3GLXA

Crystal structure analysis of the dtxr(e175k) complexed with ni(ii)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
221
structure length
211
Chain Sequence
DTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEACRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVPGTRVIDAATSMPRKVRIVQINEIFQVKTDQFTQLLDADIRVGSEVEIVDRDHITLSHKDVELLDDLAHTIRIEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Decreased sensitivity to changes in the concentration of metal ions as the basis for the hyperactivity of DtxR(E175K).
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Transcription
molecule keywords Diphtheria toxin repressor
total genus 63
structure length 211
sequence length 221
ec nomenclature
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3glxA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 3glxA02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3glxA03
1I6XA 2YU3A 2V1UA 3KP7A 2EA2A 1B59A 1LEAA 2MH2A 6PAXA 1OMIA 4EM0B 1SFEA 3E97A 4HYEA 5EEHA 4RB2C 2K86A 5CJ9A 5DCMA 4ASNA 3E6MA 4GYIA 4F7ZA 3RKXA 5A2QZ 1P6RA 2QQAA 3CLOA 4DNCA 3WG9A 5K1YA 4A5MA 2RGVA 5E8IA 3GFLA 2A69F 3TO7A 2VBYA 3HHHA 1O3SA 4KN7X 4M6YA 1GVJA 5DUIA 2IP2A 1ON1A 4OINF 3I5UA 2IT0A 4ZYGA 1I1GA 4RGXA 1GHCA 2JSCA 4U0VA 5CLSA 2QENA 3WTUC 1MDMB 1H9GA 3J80K 4MEXF 2HEOA 3DQVC 2P7CB 2ZMEA 2CO5A 3DP7A 1SAXA 2MLGA 1MD0A 2VN2A 1JXSA 3QU3A 1FC3A 3GFMA 1ZLKA 3Q9SA 1BIAA 1BBYA 3LA2A 4O6JA 5ILVA 2A68F 2EA4A 5IT9Z 1J7KA 2PFBA 4R8HA 2KJBA 1FYLA 4I7HA 3PQKA 5L3CA 1IXRC 1YQAA 5HS8A 4EM1A 3L09A 3VOEA 4L9TA 1FP2A 3F6VA 2NRAC 1I5ZA 3MQ0A 4G8XA 2DTRA 4ZYHA 2P5LC 2IVMA 5FGMA 5CVRA 3C1DA 4KMUX 3GFIA 1SMYF 4U88A 4KT5C 2RVCA 1IXCA 1R22A 1IN5A 2PMHA 5HDNA 2ZFWA 1OYIA 2LDUA 3GVAA 5FFXA 2XHKA 2RQPA 4HF0A 2DPDA 1BI3A 3R61A 4RAZA 3I54A 3HOSA 3E5QA 3FMRA 3TO9A 3CTAA 2HS5A 2EK5A 2PQ8A 1KQ8A 4CO8A 1B1BA 2OQGA 2OBPA 4A2UA 2M8EA 3E5UA 1XGNA 4MTEA 1K78B 5HLGA 4AVPA 2A5YB 2KRFA 4EV0A 2NNNA 4B09A 2W85A 3RIRA 3HTUA 2V6CA 3W6KB 5D4RA 3DPLC 4OIOF 3FXQA 3MFKA 4IPAA 5CVIA 1B9NA 5E8GA 4KIBA 3C3WA 3L00A 3TGNA 1Z1DA 1T38A 3U9GA 5LEJA 3SZPA 2HKOA 3JAMK 2XKPA 4IHSA 1E2XA 2EV6A 1G6NA 3RYPA 3R0JA 3U1DA 4LGWA 3R4KA 2Y48A 1LNWA 2EV5A 2PG4A 3SFZA 5E1ZB 2W25A 2VOPA 4LB6B 3T8TA 1ZG1A 1CF7A 1V3FA 2K4JA 1MZBA 1I27A 1PDNC 4YIIA 2Y75A 2G9WA 1RI7A 2FRHA 2PJPA 1SD6A 3GO5A 4U7DA 5F6FA 2FA5A 1BI2A 4LFUA 3V7CA 3RPUA 2VBZA 3G3ZA 2VE8A 1C0WA 2ZNYA 4KN4X 3WE2A 3BJAA 1DDNA 2GA1A 3KEOA 2K7LA 5ILSA 2WTEA 3K9TA 4BAYA 2WWYA 1XSXA 2NYXA 1BYMA 2FNAA 3BPXA 1AOYA 1O3QA 3V7RA 3LAPA 1S6LA 1W7PB 4OIQF 3BJ6A 1SFXA 3K1PA 2TDXA 2R7DA 2AXLA 4JK1X 5L3DA 1FLIA 1JHHA 2X0LA 1USTA 3BP8A 2PN6A 3KP2A 1HSJA 3RYRA 4CXFA 3DV8A 4UXNA 2UXXA 2MC3A 2DAOA 1P4XA 1FPQA 2FNPA 3ROUA 2KKOA 1IRGA 4QLCU 4HQMA 3SZTA 4ENKA 3ZN1A 2AS5F 4ZZLA 2ESNA 5DCFA 1K7AA 5K5OA 3KZYA 2E7WA 2KJCA 3RDIA 5BQTA 1BN5A 2VE9A 1G3SA 5AIPA 4DQ2A 3K0LA 1QZYA 2YR2A 4KIFA 1K78A 5ICEA 1F5TA 5JFRA 4M72A 3L2CA 2XV4S 1GXQA 4R1HA 3IKVA 3IL2A 1KYWA 3EDPA 4GXOA 1LDKB 1WQ2A 4G7OF 2P5VA 2LF7A 3BROA 2NAZA 3GZ6A 3RI4A 1B9MA 4XLNF 1D5VA 3I59A 4EVIA 1XSVA 5D8KB 2XVCA 3S2WA 2KIFA 2M1BA 1CF7B 1PUEE 3P9IA 3CUOA 5FD6A 1LQ1A 3K2ZA 4ESJA 2GIVA 4HX7A 2OZUA 4L9JA 3KETA 4M9ZA 1QVPA 3ZMTA 3TOBA 1W5SA 3VEPA 1KU7A 4M9SA 3F8BA 4YFXF 1G3WA 1D8JA 4YFNF 1OYWA 2F5CA 2KIMA 5FFZA 3T0YA 4MTDA 5D4SA 1R7JA 3M9AA 1G4DA 2O6GE 2CWEA 2VOOA 4RAYA 1RUOA 2D45A 3WTWC 3KCCA 1KGSA 3FM5A 2DI3A 2HQRA 3I58A 4XSZF 3VFZA 3GFJA 4HV5A 4LLGF 4L0YB 4A12A 1QO0D 3O6BB 3M8FA 2STWA 4EMSA 2B0LA 1ZRDA 2CFXA 3VB2A 2PEXA 3NEUA 1R00A 1KYZA 4KICA 2CQKA 3GZ5A 2L02A 3C18A 4L9VA 5LEKA 4WXHA 5D5UB 1F9NA 1ZHFA 4S04A 2X4HA 2HTSA 1F1ZA 4RB1A 3ERED 2VBXA 4GGGA 2CG4A 3BPVA 3I53A 1FYKA 4UVAA 1CGPA 1J0RA 1WKMA 5TJJA 1HW2A 4BHCA 3JSPA 2EFWA 5D5VB 3LQQA 3I0TA 2OQRA 3LA7A 1WRJA 2FMLA 3QAHA 2V1XA 3WGIA 1XDSA 2PLYA 2A6EF 5HS9A 4XSXF 2HYGD 3B73A 4UV9A 4KNYA 5HLIA 5E18F 2Z5UA 3WTTC 3WGGA 3T1BA 3E3VA 5JI6A 1YW8A 2XUBA 1GXPA 1OKRA 3HSRA 2O3FA 2NS0A 4ENJA 1XGOA 3FF5A 3TDUC 2QQ9A 3GEZA 1QW1A 2EFQA 3IRRA 2EJRA 1FX7A 2IJLA 2OD5A 1TQMA 3ZQ7A 2Q2EA 4LG0A 4I01A 3E19A 1HBXG 4G7ZF 3DEUA 2YX7A 5CYVA 2Z9OA 2YPRA 2PMUA 1F4KA 5DCMB 1YTYA 4Z2YA 2DK8A 4AIHA 5J8CA 4M73A 1HW1A 2FF4A 5LRSA 4EGZA 2K4BA 5LGNA 1HSTA 1FY7A 3HRTA 3P9KA 4ESBA 2P4WA 2W57A 4FX4A 1S29A 4RGSA 3F23A 1PP7U 1IN6A 2QLZA 5HDKA 2E1NA 4LLNA 1YS6A 4OIPF 2QVOA 3D5LA 3HUGA 3MEXA 2FQ3A 4KIGA 1YFHA 3N4MA 3O3KA 2ELHA 1W5TA 4HZFA 4L5IA 4PCQA 3GWZA 2OU2A 3ZMZA 1HKSA 3LFKA 4MGRA 1B6AA 1LB2A 5ILUA 4P55A 3BY6A 1FBUA 5FO5A 3I4PA 2IRFG 2O0YA 4I98B 3KEQA 1R58A 5AIQA 4A6DA 3FZVA 3O2PE 2ISYA 2XAJA 1U6GA 5CVUA 4KMFA 3CO7C 3QRFF 2HR3A 5LGUA 3FXUA 2BV6A 2D1HA 1K79A 5BPIA 3HSFA 2VXZA 4L18B 1R36A 1IN7A 2O61A 5LBQA 3QU6A 4WF2A 3W6JB 4LG0B 3JAMZ 3GF2A 3HRUA 2VBWA 4NQWA 2ESHA 1T2KA 1YS7A 2LNBA 1FWZA 2COMA 2IA0A 3HSEA 4BXUA 2HFHA 5ERIA 4OU0A 3LQRA 4BH9A 4FX0A 4UHTA 3FMQA 1TLHB 2OA4A 5BMZA 1L3LA 2V9VA 3WTYC 5E20A 4LMYA 2XASA 1PP8F 2HKXA 1SFUA 5LHGA 2JZYA 2Q0OA 4N9HA 1U5TA 2VT3A 5EEGA 2P5KA 5BPDA 4LB5A 2JPCA 2ZBKA 4BHPA 4IHTA 3NQOA 4ETSA 1H9TA 4EQQA 5F1RA 5F64A 3M1EA 2O03A 