3GLXA

Crystal structure analysis of the dtxr(e175k) complexed with ni(ii)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
221
structure length
211
Chain Sequence
b'DTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEACRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVPGTRVIDAATSMPRKVRIVQINEIFQVKTDQFTQLLDADIRVGSEVEIVDRDHITLSHKDVELLDDLAHTIRIEEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diphtheria toxin repressor
molecule tags Transcription
source organism Corynebacterium diphtheriae
publication title Decreased sensitivity to changes in the concentration of metal ions as the basis for the hyperactivity of DtxR(E175K).
pubmed doi rcsb
total genus 63
structure length 211
sequence length 221
ec nomenclature
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3glxA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 3glxA02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3glxA03
2STTA 5L3FA 4RGRA 3CJNA 3VEPA 1Z9CA 1FP2A 2DBBA 3I58A 1IRGA 3V8LA 3E5UA 5J6XA 2RKHA 2XASA 2XAQA 1YW7A 3IL2A 4UVCA 4FX0A 3QPTA 2KIMA 1REPC 1IF1A 3E6DA 5H20A 2A6HF 3WTZA 3E6CC 3T1BA 3BJ6A 1LDDA 1Z7UA 1DPUA 3E6MA 1K78B 4MTDA 4GYGA 1MJBA 3O6BB 5E17F 5E8IA 1LDKB 3FZVA 3PFIA 4Q5SF 1W7PA 3T8TA 5D5VB 5L3GA 1WSUA 4A12A 1I1SA 4A0YA 3M9AA 3HUGA 1ZH5A 4I2OA 2G7HA 2ESHA 3QU3A 3BOQA 4XSZF 4HX8A 1IN6A 4XLPF 3WODF 1RUNA 3ML6A 3RIRA 3ZMUA 4M6YA 4UXNA 3GYHX 4BQAA 4JK1X 5HVQC 3EYYA 4I0AA 3RYRA 1IN8A 3WG9A 3DPTA 3ZN0A 1Z91A 2HGCA 4OMYA 1P2FA 4EGYA 1UFMA 3GFMA 4LGWA 1VTNC 5DYMA 1LEAA 2BV6A 4GYIA 4WCGA 2KIUA 1BI3A 1G3YA 1T0FA 1F9NA 1LB2A 4IHTA 3LAPA 1Z6TA 3I59A 3B02A 1SMYF 2GXBA 3CUQB 3JTGA 1U2WA 4IHSA 1Z1DA 3E97A 5LBQA 3IWZA 1LQ1A 5JHUA 4CXFA 3WU0A 3M8FA 1GVJA 2HEOA 5K5OA 2E7XA 3IRRA 5H6QA 2DW4A 2Z3YA 3EYIA 5FD6A 3AAFA 4E70A 1J75A 1KQ8A 1R7JA 3KZZA 3WTTC 2P4WA 1C0WA 1B1BA 2QBYA 4FHTA 4LD5A 1IN7A 1Z05A 2A61A 3U1DA 3P7NA 4CO8A 1YFHA 1YW9A 