3GLUA

Crystal structure of human sirt3 with acecs2 peptide
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
274
structure length
274
Chain Sequence
GKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-dependent deacetylase sirtuin-3, mitochondrial
publication title Crystal Structures of Human SIRT3 Displaying Substrate-induced Conformational Changes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase regulator
total genus 84
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 3gluA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 3gluA01
2A1UA 1T9AA 1PTJC 1U31A 5K6TA 5FYQA 1PO7A 3F6EX 3GLUA 4Y6OA 1V5GA 2VK4A 4ZZIA 2H4JA 4RMJA 2OD9A 1O97D 4MPJA 4GPEA 3FSJX 4Q9DA 1HZZC 1PT9A 2PGOA 2Q5JA 1SZCA 4K9MA 3D81A 1UPBA 4MZXA 4JD5A 3JWPA 1YI1A 2OO5C 3PDHA 2VBFA 3RIYA 3LQ1A 1PI3A 4R8MA 4ZP1A 4UU7A 3FZNA 2IHUA 4BVFA 4QELA 1UPAA 3CLSD 1T9DA 2Q28A 2VJYA 3K35A 4JU9A 1UPCA 2NXWA 4RJKA 4UTXA 3U3DA 5K3SA 4BVHA 4MQ5A 1U28C 1PVDA 5EJMA 1Y9DA 5BWOA 3IAEA 2C31A 1Q6ZA 2H2GA 2VBGA 2QQFA 1D4OA 2A1TR 4JUAA 4BVEA 3ZGVA 2H2IA 1MA3A 5IMSA 1POWA 4X3PA 4KGDA 1M2JA 4JUBA 4L2IA 1PYDA 2IHVA 4FEGA 1YC5A 2H2HA 2JI6A 4JSRA 3D7KA 1DJLA 4RMIA 4QPZA 2Q5QA 1M2GA 1N0HA 4V1CI 1U2GC 3EYAA 2UZ1A 2EZ9A 3JR3A 4Y6QA 1Q17A 4JT9A 2JI7A 2WVHA 4I5IA 4GM1A 3EY9A 2H2FA 1V5FA 5DEIA 5BWNA 4IAOA 4K9LA 4GP9A 4QQ8A 2IHTA 2FSVC 1YHZA 3FLMA 2FR8C 2W93A 3CF4G 1OZHA 5MFZA 2Q5OA 2BRUC 4C78A 4F56A 3F6BX 4RMGA 4BV2A 2JLAA 1MCZA 2DJIA 4D5GA 4K9PA 4K9KA 5EJAA 1M2KA 3D4BA 1YBHA 4J1TC 3RIGA 4HDAA 1YC2A 2PGNA 2H2DA 4RMHA 5FEMA 4O8ZA 1PNOA 3EA4A 4KXQA 2OORC 4GG1A 3E9YA 4KPUA 1M2NA 1JSCA 3GLTA 2EZUA 1O96B 5EJ5A 4UTZA 2FN3A 1YI0A 4TWIA 4UU8A 4COKA 1Q14A 2H59A 4K9NA 4L3OA 4UTRA 2Q27A 4UTNA 4UTVA 4RJIA 2EZ8A 4BVBA 4Y6LA 5EJ9A 2WVGA 1S5PA 2JLCA 3PKJA 2VBIA 4FZ3A 3CLTD 4JT8A 2FRDC 2B4YA 2H4FA 2UZ1B 4K9OA 1T9BA 4IG9A 4UUAA 2NYRA 1YHYA 5K6RA 1OVMA 5K2OA 5EJ7A 2FWNA 4TWJA 1M2HA 1YNOA 1OZGA 4GM0A 2OD2A 2VK8A 4BVGA 4UUBA 4J16C 4D5EA 3GLSA 2AG1A 2HJHA 3ZGOA 1ICIA 4MPPA 3CLUD 4JUCA 1S7GA 4V1CB 2AG0A 4FEEA 1Q1AA 5AHKA 2JI8A 4JUDX 5BWLA 4JUFA 2QQGA 4V1CA 2Q29A 4RJJA 2Q5LA 1BFDA 5EJ4A 3HWX1 2OD7A 1Z8NA 4GM4A 5MF6A 1OZFA 3U31A 1XLTC 4HD8A 4C7BA 4MPRA 1E3TA 1V5EA 3ZG6A 2WVAA 4IF6A 3OE1A 5MGNA 4K9QA 2V3WA 1EFPA 5D7NA 4G1CA 5EJ8A 5EJ6A 1T9CA 1PNQA 4FVTA 4X3OA 1QPBA 1U2DC 4BN4A 1J8FA 1POXA 4F4UA 3IAFA 4JU8A 5DGDA 4BUZA 5MFPA 2PANA 2JIBA 3HWWA 1ZPDA 1YTLA 3GLRA 2JI9A 3PKIA 2X7JA 3CLRD 2VK1A 4BN5A 2H4HA 4BV3A 2EZTA 1EFVA 1NM5C 1SZDA 2EZ4A 5DGTA
chains in the Genus database with same CATH superfamily
1XZGA 4PSDA 2Q1WA 3TIVA 3OCCA 3O73A 3N58A 1SCKA 5HKAA 1JFFA 4Y2UA 1P77A 1V41E 3DA8A 3TW0A 1T9AA 3IKLA 1DAFA 2Q4TA 3CLUC 3PUZA 5C1DA 1AQIA 1W85A 5T6BA 3ZX5A 4LF5B 9MHTA 5B3LA 1RXIA 4AT1A 1M2OB 4PTLA 3ZTTA 1R7RA 3GPDG 3NBQA 1NN5A 4DMLA 3FZGA 5JSUA 1JKJB 3M33A 2NZ2A 1DIRA 1VCOA 1NV8A 2X1MA 2Y1KA 4FDAA 3X43A 1CNFA 2HXYA 4F6RA 5KWIA 3PWSA 5LB4A 3D4LA 5FF9A 1JI0A 4EFLA 4O2AA 4RSRA 3OOHA 1RAFA 4E4YA 1Q50A 1TU0A 2J4DA 3AL3A 2OBFA 3AETA 4N54A 3HJFA 1JB1A 4FX5A 2PGOA 3PQ6A 1C30B 4MI9A 1PQWA 1Y6JA 5ER9A 2XOKD 4ENVA 1AUPA 1BHQ1 4P35A 3U7QB 2HSDA 1GGVA 3KWLA 1LJLA 3BF7A 5CA1A 1E7RA 1VCIA 3AR8A 1D2GA 2JHAA 2HHCA 4YMVA 5FUQA 2VRBA 4IVQA 1DPGA 1IH8A 3B12A 2V1XA 3CCCA 5B6JA 1KDPA 2GN2A 2KE5A 3SF8A 4MHSA 4MQEA 5ALGA 5FL7A 4A36A 3EBLA 3T1NA 1M1ZA 4N7MA 1BS2A 5DBOA 2NZYA 1QBGA 2BEWA 3IP3A 4HC4A 4YT2A 4L3WA 4OG2A 1Z38A 1OQAA 3TLCA 4R84A 1Y8QA 3LHDA 5JPDA 1DHRA 1F0NA 2OV3A 3U44A 3E9EA 3LQ1A 2P8JA 1ZCFA 4QGGA 4LNUB 4LZLA 1WSAA 1NRJB 3NHAA 1NVBA 1PI3A 1ZN9A 2W2TA 3MMPA 1MMFB 4MRAA 4J0GA 4OHMA 4PYQA 3S4YA 4NV0A 1L8LA 3EFHA 3GEGA 3CEJA 4ZP1A 1QRAA 3X1KA 3TLGB 1M7GA 4Q9KA 3G6WA 1WB5A 5JE8A 5E6SB 3H2JA 3HA7A 4ZHQB 2QU7A 4RK7A 4FD2A 4R5HA 4C07A 2NNWB 2D5CA 3M1AA 5CVCA 5CVVA 4C7JA 1ZZGA 3U1VA 1H6CA 4F3RA 5I7FA 3TECE 1LSJA 1U7OA 1EWQA 2AG8A 1DQSA 4EJ0A 1LZKA 5KWJA 2QD1A 5TXGA 3SVLA 1SCJA 3L49A 1UMDB 2HPZA 2LR0A 3EZLA 5CP8A 5BQOA 1A04A 5KYYA 3DXXA 3SLGA 3TAHA 3MJVA 3CZ5A 3NIWA 3ORFA 1ZJ4A 3FNBA 2IUEA 2GNPA 4JCCA 5FPKA 1AKYA 4U6QA 1WWKA 4BWYA 1D2CA 2NV2B 4ZI7A 2ZDQA 5CGZA 2GHRA 5DLEA 1MX3A 1HOTA 2WV7A 3E05A 2JVIA 3M2TA 4A5SA 3IT2A 5FB3A 2JFPA 2GCOB 1M5UA 2PWAA 1Y9EA 3WKBA 1P44A 1B6SA 4PLVA 1QP0A 4RL4A 5TT1A 3VGJA 2VPZA 1PVDA 4REOA 4DQVA 2J9YB 1E5XA 1GTZA 3U0VA 4N4AA 3Q8XB 5DK4A 2JANA 1QZXA 3H9GA 4JC0A 2C31A 1TM1E 1QE0A 4KHPB 1H2ZA 3BG5A 1EGAA 2HB6A 4EHIA 3KSRA 1FRVA 4QXAA 2A1TR 4OU5A 5LPNA 4AY6A 4UM8B 5REQA 3RGGA 2YJTD 3SPXA 4OGLA 1FS5A 2UYQA 5J43A 2XDAA 1TCUA 2TMDA 4B3FX 1OVGA 4JI3B 1EGHA 4E70A 1CKEA 4MQ4A 4CLDA 5L3QB 3VKUA 1QU3A 4O3FA 2WNHA 4IV0A 1YCDA 3GJ4A 1YKGA 4RXUA 3WB9A 4DDVA 2JAWA 2CE2X 4LV8B 4MRMA 3KUKA 2WSBA 1I6LA 1I0LA 3DOHA 3KZ1E 1Y9AA 4N3AA 4U0KA 2Q4DA 3VHXA 2GEFA 5CTAA 5EJFA 4CEHA 4P3KA 4HWRA 2RB5A 3ORHA 2RH9B 3Q6IA 4JSRA 5ES4B 4MQLA 3HU3A 4X24A 2ARKA 3D7KA 3PFCA 4QNRA 2G6BA 3AL2A 1P4JA 2W0MA 4BC1A 4M9ZA 3I2GA 3AUSA 2C92A 2ZYUX 4JA0A 4RHFA 1XKXA 4P3NA 5FI0B 1KTIA 1YVRA 4F93B 4V1CI 2FWMX 4PSKA 3RIMA 5KNDD 4M99A 2NU9B 3SZOA 4EGQA 