2VC1A 4YFKF 4I0BA 3F6OA 5E17F 2Z3YA 4HAMA 2KIUA 4M6XA 4UV8A 3HRSA 4HLYA 1DPRA 2K5IA 2RNJA 1TQPA 1ZGAA 5D5XB 1EV7A 1FT9A 1IN4A 3J7AO 1K6OA 2GXBA 3IWFA 2UWMA 5JR3A 1S8NA 4LK0F 2WV0A 4AD9A 2GCXA 3WU1B 1IUYA 4HDVA 3JTHA 4YIFA 4K2EA 3EYIA 4Q5SF 1EH7A 4RGRA 2JPBA 1DP7P 3OOPA 2XAQA 4ZYDA 4AIKA 5D6FA 3WTVC 2QBYA 1FP1D 4RB3C 3CDHA 3EYYA 1P92A 3MZYA 1IAWA 3RKYA 4U7BA 1FOKA 2DPUA 4G9YA 3KZZA 5CVJA 3MCZA 1ZGJA 2FBKA 2A6HF 5LGTA 1ZH5A 3QPTA 3JSOA 2HTJA 3RPQA 1HW5A 2IA1A 5AONA 3Q5FA 1FZPB 1S7OA 4XRFA 4ZZDA 1Z91A 1ODDA 1A04A 2C6YA 3WTSC 4HW0A 4NHJA 1U8RA 1SD7A 2L54A 4OMZA 3E6DA 2DQLA 4CHUA 2LF8A 4ENMA 1R23A 3M8EA 1UB9A 2BYVE 1BM9A 3V4GA 1Z05A 2IA2A 1TBXA 2J5OA 2VT2A 1O3RA 4U0WA 3GYHX 4PGHA 1T6SA 1S3JA 5LHHA 2M30A 4GO1A 3GUDA 1P2FA 1BIBA 2DU9A 1STZA 1XGSA 3V7SA 3CJNA 2CGPA 1IF1A 3ML6A 2ZXJA 3KFWX 1W7PD 5HDGA 1XB4A 3F8FA 2XAGA 4UUVA 3QP6A 4IJAA 2F2EA 2XRNA 2JTVA 1R5GA 2HWVA 4Y17A 3PQJA 4IXAA 3HOTA 2Z99A 1QZZA 3FM3A 1S7AA 5LLQA 1I1SA 3J81K 3ZMSA 1IW7F 1YW7A 1IXSB 2H27A 1G3TA 1TTYA 2K5LA 1J2XA 5FLXK 1J5YA 4KUMA 4WXCA 2V1DA 2QYOA 4H0EA 3FXRA 5ICCA 2PBIA 1ZG3A 1U78A 1KQ9A 4BYYA 4G6DA 3E6CC 1VTNC 4HF1A 2ZNZA 2RV8A 3DPTA 5FD5A 1SD5A 1XD7A 1REPC 1E17A 2EV0A 2QZ8A 1Z9CA 1YG2A 4CDGA 1XCVA 1ZN2A 5DV5A 1LDJA 1QBJA 4KDPA 1RZ4A 5D5WB 2DO7A 2MH9A 3H92A 3F8NA 4CGZA 1ON2A 4WK8F 4Y15A 1U5TB 4L9NA 3F8CA 1RUNA 5HVQC 3ZP5A 3HRMA 1MKMA 4G6QA 4HBLA 5LHIA 1HKTA 2RDPA 2FEZA 3QP5A 3K1MA 2DLLA 3IKTA 3ISPA 4PGGA 4CZZA 4OIRF 3TQNA 4JQFA 4A0YA 2WC2A 1UHMA 1H0MA 3SXYA 1XMAA 4MEYF 4N9IA 4O5VA 4E70A 2XAHA 3KLNA 4G7HF 1XGMA 3F3XA 3ABUA 1WWXA 3E5XA 2HOEA 4IVNA 1ONVA 3LSTA 2A07F 3IRQA 4EJVA 2V79A 1P4WA 2NNYA 3GXOA 2MBFA 4AIJA 4A6EA 4HF2A 5DUKA 1UCRA 1X3UA 3H3UA 3NRVA 4CICA 4HX8A 1LVAA 1YW9A 2XROA 1MJAA 4YG2F 4I02A 4G94A 3ZN0A 4R79A 4AWXB 1OYYA 2IW5A 1AWCA 3WTXC 1T39A 3RTRA 3MHXA 5H6QA 1WI9A 3FX3A 5TRDA 3M7GA 1EH6A 3U2RA 3CUQB 1KQ0A 2ETHA 1OR7A 4I2OA 1TNTA 2XAFA 3BWGA 3K1NA 3P7NA 4EM2A 1BI1A 1NHAA 2E7XA 4GYGA 3REOA 3TO6A 4I09A 2DT5A 3GW2A 1KU3A 3FHZA 4HOBA 2YX4A 5E1WA 2LSOA 3BJOA 3K69A 2Y0MA 2H09A 4LD5A 2BE5F 3I59B 3I64A 1U3EM 1ZARA 1U2WA 2R7FA 3CO6C 2XIGA 3HHGA 5JHUA 5D6EA 2VONA 5ICFA 1BI0A 4LLLA 1J59A 3OV8A 2M5WA 4BHBA 2GA2A 3H3ZA 1USSA 4EJOA 3F22A 2OAZA 1KU2A 2D1VA 4PDKA 4KYWA 3T8RA 3TOAA 1ZYRF 2P7VB 2MLKA 3V8LA 1MGTA 2CYYA 2FU4A 2HQNA 2K27A 1BC8C 3LAJA 2GAUA 1YO5C 1ZREA 2UZKA 3ECOA 4KFCA 2PI0A 5L3GA 3BDDA 1TW2A 1OPCA 4M9XA 2J5PA 3GLXA 5D8LB 1TNSA 3SQNA 5CVVA 4M74A 1UHWA 4P96A 2RKHA 3V8KA 5HS7A 2ZMEB 2H6CA 3ZMUA 4WX9A 1EH8A 1R1VA 3ZMVA 3QPHA 1ZG5A 2EFNA 4A0XA 5K5QA 2UXNA 2EFPA 2QWWA 4HQEA 3KP3A 4BNCA 1U5TC 4HDUA 3HIFA 3G73A 2OZ6A 2CW0F 2JRTA 1O7FA 1P4AA 4XLPF 1FNNA 1FSEA 5H20A 1Z7UA 2DK5A 3GX4X 3R0AA 1ZRCA 2P6SA 4M71A 5LRRA 3DFGA 2E1CA 3J81Z 1MJ9A 4UNOA 4Q4ZF 3FMSA 3QOPA 2VC0A 2M87A 3EUHA 1TQIA 2DQRA 3HYIA 1XN7A 2XGXA 2ZJ2A 5L3FA 1SMTA 2DW4A 3L9FA 2CSOA 4O3MA 3MZHA 2K02A 2ZCWA 3TDZC 2BEOA 3KE2A 4FT8A 2G7HA 1HQCA 1DPUA 2DFIA 1J9IA 4A5NA 2A3SA 4PZJA 4EGYA 1J75A 3JTGA 2QQBA 4L0ZB 3CUQA 4IF4A 1RNLA 2G7UA 1DUXC 1ZLJA 1MDMA 3J80Z 5IT9K 4ZYEA 3RKWA 3KLOA 3KP4A 5L3EA 2LKPA 2BGCA 3SHFA 1QQIA 5DD8A 2STTA 2ACJA 4QWQA 1W7PA 3AAFA 4A0ZA 3E6BA 3FWEA 3D0SA 5K5RA 2GZWA 2HYFA 2GQQA 2HGCA 3B02A 1LDDA 2FXAA 4OMYA 2F5FA 4CYDA 1YIOA 2Z33A 1BOAA 4XBFA 4WCGA 4IRGA 4ZH4F 1R1UA 2QM3A 1XMKA 4HV6A 1SD4A 4B8XA 3WTZA 2HDCA 1ZAOA 4ESFA 4P5OA 3PFIA 1HXDA 2RN7A 1HKQA 1YLFA 4MQVA 3ABTA 1IN8A 2Q8KA 2F5DA 3ELKA 3DXJF 2FE3A 3LA3A 4HA8A 1XCBA 5FLXZ 4N0BA 3C7JA 4OOIA 3VODA 2FOKA 1O7LA 2YSRA 5FB2A 4WWCA 3RJPA 1W4MA 3MWMA 3T5XA 5KVRA 2LX9A 4WXDA 2MA3A 4Q47A 4EJTA 1BJAA 3KP5A 1IZ1A 1BC7C 1TW3A 1B4AA 2P6TA 5BOXA 4RGUA 4KA4A 2ADUA 4ENNA 2IPQX 3IWZA 1T98A 2GXGA 1QGPA 5J6XA 3HTSB 2W24A 3ECHA 5ED4A 3WE3A 1QNTA 2ZKZA 1JGSA 2W84A 4RS8A 5E1XA 4ON0A 1KA8A 3COAC 3R6SA 2FBIA 2K5FA 4P9FA 4I0AA 5BS6A 4GCVA 4LJZF 4MQ9F 3LWFA 2D2WA 2L3DA 4TV7A 2BBYA 3DKWA 3Q9VA 1FYMA 4IRHA 1RIOH 3R60A 5DEQA 5H6RA 2EB7A 1G3YA 2ZO4A 4D0PA 1Z6TA 1Y0UA 1FBQA 4Y13A 1D3YA 1FBSA 5HLHA 5DDGA 2F5EA 5J8FA 3ZPLA 3TKYA 4FHTA 4UVBA 1V4RA 3DF8A 1L0OC 2L4AA 4BQAA 2H6BA 2XKOA 1ULYA 4HX4A 4EJUA 5JVTA 5A2QK 1QPMA 2FSWA 1Q1HA 3F72A 2EWNA 3EQLF 1T0FA 3L7WA 3I71A 5KK1A 2L01A 1XSDA 1ZRFA 2A61A 2L4MA 3EETA 1KU9A 4JBAA 1O57A 3WGHA 5DYMA 3ZMDA 3CUQC 2H3JA 4U0YA 1LEBA 4L5JA 2QBYB 2HZTA 1JE8A 1WSUA 3F21A 3IHUA 1D8KA 1MJBA 2JT1A 1R1TA 5IT3A 1YYVA 5DD4A 1XDUA 3KP6A 2GWRA 3N97A 5HOOA 2RC4A 3MAJA 3JW4A 4P9UA 2FBHA 3WU0A 1IRFA 3P9CA 2VODA 1LJ9A 1UFMA 4MHGA 4EJWA 5L3BA 2K4YA 3WODF 4LK1F 3IC7A 2EFOA 2M45A 4S05A 2O8XA 5ICGA 2MD5A 2FMYA 3ULQB 2QUFA 3V8JA 4Q48A 3BZ6A 4RB0A 1Z6RA 1O3TA 1JHFA 4NB5A 1R5HA 2P8TA 4IRIA 4MNUA 2R3SA 2DBBA 2H94A 3F8MA 2ISZA 1FSHA 4HLXA 3BOQA 4UVCA
chains in the Genus database with same CATH superfamily