2FRHA 4OOIA 2ESNA 4EV0A 2XAGA 4L0YB 4BH9A 2GA2A 1CGPA 2A6EF 2HTSA 1S7AA 1BI2A 1HSJA 1BIBA 2RGVA 2VC1A 1CF7A 4A0XA 2D1VA 3ZMSA 1LNWA 2OAZA 1SD7A 1XSDA 1OYYA 2LSOA 2DT5A 4LJZF 2VE8A 5F64A 2KJCA 3KZYA 1R23A 3FMSA 3JAMZ 1JE8A 3BPVA 2VT2A 3QAHA 5HS8A 4P9FA 5FO5A 4UV8A 4N9IA 4U7DA 4HV5A 2ISYA 1USTA 1W4MA 4G6QA 2MH9A 5HLGA 5BMZA 1B6AA 3TOBA 1IUYA 2VBYA 4WXDA 3L7WA 3GZ6A 1CF7B 2XIGA 1XDSA 4AIHA 2BGCA 4YG2F 6PAXA 4AIJA 1FC3A 4IXAA 5L3BA 4ZYHA 2K86A 3J80Z 2ZJ2A 3KP6A 4ZH4F 2H09A 1PP8F 1P4WA 2GZWA 2M87A 3BROA 3KP2A 1KU7A 4H0EA 1V3FA 2EFOA 3DKWA 5DUKA 3QOPA 4L9VA 3RDIA 1XGOA 3HRTA 2TDXA 2ZNZA 2QLZA 1HKSA 5L3EA 3DPLC 1XMAA 1AOYA 1G4DA 1ON1A 3PQJA 2HTJA 2LNBA 2AXLA 1HXDA 3F8BA 2ZKZA 4A6EA 3ZN1A 4G6DA 1K6OA 2W85A 1W7PD 3LSTA 3WTUC 2W25A 4CGZA 3LQQA 1P6RA 2F5DA 2MLKA 1JXSA 4EM0B 3K2ZA 4L9TA 5LHGA 1X3UA 3FMQA 2Q0OA 4G8XA 4XSXF 1R1UA 4HLYA 3S2WA 1BC8C 3TOAA 2HYFA 4EM1A 5DCFA 1ZLKA 2Z99A 1FX7A 1LEBA 2XKPA 2H6CA 2DQLA 2O6GE 5IT9K 4EMSA 2XRNA 4M73A 2O3FA 2P7VB 3U2RA 4I09A 2XAJA 4OIOF 3L00A 3FWEA 2QQ9A 1F1ZA 5BPDA 3H3ZA 3G73A 2XROA 2CGPA 1R58A 1FSEA 1ZG5A 3ERED 1HW1A 2LDUA 4UV9A 4A2UA 3QPHA 3WTYC 1L0OC 4A0ZA 2L01A 4M6XA 2QYOA 2X0LA 2FQ3A 1U6GA 3V8JA 3C7JA 1BIAA 4RS8A 4ZYEA 4ON0A 3IRQA 3DEUA 3M8EA 2XVCA 4WXHA 2R7FA 4LLNA 2FBKA 1U3EM 1ZRCA 1OMIA 2QUFA 1L3LA 2PJPA 4Q4ZF 2P6TA 2W57A 4MEXF 2DAOA 1KQ9A 5CVJA 4OINF 5JI6A 4S05A 3B73A 4Y15A 2PQ8A 2HDCA 3HRSA 5FFZA 1MZBA 1U5TB 2JRTA 3ECOA 3F3XA 4HAMA 1KQ0A 3CLOA 4HOBA 2PN6A 3J81K 2EA4A 2YR2A 2CW0F 5KVRA 2B0LA 2LKPA 4TV7A 1XGNA 1SD6A 4JQFA 1HW5A 1USSA 1FBQA 1XSVA 2EFQA 2XUBA 1BBYA 1TNSA 1FT9A 2IA1A 5AIQA 1ULYA 1TW3A 3C1DA 1MDMA 2IRFG 5HLHA 4EVIA 2A3SA 2K02A 3ELKA 4M9ZA 2NNNA 1BOAA 2VBZA 4I02A 2H6BA 3F8CA 4A5NA 4F7ZA 1F4KA 4JBAA 5D6FA 1UCRA 1ZG3A 3P9CA 1T39A 1YQAA 3LQRA 1G6NA 2Y0MA 2BEOA 4L5JA 4AIKA 4GCVA 3GFLA 4I7HA 4RAYA 2W84A 2XAFA 4RB0A 4UVAA 1RI7A 3EDPA 2LF7A 2UXXA 4BHCA 2EV0A 4HF2A 4RGUA 2IA0A 