1DRKA 3B3GA 1GA4A 4KAAA 3RCBA 1AUVA 3E0QA 5CCDA 3ZHTA 4EFDA 1ULBA 1Z2PX 3AVQA 3LXMA 4OQYA 1DCKA 1HWYA 3PC3A 2X0DA 3UGQA 5FWNA 2R4QA 3H4MA 4E31A 2HN9A 4CTMA 4HF7A 2YRFA 4RCVA 4XCVA 1ABBA 1N2CE 3CYFA 2WIAA 3HNOA 5ALFA 2RHLA 2C61A 4CPDA 1ZR4A 3U4GA 3WK7A 3A6GA 5DBEX 5EXEA 3WMEA 4WCFA 2AXNA 2V65A 2W2PA 1BQEA 3MGAA 4JBLA 2HRDA 2H2FA 1QV6A 2D59A 4AJ2A 1FNDA 5DEIA 1O03A 2V98A 4ESOA 3LV8A 4CKXA 3AG6A 2VFAA 3LCRA 3T3DA 1WB4A 2DQSA 2V6IA 2XDWA 3EZ2A 4E03A 2FSVC 1WKVA 2G88A 3FTDA 4EKIA 4CEIB 2C0QA 2W70A 4BB6A 3RI3A 1BMFD 4OX9B 2C3MA 1YL7A 3P9NA 2PZEA 4D4KA 3IUJA 1FDOA 1VHJA 4JYCA 1MAAA 2AEFA 1E4EB 2CCJA 3GJ8A 4J2HA 4NE7A 1J97A 1T6XA 5A7GA 3TYXA 4C4OA 5I48A 2VHWA 1YFZA 4AG5A 2F1IA 1E2DA 3L8MA 1YUNA 2Y0PA 1KZ6A 1UWLA 2WINI 1FVXA 1MPXA 1I3OA 2W2LA 1PUJA 1JHQA 3B20A 3F5MA 3LY7A 2H1SA 2REQB 3ONFA 5AJYA 4LNAA 2IH2A 4OQZA 4AMVA 1FNSA 1QGUB 4BFYA 4ZYLA 2OMEA 4J9UE 4BLVA 3ELDA 1Q3KA 2BZ0A 2GZ3A 3V4OA 1JBQA 1KPIA 1L4MA 3OEWA 4FJ2A 4NMMA 3CIFA 2EQAA 3JAWA 1L7VC 3I1YA 1K5DA 5I3CA 2PU5A 2ZZNA 2ZTMA 1FFXA 4R31A 4DJJA 2PH3A 1M1UA 2YRXA 1DEHA 4KVAA 2VZEA 1XMIA 2CVOA 1DFGA 2B37A 2QORA 3AUJB 5IM4F 3GJRA 3CX7A 3D1JA 1IHUA 1P7ZA 1YJBA 3FDZA 3LXUX 2XKBA 3ORYA 3IILA 5EKDA 4C0WA 3PD1A 4C20A 2I6TA 3NI2A 1TO1E 1ULHA 3A6KA 3CXRA 1N2ZA 2QF7A 5FRDA 3WBKA 1RLJA 1U0RA 1UOEA 2QTTA 1N5OX 4Z6KA 1XZJA 3SF0A 1ECCA 1KHTA 1DQNA 4PEVA 3KLMX 4M76B 2Y0DA 3FPFA 3OZIA 3PWTA 3KQYA 2QJOA 4HFRA 3GUVA 3U40A 2NT3A 3A6DA 3BS4A 3LCVB 3O4JA 4IOMA 4OQMA 4DEXA 5ILOA 5DTIA 3CLHA 1PWXA 4LSGA 1XRMA 2A6PA 2GJ4A 4EZIA 1XD9A 1F20A 1NULA 4B31A 1Q92A 3CKLA 3MRXA 3IV9A 4GUDA 4YQEA 3IT3A 3UPDA 1E94E 3ZV6A 4NBKA 1Y8ZA 4BECA 1VSUA 4LMBA 4JV5B 3DL4A 2ZBPA 4TUYA 4YAIA 4OHCA 5LBUA 1ST3A 2J6IA 1ZICA 3EC7A 2IU6A 2XVYA 2BV3A 3BWCA 3S68A 3CVYA 1QF9A 4WFKA 4DR7B 1LBTA 2PLFA 2P3LA 2JEOA 4TKUB 3MJEA 4B80A 3MQ2A 4E0BA 1HPLA 4IWYA 5HIKA 5JY1A 4NYMQ 1PJZA 5K8UA 5L8VA 5TQVA 4WOPA 2GWHA 3VZQA 3AR2A 4PYLA 5M5BA 4FCTA 4OX9Y 4XQEA 1HFKA 2IC5A 4JBGA 5JWOA 4QU0A 3GNSA 5J47A 2FX5A 4BZWA 1JFVA 3WIOA 3EQ6A 4GVLA 5TQ0B 1BHSA 2HA5A 2WVGA 4IGFA 3KD3A 4KUHA 4X7BA 3T3IA 5FUMA 5HGJA 1Z34A 1W5TA 3VZRA 1NUPA 2FZVA 4LAFA 4GBED 1JFRA 1ZRHA 4IH1A 5TR9A 2AOTA 2EIHA 5I51A 1NNI1 3CUVA 3I72A 5CB0A 5H59A 3PTLA 2Y4OA 1Z5GA 2GN1A 1N0VC 1RMYA 3WRXA 4YT8A 1NFRA 5HSGA 1QZ3A 4L6AA 5AI4A 1QJ4A 3JD3A 4RPLA 3ZE9A 3R3VA 4PFJA 5EJ2A 1QCZA 3BPSA 5FV7A 2OQIA 5HBGA 2I6UA 1R0WA 1LQUA 5C81A 1D6SA 3LUPA 3QVKA 1MNAA 5C3UA 4AN0A 1T3HA 3DTNA 2D2EA 3O82A 1HT3A 1VHWA 1YQTA 4OOFA 1DZIA 2YYZA 4LKOA 5I7OA 2OXRA 3GELA 2IPNA 1P7YA 1U2TA 2CJWA 1CULC 3QLJA 1MQ8B 1I32A 3U4AA 3QEAZ 2WSYB 1ZUNA 3K6JA 3TG8A 1JUDA 1NIPA 3L0ZA 3H05A 4HB3A 1KIMA 3PA8A 4MPPA 4MKIA 4CGYA 1FQJA 6REQA 1C9NA 3CLUD 4W5NA 4WZAA 2IW1A 2FMFA 3HYRA 1CY8A 2D5BA 3PT9A 1C0IA 4WLNA 4D80A 2RHGB 4EITA 1JSZA 2C2KA 3OCUA 4LXIA 3OHMA 3JATB 3ICCA 1YR7A 4TSKA 3PA6A 1GQRA 5JJBA 2G1AA 3L79A 1BWRA 5DX0A 3U17A 4PZPA 5KVAA 1YS6A 5L9AA 4Q4AA 3URKA 5C51B 3RFVA 4BFTA 4ZVKA 2Z4RA 4U7FA 1RKQA 1R0XA 1L3IA 2BHRA 4F4JA 3HVJA 2H7XA 1DBQA 2PKRA 2AZMA 2Q29A 2QN7A 3ABZA 1H4VB 1MB9A 2X58A 3AF1A 2PS1A 3L1IA 3AESA 2WAOA 3MWGA 1ZU4A 3SBXA 5KVSA 2ONJA 5DCLA 3L9WA 3AEKB 1RFLA 4R2KA 4RFVA 4HNQA 3O8OB 3RHSA 4N9WA 4YR7A 2QYTA 1IY1A 3GCWA 2J3QA 3HU1A 4KE7A 4XVRA 4BP8A 4HNGA 2V9CA 5DX1A 3WRWA 1BE1A 1NM5A 4OB7A 1QV7A 2B4QA 1RQGA 5JAZA 3KVYA 4UMEA 5LD2C 5F3RA 4FWBA 5LYJF 4O2BF 5CB4F 1SCUA 3LM8A 2O1XA 5DYGA 1A5SB 5KWSA 4N5LA 2ZI5A 4TYWA 1X8KA 2V7WA 3LCCA 2OCPA 3KSMA 1GZVA 4OBBA 4ABTA 1I6WA 1N34B 2GAOA 1WTCA 2ZYHA 1RWPA 3IX7A 3KT0A 4BO7A 2DE0X 3DVLA 1QHHB 4X65B 1QTQA 2BONA 2B1QA 4X1KB 4EKDA 3NHRA 2XBMA 1FTQA 3ML1A 1XD2B 3S2FA 2WAAA 1V8FA 3RFXA 1EKXA 3IVXA 3EMDA 4I1PA 2V3WA 1HC7A 4E32A 1NUTA 4DNOA 4F92B 4D9KA 1EUDB 2VWQA 4ZGGA 1ND5A 2PUWA 1CP3A 1KIFA 5EJ8A 2EAUA 1RWQA 1HE2A 4MKXA 4DQLA 2REXB 4BMZA 1W88A 2WM8A 2VF7A 1MB4A 5G0TA 5C80A 4YJFA 3K0CA 2XUGA 2ZROA 2WHXA 4RORA 1TUEA 2P1DA 4Z3OA 4EHLA 2VPQA 4UEJA 3LIPA 3CWZA 1MOQA 4TS4A 3ZCVA 1C8KA 1TB4A 4BN4A 3KLBA 2A7QA 1ZJZA 3CR8A 4HRXA 2P2LA 3HDYA 3P9SA 2FTKE 3QFSA 5KVCA 3VC1A 3L4KA 2PFGA 1MH1A 2WILA 3BGDA 3WNVA 4GI7A 1RXWA 1G4HA 1MO4A 1W76A 2Q8NA 1Y89A 4U6SA 3UK6A 4DPKA 2FFQA 3MD9A 2QTBA 1LNZA 3C5VA 3NDIA 1R6DA 1Z7GA 2F48A 4JU8A 3SICE 1ZIDA 3K9GA 2V7VA 1WW3A 3DV9A 3OQ6A 3S2UA 2VJNA 4HB2A 9ABPA 4G0VA 3GN2A 4YN3A 5H81A 3OTHA 2Z57A 4E5KA 2IP1A 2IX9A 1VG9B 4M1ZA 4AJKA 4IIGA 5BSWA 4D6YA 1U0HC 3RDPA 4CM4B 3CUUA 1RYZA 1SUEA 1R0BA 5GJBA 3VPSA 2HNBA 2G7ZA 1YVDA 5IBRA 2ZJ7A 4GZ3A 4JJIA 1GGNA 1Y7LA 5AI0A 3S3TA 4X64B 1O1YA 2RI1A 1RAHA 3MWFA 4YMGA 4HPWA 1A72A 3ZHRA 1O5OA 5EIOA 3SY8A 3PXAA 5EOVA 5I5EA 4QM7A 2JJ1D 3MVEA 3R1IA 3TSZA 3OEHD 1Y8RA 1T25A 1IU9A 2VA8A 4PV7A 1XALA 5I7RA 3ZJUA 2XE7A 1TI7A 1RWKA 1JHOA 4P58A 2MIIA 4UQOA 3ZY3A 3KHSA 3O47A 4HRYA 3WXMA 5HMLA 1EIWA 4DA0A 1KMNA 3UTCA 2ZKLA 1ZUHA 3BJRA 1HM5A 1RJFA 3K4HA 1ODLA 2EATA 4KQGA 1I1HA 1NDQA 2W00A 3HN6A 1VL0A 3IJEB 4G2NA 3UICA 4R8VA 1DL5A 3MRSA 2POQX 3AJ8A 3OIVA 4F9EA 2FLVA 2OK8A 3BRWD 3D3EA 5COAA 4BNTA 2GESA 2O0MA 2BFDB 4KFUA 4O4JA 1ZBDA 2LZ0A 3C5WP 4KXMA 