3JCMb 2L8DA 1I6XA 2YU3A 2V1UA 3CD6I 1S1NA 2LNVA 3TCJA 3CC4Q 2WBMA 2NOJB 3A8GB 1IRXA 3KP7A 5TISC 2EA2A 3I3LA 2XDBA 1QVGP 1NTCA 4PFOA 4M78G 1B59A 1LEAA 2XI9A 1GXIE 2MH2A 4HT9A 4PJOB 2EH3A 2O5RA 1NEGA 1JI8A 2F2VA 1MW7A 4BXXJ 3RUXA 2HXIA 3JCMQ 1VFCA 3I55Q 4XOPA 6PAXA 1OMIA 1OYXA 4EM0B 1UGVA 4WCIA 4IOAF 5F27A 1I5LA 2FPFA 1SFEA 4ZGJB 1YWOA 3E97A 1ZTRA 4HYEA 5EEHA 4CRIA 4N4IA 4RB2C 5DM7F 1IHWA 4ELZC 2HMAA 2GXAA 2K86A 5CJ9A 5HLTA 4X34A 5FROA 4A3KJ 2A3LA 5DCMA 2ED0A 3PVLA 4CCJA 3IV5A 4J9DA 4ASNA 1B34B 2E10A 3E6MA 2JUCA 3GZNB 4GYIA 3LW5E 1K0XA 4NDLA 4F7ZA 3RKXA 5A2QZ 4M78F 1P6RA 5DM7R 2QQAA 1MMSA 1X1CA 3BG6A 3OIQA 3QUIA 3CLOA 2MK5A 4DNCA 3WG9A 4LUDA 3VJPA 2ZCFB 5K1YA 5FW9A 4A5MA 3CCEI 2RGVA 1QP3A 1Y8RB 2JWTA 2VJ4A 5E8IA 2KQWA 3GFLA 2A69F 1JKRC 2LFBA 3TO7A 1UDLA 2EQJA 4RTVA 1Q95G 1TUDA 2R5YA 2CMPA 1WHHA 2VBYA 4XRMA 4DYCA 2F4MB 4E7SA 2CP0A 4LDUA 2XRLA 2CJJA 3HHHA 1O3SA 1ZBJA 4KN7X 4M6YA 1ZR4A 1M8VA 2V1QA 1JUMA 1YOVB 5CKDA 1C0MA 1ZUYA 4FW1A 1GVJA 5DUIA 2VXFA 3HOZJ 2CP7A 3CCVI 2K9GA 5GAOp 2IP2A 1ON1A 1DGWY 1WJBA 1AHDP 1RAAB 1YCYA 5I11A 2ME0A 1QVUA 4OINF 4M7AD 3PNVA 2KT8A 3I5UA 4XRSG 4BEHB 2IT0A 3VYSB 4ZYGA 3NWTA 4ZDOA 1UGQB 2FG0A 5FWBA 1PCXA 5IHIA 1XS9A 1UJ0A 4XTUA 1IHVA 5IHNA 1I1GA 5EZGA 4RGXA 5J1UA 1GHCA 4J6YA 4EEFG 1KQSA 1X58A 4M78A 4XICA 3MP1A 3CCVQ 2JSCA 4U0VA 2YT6A 5CLSA 2QENA 2MVTA 3J7AW 2C0OA 5FU7C 3WTUC 3SJMA 2N8GA 4QSHA 1H9GA 1MDMB 3J80K 4MEXF 2HEOA 3CCYA 5F1JA 2XF5A 3QYFA 4PK4A 9ANTA 1Z67A 4JRQA 3DQVC 2P7CB 1PD1A 1TWCJ 2ZMEA 3TREA 2CO5A 1K73U 1FMWA 2FZCB 3DP7A 3A01A 1SAXA 3OMGA 4EMKB 2R7VA 1AKHB 1OEBA 2Y90A 2MLGA 1MD0A 2VN2A 2X4WA 1JXSA 3QU3A 5I2MA 1FC3A 3OR1C 2JMCA 2PNIA 3GFMA 1ZLKA 1FMVA 3Q9SA 1BIAA 1BBYA 1NLOC 3VS4A 2EZKA 3LA2A 4M7AF 1JUPA 1RR8C 4OVAA 2PJRA 4D6WA 4O6JA 1BL0A 4M7DE 1KIKA 4ABZA 1VIFA 3G71I 2VJJA 5ILVA 1ZQ1A 4EPCA 2A68F 3H9GA 2EA4A 2K3BA 1YJNA 3FHNA 5IT9Z 1J7KA 2PFBA 4ZDLA 4QW2A 1WHKA 5LJ3h 1KC8C 2BHYA 3CBPA 4DYRA 2X9HA 1UG0A 1QCNA 4R8HA 4II2A 2QQRA 4A63B 2EJFA 2KJBA 3F70A 3OW2A 1FYLA 3OL3A 4I7HA 1YCSB 1ZSZA 3PQKA 1XNIA 2MWOA 5L3CA 5GANe 2LT1A 1IXRC 4FYXB 1YQAA 3GCMA 5HS8A 4EM1A 1WHLA 5J26A 4C92F 3L09A 2F48A 4M78E 2OTJQ 4PSWA 3VOEA 4ZTJA 4L9TA 6AT1B 1FP2A 1DJ7B 1N9RA 1KHCA 3F6VA 1TU0B 3Q0VA 2NRAC 3CC2I 4YRVA 2F4OB 2DJIA 3LSRA 4XTWA 1I5ZA 3MQ0A 4G8XA 1UUEA 2DTRA 1YI2I 3DTKA 2K2VA 3ULRB 4ZYHA 2P5LC 1NZ9A 4OMNA 3DBRB 2IVMA 3LNQA 1MSFC 2EJ9A 2DTZA 3H0DA 2X9DA 1WPKA 5FGMA 5KAFC 5CVRA 4B3XA 2R57A 3CMAA 3DTEA 1H89C 3GLLA 2EJGA 2HSEB 3C1DA 2QXFA 4KMUX 3KXTA 3A02A 1M4ZA 4CH7A 3GFIA 1SMYF 4U88A 4KT5C 2E4HA 1Q82R 2RVCA 1UTIA 1Y0MA 3CBMA 1IXCA 1R22A 3NHNA 1OX8A 3NMZC 4M77D 3G2BA 1IN5A 2E60A 4AC0A 2DMQA 1M1FA 5LJ3e 2PMHA 1YI2T 5HDNA 2E34A 3AKZA 2DJZA 2ZFWA 4PJOF 1OYIA 2LDUA 4YIRX 3GVAA 2X98A 3X26B 5FFXA 2XHKA 3S1NJ 1XQHA 2LCCA 1YJ9T 5HNHA 2RQPA 4HF0A 5CQEA 2DPDA 2PUOB 2FPEA 1BI3A 3R61A 4D5CA 1PD0A 4RAZA 3I54A 3HOSA 1VQ7I 1CQTA 4MMKA 3E5QA 3FMRA 2ZPBB 3ZCOA 3E1SA 3TO9A 3PNYA 3CTAA 1MH3A 2HS5A 3BTCA 2EK5A 3J80E 2ZFUA 5GAGJ 2CUBA 1FIPA 3F9KA 1ETYA 1VOMA 3BLYA 3CF5F 2PQ8A 3EGDB 1KQ8A 3U1KA 3CPWP 4CO8A 1B1BA 2YHTA 2CH4W 2OQGA 3K70C 2R5ZA 5FKMA 2CV2A 3FDYA 4XK8E 2OBPA 1Y57A 3RSNA 1PUFA 3DLLF 2BY0A 1H641 2V7FA 2EIJH 3FLGA 3M59A 3JCMJ 3S93A 1VQLA 4A2UA 1U5SA 2M8EA 2AHQA 4Z6YA 3X24B 3E5UA 1XGNA 3BTIA 2E2IJ 1YJ9A 1JT6A 4MTEA 1MNEA 4JPBW 4BY6C 1K78B 4C8QE 1TT5B 3FK6A 4FETA 5HLGA 4AVPA 2WV1A 1BCOA 1B34A 2A5YB 2CUDA 2KRFA 3H5RA 2NNNA 4EV0A 1VQ4I 4B09A 1RAFB 2QGGA 2W85A 3RIRA 3JCMW 2X6XA 3HTUA 3KYDB 4NQWB 5FKKA 3MKZA 4BE1A 1PHTA 3RNJA 2V6CA 3W6KB 5D4RA 3DPLC 1TH7A 1WCMJ 1YJWI 4OIOF 3D1NI 1ZHIA 3FXQA 3MFKA 2DFUA 3KYCB 4IPAA 2EIKH 3PTAA 1IZ6A 3P8BB 5CKTA 5CVIA 3CMAT 1B9NA 5E8GA 4KIBA 5GPAA 2X85A 3C3WA 3L00A 3TGNA 1Z1DA 3HG9A 4C3JJ 1T38A 1HSQA 1MBFA 2ECCA 4OB3B 3QSUA 3U9GA 5HY6A 5LEJA 4B47A 3SZPA 2EQRA 4KT6A 1QWEA 2HKOA 2K9SA 2NS7A 2XKPA 4LIUA 1E2XA 1Z21A 3BCAA 3JAMK 4IHSA 1WXBA 1K4US 2EV6A 1G6NA 2M4KA 2V9PA 3RYPA 2R5YB 1MH4A 2DZ9A 4RTZA 3R0JA 1NJIU 3U1DA 2X48A 1WGXA 5CQGA 1IGQA 4X1VA 4LGWA 1T95A 3R4KA 4F7UB 2M9UA 2RHXA 2EKOA 1WNLA 2OAUA 2Y48A 1LNWA 3HFNA 1TS9A 3BFMA 1FEXA 3M8JA 1N8RR 1W36D 3E7LA 3GTMJ 4RCBA 2EV5A 5KH6A 3GNFB 1M8MA 3VUZA 2PG4A 1VQ7A 3FEOA 2CU7A 4MO7A 3SFZA 4KRTA 5E1ZB 1YJNT 3H35A 2W25A 4AVZA 1Z7LA 4B48A 2VOPA 1T3SA 4LB6B 3T8TA 1ZG1A 5GMKi 1CF7A 1I81A 3MZ8A 2ESWA 1JRIA 3JV3A 4FTHA 1V3FA 2RD1A 1SC7A 3TMOA 2K4JA 1F43A 4BDZA 2Y9ZA 1SSHA 2L0KA 1MZBA 1I27A 1PDNC 1A36A 2Y75A 4OAYA 4YIIA 1N27A 5JLXA 2G9WA 2KEAA 3OBWA 1RI7A 2FRHA 3OSVA 2DODA 2V4JC 1SD6A 3GO5A 4PFPA 2PJPA 4JRPA 1XTAA 2L3PA 3HTRA 4F92B 8ATCB 5GANd 2KLOA 4U7DA 2V8KA 5GMKe 2CQXA 5F6FA 4ZNXA 1SVLA 2FA5A 4FE4A 3GF5A 1BI2A 4LFUA 3V7CA 3RPUA 1JXMA 1T3LA 2VBZA 4IHWA 2JS2A 1RR7A 1VZ0A 3G3ZA 4GBQA 3JCMf 2VE8A 2RHYA 1C0WA 2CSIA 1LUJB 3CXCA 2ZNYA 4C92B 4KN4X 4F17A 3CCSQ 3M55A 1VQ6Q 3WE2A 3BJAA 2WY8Q 3IAS2 1DDNA 4FYYB 1XG1A 3X28B 4DW6A 2GA1A 3KEOA 4G12A 3EFRA 4A54A 3DKMA 3SD4A 2E71A 5LD2C 2K7LA 4GDFA 5ILSA 1LVKA 2DOAA 3ONQA 4DZPA 2WTEA 2DA7A 3K9TA 4BAYA 2QYZA 2RMOA 2WWYA 2DTIA 2FHDA 1VQPT 1JTXA 1XSXA 4M77F 2NYXA 1BYMA 4KT0E 4JLIA 9ATCB 1LFPA 2FNAA 2KSSA 3QJYA 3BPXA 3K4KA 2XD0A 1AOYA 3RESA 1O3QA 4M7DA 3LX7A 2UV1A 3KX2A 3V7RA 2R7RA 3CLQA 3K4CA 3LAPA 1S6LA 1W7PB 2O9SA 4E7ZA 3KUFA 4QQDA 4KBMB 3DEEA 3HKZN 1ZGWA 1T0FC 1QQJA 1TSFA 2QAZA 3M0TA 4OIQF 4J7FA 4Y4RA 1W36C 3BJ6A 1OX9A 1R4NB 4XKBA 2J6OA 3QBYA 1OULA 2LLKA 1SFXA 3K1PA 2FZGB 