4EJVA 2MH2A 5J8CA 5CVVA 4RB2C 3KLNA 5CYVA 3CO6C 2DQRA 4HF1A 4LG0B 3WGIA 3SXYA 1ZREA 2MLGA 1QZYA 2VBWA 5LEKA 2IJLA 3VB2A 1K7AA 1R22A 1R1TA 5DCMB 3VOEA 3LA3A 3LA7A 2HR3A 1R5GA 5CVIA 2MD5A 3WTSC 5FFXA 1K79A 4YIFA 2E1CA 3NRVA 5K1YA 2IP2A 3JW4A 1R5HA 3M7GA 1LDJA 1J9IA 3ZP5A 1XGMA 2ETHA 2COMA 3LFKA 3CUOA 5D4RA 3RTRA 3P9IA 2O8XA 3REOA 4BXUA 3K1NA 1Q1HA 1J0RA 4PGGA 4HQMA 3MCZA 3U9GA 2IVMA 4WWCA 5DDGA 1S6LA 5DCMA 3JSOA 2OD5A 3E3VA 1H9GA 2ELHA 4CICA 1WKMA 4GXOA 4I0BA 2ZFWA 4M71A 3D5LA 2HS5A 3BP8A 4KIFA 5JFRA 3F22A 2XV4S 5DV5A 4D0PA 4CYDA 2EB7A 3RPUA 3K9TA 3KEQA 1TTYA 2M1BA 2XAHA 2JPBA 2HQRA 5CVRA 3VFZA 1YIOA 2PMHA 4NHJA 1HKTA 2M5WA 3T0YA 1O3RA 2KKOA 5FLXK 2HYGD 3TKYA 3HTSB 5E1ZB 2GXGA 3RKWA 1D5VA 3G3ZA 4M9SA 1T6SA 1J59A 5D5UB 3FMRA 1TQMA 3I71A 2E1NA 1FLIA 3EETA 3JAMK 4ENKA 5D8LB 2ACJA 3RI4A 4U0YA 3ZMDA 2KJBA 3F72A 2CFXA 2FMYA 3QP5A 2ZNYA 4A5MA 1STZA 4RB1A 2JPCA 4IJAA 2BYVE 1U5TA 4CZZA 4ESJA 2DU9A 3VODA 2K4YA 4L9NA 1ZGAA 1FNNA 3ULQB 2Y75A 3T5XA 4MTEA 4GO1A 4Q48A 3GUDA 2IW5A 3J81Z 1I6XA 1TW2A 2C6YA 2EFPA 1U5TC 5L3CA 3HSRA 1W5SA 5DD8A 3NEUA 4U88A 2G7UA 2F5FA 3TGNA 3GXOA 3R0AA 4P5OA 3TDUC 1HBXG 3SQNA 2EV5A 3LAJA 4KYWA 1QPMA 4BYYA 1H0MA 1YG2A 2DI3A 2V6CA 2OBPA 3K0LA 4BAYA 1KA8A 3MZYA 2EK5A 5E8GA 4A6DA 3EQLF 2ZXJA 1F5TA 1TBXA 2DPUA 3KP3A 3F6VA 3IKTA 1FYMA 4EM2A 2NS0A 2HWVA 5LLQA 1JHHA 2V1UA 3D0SA 4HLXA 3RKYA 3R6SA 3WE3A 5ICFA 1QO0D 2YSRA 1G3WA 3KP7A 4KN4X 3CO7C 4UVBA 3FXRA 1G3SA 2XGXA 4O3MA 2A68F 5HLIA 1ON2A 5AIPA 3HSEA 4I01A 1A04A 1O7LA 4XLNF 3WGGA 3TO6A 2BBYA 4HA8A 5D8KB 1U8RA 4KMUX 1IW7F 1ZGJA 4EQQA 3ABTA 2PG4A 5LHIA 3ZQ7A 3BZ6A 3IC7A 3I53A 5HDNA 4DQ2A 3ZPLA 3WTXC 4ASNA 5D5WB 2WV0A 1SMTA 1MD0A 5FLXZ 4OIPF 1ZARA 4LMYA 2HZTA 3GFIA 4L5IA 2K7LA 1FZPB 1IRFA 1HW2A 2P8TA 2A5YB 4GGGA 2ZO4A 3KP4A 2RQPA 4RB3C 1B9NA 1BM9A 5TRDA 2VC0A 5E1XA 3TQNA 1ZG1A 3LA2A 3GF2A 3MQ0A 2RC4A 4BNCA 3JSPA 4WF2A 5K5QA 1KGSA 5A2QZ 3JTHA 1T2KA 2FNPA 5LRRA 4LB6B 