4U1RA 5IAAA 1G98A 3A6PC 3B1FA 5FOQA 4CUKA 1RQ7A 3I0MA 1KEEA 1GL9B 4TV9F 1GRCA 3ICEA 1PJRA 4HAVA 5EFOA 3RTDA 3VI4B 1GVNB 4IDFA 4YAWA 1L5YA 1WEHA 4YRGA 4I4LA 2QLLA 3LUKA 3PENA 3A4LA 5PGMA 4BTEA 3NOQA 2AK2A 2JFOA 1S2LA 3NTQA 2BHLA 1G18A 1MX5A 4K0RA 1XQ6A 1EBBA 3L7KA 5FV4A 1BDJA 1VI2A 1II9A 4JKOA 1A1SA 2J9FB 1ULAA 2JHGA 1VFPA 2BFNA 1D5WA 4MULA 3MIZA 4TRRA 4GPEA 4INJA 4G37A 2P41A 3X0DA 1EFAA 3O5AA 2AT1A 3MHPA 3H2HA 3KJHA 5HRCA 1KJJA 5AFSA 1CUSA 2H7CA 5EE9A 1E69A 5TY0A 3BREA 5CEFA 1Y3CE 3BMCA 1QRRA 2PXXA 3OUUA 3QIVA 4NOJA 4WLVA 3K9QO 4X92A 3MWLA 1U3WA 1ZGCA 2O7QA 5AIAA 1V39A 5AKEA 3HB1A 3RSGA 1P9WA 3TNLA 3H1PA 4K28A 2QUAA 1E0KA 2CFRA 4GQAA 1E9RA 2JLSA 5BXQC 4J1QA 3VNUA 4J6FA 2I1QA 3HKBA 5KIAA 3SFVA 1N7JA 3UPUA 3GRPA 2FW7A 3NBYC 3FZEA 3BCHA 4AWXA 1LU9A 3KEFA 2DQZA 4KE8A 5ERYA 1YI1A 4B3XA 5K4GA 1MT3A 3C8UA 3D1LA 1MQ9A 2ZYVX 4DDMA 4PXAA 5ADHA 4R98A 4KH0A 1HYEA 5FLEX 2GEVA 4HGZA 4NMXB 2FPGA 2VT3A 2GKGA 1VGQA 2QN3A 5JFGA 1ZOLA 2PHZA 2N0SA 2FHPA 5C4MA 1W75A 3RIYA 2OCGA 5GADl 3AWIA 4G56A 1SM4A 3U4IA 3U3RA 2R48A 2BJWA 3A6ZA 4O4HF 4X7PA 3UB2A 3P45A 4FYYA 4YJGA 4X1YB 2RC5A 2Y68A 1NJSA 5J59A 3ZXIA 2C2MA 2B9EA 4P81A 4CL0A 3K8YA 3WIEA 3C24A 1UP4A 5IC4A 1ZNZA 5HZKA 5I9IA 1WQ1R 2O7SA 3H4TA 2XTMA 4CRWB 3VKHA 1YS1X 2YFQA 4B2IA 5CITA 3TLBA 4W6ZA 3RVMA 4EUKA 4MQMA 4LNHA 1P17A 2J3LA 2XMBA 3COVA 1Z0IA 2ZJYA 4OQDA 4G0UA 3HJHA 2YJNA 1DO8A 3C70A 1U9ZA 4C4RA 1JHYA 3I45A 2JH8A 3NAQA 3EJ6A 5BOVA 4RACA 4BZQA 1ONPA 2CHVA 1AUOA 3EK2A 1I0ZA 1U8ZA 3OFVA 3OJ0A 5LQNA 4HYTA 1I5EA 2CNDA 3E9NA 2FW9A 4UOZA 1ZD4A 1XLUA 3TZCA 1WU8A 4FGUA 2QR2A 3HCOA 1BDMA 3ICPA 4JBIA 4NU5A 4PWYA 1V11A 1RAGA 1ONBA 1SD5A 3NPMA 2QBYA 3DDSA 1HF3A 5E9WA 4D8WA 3OZSA 5IM5A 4MP3A 1IN7A 1B1AA 2H7YA 4Q7JB 2RGAA 3NIDB 1GNRA 2GEJA 3DOIA 1IN6A 3D64A 2H85A 4RK0A 4YP1A 4CT0A 3GLGA 3BN3A 1MQAA 3HN7A 3RRMA 2Z2YA 3I61A 1X80A 3RBZA 1D6MA 3B9BA 4F9TA 4WBSA 2D62A 3BJMA 1CUDA 1YK1A 1WXEA 3DZ8A 2GLUA 3I6QA 2H9AA 3L7AA 1C1XB 4XM2A 5F7OA 4PHCA 1Y6ZA 4E21A 3ZWQA 4HAUA 4HSGA 5KS2A 5F7XA 5K3FA 4B6QA 5K0GA 1PL7A 2VO1A 1FYDA 2VP4A 1FS6A 1YR9A 4QPDA 5DGXA 3ZI7A 1JFFB 1CJTC 3ZIAA 4PZAA 2CXHA 1GFWA 3DMDA 2RE8A 1HRDA 2XUHA 5TPZD 3K6SA 1GRRA 5E7IA 5JXJA 3DLAA 4R1SA 3K09C 3SMVA 4IIUA 4Z3DA 3BORA 5KJFA 2C5BA 1VL6A 4LZWA 4QTYA 2VDVE 5EUQB 1T2CA 3G82C 4KV9A 2F1JA 5DMHA 3FTEA 3BHJA 3CLVA 2D0IA 4QTZA 2XYHA 3HUFA 1JU9A 3L82B 3A1VA 1O6FA 4XPIA 3BL8A 2Q2NA 1PR1A 4F6RB 1PGPA 2J45A 4O08A 5A4KA 4O2AB 2DHEA 1ACJA 5KYTA 2NPIA 4E7PA 2H4WA 4ANFA 3AETB 2UZ1A 3WVNA 3TVTA 4K7JA 2BLNA 2Z09A 4KXXA 4QDKA 2UUCB 3KOYA 1YZTA 3NHZA 4Z51A 1XFAA 1QCYA 1I7DA 3RYIB 1T15A 5CA1B 3TGLA 1XRNA 3E8MA 1YA6A 3RS8A 5JQGF 3CR3C 3DVQX 4Y2SA 1RRCA 2Z8YM 2F2TA 1ZM7A 3BZUA 1WUJS 4F5DA 2PRJA 3IAS6 3SCZA 1AMNA 1GAWA 3OIGA 1GSOA 3X1WA 4OHFA 3SF8B 5FBHA 1ILEA 4DSOA 3PNKA 1WABA 1IPHA 1B15A 1ULTA 3K9CA 3HI6A 4RV9A 3D8BA 3BXZA 2FFRA 4M22A 1WTAA 4G07A 3D0QA 5J5CA 1KZ1A 1ORDA 2A0XA 2W93A 3TPFA 4R2WA 3DD5A 3D4NA 2HC9A 2X7XA 4CG0A 2WD7A 4QJ3A 3JASA 4C5AA 1OXVA 2FRDA 1C9EA 1Z17A 2WD8A 4Q6BA 3C3PA 1FFGA 1LVHA 4GPD1 4NZNA 5KJCA 4K81B 1QGAA 3V4FA 4F56A 3F6BX 4YCBA 4EX7A 3COYA 5JS7A 2DX7A 4AYWA 1G5FA 1C3EA 2CLKB 4A0QA 4J0DA 2F8TA 2RB4A 3VBEA 2IZ1A 2PMDA 3S5UA 2JGLA 4K9PA 4K9KA 3OQOA 4ZPXA 2AG6A 5DTEA 1P6XA 1O94D 2Q7DA 1M2KA 4G5GA 3OQ1A 3CT4A 3COWA 1IYZA 1ZN7A 3TSWA 2O0JA 2QSZA 3A70A 3C6MA 4JBWA 1SHTX 2H2DA 4ZALA 4ZCMA 2BI7A 1UT6A 4FILA 4DIDA 4KLCA 4FWTA 1C2TA 4ZI7B 1DOHA 2BEKA 4CIBA 1Z13A 1I6MA 3SN6A 5JS6A 2OFXA 1NE2A 2R00C 3GWGA 1NJ2A 1Z5OA 3KHKA 5EQFA 4ER5A 4GX5A 4D92A 3SBDA 4GL2A 1ZIOA 1XYYA 2PX2A 5JZSA 5KSPA 1PVVA 3S2IA 3HYSA 2HIAA 1V45E 2PTGA 1DPFA 3QE3A 4J49A 3ESXA 3CA8A 3HACA 1NNSA 3IVCA 1XMOB 5AHWA 2UAGA 4LOAA 1P9RA 2Q3LA 3LBYA 5AT1A 4B0PA 5AI8A 2W6PA 1HEUA 3CKYA 1AHPA 1LWNA 4HDNA 2GM4A 1NGSA 4DA6A 5IJ0B 3N5CA 4LECA 4EFKA 4MROA 2W83A 3UJ8A 2WHQA 1DADA 1P4GA 1DBSA 1SU8A 4XWYA 1E99A 2FPLA 2JB9A 4H7EA 2ATIA 1A2OA 1FNMA 2H1HA 3GJXC 5JD6A 1NDHA 1T6ZA 1JJIA 1O54A 2FDXA 4N12A 4COKA 1D1PA 1QC5A 2B6HA 4JR0A 4OFXA 4FBGA 4HDRB 4H6XA 4FGLA 5SZJA 3T7CA 3HCFA 3R76A 5KBYA 2PZAA 3LJKA 1XQVA 2ZBDA 2CJXA 5LQKA 1THMA 2RHWA 1UWKA 4KKXB 4LW8A 1EJ2A 1LVGA 4MRMB 3FTQA 1QRDA 4XCQA 3VHXB 1ZA2A 3BQMB 5MDHA 1XTQA 3AUAA 4CEHB 4Y6LA 2X77A 2QRZA 2HGZA 4GNKA 1G66A 1UDBA 1CDDA 1XX6A 2J07A 2ZAMA 5BN1A 1K0FA 2ERXA 3B8HA 3GLHB 4ND8A 2PUHA 1YZVA 2IHYA 5T6MA 4Q7QA 3KB8A 4WK2B 5B37A 2QT9A 4EB0A 3M5DA 3UM9A 3G0GA 3IQZA 3QMPA 4ZCTA 4JT8A 1RRVA 5UKDA 1GV1A 2Z2KA 3LLVA 2IIPA 5CJ2A 3VDRA 2V5UA 2VEOA 3ED1A 4Y6PA 3C74A 1UJ4A 2PV7A 4R7GA 5FPQA 5E38A 4IG9A 2GCGA 2NYRA 1ZISA 4MUGA 2XT9A 5K6RA 1SB9A 3GFQA 2PH7A 3RD5A 2OCXA 3FJOA 3PEFA 4WZAE 1D4ZA 4X7MA 3V4ZA 3RLIA 5LBTA 2IYSA 4TT3D 2VQDA 1C9DB 2YQ4A 2ZATA 3DV2A 3M0EA 3L0SA 3OJEA 1K92A 5IARA 2WP8J 5K8CA 3PRHA 3TJMA 1DUVG 1Q2UA 3WG9A 1G7CA 1S9DA 2QZJA 2HCJB 3B6ZA 3DPUA 3JWEA 5EWMA 3A1UA 1LB1B 3MK31 4UE3S 1JR4A 2CL6X 2OYRA 2QLBA 3RF6A 3F9IA 1DX4A 1W47A 2A5FA 4L5IA 3C3YA 4OYHA 1R64A 4RQTA 2YY7A 2LIPA 4C6HA 1K2VN 4FKMA 3RRJA 4YV0A 5KTNA 4PHGA 4PGGA 4XTRA 1XHFA 3MC1A 5CFNA 2H51A 4ETIA 