3I9QA 1U0JA 2TDXA 4XTZA 1T8IA 3PFSA 5IXBA 2R7DA 2HU9A 1AT1B 2X4YA 1X43A 2EVRA 2KXDA 5FLXE 3G6ET 2AXLA 2RQWA 3VRYA 4JK1X 5L3DA 1Y6IA 2DEQA 4MFDA 3ER0A 1FLIA 1JHHA 4E47A 2X0LA 1USTA 2ZJPF 4CC2A 1DQUA 3BP8A 2PN6A 1I07A 2M0MA 3KP2A 5FLMJ 1BU1A 1Z9QA 1HSJA 3RYRA 3SDGA 2DBKA 4CXFA 2OAWA 3DV8A 3L1AA 2HOTA 2YLBA 4UXNA 3OSGA 4C5GA 4F7UE 3UDCA 2UXXA 5KYWA 2MC3A 3JB9J 2DAOA 3H0HA 3QHSA 3A1YA 3PMIA 1P4XA 1FPQA 4DBQA 2FNPA 1T0HA 3EHQA 3SDZA 2MIOA 2JA2A 4JX5A 4M7DF 3ROUA 2FVUA 2KKOA 3PM1A 1F1BB 2OUMA 3CXCP 2H8HA 4GLMA 2BY3A 1V55H 1IRGA 5A0DA 1JUSA 4HQMA 4QLCU 2DCEA 2O88A 1JO8A 3CCLA 2O2OA 2OJ2A 4XLAA 1GRIA 3SZTA 1KQ2A 4ENKA 2HNIA 2H1KA 2HD0A 1M9SA 3OS0A 3DEWA 3ZN1A 1U8BA 2VB6A 5JLWA 4A3BJ 3PL8A 5KYYA 3K7AJ 3QPSA 2VL8A 5KYUA 2KI7A 2MYSA 1O9SA 4MZTA 2I5UA 2AS5F 2KBTA 4ZZLA 2ESNA 1NYGA 3UNGC 1YIJA 5DCFA 3VS1A 1PYVA 2BZXA 1YITQ 4M7DG 1FMKA 3PUBA 1BR2A 3JSCA 1K7AA 1KD1C 5K5OA 2LG4A 3KZYA 2E7WA 2KJCA 2XAUA 3RDIA 4L59A 1OCTC 5BQTA 3S3MA 1BN5A 2JMWA 1I3QJ 3FXKA 2VE9A 1G3SA 4MLOA 2CZ0B 4XOTA 5IY5H 5AIPA 2DTOA 1R4MB 1BBZA 2LQ8A 3A01B 3C2HA 4F7UF 4DQ2A 4RG8A 3CCMQ 1X75C 3K0LA 2DYSH 1QZYA 1QKWA 2YR2A 4C8QA 3TP0A 4KIFA 3JRHA 3R6OA 1X1BA 2CW8A 5L23A 1K78A 2BTTA 5ICEA 1F5TA 4M72A 5JFRA 3L2CA 2XV4S 1GXQA 4R1HA 4IOCF 2XPWA 2HDDA 1UHCA 4FSSA 1KG1A 1K9MR 2VQGA 1JTYA 3IKVA 5M3FJ 5E79C 3TW6A 3IL2A 1KYWA 2MOXA 2R5MA 4PFZA 4D7MA 3VYHB 4BBRJ 5K7FA 3EDPA 3GIBA 4GXOA 4OP0A 1B72A 1IREB 1LDKB 1WQ2A 5HKCA 3CCUT 5GAN8 1VYUA 2WAQA 2LBFB 4G7OF 2P5VA 3VYRB 1N5ZA 2LF7A 3BROA 4PJLA 1VQ4T 2NAZA 1YJWQ 1R9TJ 1D09B 1SHGA 3GZ6A 1SANA 3TL4X 4M3BA 1TUGB 3BC8A 3RI4A 1B9MA 3M58A 5M5XJ 2QEXQ 4XLNF 4OMFB 3ZQIA 2IS2A 1D5VA 3I59A 3X20B 3CMEQ 4EVIA 3NTKA 1XSVA 3A8OB 4DEXA 4J9GA 3HL8A 2E6NA 2LT4A 4Y91A 5EYRA 4OAZA 3H3VK 2RH2A 4JUVA 4A3IJ 2CT3A 4W97A 5D8KB 1M90U 2XVCA 3N5BB 2IG0A 1JKOC 2WSCE 1B8IB 3QOEA 1QVFA 3S2WA 1I3AA 4XU3A 1OQYA 2KIFA 2M1BA 1BOBA 1V1CA 1CF7B 2HI3A 5LJ5j 3QG1A 4ZN1A 1PUEE 2YUOA 3DLAA 3P9IA 2JA7J 2LP0A 5C3EJ 2CW7A 3CUOA 2NUZA 5FD6A 2KQRA 2CV0A 1LQ1A 1Q86U 4Z8AA 3K2ZA 5J3BA 4ESJA 2MCNA 1VQMT 5J1YA 2GIVA 5F0HA 4IO9F 2ZPGB 4HX7A 3UA7A 1VQ7Q 1J3TA 3M4YA 2JN6A 2OZUA 1IB8A 4L9JA 3H1CA 1B07A 1U1SA 1VQ6A 3CC4T 4LN2A 4M7DC 3KETA 2FEIA 3K10A 3W2WA 3G4SI 1RAGB 4M9ZA 3KZIC 1QVPA 2HPIA 3ZMTA 4BKXA 4J9HA 3J7AY 1R0CB 3TOBA 1W5SA 2ID3A 3VEPA 1H8AC 1KU7A 2J06A 4M9SA 1Q7YC 1F36A 4ANJA 2KGTA 1X1DA 3F8BA 1IV6A 3CC7T 4YFXF 3J7AF 1G3WA 3BG9A 1D8JA 5LJ5g 1VQMI 3JRGA 1HF0A 1VQ9Q 1IDZA 2GIZA 1OYWA 4YFNF 4FYWB 4AT1B 3HKZA 1X1AA 2F5CA 2GFAA 2OTJT 2E5NA 1KK7A 3ERMA 5L8RE 1EZZB 2KIMA 5FFZA 3T0YA 4MTDA 4OMMA 5D4SA 1R7JA 1GUUA 3C2GA 3RPUD 5GAHJ 3CC4I 1WJEA 3G1LA 4RLQA 4NC8A 3PO3J 1GBQA 5KYXB 3M9AA 2DN0A 3OYLA 1G4DA 2O6GE 3MEAA 1N78A 4F16A 2CWEA 4EDUA 4ZN3A 5GTHC 2VOOA 1BK2A 2R7SA 4RAYA 5IP6A 1PUFB 3LLRA 4J9CA 3SFIA 3OYDA 1RUOA 2D45A 2M4GA 1VNDA 4J19A 2ZPFB 3RBBB 3OY9A 2COBA 1M1EB 3WTWC 3KCCA 2PX9A 3K4NA 2K6DA 5LL6S 1KGSA 3FM5A 1WJFA 2DI3A 2HZDA 3V42A 4CCOA 2KT1A 2E1HA 4ELYC 5I21A 2HQRA 4M7DB 3I58A 3NGPA 1M1GA 3K4BA 4XSZF 1ZUUA 2DXCA 4B9XA 3VFZA 5CR2A 3JCMe 3GFJA 4HV5A 1BW5A 4LLGF 4L0YB 1MBHA 2EZHA 3G1MA 4A12A 2ZPIB 4DJAA 3G6EQ 5KAIC 4L5GA 5C6SA 2QEXI 5M5WJ 1QO0D 4RUGA 2BW3A 3D5RC 3OS1A 4X9DA 2F5TX 1UJYA 1ZQ3P 5I2SA 3O6BB 3M8FA 4II3A 4OB1B 3OB9A 2ZXWH 2STWA 4EMSA 1V54H 5FWCA 2B0LA 1WDXA 1ZRDA 3HUGB 1VQ6T 3CCJQ 2CFXA 2VWFA 3UT1A 3VB2A 5IHKA 2PEXA 2KK4A 3LSHA 4M75A 1B72B 2AKLA 2WY7Q 2JOYA 5AT1B 3A03A 1G8XA 3NEUA 2PUKB 4QQ6A 4GRIA 4A3DJ 2HZYA 3OR2C 1R00A 1YN8A 3G4SA 3QYBA 1TL8A 1KYZA 4KICA 2QEXT 1W2BS 1VQPQ 5GAEJ 2CQKA 3GZ5A 2B9SA 2L02A 3C18A 5CKEA 4ATOA 3CCMI 2XIDA 4L9VA 2NXNB 5LEKA 2KMUA 4WXHA 5D5UB 2DTHA 2L3SA 4JRKA 4M7AG 2COYA 1F9NA 1ZHFA 3WXMB 4S04A 1PRLC 2X4HA 2RA2A 2HQ5A 3H5NA 3B6AA 2LJ3A 1K8AU 1UB4A 1QLYA 2HTSA 4HNVA 1MSEC 1F1ZA 4RB1A 3JRZA 5IAYA 2OPTA 4XLFA 3I55T 4F52A 2GFUA 2O7OA 3QZ5B 4LDWA 2YSQA 3INZA 1TTHB 3G4SQ 1VQKT 2VQCA 3NAUA 3U21A 3ERED 2VBXA 4GGGA 2CG4A 1VQ4A 2HDWA 5CKHA 3BPVA 4NNJA 4M75D 4BY1J 3I53A 2KR3A 3CCLT 4AUXA 3CMEA 2X51A 3CCUA 1FYKA 2B86A 3F0CA 4JYKA 4UVAA 2O31A 3S6WA 3BQYA 1CGPA 3PSIA 4V2GA 1O4XA 2VKVA 1JB0E 4G6TB 1T08B 1J0RA 1QHHD 2V8JA 3ZBDA 5J47A 4IHYA 3CCRI 1LNXA 1QCOA 3LYIA 1WKMA 4FW2A 1X2NA 4C0GA 2JZ2A 5GANg 4RM3A 3CC4A 5TJJA 1YWPA 5CIUA 2W4SA 2BE9B 3IH4A 2VC8A 2AKKA 1RKTA 2TCTA 4XK4A 1HW2A 4BHCA 3JSPA 2EFWA 5D5VB 1YP5A 1WZOA 1X1PA 3I0TA 2LBFA 2OQRA 3LQQA 1AU7A 2JUFA 3LA7A 1WRJA 2FMLA 4U87A 1W1WE 1ITYA 1SVMA 3QAHA 1M3AA 2DK3A 2V1XA 3WGIA 2RQTA 1VQLT 1XDSA 1UHSA 2L3QA 2PLYA 2A6EF 3CMYA 4J6XA 2WB1A 5HS9A 4XSXF 1KHIA 1D3BA 5ECAA 4PJ0C 2HYGD 2VV5A 3B73A 3SEZA 4RBOA 3CCET 4UV9A 2XK0A 3MEUA 4KNYA 2W82A 5F0FA 5HLIA 2IEKA 5LJ5h 2OTLT 3VS2A 1JT0A 2Y4YA 3PIPA 3NTIA 4ORZA 5E18F 1E7OA 4LDYA 1NBEB 2Z5UA 4AIDA 5GMKl 2RF0A 2DMPA 3WTTC 3WGGA 3T1BA 1YRNB 3E3VA 2QEXA 4IUTA 5JI6A 2L7ZA 3NFCA 1QU3A 2EILH 1WI7A 1YW8A 2XUBA 5CKBA 3EUKL 4MDXA 5BNGA 1K83J 2F5VA 1P7JA 3PNWC 3OW2P 1VQLQ 1GXPA 1OKRA 3HSRA 3VDXA 2EBIA 1MV0B 4Z02A 1OCPA 3A98A 2O3FA 2L7MP 2X1DA 1TWAJ 2OX7A 5J40A 2OCCH 1T0JA 2NS0A 4ENJA 1XGOA 2P0WA 4ZJZA 3P8DA 1K0SA 3TEDA 2I10A 