1IN4A 3WU1B 3R4KA 3E6BA 1WI9A 4KT5C 1W7PB 2ZCWA 5J8FA 1IN5A 4HX4A 1HSTA 4P9UA 3CDHA 5AONA 3MEXA 3HIFA 2YU3A 4Y13A 2CSOA 3WGHA 3WTWC 3SFZA 4WK8F 2A69F 1FBSA 4YFNF 1SFXA 4HF0A 5H6RA 5FB2A 1ONVA 2WC2A 1IAWA 2K5FA 2GA1A 4DNCA 2K5IA 2EFNA 1QBJA 4ZZLA 3QRFF 1YTYA 3FM5A 4P96A 4CDGA 4HDUA 4OU0A 4G7HF 4ESBA 1KU2A 3MWMA 5CJ9A 2E7WA 3HTUA 2BE5F 2M30A 4UNOA 2CYYA 2XHKA 1DUXC 1XB4A 3ECHA 2OZ6A 3SHFA 1BC7C 4PZJA 3HRUA 4LLLA 1D8KA 2O61A 1TQIA 1Z6RA 1XGSA 4G7OF 1LVAA 1SD4A 3PQKA 3V4GA 3DF8A 4MEYF 1ZN2A 2V79A 2V9VA 5E18F 4HX7A 1SFUA 1T98A 1QNTA 2RN7A 3O2PE 1O3TA 1B9MA 4KA4A 2DLLA 2EV6A 5CLSA 1ZLJA 2K4BA 4FX4A 2K5LA 1FBUA 4ZYGA 3KE2A 2K27A 2YX7A 4MQVA 5JR3A 2FF4A 4ENNA 4HBLA 4MQ9F 2FEZA 1EH8A 5ICEA 1PP7U 3I0TA 2UXNA 1SD5A 2GQQA 2RDPA 1FYLA 1ZAOA 4UUVA 1DPRA 5EEGA 2GWRA 3J7AO 2A07F 3E5XA 3BWGA 3RKXA 1UHWA 4G94A 3E5QA 3QP6A 5HS7A 4XBFA 3DV8A 2IPQX 4QWQA 4PCQA 4K2EA 1T38A 1YO5C 3KCCA 4HW0A 1RIOH 4UHTA 1O3QA 1XD7A 2CWEA 4Y17A 1TQPA 1R00A 2H3JA 3MHXA 5E1WA 2UWMA 3Q9VA 2HKXA 1HKQA 2VBXA 3GO5A 5BQTA 3F6OA 3CUQC 2KRFA 1P4AA 5BS6A 1PDNC 2J5PA 1ZYRF 5BOXA 2L54A 1GXPA 2NRAC 3H3UA 1WRJA 2NNYA 4AVPA 3V7CA 2NAZA 3FHZA 2EJRA 1UHMA 1IZ1A 2RNJA 1I5ZA 3RYPA 1IXSB 4CHUA 3FXUA 2QM3A 4EJWA 4N0BA 1Y0UA 2PEXA 1RZ4A 5ICGA 4HQEA 2FOKA 5F1RA 3I4PA 1IXRC 4MHGA 2GIVA 2O0YA 4U7BA 2PI0A 1DDNA 4RGSA 3R0JA 3WE2A 4Z2YA 1YS6A 1MGTA 4PDKA 4M72A 1TLHB 3BJOA 5K5RA 1O3SA 2FBIA 1HQCA 2K4JA 4N9HA 3E19A 4KIGA 2M8EA 3KEOA 2Y48A 1SAXA 4KN7X 2QVOA 3GX4X 2R7DA 1PUEE 1J7KA 3Q9SA 1OYIA 5D5XB 3FX3A 2Z33A 2D45A 2FBHA 2D1HA 3K1MA 1EV7A 3HSFA 3J80K 2Z9OA 4G7ZF 2P6SA 5ILUA 1S29A 1ZHFA 2QQAA 4L0ZB 5L3DA 1KU3A 1AWCA 2L3DA 1EH7A 5BPIA 3W6JB 3GFJA 3K69A 1FY7A 3MAJA 1K78A 3BDDA 1G3TA 2H94A 4QLCU 1OYWA 2Z5UA 2OU2A 2L4MA 1XN7A 2RVCA 3V8KA 2EWNA 1WWXA 4KICA 3QU6A 4L9JA 3P9KA 2CG4A 2P5KA 4OIRF 3FXQA 5HS9A 1QVPA 2PBIA 5TJJA 1P92A 2CO5A 1KU9A 2DFIA 1FPQA 2OQGA 2W24A 2FA5A 3F8NA 1BJAA 2STWA 3I59B 