3CF4A 2Q2QA 2GOYA 2F6RA 4JDUA 2IQIA 4KXFB 4HXGA 4N8DA 1S01A 5A4MS 1Y1SA 4G09A 3PCRB 1EX6A 1EVIA 3EVZA 4V3BA 1KVTA 1T0HB 3E35A 4PM4A 2BF4A 4ZOBA 2C58A 3T9DA 1G4UR 2YQ5A 1XZCA 4YRPA 3T4PA 5LNK6 5CT9A 1OMOA 4RHTA 4Q3EA 3WQBA 4LZOA 3V4LA 3DMHA 4K26A 4AO8A 1IUPA 4M37A 3L6UA 3JAWB 4RCYA 1QH9A 4L3VA 4Q7MB 1G0OA 2Z30A 2A5YB 1FFXB 1XZDA 4Q48A 3ISVA 2V3VA 3JZAA 3WAJA 3LBNA 3ZUPA 3IAAA 1KEVA 1IQPA 4N1AA 2NU8A 4EBBA 1ODCA 3QOFA 2YHBA 1JPUA 2VYFA 4E5SA 4JC5A 4P8RA 1CE8A 1MKYA 4YJ3A 1ECGA 4DLPA 1EA5A 1Z2EA 1L7EA 2CXSA 5EE5B 3PXEA 2R79A 3VOAA 1KBZA 1P3JA 2PZLA 2GARA 4G26A 1SPBS 1E3IA 1OX6A 2W48A 1VI5A 4QUJA 4NNOA 2QP3A 1KVRA 3T38A 3O75A 4G89A 4G86A 2XGMA 3M6IA 5AOCA 2LCQA 1KZ4A 2GTHA 2VUUA 5I01A 5JAOA 1PTJA 2H92A 1SK8A 1IFXA 1WP9A 3BMQA 4BZZA 5L4NA 3LDGA 3ZWNA 1E2MA 1CY6A 1V1JA 4PQYA 4QJ4A 4RSMA 4XYGA 1CRWG 2G40A 4ND5A 1QLHA 3H16A 4TUYB 3BCSA 3O4FA 5K99A 3Q5DA 3E9QA 1OAOC 2IRWA 4HN4B 3JXEA 2YMQA 4JHLA 4XDYA 4B3JA 4DARA 1T8TA 3H11A 2Z1DA 4B2LA 1XEXB 2HU5A 4QO7A 2P9HA 4TYYA 4MB6A 4QUDA 2CN1A 1Q95A 2UVDA 3G5MA 3D8HA 3NMUF 1XDBA 3ZJ4A 1PV1A 4LF7B 1EFUA 3KRTA 3IJ5A 2ZJ2A 3MW8A 4N41A 4AXXA 4D9GA 4RJTA 5FBLB 1XGKA 3DCNA 1HGXA 1J8FA 4RVOA 3RTAA 3WIDA 3C4VA 3KDPA 3QU7A 3S27A 3FHJA 3GFBA 5DP2A 5K51A 5BPFA 1YUMA 1X0XA 4RVUA 5IC6A 4C05A 1X1TA 2I4LA 2WF7A 2PKWA 5JZVA 1C7ZA 1KK0A 3T5GA 4W5OA 1BVYF 1EHIA 4HH3C 4ITRC 4JMPA 4XSGA 1NP7A 3EEBA 2HR1A 2AOTB 3D0RA 4X60A 1GG8A 2AD5A 4DMFA 1J25A 2D2XA 4QQRA 3ZKWA 1RJ9A 3HZRA 4FFDA 4DIEA 5DXFA 2FOLA 3DE7X 3Q3HA 5A4DA 3DAYA 1UH5A 1EGMB 2Y2UA 1YH3A 1W48A 2JBHA 2WWHA 4Z99A 4ARBA 3PKIA 4BZXA 2X7JA 4ZT7A 4NPAA 3NCTA 1NA5A 4NEQA 2XUJA 4OFBA 4Q24A 4Q3AA 2IY7A 1Z6AA 4MVYA 4YLGA 4CFZA 3LTNC 3QNMA 1TZKA 4RLHA 5L51A 4PLCA 3VKGA 1M1XB 1VKHA 5H4GA 2B69A 3ES9A 1G0NA 2CJWB 2J85A 2OCAA 4ITUA 1ZGGA 5A0VA 4J2OA 3BWYA 3ST7A 3QVOA 4ZOAA 4ZU1X 3B89A 3PQ8A 5DBFA 1XQYA 2CLHB 3AEUA 3DZJA 6REQB 4MDFA 4C7KA 2BMDA 4WZAB 2HNAA 3ORRA 2FVYA 1JS1X 1XRLA 5DNWA 5SZHB 5JNTA 2FG7C 2IYXA 3F8SA 5IT0A 1TVMA 1Z18A 1GRQA 4IPTA 4BJ1A 1JIQA 3M81A 2XNSA 2OAGA 4Q01A 5EINA 3TZHA 4A2PA 4B4WA 5HKKA 1U0SY 4QSHA 4Q4AB 5AOVA 3PSHA 1KERA 3LTEA 1KVUA 1TVKA 4EUFA 2HXSA 4R54A 1OWLA 5TF4A 1QXSA 2R6JA 2G77B 3EXIB 3QY0A 1XSEA 2Z2IA 4F85A 4BBPA 3A1WA 2Q9BA 3CF0A 2WJ4A 2X0NA 1PWHA 1RXUA 1B16A 2HWYA 2GVDC 2P77A 1Z12A 1TTHA 3IOEA 2FI1A 4I9UA 1WG8A 5JS2A 5FDFA 4S1NA 3O2NA 2NYVA 1AGNA 4F86A 6ADHA 2G8LA 3ETDA 2FN8A 3EWAA 5DVZA 1COWD 3SG0A 1PWZA 2NXNA 2DG2A 1RHKA 3JQAD 1A0OA 1J9EA 3KOWA 3WFIA 4E12A 4ER7A 4ZYUA 3ZYCA 4PLPA 3IB6A 3OLVA 3Q5EA 4B7UA 4MK4A 1H9AA 3D81A 3NT4A 2CNBA 3RUFA 1PVOA 3I9OA 1QH8A 1LVUA 4MWSA 4MYTA 5KJEA 2Z2ZA 2QT1A 4FOTA 3TLJA 2FPPB 3B1JA 2DM6A 3IVAA 3WQSB 3D31A 4AJOA 2CLSA 4B6JA 5H3CA 1VMIA 2Q3HA 3O1LA 5BYBA 1F06A 3OPVA 4I1IA 4RF5A 5AHRA 3A1CA 2CYAA 4JGIA 4X94A 3NM5A 5KTTA 3ZDBA 3DE4X 3RSCA 3T5MA 3ZXSA 3R24A 3HXOA 1ETUA 1Z4IA 3BK7A 5JZOA 1U0FA 3NV7A 4M7WA 2PX8A 4ZN6A 16PKA 3SYNA 1KRWA 1XV5A 2EJTA 1WW8A 2ZT6A 1JKIA 4TLCA 3EWIA 3PIDA 2BW0A 4PZZA 4YJFB 4GXQA 2BHSA 4E51A 4WK6A 1UPUA 2PRYA 4JOSA 3TAXA 4C06A 2VYVD 1MW8X 3BD9A 2GM9A 1GSAA 3IUSA 1CG6A 2QY9A 2R1TA 3BFPA 2OHGA 1NOJA 1FFCA 3DTVD 3W1WA 3MTGA 4ZYTA 5IDVA 2JDID 2VH5R 2C2WA 4R71A 1L7OA 3C7KA 1O2DA 3LFHA 1GUYA 5EEHA 1U7XA 2XB9A 3IAM1 4LV5B 4OKNA 2IPLA 5CU7A 2FPRA 3PPWA 1DQZA 2PVSA 2WDZA 1YQQA 2NP6A 3DEHA 3KUCA 2VXBA 3C8ZA 4M1QA 4R7ZA 2YWCA 5D85A 4OHWA 1IBMB 4LVNA 1X2BA 3TF5A 4TMYA 3DB2A 2VR1A 2C2HA 1A9PA 5HIJA 1VA4A 1AF4A 2NSHA 2Q5IA 3AR4A 5CPBA 3GLGE 5IAOA 5LMNB 3LP5A 5E95A 1N25A 1G2PA 1TO2E 2EEZA 4URUR 3QVMA 2ORYA 3R7BA 2BFCA 1HL3A 3VI3B 1XMPA 1GFIA 4IEIA 3FFAA 3BCUA 4EEZA 3EPRA 1MPTA 3HDJA 3FRHA 4HXEB 2G71A 4WJZA 1XAHA 1K6MA 1UADA 2X13A 4RFSA 2WKWA 2ZUTA 5THKA 3X1JA 3WAGA 1PU2A 5LZ9A 1VDZA 1R0RE 1XZ8A 3DBHB 4UVGA 1F0KA 4TGLA 3L5OA 1N1EA 1CBUA 1OFHA 1Z4LA 2BAGA 1Y8RB 2HUNA 1HTBA 3H1TA 2OYSA 3NVAA 3OO0A 5LR6A 5BVGA 2NU6B 4HR7A 5EIFA 4RSHA 1QFJA 4PG5A 3ILVA 1QHEA 4QBKA 3H97A 3NHMA 4LPKA 4NZOA 3UKOA 1DU4A 5JAHA 1SOUA 3HC7A 3TZLA 1XF9A 3KE9A 5FBRB 3DLBA 3V1YA 4RDHA 4LBWA 5FWXB 3K9WA 4E2XA 3IEUA 1XBTA 3JYPA 3OQMA 1HYQA 3JARB 3R3ZA 4JFRA 4ND4A 4OFZA 5CIWA 4EX6A 2P62A 1QVRA 4YUZA 1KMIY 1S8FA 2PY6A 3EGIA 3LZCA 1XNGA 1OXKB 1XAJA 1ZL2A 4LXHA 4O4JB 4UNRA 2FWPA 3A11A 3UUFA 4R2JA 4WKBA 2XYGA 1B2LA 4XDHA 1R3UA 4L2IA 3RTGA 1OXXK 3QTBA 3Q2OA 4FEGA 4YMIA 2AJ8A 2DKNA 2J9RA 2XMQA 5HF8A 1Y6GA 1L7RA 1IQRA 1C0PA 1JHPA 1UZLA 5A3VA 4JQSA 3F3MA 2ZWIA 2OHOA 4GI5A 3Q5GA 4NK4A 5AJVB 1ONSA 2BEJA 1SIBE 4DJDC 1S9HA 3TOCA 1L8AA 4MVXA 4RTRA 5DHTA 1FUIA 4JJAA 1DTEA 4FYKA 3RWOA 4AO6A 4H7PA 2WFLA 3UWDA 3LUFA 2FEKA 1JEJA 1UK6A 1VIMA 2Y3IA 4L15A 4ZQGA 4CIYA 1NUUA 3BMCB 3ZD6A 4G6ZA 1TEHA 5HM8A 2ZUCA 2GASA 4R05A 4ZEOA 2CXOA 5BYJA 8ADHA 4A82A 3UTDA 1KSGA 4MMXB 5A71A 4JT9A 1JR2A 2BKAA 1DWPA 3QXJA 4I99A 2DHRA 1XZNA 4E5NA 1UJ5A 1TF5A 1SXGA 3HKBB 5DJ5A 4BEVA 4NVRA 1R5BA 2PX3A 5ILGA 1M34A 2JFZA 3WJ2A 4IV8A 4PO8A 1QIDA 2G9UA 3NONA 5DNYB 3ZHCA 1LI7A 1IL0A 4GP9A 4DTCA 2IHTA 2XHZA 3TVDA 5D1HA 3AERA 4TMXA 1GTL1 1YHZA 3WSTA 3LLUA 5JYCA 2HBQA 4S1TA 5AKGA 5P21A 