1VIEA 3LWIA 2R5AA 3L2QA 1J09A 3E0JB 3D5SC 3FF5A 2QQ9A 3TDUC 1YITI 4C2UA 4Y52J 1C6VX 2ECZA 1TT0A 5GTIC 3GEZA 5GPCA 1QW1A 2EFQA 3G6EI 5GAMg 4MMLA 2CUFA 1D0ZA 3AFHA 3IRRA 1SG5A 2CZ7B 2GTOA 2P4TA 4NOYA 4Z88A 3RDVA 2EJRA 2A37A 4J7IA 4C3HJ 1LKXA 2A5WA 1FX7A 2W48A 1WHUA 1V29B 2IJLA 2OD5A 2P0KA 2HQHA 1TQMA 4HKEA 3L2ZA 1LE8B 2DXUA 5CAIA 3ZQ7A 3SEQA 2Q2EA 4LG0A 4I01A 2F2XA 2HKQB 3E19A 1HBXG 3O8GA 4G7ZF 3DEUA 2LZ6B 3OIOA 1E3HA 2YX7A 1MGQA 5CYVA 5IYBJ 2Z9OA 4HCZA 2YPRA 2PMUA 4M78B 5LJ3g 3EH2A 2IVWA 1F4KA 1YBYA 4A3GJ 5DCMB 4LOCA 4UB8C 1YTYA 2XDVA 3L2RA 3OYYA 4XTXA 4Z2YA 5J4YA 2M16A 2DK8A 1YFNA 3CJTB 4AIHA 5J8CA 2J7IA 4JRIA 2LREA 4M73A 3A8MB 4M77B 2HNHA 1HW1A 1VYVA 2FF4A 2KZGA 4A3FJ 4C2MJ 2EGAA 3E9FA 2E6ZA 1SVOA 5LRSA 2K4BA 5LGNA 4EGZA 3HM5A 5GANf 1SF9A 4FCYA 2KRMA 1HSTA 2NOGA 2DMNA 3M0UA 1GL5A 2WAEA 3M07A 4AFQC 1FY7A 3W2VA 3HRTA 2FD5A 1I39A 2M35A 2TRTA 3P9KA 3DU6A 3JRBA 4L6V5 5GAN4 4ITVA 2EW3A 2PJRB 3CC2T 4ESBA 4C0DC 2F6CA 2X4XA 3BY7A 2P4WA 2RQRA 4RKUE 3CDLA 5D7UA 2EYWA 5IT9E 2W57A 2DPPB 4KGXB 3VV0A 2QSHX 4FX4A 1S29A 2DE0X 2VVKA 3HZJA 2LY1A 4W1UA 2AXTC 1GCQA 4RGSA 3F23A 1PP7U 1IN6A 3E2UA 5J3LA 4M7DD 2QLZA 1IRZA 4M75B 5HDKA 2LQNA 2E1NA 4LLNA 3C12A 1R5ID 1GV2A 1YS6A 4OIPF 1OPKA 1H3ZA 1R71A 1MMAA 2DA6A 2VXDA 2XPVA 2LC4A 4BEHA 2B8AA 4KUIA 2QVOA 3FBNB 3D5LA 2LNHB 2DRMA 2PTKA 2LMDA 2DBMA 2HSPA 5GANh 1KC8R 3HUGA 3MEXA 1ACIA 2FQ3A 4KIGA 1YFHA 2JMAA 1QHGA 3N4MA 2EQUA 3O3KA 3H36A 2ELHA 3H9JA 1W5TA 4HZFA 4L5IA 4PCQA 1S5LC 3GWZA 4YELA 5FKLA 1SSFA 3HHTB 2OU2A 4QT7A 3ZMZA 1HKSA 3S1RJ 2R93J 2X4JA 3LFKA 4MGRA 1B6AA 1LB2A 2JJ9A 2GOMA 4A53A 5ILUA 4P55A 2QGUA 1NPRA 3BY6A 4I6ZA 4C5EA 1E6GA 1FBUA 2JQ7A 1EKEA 5FO5A 1M3CA 2Q1ZB 3I4PA 2XDPA 4BUGA 3NARA 1MBKA 1X2QA 3CJQB 2YU9J 2IRFG 2O0YA 4I98B 3VS6A 3M3YJ 4DYQA 3KEQA 4C0DB 1R58A 5AIQA 3CCRQ 5FRNA 2O9VA 3HPWA 4HSTA 2K2MA 1RKWA 3K2AA 4A6DA 3FZVA 3O2PE 4CCMA 2Y0SA 5B66C 2ISYA 3ZQCA 1U3OA 2E35A 2XAJA 1OI1A 1U6GA 1WI3A 3GMEA 5CVUA 4KMFA 5EC7A 3HGGA 4J00A 4LD9K 4YEJA 3CO7C 3QRFF 2HR3A 5LGUA 4EMKA 5H2FC 2M0CA 3DWLE 2CUEA 4DGWB 3FXUA 3CZ6A 2Z2SB 3GP8A 2DJNA 2VKHA 2BV6A 4ESRA 3LSPA 2FRYA 2D1HA 2XKOC 4C92E 2OF7A 1K79A 2A6TA 2DAQA 5BPIA 3K70D 2QQSA 3KIOA 1SRMA 1TOVA 4PUSA 2HBPA 3HSFA 3P8HA 2VXZA 2ZGWA 3ASNH 4RCCA 4L18B 3VYGA 4HCKA 3OYGA 1R36A 1D5YA 1IN7A 2AZSA 4XRSA 1IG7A 2O61A 2QQ8A 2MSYA 3FKIJ 1ETVA 1FIAA 1OU8A 5LJ3f 4E4HA 2RM4A 5LBQA 4AMCA 4NL3A 2XB0X 3QU6A 2K3FA 1PVEA 2K3YA 1VQOA 1CKAA 2Y4XA 2KNBB 3JR9A 3CCVT 3L2UA 1QVGS 2RNGA 4WF2A 3W6JB 4LG0B 1AZGB 1Q81U 2K9NA 2CZ1B 2R7UA 2P81A 3TVTA 4DOVA 4WTOB 3G7ZA 2FJ1A 1RESA 2SRCA 1YI2Q 2DOEA 5FU6B 1PKSA 4C2TA 3JAMZ 3UR3C 4TVRA 3HB9A 4A3LJ 4E7JA 3GF2A 3HRUA 2A7YA 2VBWA 4NQWA 2ESHA 1WFXA 2I2LA 1T2KA 4AG1C 5GAMh 4JS5A 1VQNA 2BIVA 2QDLA 3CCJI 1QWFA 3FISA 3OMCA 3SEMA 2XU8A 5IPAA 2K9QA 3J81E 1YE9A 2MFZA 1X3ZB 2LX7A 3LGFA 3CXCS 1EF4A 2LNBA 1YS7A 2Y69H 1FWZA 2L7KA 2COMA 3QYGB 4KH0B 2IA0A 4EMGA 3HSEA 4BXUA 3M0QA 3CC2A 3IH3A 4D8DA 2HFHA 5ERIA 2LH9A 3CQZJ 4OU0A 1FOYA 3LQRA 1QP2A 1VQ9A 1YI2A 5F04A 4OB2B 3CCQT 2KHMA 2QSGX 2DYBA 4NC7A 4BH9A 1NK2P 4FX0A 2LQWA 3OYIA 5CQXA 4UHTA 2M2EA 4FISA 2GTJA 1WH7A 4M3DA 3CMAI 2E36A 1SFOJ 5A0GA 2JVGA 2L9RA 3FMQA 5CQYA 2LCSA 1TLHB 1ZR2A 2OA4A 2EFIA 4N0AC 4M77C 2E1OA 5BMZA 4D9JA 1D1CA 2XICA 3EGDA 3Q0WA 2E2JJ 2V1RA 1L3LA 2V9VA 2QA4T 3WTYC 2EGEA 2NLUA 3CCQQ 1NG7A 3H41A 4CC4B 5E20A 2ZXIA 4LMYA 2K85A 1Z9ZA 3KBGA 4N4HA 3KPHA 2XASA 5M5YJ 1PP8F 1Q7YR 1HLVA 1VQLI 1SFKA 2PZ1A 3FXMA 4PJOD 3HKSA 1POGA 2C0IA 2QA4Q 2HKXA 2DYRH 4XLHA 2FO0A 1SFUA 5LHGA 3X2QH 1AOJA 1PWTA 1W4SA 1MV3A 1S9HA 2JZYA 2JNGA 2Q0OA 1APLC 1ZUKA 4N9HA 2EGCA 3JAME 3PMTA 1U5TA 2VT3A 5EEGA 2P5KA 5BPDA 2D8JA 4LB5A 2D0QB 3A5ZB 2JPCA 4HPQA 2ZBKA 4BHPA 3OYBA 3H9NA 4IHTA 1VQMQ 1YRNA 3AG2H 2O4XA 3QWYA 2B63J 2BZ8A 5C44J 2DA3A 3NQOA 4C9YA 4ETSA 1H9TA 1RI0A 2GGRA 1P9QC 1M1KC 4EQQA 5F1RA 2R4GA 4JS4A 3H0GJ 5F64A 3M1EA 3RKQA 1ZELA 3DB3A 2O03A 1KSWA 2VC1A 1M27C 4YFKF 1RABB 2MZ4A 2KL4A 1WHGA 4I0BA 2IGNA 3F6OA 4A3EJ 5E17F 2Z3YA 4PJOE 1HYOA 1WJ5A 4HAMA 2KIUA 4M6XA 4UV8A 2KDSA 3EG9A 1Q7YU 3HRSA 4HLYA 4A3CJ 1DPRA 2K5IA 1ZKGA 2RNJA 3Q3SA 2GM4A 3EGUA 2KXCA 3S14J 3WG7H 1AWXA 1SPKA 2E41A 5GAOn 1LFUP 2O8KA 2RK1A 2ELKA 3HPHA 2DL7A 4N0AA 1TQPA 1N9SA 5C0MA 4FM4B 1ZGAA 1VQKI 5D5XB 3GTKJ 2IS1A 3BR0A 3NPFA 5KCMA 2DXIA 2ZAEA 4V19K 5D6WA 4F04B 2E1MB 3W3CA 2DNUA 2Y9YA 2JW4A 1EV7A 1XX5A 1WJAA 4XTYA 2WACA 3META 1FT9A 4PJNA 2BE7D 1IN4A 5E3MA 1ETKA 2FOWA 1VQ5I 1LE8A 8AT1B 3J7AO 1K6OA 3S3OA 1K9MC 3L2VA 2GXBA 4PJJA 1ZK8A 3IWFA 3CCRT 2UWMA 5JR3A 1S8NA 1YX5A 2ZJQF 4DBHA 3THKA 3G71Q 2IGMA 4LK0F 3X25B 2WV0A 3VS3A 2HAXA 4AD9A 5KYUB 2Y0SN 2BVMA 3H8ZA 2GCXA 3WU1B 5HK0A 1AWOA 2RREA 1IUYA 4HDVA 3RERA 3FIWA 4B43A 1PC0A 3JTHA 4CA0A 1UMQA 4YIFA 4K2EA 3EYIA 2DA4A 4Q5SF 1EH7A 2K57A 3M56A 5KHDA 4RGRA 2JPBA 4JJCA 3LSIA 4JP0A 4RM2A 1DP7P 3C95A 1XPXA 4UC4A 1OCRH 1PJRA 1JKQC 4HVUA 3OOPA 5HCKA 3FC3A 4J6WA 1Y0NA 2XAQA 5EF6A 1PG5B 3I55I 2W10A 4ZYDA 4AIKA 4M3EA 2JTEA 4JDSA 5D6FA 2BZTA 1MMNA 3WTVC 1OZ3A 3VS7A 2QBYA 1FP1D 3MN2A 3OOUA 4RB3C 2ELJA 3CDHA 3EYYA 3ZRGA 4IL6C 4AFUC 1P92A 2DT6A 1UAAA 3CPFA 1WGSA 3OQ5A 