KA 2CK3A 2OLKA 4FR0A 3EMVA 3RIMA 5FP0A 2R65A 1Z2NX 2D7CA 4URZR 4H60A 1Y4UA 1C80A 3K5PA 4XRGA 4YHHB 1U04A 3FCEA 1TO6A 3K0HA 1HFEL 4GPIB 5GM1A 2PUBA 1Y7HA 2QTMA 3I5MA 4TSRA 4QATA 3N59A 3ZD6A 2O2YA 4EG0A 4QXPA 4UPEA 1PWHA 1Y4ZA 3DZKA 4TKUA 5H5JA 2HRZA 2QN2A 4JN6B 3UKOA 3AHHA 1F2VA 3EZ2A