4M8SA 4XQ0A 5L4SA 1DIAA 2ZVPX 5IT4A 4FGZA 2EIXA 3GGPA 4IMIB 5DM1A 2VRWA 3ZX4A 2P75A 5TGDA 3USES 3SSNA 3WDKA 2WB2A 5CT6A 3B7WA 1YSCA 3EMBA 1FYXA 1TM3E 5JDCC 1M8JA 3P9PA 4NNPA 4YJGB 4RKYA 3A4YA 2ZKIA 3JQQA 4HT3B 1SOVA 3VSEA 3G1WA 4DQDA 2ZIEA 1T9HA 4BV2A 2V8BA 3VNQA 1YA8A 1KJZA 1RI4A 1D9XA 4ICIA 1FIUA 1GCIA 5F2OA 3V4SA 1VL8A 2WM2A 3OKFA 5K09A 1JEEA 1K5GA 5EJAA 3TCKA 3DEIA 2XCUA 3BXOA 1JDBC 4M1YA 3ETCA 1YBHA 5TS2A 5KPDA 2H5EA 1L5QA 2WJVA 1ZH4A 4AJPA 2DECA 5BSVA 1K4KA 2G9RA 4BUCA 3VA7A 3BIWA 1JMVA 4MW7A 4AUKA 1KYYA 1ZJ6A 1JHAA 3HV2A 4KI0A 4JNCA 3PXBA 4KE6A 3KELA 5LL6P 2AZXA 1GWNA 4XVQA 1ZDMA 2EWWA 3MJFA 3R74A 1AKVA 1PR2A 2XZTA 4NZZA 3R3WA 1LPNA 2ORWA 5JD5A 4BXOA 2CL7X 1Y5LA 3W7VA 2HU7A 4D0NA 1E0JA 1FVOA 1NSFA 1SUCA 1TK9A 2IYWA 3P94A 2O8FA 4ZOCA 5FBWB 5CXXA 4DABA 2WTAA 3GVXA 1V11B 3G13A 4ZOLA 2Q4OA 1AM4D 2QBYB 1PIWA 1M2NA 1BMFA 3CUEF 3DBOB 3SP1A 4C43A 4KO3S 2I1LA 3FH0A 1NZFA 1Z6QA 3MB8A 1TCVA 3GLGB 3KEQA 5EJ5A 1A8QA 1I2AA 3FXAA 3OQJA 5BSFA 5BWBA 2FN3A 2YWEA 3LKZA 2LTAA 4ARSA 1X80B 2G9ZA 3D3QA 3KXDA 4G0OA 2A9JA 5FH9A 4YR9A 3W5CA 1C4KA 1IBKB 1JB9A 4FSDA 3FYUB 3A04A 1JHZA 3I3OA 4HX2A 4IMPA 4U2EA 3TPCA 4CL2A 2FZCA 4H31A 5K3FB 1UANA 5KJ1A 2OCDA 3LYHA 1YVPA 3B3QA 2YINC 5LZ8A 3W34A 1GITA 1NVVR 5FA5A 4YPOA 3C2QA 5BY2A 3FUTA 4XLZA 4L3OA 3VZPA 5LQCA 1RRPA 1RRMA 2H1CA 1UP7A 2QGZA 3DO6A 3WR5A 3CW8X 1Y48E 1HNXB 1EFHA 1IN8A 3MWKA 2V6GA 1NXTA 3B52X 1AZLA 1SRRA 1ZA1A 3DBLA 4YCJA 5JJKA 4C7MA 3GRZA 4CN9A 1ZD9A 1SG6A 5CA0B 5EMLA 4A6EA 4LQCA 1WB9A 1H2WA 2FLKA 2C9CA 1W44A 2HH9A 1GGMA 5EHIA 5AVUA 1UUFA 1KXZA 3R3XA 1SB8A 2NOAA 1J2RA 1OLUA 4II2A 3MSCA 2D1FA 1RCUA 4XPIB 5HJ7A 5KX5B 4AZ3B 1TX4B 3FAZA 2C4KA 4PAQA 4I5DA 4FD3A 5B12A 3KWJA 2W43A 4FZ3A 2FR0A 4NFLA 4YT5A 4BLSA 3R0ZA 4B3DA 4B6GA 2C99A 2GAFA 2JEZA 2G0AA 2UZ1B 4BGIA 3ITKA 2ZDGA 4WNCA 3G7SA 4YXWD 4M0KA 4OHVA 3EXEA 3COJA 5DSZA 2C5LA 2WNSA 4FN4A 4C3OB 1IZ8A 1R9MA 4XUGB 2FMIA 2WT8A 3DUFA 1SJ9A 3U7IA 4FQ5A 4N3GA 1U7ZA 2GT1A 1BN7A 2PN1A 3EBPA 3INGA 4KBYA 4HZGA 3EA5A 2WTUA 1B3RA 5AXBA 2I3ZA 5T41A 1T8WA 5BQ5A 2DSTA 4UPVA 3O9ZA 5C34B 4E4TA 5JAUA 1KNXA 4JQCA 4HMQA 1YL5A 3F96A 4LY9A 1GNPA 1Z36A 2FN9A 2JS7A 3AF3A 4NX2A 4PNHA 4PYNA 3RAEC 4BJ5A 2I7CA 3Q72A 1P0QA 1MC1A 4HGYA 2WD7B 3FPAA 4OIFA 5C32A 2XAUA 3JASB 3UT5B 2H8KA 3AL0C 3Q88A 1D1QA 4BEJA 3CUTA 4P7FA 1LK5A 2D0PB 3M7IA 3O0DA 2AG0A 1RNLA 3LK6A 4MUKA 2F3PA 3DV0A 1VCMA 2XGOA 3EXFA 4XGQA 4CL3A 3DCYA 2X2FA 4QBTA 4UBOA 1KTVA 1RXSA 3VUFA 4CGZA 1VB3A 1FFWA 3GT7A 3ZE2B 1DQPA 3BDVA 3WHKA 3NBFA 2JARA 3GAAA 4Z4QA 1OWPA 1BW9B 2PH5A 3IJPA 3PRJA 3U4QA 1U8CB 2QIPA 3AEZA 4I1OA 2AOXA 3CTPA 2WG2A 3FRIA 3I9LA 1ZL0A 5EIBC 5F5NA 4EJSA 1DJPA 1A9XB 4EHFA 2HPVA 1YCFA 4FONA 1IE3A 1NKVA 1Q20A 3ESBA 5H70A 1GIAA 5GGXA 3TZ6A 1FLDA 3C45A 3GZTB 4GM4A 3TJZA 1Q0ZA 4FDMA 4U39A 1JXQA 3AFNA 2J32A 4A0RA 5I7EA 2WJJA 2DCUA 2W6QA 3NDBB 5EKUA 2BL4A 4PRYA 1Q1NA 4V02A 5D5HA 4REMA 3Q9SA 3B3FA 1QB8A 3N3AC 2A5LA 3JVEA 2XLBA 1UBHS 5A03A 1DMSA 1XRPA 2B1IA 2EJBA 4D0SA 3IQEA 3VR4H 2CZCA 3IEXA 1Q0RA 3UWPA 2JIDA 3N0TA 4ES6A 4EUHA 3RS7A 4WKGA 1L5NA 4HDNB 4C6SA 4J9VA 1USIA 4G0MA 4ENPA 2HO5A 4PZ0A 5K45A 1PAUA 1R8SA 4A8PA 1CNMA 4JK3A 2NU7B 1WVIA 4K9QA 5SICE 1EG2A 4GWLA 3U60B 2FQXA 1YQ9A 2NV0A 1TNDA 3D3JA 2R7AA 4Y6SA 1XRSB 4ZIRA 1UBRS 2ORVA 4GPIB 2HA7A 4LJKA 2AV6A 1NATA 3OEEA 4HNHA 4O2AF 1OV6A 4WEQA 5EJ6A 3D7LA 1K8QA 1Z6XA 2P5YA 3E9DA 4I8XA 1QC5B 3WC4A 2YIJA 4IQGA 1GL7A 3ZY2A 1WXGA 1W96A 2QX6A 1OAKA 3H1GA 4DZZA 1EFKA 3GCZA 3Q2IA 2WI8A 1J0CA 2G1UA 3K8OE 5J58A 5DF1A 5F5LA 4DLRA 5CA1F 3E81A 2J30A 1YJ8A 1YRQA 1SA0A 1WDMA 3N2KB 4DHWA 3E18A 1E7YA 3I04M 1H4TA 4MR9A 4JODA 4BE7B 2PUTA 4XE5A 1PJ8A 5FOWA 2EHJA 2XB6A 4ND8B 4P6VF 4A7PA 5K0CA 1XA4A 4JC4A 1N9GA 2IDZA 2WU0A 5IXSA 2VSYA 2NG1A 5CTJA 1KP3A 3DBRA 3PR3A 4KR6A 2AI1A 1L1EA 1TDJA 2BHTA 2GTIA 3I2FA 2JBAA 2XTAA 4HVAA 4V2UA 4DXHA 2C42A 2Z9CA 1HR0B 2O8BB 3ESRA 5BSRA 3TRDA 3JRXA 4IJMA 3B5EA 4XI9A 3WXBA 3O8CA 1ZJWA 4HZUA 1F9AA 2GZDA 3OT1A 4R4JA 4RE6A 4FFWA 3GI1A 5J4VA 1U3FA 4NQZA 4QQKA 4K6OA 3TQHA 1QTRA 5FFNA 4LXXA 3BULA 4OUDB 4OATA 4F3KA 1WDWB 2EF1A 3V1LA 4RD2A 2R4UA 5LXTB 3C43A 3RRYA 2PQ2A 3NZEA 2WK1A 5CJPA 3QG1A 1QHIA 1P1IA 5BYAA 2ZJ0A 4EQ6B 1V8PA 4RGVA 1RTKA 3G7NA 2I2FA 5B53A 1QH0A 3SS9X 2FVXA 4GMKA 2GYYA 4JLAA 2FE4A 3OPQA 3QFCA 5CHEA 5E2IA 2M6LA 2OQVA 1WBDA 4AJEA 1ABFA 5GOTA 3VOSA 2QGFA 4RZUA 5ERGB 1E0DA 4A2CA 4U2GA 3N6VA 3W5IA 3DULA 1Z82A 4FI3F 4DLLA 2BDUA 1JLSA 2FEAA 2JGMA 1T0PA 3R5HA 1VXOA 5ALZA 3ROQA 2OZVA 5DXJA 2Z08A 3WNZA 4C9BA 2REBA 1UWVA 1PQYA 1DG9A 4FXPA 1WNFA 2HI0A 1VPLA 1VLJA 2ZWOA 3O74A 4R0NA 5DWVA 4BKQA 3W7BA 3UXYA 4V0LA 1XA3A 4PZYA 4QULA 4WCVA 4H0FA 5CFMA 3MWDA 4FR2A 4X8HA 3HJUA 2GZRA 4M8LA 2NU8B 2FPXA 4ZI5A 4PIMA 5B2FA 2DWOA 4XWOA 2R2GA 1CE8B 3KAQA 4YJ3B 3IDOA 2CMGA 2JJ1A 1YFLA 4HDOB 3OEHA 2PRZA 5F35A 4H1VA 2GBCA 2Q5JA 3DEZA 4QYWA 1KYXA 3AF5A 4L0QA 3SSAA 2XT0A 1GLVA 1RP7A 2UZ3A 3LK7A 5EP1A 4Z0TA 4E5VA 5IVKA 5E1MA 5L53A 1XVAA 1ZJYA 2PJRA 4QFMA 4W5RA 4U4AA 5FHRA 1EGQA 1G8SA 2V58A 3EDYA 3IBTA 3UB4A 4JOBA 2QRLA 4G1UC 3BMQB 3GIWA 5L3RA 3HKEB 1IB6A 2OENG 3QVJA 4E2FA 