3K4JA 3MZYA 2BKDN 2KAFA 2DXBA 1IAWA 1BA5A 2FPDA 2MAMA 2LY9A 1N8RC 3RKYA 5B1BH 4BQNA 3BQZA 4U7BA 1R6RA 5A0LA 2XGCA 3M9QA 1VQKA 2WSEE 1FOKA 4GY5A 2DPUA 4G9YA 2DO3A 2HL3A 4BI8B 3KZZA 5CVJA 3MCZA 1ZGJA 4BBSJ 2MUNA 2D9TA 3TP3A 2I8DA 2RHZA 3QDRB 3QKJA 2E2HJ 4IQJA 2FBKA 2A6HF 2CQQA 5LGTA 1ZH5A 3G1JA 5CKFA 3TQ7P 2M02A 2NUTA 4KULA 3QPTA 3JSOA 4A3MJ 1IGUA 2RNAA 4JZ4A 3TEEA 4XAXB 4A93J 3BW1A 3CQTA 1IGNA 2HTJA 2OV7A 1HW5A 1XC5A 3RPQA 1R77A 2DL4A 4LUEA 4M75C 4NS5A 2IA1A 5AONA 2YRVA 2M51A 5CCAA 3Q5FA 1FZPB 2JM8A 1S7OA 3P5JA 3C0CA 1K9MU 3HOUJ 3I5RA 4XRFA 4BDYA 4BJ5C 5TGTA 2VASA 3CPWA 4ZZDA 1TZLA 4C8QF 1KFZA 1Z91A 1XOVA 3MPUB 1NE8A 1AWJA 2XSJC 2KRNA 1ODDA 4RA2A 2COZA 5D6XA 2K9LA 2L9NA 1ETQA 1A04A 1B8IA 2C6YA 2V9KA 3A0BC 1XMXA 3WTSC 2QASA 4A4GA 4HW0A 3QWLA 2M7BA 4XKWA 4NHJA 1U8RA 3MKYB 1SD7A 2L54A 4OMZA 4IKFA 2LK2A 2DQLA 3E6DA 2LF8A 4ENMA 4CHUA 1OPLA 2EYZA 2XMFA 3QXEB 5GAN3 3BR1A 1S72I 3DBHB 4BY6B 3BTLA 3C4SA 1R23A 3M8EA 1YHQA 1UB9A 2BYVE 4N4OB 1BM9A 3SWNA 3V4GA 1Z05A 2IA2A 1XTDA 2KRSA 2EZLA 2CZ6B 1TBXA 3S15J 1IV8A 4XTVA 2J5OA 2VT2A 1O3RA 3RQ4A 1UJ8A 4U0WA 3GYHX 4UUTA 3PIOA 3HFOA 4PGHA 1T6SA 3JRCA 4IHVA 3G6EA 2EINH 1S3JA 3LMMA 3JRFA 5LHHA 2KRHA 3O5ZA 3QYHB 1A6QA 2WA0A 5GMKj 1TWFJ 4DZJA 2M30A 4GO1A 2BUDA 4JLGA 1S72Q 1UHFA 3M0PA 3B6CA 3GUDA 2CP3A 1P2FA 3CCST 2J6KA 3HXLA 2LP5A 2CSQA 1BIBA 1TXQA 2DU9A 2EIFA 2GQVA 4FT2A 3RMSA 1STZA 3ZGKA 5FKOA 3O8VA 1XGSA 4OGCA 3V7SA 3JB9F 4E7LA 1Z3YA 1ZSZC 1IO2A 3CJNA 2LC2A 1WXUA 3H6ZA 2CRGA 2CGPA 3ZFJA 1IF1A 1ENHA 3ML6A 2VQLA 5EG0A 2BHZA 2EQKA 3CCMA 2DKGA 1X6GA 2NS8A 2ZXJA 2R92J 2WAQN 3KFWX 4DBFA 1W7PD 2GLOA 3EHRA 3BG7A 2P0TA 5IXFA 5HDGA 2VIXA 2AK5A 1XB4A 3F8FA 1VYTA 4C5HA 2DMTA 2BXYA 3CCSI 4B1RA 4ENNA 3FXJA 4P1WA 3RZDJ 1Y39A 1LCKA 1I1JA 1OCCH 2FL7A 2XAGA 4FU6A 1MNMC 3HP9A 1Q1VA 4UUVA 1Z77A 3QP6A 1D0XA 4PJOC 4HVWA 1GLNA 4IJAA 1WZ2A 2DL5A 4OB0B 1Z3XA 2F2EA 2XRNA 3MMYB 2CH0A 2JTVA 1R5GA 2HWVA 2K3XA 3H9QA 4Y17A 4CUGA 3L42A 3G71A 2KDZA 1TWGJ 3PQJA 4IXAA 4IEJA 4H4KC 2Z99A 1QZZA 3HOTA 3FBIB 1LPQA 4HNTA 1HD3A 1JU5C 3G71T 1D1BA 3FM3A 1S7AA 5LLQA 2E19A 1WQ7A 4XM3A 5FJ8J 4HG2A 1I1SA 4NL2A 3J81K 3M57A 1N75A 1KC8U 1X6BA 3EG9B 3JREA 2LD5A 2E12A 3MP8A 3ZMSA 1IW7F 2AIRB 2Z16A 4AG2C 1YW7A 1IXSB 4E6RA 3OL4A 3CJRB 3J7ZI 4ZDPA 3AT1B 2H27A 2IS6A 3FJPA 3PFYA 1G3TA 1TTYA 1VQ7T 5DM6F 2KMTA 2K5LA 4LE9A 3H0FA 2IBDA 2DD4A 1J2XA 2KP6A 4F3QA 5FLXK 2HQEA 4BACA 2DD5A 1J5YA 4AFZC 4KUMA 3JCMd 4WXCA 2P0QA 2JK3A 4A4EA 2V1DA 4E7IA 2RAEA 5AYFA 1W0UA 5M9OA 2QYOA 4H0EA 3FXRA 5ICCA 2PBIA 1ZG3A 1U78A 1X2MA 2HOAA 1KQ9A 4BYYA 2L7FP 1M5Q1 3LGLA 3M5AA 2JRMA 5C4XJ 5EGOA 4M7AC 4PJOA 1AWWA 4G6DA 2LQKA 3M4OJ 3VUBA 5A2QR 2QSFX 2ID6A 3E6CC 1VTNC 4FIBA 4R55A 3EGXA 3CCSA 3S1MJ 3OW2S 5LFAA 1WYXA 5DY9A 1VQ5Q 2LJ1A 1SEMA 4HF1A 2A36A 2ZNZA 3SZGA 1FOWA 2VKEA 2LMJA 2RV8A 3DPTA 2CGHA 5JVGF 5FD5A 1VQ5T 2ZPHB 4IQ4A 1OQKA 4BE2A 2CFOA 1T33A 2CQ7A 1SD5A 1MMGA 4HNUA 4HVVA 4Y28E 1D0YA 4IX7A 2QKLB 3BDUA 1VQKQ 1YIJT 1XD7A 4NC6A 1REPC 2EV0A 1E17A 2PQWA 2KISA 2QZ8A 2RQQA 3EFSA 3ZEHA 2DETA 1Z9CA 1YG2A 3CCJT 3ZQHA 1YHQT 4CDGA 4C8QG 1E3PA 1XCVA 1ZN2A 5DV5A 4CCLA 1VQ6I 1VQ8T 2L0AA 1LDJA 1QBJA 4C92A 2XPUA 3WHCA 4D5FA 3RR6A 4DA4A 4KDPA 3I4NJ 3AG1H 1RZ4A 3LSJA 4AM3A 5D5WB 1NH3A 3WVEB 2DO7A 1KD1U 2A05A 3OYNA 1DU0A 1I4K1 2MWPA 3Q1JA 3QODA 2MH9A 3H92A 3F8NA 4CGZA 2R58A 2BY1A 1H88C 4B4CA 1WHJA 3JCUC 5EEAA 1TWHJ 1VQOI 3GTOJ 4PNOA 1I6HJ 1ON2A 4C0FA 3A8HB 3HOXJ 4WK8F 1O75A 2GF7A 3CPWS 4LD6A 1WHMA 4RMNA 1N8RU 1A31A 4Y15A 1V5EA 1KQ1A 1U5TB 1WIEA 3OWTA 1ZA1B 2E3IA 2RO0A 4M7AA 1KQSP 4L9NA 3BCBA 4PJMA 1TUCA 3F8CA 1RUNA 1TG0A 3I35A 5HVQC 2JVVA 4X9CA 3ZQGA 1X6OA 3ZP5A 3HRMA 1MKMA 2QA4I 2ICWG 1UZCA 1PNJA 2DX1A 2HDAA 3DLMA 4G6QA 4KUDK 1NG2A 4HBLA 5LHIA 4E7HA 3GTGJ 2R7XA 1HKTA 3VS5A 2RDPA 1H8KA 1VQ8A 1M3BA 2FEZA 3QP5A 2A0FB 4QQGA 3K1MA 3SB2A 3FXOA 3AHUA 2UUZA 1FXXA 3FK7A 1UGRB 2XHCA 2DLLA 3IKTA 4V2SA 3VYTB 4RTTA 3EG3A 3M1CA 1OISA 3TW7A 4PJOG 2KYBA 2YLCA 2VYTA 3ISPA 4PGGA 2DJQA 4CZZA 4BE0A 1RI9A 4XQ3A 2W7NA 1M2VB 4EMKC 4QKUA 4OIRF 2YWWA 5FU6C 1W70A 3TQNA 3K6GA 3NWSA 3HGYA 4JQFA 1FJLA 4ZYAA 1A35A 4IUQA 4A0YA 4OMLA 2WC2A 1N6AA 1UHMA 2CREA 2DA5A 1H0MA 4IURA 3ZOBA 3SXYA 3JB9I 1N25A 1K9AA 2SEMA 1VQ8Q 1XMAA 3HOWJ 5FU7B 4MEYF 3PIPF 4BI4A 3EG1A 2OTJI 3OS5A 3DLLA 4N9IA 4O5VA 4CYCA 3GOXA 4E70A 2XAHA 4XNFA 4JJBA 1Y56A 3IQLA 3HOVJ 2WAFA 5KE3A 5FRMA 3KLNA 1R49A 5HNFA 2DRKA 3MP6A 5A2QE 4G7HF 1XGMA 3D7SB 3F3XA 3E9GA 3MCAB 3ABUA 2VJIA 4M7AE 1WWXA 1PM3A 4XKCA 3BTJA 2YDLA 3E5XA 2DYIA 1YJNI 4EATA 1JKPC 1Y7XA 2HBWA 2HOEA 2KT0A 1VQ4Q 1VQPA 3BR2A 4IVNA 3W6VA 3S8PA 1ONVA 1GCPA 4JJDA 1NEBA 2NUPA 4FSXA 3CCUQ 3LSTA 1P7IA 4M3GA 2A07F 2XG8D 3HC7A 3IRQA 2FZKB 4EJVA 2JXBA 3BR5A 2X35A 5GJVB 4HCCA 2MGQA 2V79A 2RQVA 2QA4A 2CUZA 2R7WA 4B6MA 1P4WA 2C0TA 2NNYA 2EKHA 3GXOA 1BW6A 2MBFA 4AIJA 5B1AH 4Y7NJ 4A6EA 3DU5A 3ZQLA 4HF2A 1PRMC 5GP9A 2LTOA 1QRYA 5DUKA 5DLOA 4M77A 3GBGA 3S32A 2EQIA 1AA7A 2BOLA 2PMZA 1UCRA 1X3UA 3H3UA 1RLPC 3NRVA 3LFUA 1IDYA 4CICA 4HX8A 2DXTA 1LVAA 1YW9A 2HXOA 3L1PA 2XROA 1JXOA 1MUZA 2CP2A 4XN0A 1K76A 1UELB 3FDRA 4XQFA 1MJAA 3J80R 4GFBA 1Q86C 4GLKA 4YG2F 4I02A 4G94A 