3G6KA 3TBHA 4D57A 4P5PA 1Q12A 1IM8A 4IO0A 1NBWB 3HJNA 3NJ8A 1SZPA 2FFBA 3FGNA 3KQWA 4F97A 4DR2B 3PJGA 4W9NC 2H4YA 4OGFA 3H11B 4PC3A 3DB1A 2ST1A 3LKVA 5J5AA 1P0PA 4GLOA 4WJLA 2ZIGA 1CJKC 4G9GA 4BQSA 2DY0A 1SOMA 3DS8A 3P9ZA 1NASA 4J76A 5G4LA 2HNKA 4KTTE 1QYIA 4G2TA 1KOLA 3KR9A 2CVQA 3IOYA 1L5FA 1L5SA 3I9V1 3C3JA 1I10A 1TPYA 3C5CA 3GO4A 3SI7A 3A6FA 4L75A 3U3JA 2XXJA 1JU3A 1PT8A 5BR4A 3HJRA 4PYMA 3MT0A 1KSJA 4OJYA 3MEQA 4L5JA 4YREA 5KEIA 2B8TA 4HAYA 2GPWA 3L07A 3KTOA 2XA2A 1W46A 2A9KA 1TECE 3KVVA 3RJMA 5EHGA 4YX9A 4C0LA 2EERA 2CJPA 5ELLA 3THSA 3IV6A 2YWFA 4GGPA 4RGBA 1RJ9B 2FSVA 2X40A 4LRYA 4WRRA 3ZKWB 4EG5A 2PUBA 1AUXA 5CLGA 4JI0B 1YRWA 3HGQA 2BP7B 2DMRA 4GPAA 4X3CA 1T8UA 1AS0A 1ZRSA 3UAZA 5HQ3B 1OXUA 1JAIA 2BMAA 1EK5A 3M70A 2YVKA 1GKKA 1Y8CA 4GR9A 4TM8A 3ZCUA 4B8WA 4D4JA 4BAZA 5DTMA 5B3KA 1HE5A 1XQWA 1Z4OA 3K3PA 2R47A 1DXQA 1QDEA 1FUKA 3KV1A 4LY0A 1MGOA 4R69A 4CM1A 2ZLBA 2IGTA 2BGIA 1KI6A 2VDUE 3KYDA 2BFBA 4OGWA 1B00A 1PEYA 3BD8A 3CM0A 1KI8A 2E37A 1SKQA 2EBHX 2EU8A 1GG2A 2ZSAA 3CRZA 4IUCS 4MVWA 4DA9A 4DY6A 5ALRA 4GO1A 1G55A 5AJXA 1LPMA 3IBSA 3MJTA 3VM6A 1JDTA 4Q1EA 1FU7A 1OX5A 1OBVA 1W5BA 3GEHA 3SU8A 3PIRA 3QXCA 1A88A 1J99A 3AEUB 1LPAB 4JKIA 1TEZA 3HA3A 4PXSA 3U1BA 1YHNA 2H5IA 4OM7A 5H5JA 5ITSA 1DAPA 2QMQA 2XMPA 3CH7A 4GDFA 1LDNA 2Q1TA 4TLEA 1FP7A 4Z9AA 4E3WA 4PYKA 3VR3A 1QOPB 2QM7A 3DM5A 5F5XA 1RQLA 3GVPA 1TVKB 2GYWA 2JI4A 3M9LA 1YKFA 1ZGAA 2GHIA 1X0VA 3P5BA 4O4LA 5EHZA 4LOJA 1VFNA 1L8OA 1QHYA 1XOIA 3KT6A 3GWZA 5DE3A 3EOZA 1YC5A 5CFQA 3HJBA 2JAXA 2NT4A 3FUXA 4MLZA 4OHPA 3RANA 1TFUA 4D3SA 4XXHA 1OH7A 4Z1MA 5EFZA 3FNGA 3WJ7A 4MVJG 4JEMA 1WXXA 3C48A 2D0DA 2VJMA 1IEVA 1M34E 2K7ZA 2OGUA 3C85A 2QTNA 1VCNA 1DFIA 1GAEO 3N39C 1GQFA 3C6ZA 3CH4B 3BMOB 3D6HA 3NXKA 4TUYF 1XPRA 4K40A 3R0XA 4D9IA 4Z9XA 2PK3A 2H5JA 1C4XA 2QB5A 2VZ0A 3T3OA 1BFKA 2JAQA 2BJVA 2QG9A 1F8GA 1VE7A 1PDWA 4CUJA 3Q3JB 2VDNB 1TU3A 3UKDA 3I09A 5BSTA 5BUSA 3W5BA 4DV2B 4IEFB 3LPLA 2MOKA 3VH3A 4UM7A 1QH8B 1XDWA 3HN2A 3PHJA 1E1RA 4Y0VA 2PMFA 2G4LA 5F78A 3UEOA 4E6PA 3RC2A 4PYIA 4B9AA 3IEPA 3UT0A 4A0FA 1UXJA 2PX6A 2YV4A 2IV3A 1A95A 3DMFA 1XT6A 3QUCA 5ARDA 4TOIA 5JJLA 3AJDA 3D59A 4G4JA 3LGXA 1GTSA 1IUNA 5CDHA 3COSA 4OXYA 1TQ6A 4GXRA 5TPZA 5C35A 3AB7A 1SIOA 3A06A 3L04A 3PZBA 4BNFA 4RU1A 1MF7A 1P4HA 4LC1A 4CMIA 4G5YA 3KJXA 1RBYA 1KZHA 1DXOA 4C7OA 1USWA 3B70A 3RAGA 5DM4A 5FUBA 3BWMA 3KU4A 4X1IA 5JFOA 2PLWA 3OZRA 2XRFA 1KZGB 2YHIA 4L5YA 5A5DA 5AJTA 2AQKA 4Z7OB 4X44A 1ZMBA 2R1TB 4MUFA 4TTQA 1HH4A 1SQSA 4N39A 1Z9BA 5DW3A 3WYGA 2WUFA 1HRKA 1NQAO 3E23A 5EIBD 2YWJA 1R12A 5FIUA 4DGSA 2X8JA 4LC0A 1CJUC 1GCOA 2Y0CA 3L8YA 4WBNA 1R4ZA 2VLIA 4EKNB 2GPBA 1IJEA 5SV2A 1XR3A 5ALIA 2W6JD 3UMBA 4D3ZA 4CR7A 1EUZA 1UOPA 2PRKA 5LP6C 1GKUB 3OX3A 5LMZA 2QPLA 3D5QA 3PJEA 2H06A 2PS9A 1D1SA 2G76A 1FFSA 5EEGA 4BLPA 2KB0A 3JD1A 4YMWA 2PGNA 2WKRA 4QFBA 4WXEA 2GRUA 2QUKA 2JLRA 3KUDA 5DGTA 4A6XA 4BMDA 4LHWA 1DAMA 2CV0A 5EIHA 4O8ZA 4ZQHA 6ABPA 4TPKA 2Z58A 4JB2A 5IDYA 3U4HA 3AJ9A 3W04A 5KSZA 3OCYA 3U6BA 1PFVA 1EXDA 3LX8A 2CSUA 1NJ5A 2DFNA 3PV0A 5CNIA 2ACEA 2HK9A 2WF8A 4MW0A 4PGFA 1H8HD 4C0HA 4UXHA 2X8AA 2PLNA 3GRFA 2BGJA 3H9QA 4XPZA 1Z0FA 2QW1A 2VNHA 1DC8A 2WYIA 4PSUA 3BFJA 5BVGB 4UTZA 2VKTA 4YALA 4AO7A 1CF4A 3PJDA 1ZOIA 1ODTC 1EGVB 2PGJA 3K0AA 5K05A 3BXFA 2CV1A 2CYCA 2PGLA 3TLXA 3QLVA 2FN7A 3ADKA 4BGUA 4EAQA 5AUOB 5BWCA 9GPBA 4GLBA 5CK4A 1OWOA 1N2OA 1R1DA 2X86A 3GFGA 4U9HS 2W2KA 4UMDA 1IXKA 1FTSA 1NJ1A 1KORA 4OXKA 1Y7PA 3O4IA 4XUCA 4JWKA 4JLWA 3OWOA 4Y0AA 2Z4TA 3DE1X 2ZVQX 2BFFA 4KUGA 5IU6A 5LCXA 3NT2A 3PGA1 1NXWA 1WDLA 3K2EA 1Z08A 4LBZA 1J5EB 4L2IB 1PLJA 1BA2A 1XUOA 2SCUA 3AF2A 2G25A 4UUNA 1II0A 4YJ2F 1Q83A 4AZ0A 1ZM3A 1XJCA 1N8TA 1RYBA 3UXHA 3KKLA 4PQGA 4BP9A 5CCXA 2OG2A 3TX6A 1M6NA 1RC8A 3QIAA 2FPOA 5B7GA 3LT1A 4QUHA 5IULC 1DRUA 4ZAXA 2WMDA 3W9BA 3D6JA 3FPGA 1CQWA 2DERA 2ZTSA 3RSLA 1S5PA 4HEHA 1YFJA 4JZYA 2PCJA 2VBIA 3HJTA 4OQFA 4RTPA 1A3CA 2OHFA 5FNZA 3AUKA 3K8QA 2B4YA 2CZQA 1N4AA 3WIBA 1AOXA 3NNSA 1T9BA 3RAJA 3L84A 2ACWA 3AZPA 4YNBA 1NUAA 4WTOA 3U3OA 1NDUA 4UUAA 2CNKA 1J0BA 2GILA 4G5HA 1OVMA 5K2OA 3RBAA 5B6IA 2ZRBA 4I4CA 1E79D 4MIOA 2IPMA 3LWNA 5FL3A 4I1SA 2QL6A 4JLNA 1W0CA 2BD0A 4KYIB 4HQNA 1G2OA 5C3MA 5CFRA 1V8ZA 2I2CA 4QLOA 1MQSA 3D2LA 3LPCA 1EPUA 2QPAA 3EGVA 1JAHA 5ALKA 4YO7A 3T7AA 3U19A 5IXJA 2OGSA 4FDTA 1VKZA 3JRNA 2BFEA 3KFVA 4DLSA 3AERB 3NHUA 2IS6A 1JTVA 4BIMA 1SK9A 2JH3A 3CVXA 4D43A 3E84A 2GHQA 4CKBA 2B82A 1ICIA 3CV3A 5I7WA 2JLYA 1UJBA 3AEXA 2XSZD 3C5EA 1UBMS 2DB3A 4A2QA 1X8LA 3VVCA 1KY3A 2WSSA 3B5IA 5A3JA 3P1JA 1BA3A 2FF5A 3MQFA 4B47A 4EFNA 3TKLA 4NJOA 4EPYA 5AVKA 4ZTZB 1XCMA 2Z5VA 4M1KA 2JI8A 1Z15A 2D8AA 3QLEA 3WKCA 4LDJA 2Q8PA 2XXAA 4ARZA 5JYBA 5INTA 4IHJA 1O57A 4GUAA 1JJAA 1SPXA 5BWLA 3M6FA 4HVLA 1QO9A 3DEAA 1Q0UA 2DFVA 1XHEA 2JGNA 4C4AA 4CDMA 5BV2P 4B6EA 2ZQZA 2A84A 2HFJA 1SHZA 1KP9A 4E08A 5C8YB 1Y7TA 3OIDA 3EFEA 1SCIA 2IK8A 4OY3A 4Z2AA 1BFDA 1MC4A 1N5LA 3OD5A 4LJAA 1LFDB 1J9ZA 4QUIA 2Y1FA 3KYCB 3VTAA 4AKHA 4XGNA 3I0NA 5A7HA 3NP9A 2YXBA 3MTBA 3IAUA 4TROA 4TT3A 3WGMA 1NLYA 1Q3HA 1QRSA 2DPMA 4Q4JA 3SZLA 3U09A 1EUCA 3Q41A 5DKFA 1T10A 2NV6A 4BXOB 3ZXUB 3DQPA 1JE0A 6PFKA 3I4LA 2IGBA 5T4BA 5JROA 3BL6A 3HTXA 1BCRB 3I34X 4KO1S 4O4JF 5GVSA 1KGSA 1CUGA 2V45A 4KWTA 4ZOLB 1NN0A 4W5HA 3V3KA 2COEA 1R4MA 3EC2A 3ETLA 4E1BA 3N7TA 1G16A 5JT1A 1JH9A 1E3WA 2PMKA 3OHSX 4GWGA 1OH5A 4HSEA 3WK4A 1QDUA 2VQEB 5EUMA 4DSTA 4F2WA 1FJHA 4B83A 2DPYA 3ZDRA 1TA9A 2XRZA 2ZR8A 1VA5A 1GGEA 2J41A 1Q7RA 4XIGS 1XNQB 1PK8A 9ATCA 2VAXA 4D25A 1IHYA 3NH9A 2NTJA 1E3JA 1N6IA 1RDFA 3ZS8A 5D7NA 2YTZA 2N75A 4MO9A 3QVLA 5KTRA 1YBAA 3L05A 1T91A 4L28A 4PFSA 2IFTA 5C7OO 1UBNA 2A88A 2QRJA 3L0OA 5LQDA 3E70C 8AT1A 1J70A 2EVWX 3TRJA 1EJ6A 2IXTA 2OZKA 1JKMA 3PHLA 5JVDA 1QV9A 4R01A 1PR5A 2D1YA 1ZYUA 4MVJE 4NMHA 2MHCA 3E4DA 4DLUA 3RFCA 3V97A 3P7MA 4D46A 2D7DA 2QRUA 1WSWA 3ENQA 3DBLB 4RESA 4BBAA 3ZZUA 3BM5A 2WB4A 4LYHA 1R8JA 2J0EA 4BMYA 1LDEA 1LDYA 3BQNB 2QVXX 3A05A 1XVLA 3IUNA 3IBYA 2BMJA 3QW4B 1TJYA 4N6NA 4BTVA 4HVTA 2ZSIA 1KK1A 4PFKA 4RZ3A 1EVKA 3I5YA 4E2WA 1W7AA 4D9MA 2PGDA 1ODSA 3OE7A 5ITZB 4AI6A 3LVFO 4DLNA 4AY3A 2IXDA 4N5HX 4R2XA 4DBVO 2O52A 4EL0A 3THYA 2C95A 3CPEA 3O26A 1IDOA 2C1ZA 3TGPA 2UU9B 4OHRA 1QB7A 2OILA 2PEZA 4YI5A 1ADCA 1NYTA 4RZ2A 2DVMA 4F5YA 3E2MA 3UAVA 4C29A 4DYVA 1PFWA 1D2NA 3CO0S 5AK3A 1UAAA 2QS9A 1G5IA 1OF1A 5JADA 2YWRA 1YRBA 2ZP1A 3CFYA 3GFRA 4MEAA 4PRLA 4AK9A 1M1NB 1DIGA 1V35A 1DBPA 3DUFB 4ZODA 1EFRA 3TOVA 3E7XA 2C4WA 5CD1A 3NBUA 4RQUA 1ZH0A 1P1CA 5EWJA 3JQCA 1MIHA 1D0IA 1E0SA 1EDDA 3RWBA 1SBTA 3ROPA 4ZJPA 1QLJA 2NQ8A 3H2GA 4OHUA 3MRTA 5EWLA 1PZXA 1IIBA 4X9XA 1RE0A 3DVAA 4RELA 5F3DA 4YV7A 2GBFA 1JEQA 3WWEA 5ETJA 4QXRA 1NXXA 3MG9A 2CJYA 3FCEA 4Y67A 5HS4A 4LRTB 3OFSA 1DV1A 1RZ3A 1JN0A 3AZOA 2AJTA 4LDRA 4M8KA 1DT3A 1O08A 5E3IA 4P3OA 5AWFC 4PGMA 4BWVA 4DLZA 3QENA 2EZ4A 3AK4A 4Y6GB 3IVMA 1T6NA 2WSIA 3LYUA 4DSUA 2O8DB 4H59A 2FHSA 3CE6A 3PF9A 1QYWA 3DKPA 4EOGA 2HADA 4X5OA 2V7XA 3PFHA 1F2VA 3DV0B 3EXFB 2GA9A 4TS9A 3BFKA 3H2BA 1BEUB 5ALEA 4K9SA 4MLDA 2QXYA 4MW2A 5H9VA 2KQUA 5FYQA 2ZULA 4MW5A 4NRDA 3VR6A 1ISHA 4EB8A 4FBMA 4Z49A 3EPLA 1OHHA 1NOKA 3CEHA 1H6DA 4GVXA 3GRKA 3K16A 4X93A 4EG6A 3HVHA 3U4QB 2BTEA 1CUFA 5AVRA 5ISMA 2QP9X 1MUUA 1JWLA 4GECA 5I9TA 1V71A 2HMUA 3LF2A 4UW9A 3V1MA 4TTRA 1CQIA 1EUQA 3IGFA 4UEQA 2I34A 3JRWA 3DPSA 3OZFA 2BFPA 4ME6A 5GIPE 4PRKA 4I19A 2R44A 3O6VA 4QYTA 5T5QA 1K8ZB 1J20A 2N46A 4YAJA 1P5RA 1RYHA 1KDZA 1N77A 5SYNA 1YR1A 3TQIA 1Y6FA 1S1CA 2E85A 3QTLA 4LVOA 4ER6A 3IUQA 2AD1A 2VCHA 3DXFA 4RMNA 5KKCA 4J3NA 2YQZA 4YAEA 2C9OA 4NENA 1QF6A 3M6LA 1G6OA 4MX8A 4DA7A 3LVQE 4FHEA 1ONOA 3A3KA 3WK6A 2HRQA 3JVDA 4LXTA 1Z35A 4FFBB 2IHJA 2WAYA 3S2ZA 3WJAA 4F9GA 3UAXA 4GLFA 1QFXA 5D01A 3K09A 5L3SA 1ADYA 2VVTA 3QUSA 4OUKX 3V46A 1V4NA 2IH5A 4R83A 3GGSA 1X7XA 1AHHA 2E21A 1UMBB 3KFXA 3NVDA 1CVLA 3FVQA 1QIFA 4L16A 2CEKA 5FPHA 3TW8B 3SLRA 4GI1A 3STTA 1T8YA 2P5UA 4KNWA 4AX8A 3OESA 4KVZA 1F3OA 2WIDA 4MTCA 4AKGA 3KOXA 4DLWA 3CIOA 5IJXA 4EYKA 1E7QA 2QR5A 2X3FA 4TVBA 3K1JA 3TQTA 3IR7A 3P97A 3S1LA 3EVBA 4J0IA 4P4GA 1H69A 4H0NA 4JQYA 1SA0B 1QIKA 2EKDA 2ZR7A 3GDOA 3ANMA 1NQTA 1J8MF 2O0LA 3R3SA 4X8LA 1NXVA 5FCDA 2UUAB 4QECA 2CVPA 1AQYA 3JYHA 1C9JA 3ZV7A 1RYYA 3V6MA 1JHMA 4B8YA 2CL0X 5HOQA 3R7WA 3KYJB 2R8ZA 4QOSA 5COQA 3K9HA 5E4TA 5F2EA 2N42A 3HFSA 1EE2A 1R4AA 3BSWA 3GCGA 3L0CA 4OMUA 5LJIA 3B1YA 1EA7A 2JBAB 4HQKA 4DDHA 3BYZA 5BW4A 3IIEA 1G20B 1GFSA 1A5AB 5A9TA 5FXMA 4RIHA 1Q6YA 1TVCA 2FN4A 4HZUB 1VL1A 1RI3A 3O8BA 1FE8A 3OT1B 3MCWA 3GRRA 4GP6A 4KK4A 1U3CA 1GGFA 4BVHA 4QOGA 3TKAA 3CEAA 3L4JA 1IOLA 1KJIA 3KD2A 1D2EA 1SU7A 2GPJA 4HDQB 3SNKA 4PAOA 1P2TA 4DLKA 5ENZA 2WIBA 4BU0A 4CETA 2AKEA 2YIMA 2DTXA 4QUGA 1Z39A 1IEWA 4RM2A 3ZE7A 3W1EA 4QT0A 3U62A 1XZLA 3IALA 1VQ1A 1VJ1A 2FGKA 2M1ZA 2IUUA 5HKOA 2VYVA 1EVEA 4AZSA 3C8DA 4W5WA 4YUYA 5JY6A 5HFJA 1V43A 1ELOA 1YR6A 1DAGA 10MHA 2DHQA 2ZUWA 5HBRA 2YN0A 3UCFA 3Q7SA 3W5UA 1GPLA 1Y4SA 3EZ7A 5AI5A 3KUXA 4U3JB 3SHFA 2VTBA 4H7DA 4IIJB 3UGTA 121PA 1OJLA 1OZAA 2VS1A 4F4CA 3K0FA 5LJLA 3ND7A 4Q15A 1Q44A 2FSFA 2BE9A 2GKSA 4NDAA 4N01A 3WGQA 4BMOB 1DEOA 1F2DA 3LOQA 3WP1B 2Q0HA 4L6CA 4NECA 2C9DA 2LGJA 2Q6IA 2BELA 2R00A 3PPYA 3U4DA 3V7NA 4BO4A 5FTJA 2NO0A 3MTJA 1WAMA 3M8KA 1X92A 1U4SA 4PC2A 1P0FA 2RARA 1S3GA 3JQ8B 4YXFA 4LJ9A 3UMCA 4EY8A 3KJIA 5LN1A 5BVHA 4R1UA 1J1IA 2HO4A 3ABOB 3KPUA 4YGXB 2HLDD 5EIAA 2QD3A 3VYWA 1VB5A 5B4UA 4Z4FA 3VSCA 1Z6TA 1DJLA 2FK8A 3O8QB 4P93A 1JPJA 1D4FA 1OI2A 1Z0DA 4ZEVA 3GFTA 2WU3A 1UBCA 2XCTB 3IIJA 4BNJA 3INYA 5HF5A 4AJNA 4A23A 3DP7A 1I3CA 2ZBQA 3KQUA 2Q5EA 4QOFA 2LE0A 4IIFA 4Q0MA 1QHSA 3E3AA 3UF0A 5JC1A 2IS4A 3ZGXA 1Z25A 1OH6A 4EG0A 3NM6B 3IEKA 2YWBA 4K6KA 3GRUA 2ZYDA 3AI3A 3PNOA 4K86A 4BMXA 3KDSE 1GCGA 2HRBA 3MPUA 4M7RA 2RGYA 1AA9A 4A91A 2YBDA 1UJCA 1HQKA 3FFWA 2O7NA 3T5TA 4Q3BA 3ZVKA 3JQBC 1CUAA 1UMKA 2J48A 3RR2A 4HWPA 4HQLA 3RQIA 5IM4A 3EIEA 1YXMA 3KZXA 4Q9IA 2V54A 5CK5A 4YRRA 3SQLA 3STHA 2OXFA 4LRSB 3RG2A 3OE5A 1UZNA 1E1NA 3FF4A 2F17A 4G5RA 4J1NA 4MV8A 4WHMA 4EPWA 1RKBA 1JIIA 2C7BA 1E1YA 3ZHZA 2G4VA 3E15A 1NW4A 1GD1O 3AMVA 2QR3A 4G5OA 1GUFA 5JNUA 4WVLA 1N2IA 1T2FA 3PNLA 3PSAA 4FZ5A 4I55A 4WXMA 3L4SO 5FUXA 4B75A 1U1IA 5J4LA 