2IS4A 1BR4A 2H8WA 3ZN0A 5IYCJ 4R79A 4PLIA 1YITT 2E65A 4AWXB 2Q2EB 1OYYA 3DB4A 2IW5A 1AWCA 3WTXC 3OMYA 4M3FA 1MNDA 3J7YJ 3AG3H 1T39A 3RTRA 3MHXA 1M1KU 3CDIA 4BS9A 1W6XA 5B3SH 1JBMA 2MABA 5EG2A 5H6QA 1WI9A 5K7HA 2QKMB 3FX3A 2HPMA 3CCMT 5F08A 2PU9B 4OWRB 3OS2A 3JCMV 3LWHA 3BG5A 1TWBA 2ZMEC 3QPLA 2LR8A 4ZC3A 4M4ZA 1VQNQ 4JJNK 2LY2A 5TRDA 2AT1B 5K7ZA 3M7GA 5C4JJ 1Y96B 1EH6A 3U2RA 4ME7A 3KFVA 3CUQB 1KD1R 1KQ0A 2ETHA 4KGVB 1K61A 1OR7A 4EMHA 5CO7A 4M7AB 4I2OA 1TNTA 2XAFA 1YJNQ 2BXZA 3BWGA 4B9WA 3K1NA 2GOXB 3P7NA 2ZSHB 2DFHA 4EM2A 1M30A 1BI1A 1NHAA 2HQXA 2E7XA 4GYGA 4YTLA 4Z89A 5I22A 3REOA 1JGGA 3TO6A 2E5KA 1H92A 4I09A 1HJDA 1VI0A 4IIOA 4AYBN 3HL2A 2DT5A 3GW2A 1K6YA 1KU3A 1SKUB 4II1A 3FHZA 2RPNA 5IN1A 5LJ5f 3A2KA 3JB9D 5KCOA 3I9V2 3QJ6A 4P5NA 3UPUA 4QIWN 4RDUA 3EGXB 4HOBA 1T56A 2YX4A 2LSOA 3DKXA 5E1WA 4B44A 3BJOA 2KROA 5LJ3j 4FT4A 4LXCA 2MF2A 4RTXA 3K69A 1X19A 2Y0MA 2H09A 3LOCA 3M53A 2YRDA 5KYWB 1ABQA 2MI6A 3BDLA 3GTPJ 4LD5A 1I8FA 2BE5F 3I59B 2NVTJ 3I64A 3CMMA 1U3EM 4KGZB 1BR1A 1ZARA 3JCMg 5GAN5 1U2WA 1NLPC 4XLCA 4IIMA 2R7FA 2H1LA 2M8GX 2KDOA 3PVQA 2Y2ZA 5IP9J 3CO6C 5GJWB 2XIGA 3ASOH 3KYLA 5IT9R 2ZPEB 4F7UA 2JT4A 3OA6A 3ZR8X 3HHGA 5JHUA 4XKVA 4HSRA 5D6EA 2DIQA 4J8OA 3M54A 4OMPA 3MD2A 4CC3A 2IGOA 1KQSS 2VONA 2XB5A 2VJ5A 4KISA 1QCFA 2QDYB 2VKNA 3CC2Q 1ABOA 3OYJA 5ICFA 2ZJRF 2MPXC 1PSEA 2CT4A 4I99C 1H3HA 1BI0A 2ROLA 2VXEA 4LLLA 1UGSB 2LCLA 1YHQI 1J59A 1HDPA 5EGOB 5GAOl 2ENMA 1R8OB 3OV8A 2BVLA 2COWA 2DMUA 2M5WA 1VF9A 3OIPA 4M75F 3VKIA 1FYNA 2EYXA 3H5AA 1G59A 2QF7A 4BHBA 4HRIA 2D1XA 2GA2A 3PT9A 3H3ZA 1USSA 1WA7A 2NWMA 3MEVA 2KVQG 4EJOA 3F22A 5GMKm 2OAZA 5D6YA 3A4CA 3JRAA 2P0PA 2D0NA 4XR6A 4J9BA 2LYCA 4E6KG 5GMKh 1KU2A 2D1VA 4PDKA 4KYWA 3S2HJ 2H8RA 4J5YA 1NK3P 1LPLA 4J83A 5DLQE 1WJRA 4C92D 1M90R 1RUWA 3T8RA 4A69C 2M7AA 2J6FA 5GAN2 3TOAA 3AL0C 1ZYRF 2QK0A 2QTVA 1Y1VJ 2I0NA 2FB7A 2A28A 3CCEQ 2DLPA 2X1EA 1FTTA 4Q5WA 2P7VB 3TSWA 2MLKA 3V8LA 3CC7I 3TSZA 1QMCA 2ABLA 1K4SA 2DT7B 3SHWA 4FASD 4LIVA 1RRJA 4PSXA 1MGTA 2CYYA 2E5ZA 2FU4A 2HQNA 2K27A 1BC8C 3LAJA 1WJQA 1I50J 1LOJA 2GAUA 1YO5C 2P84A 1ZREA 4QVZA 4KJZA 1AEYA 2UZKA 2ZB9A 3ECOA 2G0EA 4KFCA 2PI0A 3C2BA 2NUTB 4DEYA 3U23A 5L3GA 3WU2C 2GQIA 1OCOH 1W1FA 3BDDA 4BI3A 3CCRA 3WVDB 1R0BG 3MKLA 1TW2A 2O9LA 3QYEA 2LVSA 2PMZN 1OPCA 5GANj 5EZHA 4M78D 3ZQQA 4M9XA 2J5PA 3GLXA 3FB9A 3CCLQ 5D8LB 4C0ZA 1TNSA 3FJ5A 1OCZH 3SQNA 3CC7Q 4C30A 5CVVA 4E7KA 4M74A 1UHWA 3IUOA 4P96A 5J1RA 2RKHA 2RJDA 2X1CA 3V8KA 1D1AA 3ABLH 2DA1A 5HS7A 4BL0B 4OF1A 4BUPA 2ZMEB 2H6CA 1IO6A 2F4IA 3T9NA 4IHXA 3ZMUA 5E3NA 4XLEA 4WX9A 1QPIA 3A52A 2D8HA 2WADA 2L9SA 1EH8A 5GAMd 2ZXHA 1R1VA 3I56T 1B3QA 3ZMVA 1VQ9T 3QPHA 1ZG5A 3JB9H 1IC8A 5HK3A 2AO9A 1AVZC 4XL9A 4LDXA 2EFNA 4A0XA 1U1TA 2DM1A 2OTLQ 3BR3A 2X6WA 5K5QA 3CCQI 1LFBA 2X6YA 2L89A 4ZTFA 1YIJI 2UXNA 5IOYA 2KFDA 1X69A 4CSWA 4M77E 2EFPA 2DFFA 1Q81R 1YJ9I 3TU4K 2L2OA 2QWWA 4HQEA 3DCFA 2X3WD 1VQNT 1WJSA 1I0CA 2XDDA 3KP3A 4BNCA 3M0RA 3SWNC 4BGDA 1Y1WJ 2K79A 1U5TC 2IAIA 4HDUA 1TC3C 4CYCB 2HVRA 3HIFA 1JJ2P 4OMQA 2YUQA 4A4FA 3G73A 2OZ6A 3RMQA 2CW0F 1RLQC 2JRTA 3CCVA 1O7FA 3CEYA 4CI0C 3VPRA 1Y8QB 1Y07A 3BZKA 5KYYB 1P4AA 4XLPF 1FNNA 2YXYA 2QCOA 2AZVA 4AYBA 4BU2A 1FSEA 1QVTA 5H20A 1AD5A 2G3RA 1Z7UA 2DK5A 5GADJ 1A5JA 3GX4X 2OCEA 4QPQA 1A6IA 4KITB 3R0AA 1ZRCA 2OC6A 1I5OB 2R5ZB 1ZX6A 2GNCA 2JM9A 3BE3A 3MJXA 2XGEA 1RL2A 2AQFA 2P6SA 2XF7A 4M71A 3DFGA 5LRRA 1BB9A 4C8QD 2E1CA 4QVDA 5GAN7 4HT8A 3J81Z 1RC9A 2Z1DA 1MJ9A 4UNOA 4J9IA 4R0KA 4Q4ZF 4IUPA 3UKGA 1WXTA 2L9VA 1OV3A 1YJWT 2X3XD 1K73R 2HVQA 2JA8J 3FMSA 3QOPA 2VC0A 2M87A 1Y96A 3BG3A 2V8IA 4RTYA 3JCMc 3GPLA 1WPYA 3EUHA 3PIOF 1TQIA 4E2FB 5GAOr 1RETA 4UB6C 5DTDA 2DQRA 1QKXA 5E3LA 1YNZA 1AHJB 3S3NA 3HYIA 5KCHA 2W0ZA 3CP8A 1XN7A 3CCQA 2XGXA 2XGDA 2ZJ2A 5L3FA 1SMTA 2DW4A 3L9FA 2BZYA 2FRWA 1S72A 2CSOA 4O3MA 4XN3A 3MZHA 3HPGA 2CYZB 2YUSA 2K02A 2D5VA 2ZCWA 3HJEA 2E70A 3EH1A 1JQQA 4N4GA 4IUVA 2EBPA 3TDZC 1OFCX 2M1HA 1M90C 1D3BB 1Q82C 2BEOA 4CCKA 3ASKA 3KE2A 4OMOA 3CD6T 4FT8A 3OBYA 4LDVA 1E6HA 2KYMA 3BZCA 2G7HA 2LRQA 1K8AC 4UUSA 1HQCA 1HK9A 1QVFS 3ME9A 2ED1A 3EFOA 1NG6A 2CUJA 3ABMH 1OR7C 1DPUA 4JZ3A 4QTRA 3C94A 2MC4A 2DFIA 3HEFA 3G1OA 2LTPA 2A3SA 4PZJA 5FKNA 4A5NA 4EGYA 1J9IA 1YJ9Q 1SHFA 1JJ2A 3JCMP 1QVFP 1J75A 5IP7J 3JTGA 2IIMA 2X6OA 3HDDA 2FX0A 2QQBA 4Y92A 4L0ZB 1VQOT 3CUQA 1W2BA 2OTLI 4IF4A 2GBQA 2DF6A 4J9EA 3CCEA 1RNLA 3EUHC 2G7UA 2MD0A 1ZLJA 4F91B 1DUXC 1MDMA 1Q82U 3J80Z 3CD6A 3LL7A 5IT9K 2IGKA 3QIIA 3GTLJ 4ZYEA 2OJED 3KLOA 3RKWA 3WHBA 4D7NA 4RTUA 2CQNA 4HEA2 2V1NA 4EIKA 3VRZA 2BW3B 1X3WB 4C8QC 3CD6Q 3CMEI 4JOMA 3KP4A 1AKHA 3LH5A 5L3EA 2DOFA 2LKPA 5LJ5d 2L5QA 2EYQA 1U9NA 2BGCA 3SHFA 2EPFA 1QQIA 2LKXA 5DD8A 3CCLI 2L2PA 3PNTA 1UEBA 2NYSA 2STTA 3VWBA 3QQAA 3K4MA 4BY7J 4DIQA 2R0QC 4PLLA 1YHQQ 3RCOA 2ACJA 4QWQA 4LITA 2JSPA 3R6NA 1K8AR 3VYUB 1X27A 1W7PA 2CP5A 4QVCA 2JTFA 3CMET 4DOWA 3AAFA 4A0ZA 1EJ9A 3A0HC 3E6BA 3FWEA 3I56I 1VQPI 3D0SA 5K5RA 1G2HA 2GZWA 3ESWB 3N05A 2NVQJ 1MBGA 1PKTA 2HYFA 1HOMA 2DL8A 3REAB 4PKCC 1ZSZB 2GQQA 2HGCA 1OOTA 3B02A 2RQUA 3JCMX 5KNLA 3W2AA 1E0EA 4VUBA 1GV5A 1LDDA 3VSKA 2FXAA 3I4MJ 1UECA 