2ZRJA 2HW8A 1RAEA 3BIFA 3VPGA 3WMWA 5K3EA 2CLLB 3U7RA 4AJJA 1R74A 3WGNA 2WSMA 1ZVKA 3TX2A 1P91A 1G19A 4TN5A 4Y30A 1PW5A 5J2UA 4BQNA 3ANYB 3I39X 2OB1A 3G2NA 2C4MA 2DFKB 4MEBA 4ZJUA 1HT1E 5I7VA 4QEKA 3D4BA 5C7IO 3H5OA 3LWZA 2BI4A 5HJ2A 3RIEA 5A6SA 1H9BA 2A33A 2FP4A 4YCDA 1NURA 2HQRA 4NC9A 3L8FA 2K2QB 4REQA 3EH2A 4CT4B 1FPQA 3ZU2A 1A9OA 1XCBA 1P5ZB 2P9CA 1YC2A 2OOSA 3A25A 3EIOA 2FJUA 4I8DA 3PL5A 4M46A 4EHBA 2PA0A 1EXWA 3GU3A 3SBOA 4FC6A 2Z9BA 4LYAA 2IW3A 4U8GA 4XW2A 4KODA 4F45A 3GLFA 2ZU0C 2Q21A 2IDMA 3PDIB 4W8OA 2F1OA 1QANA 3UV3A 3BH7A 4HP8A 5T57A 4FGJA 5BRNA 3E9YA 1YJ5A 1YZUA 4JIMA 3DL0A 2NTEA 3WB1A 5DHSA 4UBKA 2A30A 3BICA 3L8HA 2NTNA 4DM7A 1ZO8A 3UVEA 3QU9A 2J3HA 1CJMA 2CB0A 3TLYA 2VATA 1M8PA 2ECPA 3W2IA 1RI5A 3UFBA 4TZTA 3RABA 4BNMA 1FEZA 4V0OA 1E2HA 1VL5A 4KACA 4LMPA 4RVCA 3LQQA 4BP1A 1YT5A 4EEXA 3CO5A 4QM6A 2GN4A 1HL7A 4GW3A 2GFQA 2TMGA 1EEHA 3OQIB 4J0HA 5D3ZA 4BFXA 4RZXA 4CM5A 1KVQA 4M88A 3PWKA 2Z3WA 2O07A 4YJ3F 1N9KA 3FD8A 3HSSA 4BGVA 1COZA 1TXGA 2H4XA 4PVCA 5G0WA 5M34A 1UOQA 3T4EA 5CVDA 4QVGA 1AGXA 2Q27A 4O4LB 5EIWA 4RYDA 3SHWA 1BHO1 3ZW9A 4XARA 2BISA 1B3BA 4WXHA 5E4JA 4MMYB 2QUBA 3OFNA 1MIOA 2CXRA 3ZHQA 4CV2A 1TLFA 3B2NA 1S02A 4OH1A 5EUCA 1ZG3A 3SC3A 3FMFA 3K0BA 2PIAA 4FOLA 4UMFA 2I8AA 3FYTA 4XWGA 4CJXA 1QQBA 5M7EA 1IEXA 1H2RS 6GPBA 3NDJA 2BMVA 3N76A 3G1UA 2ADMA 3E5RA 3MJ4A 3M1YA 3QBDA 4WXYB 3OMXA 3VUEA 3ZE1B 3RUCA 5ENDA 3ZBQA 1CY4A 4QNNA 3C98A 3A4MA 2YIVX 2LBPA 2MSDB 4M0PA 5JEEA 1AHIA 1NR7A 2GJ8A 2SKDA 4C21A 1OAOA 1L7MA 1Q0PA 4P31A 4QODA 1X1SA 5IHXA 2YDXA 2NW6A 1PT5A 4KR3A 3F46A 2I2DA 5ICSA 1D0SA 3QW2A 5DASA 1QO0A 2CE7A 3RJTA 3ZK7A 4EGJA 2GRAA 1OWNA 4YGYA 3OJFA 4LDZA 2IP2A 3SHOA 4C0KA 5IVPA 2DCMA 1YNOA 3EPHA 3BD6A 4WW0A 5LUBA 1Z0KA 4NMLA 3UWKA 4BVGA 4DQUA 3FMOB 1LTKA 4CTNA 1ZGHA 3JD2A 4FWIB 2QDXA 5FL7D 3TRIA 4LHSA 3ZVNA 2VQ3A 3PRYA 3ACCA 3TG2A 1AKNA 2VUSA 4MB2A 5CDYA 3T9EA 4QVIA 1LJUA 3FPBA 2DBVO 4L50A 3WBJA 1ENYA 2CKDA 1XXHE 3ZXYA 3CRVA 2O7RA 1QK4A 1UK7A 5AKXA 1TMGE 3LFUA 1YMQA 2WKQA 3TDNA 2HV9A 3UBTA 2YHIB 4A8JC 1HTWA 1JJVA 5CVEA 3ZC3A 5ECDA 5FQNA 1Q1AA 4TXLA 1ESNA 621PA 4WJKB 2ISSD 1JLLA 3C3XA 3PQFA 1PUXA 1SWVA 2X8JB 4JX9A 3WL8A 3T3HA 3EX7C 3Q11A 1V0JA 1W4ZA 4WBNB 4LYDA 5F4BA 3N1UA 2YJ5A 5C7LO 1T4MA 3MUNA 3V7FA 4BNZA 4RD1A 4LE1A 3NHJA 2B34A 4ZZ0A 5KMGA 1U0BB 1KL7A 2PKQO 4JXKA 4GYWA 4NCKA 1EB8A 3ZI0A 3IEMA 2B5VA 1AIPA 4CT5A 1ZM4A 5DYIA 3VU0A 4BFCA 3QEMA 1OTYA 1R6VA 2WT9A 3CUYA 3L93A 3LPNA 4O1HA 3SS8A 2V55B 5H3HA 3W8EA 2PGXA 5IG2A 5L4LA 2CSXA 5AICA 3GZ4A 3RFTA 1RRFA 1KETA 4KFRA 1Q3TA 2BFMA 3KHUA 3QU4A 1MH9A 2JF0A 2ZS9A 3GOQA 3P0IA 2HRCA 3DT6A 4JL5A 5AVOA 3WP0A 4ZDIA 3ZZMA 5BV0A 1EFPB 1B7GO 1RJEA 3LOUA 3I9JA 4MHOA 3K6KA 4UXJA 4ARVA 1V5EA 1C41A 2ZSUA 2NSYA 2HY7A 1OE0A 1C8BA 1AKQA 2ONCA 3K5WA 3NAZA 4UUPA 2QIOA 3S55A 3U9TA 1SXQA 3EOAI 1RHMA 4AECA 1P6QA 4RETA 1P0IA 1R2QA 4RE5A 4EPRA 1Y3IA 4MRRA 2CFIA 3K0AB 2MSNA 2JLUA 4UBIA 1LLFA 3KALA 3BXHA 2Q6OA 4QQFA 4B76A 3JAKA 1UL1X 4J07A 7REQA 1LDMA 1TAGA 2H0RA 2H9YA 3QKWA 4IGIA 5A5FA 1JH8A 1R8XA 5IN4A 1UT8A 4H3HB 1FFHA 1L7XA 2LV8A 3KSAC 4P08A 4PLWA 3Q0TA 3PKZA 1BWPA 2BYTA 2BGNA 4QUEA 1NPDA 1IJKA 1ANKA 3LP8A 5LD2B 5D87A 5BR7A 3TOZA 1D2RA 2WW8A 3LYLA 4D44A 1ZQ1A 1S2DA 1NBIA 4MVJH 1WS6A 1XK6A 4EI8A 1NX6A 3VR5A 3J7AC 3RHFA 2VF8A 1Y63A 5EXXA 2E18A 2K4MA 4DCOA 4PC1A 2XCSB 3KR1A 2KYRA 2IYOA 1S4MA 4B82A 2P69A 4CF3A 4F8JA 4UJ3A 3ZGLA 5LM3A 2IKSA 1WCIA 3JWJA 1V26A 4M4SA 1W5SA 1CLEA 2FPIA 3F3KA 1KPGA 1Q0HA 1RLMA 1KQGA 1RPZA 2C5FA 3TCNA 1I9GA 2XMCA 5KQPA 3IAFA 4CDRA 2DR3A 1X9GA 2OY0A 2DF8A 2NVOA 3IQXA 2KW5A 2ZSEA 4KOAA 1UEJA 4J90A 4Q05A 4M9SA 2ZANA 1T3GA 4JI5B 5LQJA 1AV6A 2OWEA 3OQHA 4PONA 3QWAA 4UJ5A 5LQRA 3O4VA 4QTXA 2YXNA 2AQHA 3IBGA 3L2OB 4YRMA 5AKYA 3FPKA 1MV5A 3LOPA 5B1SA 4LJ7A 3U3ZA 3GCDA 1YTLA 4EW6A 1M8KA 4PN7A 4O4IF 3GC6A 2ZBGA 5AK6A 3CLTC 4ACAA 4QG3A 3RGWS 2JI9A 1MZVA 4QU5A 3L8EA 1UKAA 4E14A 2NZXA 2Q7OE 4MWZA 4E22A 4MS1A 3ZDZB 5M04A 2JFBA 4CI9A 1CR1A 1T3LA 3LC7O 2BFEB 3A1NA 4HB0A 2EZTA 5L3ZA 5IDXA 3GFFA 3BC1A 2P0EA 2FMUA 4C04A 4TTJA 4BE4A 5BNZA 4XLLA 3FPJA 3DKRA 1TUIA 4P54A 4CFYA 3T5BA 3GBVA 2C78A 3HUEA 2V03A 1H66A 2R66A 3FI0A 2X3UA 2OHJA 2Y1WA 3AM3A 4B8ZA 1Z5PA 4BNIA 2A67A 4FCWA 2UVPA 5IPFA 3WMXA 4OP3A 2W11A 4IQ8A 3W05A 4Z53A 4QQNA 1CXZA 2A9PA 1W581 4PVDA 4QFDA 5TX7A 5EMKA 2F1RA 2A5GA 1ZMTA 4V0NA 2XXAB 1PNTA 2ZCVA 4IHJB 3AR7A 3TDKA 5HXAA 2P9QA 1N2GA 2H54A 2W2LD 1CDEA 1KYVA 3ME5A 4TS1A 5K7SA 1NJ8A 4ECAA 5IZCC 2WPDD 1K2WA 2VPIA 3ZE6A 2H18A 3NB0A 1TUGA 2J46A 2CZGA 5FQOA 4ZDJA 5HR5A 4JLJA 5CMLA 1L4FA 3E9RA 4G0YA 2AUMA 3AXSA 3V80A 5ULLA 1GGHA 1QAMA 4MV5A 3E3LA 3VOTA 3OP1A 1KAMA 4YVFA 5TB5A 1F7VA 5BMOA 2UUOA 4O4HA 4RMJA 3VH1A 4F46A 3TTTA 3QWIA 4FYVA 5J2TA 3EEFA 4Q4JB 2X15A 2B7LA 2FPMA 1EUCB 3JPYA 2TECE 3T1YB 1LDBA 5U4XA 2OXTA 4YQFA 4B48A 1U4OA 1F8FA 4UHHA 3THWB 1WMBA 3ZWMA 5BN3A 2KM1A 4PG6A 2D1RA 1Z8FA 2P4HX 2Z04A 1RHRA 4CR6A 2QQ0A 2FDCA 3C3WA 4PZEA 2P65A 1LF5A 3BSYA 3QPWA 1UBEA 1EJ0A 1Y81A 4YPVA 1N7HA 4QC2A 4RTSA 1J56A 1E3WB 3GH3A 2ZSKA 3Q98A 4UEWA 1BIFA 3HWSA 4NK5A 3ZHYA 3A4IA 4GPZA 3TL3A