1DU6A 3QO3A 4ZGDB 5KYXA 2VLAA 2EYYA 4OMYA 2PVDB 2F5FA 2RJFA 2DA2A 2JN0A 4CYDA 1YIOA 2DILA 2NVUB 2Z33A 2PVOB 2JA6J 2M0OA 2RI3A 1VQ5A 1MIJA 1BOAA 2R7OA 4XBFA 4WCGA 4IRGA 1JJ6C 4ZH4F 2KRCA 5EG0B 5KYNA 1R1UA 2E5QA 2QM3A 4IZZA 1XMKA 5FLXR 5M3MJ 2VQHA 5DS9A 5LJ3d 1RQ6A 5GAMj 3GNGA 4HV6A 2CS7A 3UWNA 2KZVA 1SD4A 2AQEA 3DTIA 2HVSA 1HCRA 4F14A 3A1PA 1YITA 1WJDA 4B8XA 1ARKA 2ROTA 2VGNA 1AZEA 4RAGA 3WTZA 1CKBA 2HDCA 4MIMA 1RADB 1ZAOA 4ESFA 3SDBA 3J81R 4RTWA 4NUBA 4BXFA 4P5OA 1X4OA 4XONA 2P4RA 3PFIA 4B3AA 2HYJA 1HXDA 1K4TA 2RN7A 1HKQA 3OYAA 1JJ8C 1UFFA 1GFCA 2YUPA 4XU1A 1WJCA 1YLFA 3KEYA 4C8QB 4X0GA 4MQVA 2ECBA 1G5VA 3ABTA 3O8HA 3CP2A 3Q0UA 5KE2A 3MO8A 1IN8A 3SWNB 2ZC2A 1UG1A 2Q8KA 2OTLA 2F5DA 3ELKA 1HDDC 3DXJF 1RAEB 1S7EA 4MZPA 2FE3A 1Q81C 1LJOA 2R7QA 1UGPB 2HCKA 3LA3A 2RN8A 1W0TA 2VKDA 2DDBA 5CPRB 1VQ9I 2VUMJ 3PO2J 4DOZA 4HA8A 1XCBA 1V5FA 3OYMA 3JAMR 3K4LA 2K7AA 3MKWB 5FLXZ 4F55A 4N0BA 3C7JA 2NVXJ 1NPPA 2DZCA 3JCMh 3ZXSA 4DBRA 3I56Q 1MBEA 3A8LB 3QDFA 4A3JJ 4OOIA 2KY9A 3VODA 2FOKA 1O7LA 3S1QJ 2YSRA 3PGGA 2RJEA 1Z0XA 5GAOm 2K9MA 5FB2A 4WWCA 3RJPA 1RAIB 2HKNA 1W4MA 3MWMA 1ACMB 3GBQA 3T5XA 2A08A 5KVRA 3VSLA 2DFEA 3IP4B 3PSFA 4X6AJ 2LX9A 2ZZDA 2DERA 4WXDA 2MA3A 2LOOA 1ZBXA 4Y3OA 1N77A 2RK2A 5GAN6 3HBLA 4Q47A 1XJWB 2VI6A 2QG9B 1VQOQ 4EJTA 1BJAA 2YS9A 3KP5A 2DDAA 2RB6A 2RJCA 3EG2A 3DBLB 1IZ1A 1KJWA 1HC8A 4M75G 3I56A 2RHIA 1TW3A 1BC7C 2ZSIB 1B4AA 1GT0C 2P6TA 5BOXA 4RGUA 1FTZA 5EDNA 4KA4A 3MKDA 2ADUA 2AHJB 3CMAQ 2IPQX 3IWZA 1T98A 2GXGA 1GVDA 1QGPA 2NVYJ 5J6XA 2W24A 3ECHA 3CCUI 1GDTA 3HTSB 5ED4A 1NYFA 3WE3A 1QNTA 2ZKZA 2CP6A 3BR6A 1JGSA 2FQ4A 2W84A 1SRLA 4MDWA 4MFEA 3URGA 1VUBA 3S2DJ 4RS8A 5E1XA 4ON0A 1KA8A 1ETWA 3COAC 4PL6A 2CDTA 3R6SA 3DKYA 1BJZA 4M6VA 2FBIA 1B7TA 3CESA 2K5FA 1V5GA 1X4PA 5F0CA 4JX6A 2ME6A 1JJ2S 5GAMf 4MZMA 3S17J 3RZOJ 4P9FA 3OYFA 2M9HA 3AL0B 4I0AA 3VS0A 4LG3A 5BS6A 4GCVA 4BB7A 7AT1B 4LJZF 4X1EA 1TP4A 1G83A 3LH0A 2JS0A 4D8KA 1W5CC 2JVHA 3RQIA 5GAMe 1VQ8I 4L5EA 3LWFA 1EA3A 1WVRA 4MQ9F 2W00A 3OYHA 3JRDA 1DP3A 1RACB 2OI3A 2D2WA 2DVJA 2RHUA 2PVGB 2L3DA 3UATA 1ZA2B 1K73C 2M34A 2LDMA 1NJIR 3TBIA 4TV7A 2L3RA 4CCNA 2DEUA 2JTMA 2BBYA 2O4XB 3DKWA 2GBYA 2IXSA 3Q9VA 1FYMA 2V26A 1Y71A 4IRHA 1RIOH 4A4HA 4F7UG 3HSBA 1S72T 2F2WA 2RI2A 3R60A 5DEQA 5H6RA 2F69A 2E1MC 2J05A 2EB7A 3CCJA 1G3YA 1M2OA 2ZO4A 3FKJA 2W1OA 1Z6TA 4D0PA 2DL3A 2EAYA 1Y0UA 1FBQA 3OSFA 2XC7A 3FRNA 4KH1B 4N4NB 2KIQA 4Y13A 4M77G 5IH2A 1D3YA 1FBSA 2F5KA 5HLHA 1C1AA 2FUG2 5DDGA 1YJWA 5J39A 1IXDA 2F5EA 5J8FA 3ZPLA 2LJ0A 2WSFE 1K1ZA 3TKYA 1V76A 2FYKA 3DPUA 1ETOA 2MW8A 4FHTA 4UVBA 4BQQA 1V4RA 2IPOB 1W2BP 3DF8A 2ATCB 1A0NB 2JUGA 1L0OC 2L4AA 1IUFA 2CV1A 3REBB 3I55A 1EIFA 4BQAA 4UUSB 2H6BA 3LSKA 2YRCA 2XKOA 1ULYA 4HX4A 4EJUA 5JVTA 5A2QK 1QPMA 4FL6A 2K3PA 4R56A 1Q1HA 2FSWA 3F72A 2EWNA 3EQLF 1ZSGA 2LRDA 4C3IJ 1OZ2A 1OLTA 2Z0WA 1HA8A 1T0FA 3OYEA 3L7WA 3I71A 4XU2A 3JB9G 3QWXX 5KK1A 4S0HB 1BKBA 1NM7A 2L01A 2MMPA 4BD3A 2VPLA 2DIGA 1RPWA 5LJ5e 1XSDA 1SAUA 4V2FA 2E3HA 1YX3A 3OYCA 1ZRFA 1VQNI 3FIFA 3PUFA 4JX4A 1MMDA 3G4ST 2NUPB 3LSMA 3CC7A 2XF6A 1ETXA 5B5EC 4BQOA 2A61A 2L4MA 3EETA 3UA6A 1YIJQ 1KU9A 2VPRA 3PJRA 4BJTA 4JBAA 4AU7A 3CBOA 1O57A 1E3OC 1WX6A 1GCQC 3WGHA 4CZCA 1WH5A 5EJCA 1UG2A 1EX4A 5DYMA 3ZMDA 1X01A 3SYTA 3CUQC 2RI5A 2D6FA 5JHFA 2H3JA 4ZGEB 2B7EA 4U0YA 1LEBA 4L5JA 2QBYB 4XORA 2HZTA 1SEUA 2HOSA 4J9FA 2G6FX 1JE8A 4XU0A 1MBJA 4RLFA 1WSUA 2CKKA 5GAOq 3F21A 3IHUA 4C5IA 1D8KA 2C06A 3ABKH 2K5CA 1MJBA 4M78C 3EAEA 1G2BA 2LKSA 2JT1A 2DVEA 1R1TA 2CS3A 3EUAA 4I76A 1YYVA 5IT3A 1QA6A 1QZEA 1UE9A 2E64A 5DD4A 1XDUA 3KP6A 2VUBA 4IUUA 1ORKA 4FE7A 4Y33A 3M4GA 2GWRA 2EQMA 4LNPA 3N97A 4RAFA 1QVGA 2HQAA 3MVPA 1KZHA 5HOOA 4D1QA 1Q86R 2HL5C 2MG4A 1JEGA 5IYDJ 4FQGA 2RC4A 3MAJA 4NBQA 3IH2A 5CK9A 5J4VA 1BCMA 4XMYA 4RMOA 3JW4A 4P9UA 2QI2A 4HXJA 1OJLA 2V6EA 2FBHA 3WU0A 3ZL7C 4QPOA 2QGFB 5IOZA 3IAM2 3OSSC 2M0YA 3QZ9B 1NJIC 1IRFA 3P9CA 3OYKA 3AG4H 5E3OA 2R7ZJ 3NTHA 1WQWA 2VODA 4CC7A 3CF2A 1LJ9A 3S16J 1GFDA 2Y31A 4HCBA 2K40A 1VA7A 1UFMA 4MHGA 4EJWA 5L3BA 4AFSC 2O01E 2OTJA 2XSDC 4F93B 2Y30A 2K4YA 1U9OA 3JRIA 3L2WA 1ERDA 1M2VA 3GTQJ 3WODF 1X2KA 2YUNA 3FXLA 2BY2A 3IC7A 3EPZA 2M3AA 2EFOA 2M45A 4LK1F 3ZQFA 4UY8I 1OU9A 1PSFA 4M75E 4S05A 2O8XA 5ICGA 4K11A 2MD5A 2FMYA 3BT9A 2WB1N 2DMOA 3PE0A 3ULQB 2HEQA 2QUFA 3V8JA 4Q48A 1EFNA 1U06A 3BZ6A 1WLPB 2KE9A 4RB0A 2VGMA 1Z6RA 4C92G 1M1KR 1DGRM 1O3TA 1MHNA 1JHFA 1ZLMA 4NB5A 2EPDA 2QTXA 1R5HA 1KONA 2EIMH 2JJ7A 2P8TA 3SFMA 2H3EB 4A4KA 3LSGA 3EFOB 4IRIA 1RAHB 4MNUA 2KPMA 5HODA 1FOXA 2LVMA 1VQMA 2R3SA 4J01A 1IJWC 4XIDA 3M0SA 4OGEA 2DBBA 3VU3C 3I5SA 3UF4A 2R7TA 3GTJJ 3HOYJ 2CH4A 4RG2A 2JA5J 4BJ6C 1CSKA 1WFWA 5FLVA 2H94A 3F8MA 2ISZA 1FSHA 2EZIA 2F1LA 4HLXA 3H0IA 4FYVB 3BOQA 4C92C 1GBRA 3MEWA 4UVCA 3EG0A 2DA9A
chains in the Genus database with same CATH topology
3JCMb 2L8DA 1I6XA 2YU3A 2V1UA 2LNVA 3TCJA 3A8GB 3KP7A 2XDBA 2EA2A 4M78G 1B59A 1LEAA 2XI9A 1GXIE 2MH2A 4HT9A 4PJOB 3RUXA 3JCMQ 6PAXA 1OMIA 1OYXA 4EM0B 1I5LA 1SFEA 4ZGJB 3E97A 4HYEA 5EEHA 4CRIA 4N4IA 4RB2C 4ELZC 2K86A 5CJ9A 4X34A 5FROA 2A3LA 5DCMA 4ASNA 1B34B 2E10A 3E6MA 3LW5E