3RPQA 4O6JA 2F5CA 2VN2A 4B8XA 4MGRA 4U0VA 2VOOA 4EGZA 1UB9A 1YW8A 3NQOA 5D4SA 3HOTA 1E17A 1QZZA 3L9FA 1R1VA 2PLYA 2OZUA 3V7RA 4LK1F 1TNTA 3N4MA 4WXCA 2UZKA 3DFGA 3TDZC 2WWYA 1NHAA 3FM3A 1BYMA 2M45A 3M1EA 1MKMA 4IPAA 1BI1A 2FSWA 1QQIA 3KLOA 3MZHA 4EJTA 2DO7A 5HOOA 4RGXA 1I1GA 2EFWA 4KNYA 3GLXA 2LF8A 1LJ9A 4P55A 5IT3A 1S8NA 1S7OA 4KIBA 3KETA 3H92A 2QWWA 3ZMZA 2QENA 1BN5A 2VOPA 1XCBA 1O57A 2JZYA 4S04A 3SZTA 1OR7A 4I98B 4B09A 3GEZA 4AWXB 2JTVA 2D2WA 1YYVA 5HDKA 3OOPA 2F2EA 1B4AA 1FSHA 2HQNA 2GAUA 4ZZDA 1I27A 2GCXA 2YX4A 2Q2EA 3I54A 4ENMA 3R61A 3HHGA 2Q8KA 2HKOA 1XCVA 4WX9A 1FP1D 3HYIA 5LGTA 4IRHA 4FT8A 3W6KB 2R3SA 1KYZA 3EUHA 3GZ5A 3KFWX 2XKOA 2AS5F 3LWFA 5LGUA 4LG0A 1R36A 3C18A 2ZMEB 4M9XA 3ROUA 3TO7A 2MC3A 1QW1A 4HYEA 1SFEA 3OV8A 4O5VA 2DK8A 2RV8A 4YFXF 3ISPA 2G9WA 5D6EA 1U78A 4HDVA 3GVAA 4LK0F 3HHHA 3N97A 3GWZA 1D3YA 2HFHA 4HZFA 5LGNA 1XDUA 3SZPA 3ZMTA 1DP7P 2VODA 1V4RA 3KP5A 2FE3A 4BHPA 4AD9A 1XMKA 3BJAA 2V1XA 2JSCA 4LFUA 4EJUA 4M74A 5LHHA 2VT3A 4BHBA 1ZRDA 2V1DA 3COAC 4ETSA 1B59A 3F8MA 2QZ8A 4L18B 1EH6A 1MJ9A 2NYXA 4U0WA 1MJAA 4YFKF 3HOSA 2MA3A 5KK1A 1MDMB 2QQBA 1J2XA 2KIFA 2P5LC 5IT9Z 3DQVC 4LB5A 2FNAA 3F21A 1FOKA 5ICCA 3ABUA 1YS7A 2JT1A 5JVTA 3K1PA 1IXCA 2O03A 3RJPA 2CQKA 2MBFA 1XSXA 5EEHA 5LRSA 2LX9A 1RUOA 1J5YA 3Q5FA 1RNLA 1BI0A 4G9YA 4KMFA 1ZRFA 4OMZA 4ESFA 5ED4A 3IKVA 4R79A 2ADUA 4PGHA 2FXAA 2ISZA 5CVUA 4IVNA 2EA2A 4IF4A 5E20A 1FWZA 4IRGA 3WTVC 4XRFA 4R1HA 2P5VA 2H27A 3DXJF 2OQRA 5FGMA 4KFCA 2X4HA 2F5EA 3F23A 3TO9A 2YPRA 3L09A 4EJOA 4KUMA 2P7CB 5F6FA 2DTRA 3V7SA 4NB5A 3HRMA 2VXZA 4RAZA 4YIIA 2HOEA 2OA4A 2VE9A 1GXQA 1YLFA 2PFBA 2QBYB 3CTAA 5ERIA 3IHUA 4KDPA 1WQ2A 1OPCA 1OKRA 2FU4A 2IA2A 2WTEA 5HDGA 2PMUA 2FMLA 3BY6A 1KYWA 1P4XA 3DP7A 5DD4A 3CUQA 5FD5A 4OIQF 4Q47A 4NQWA 1D8JA 2ZBKA 1H9TA 4HV6A 3F8FA 3O3KA 4ENJA 1QGPA 2IT0A 2ZMEA 3L2CA 4LLGF 3GW2A 4ZYDA 1GHCA 3I64A 1S3JA 1JGSA 1FYKA 1E2XA 3BPXA 3MFKA 1O7FA 4R8HA 5DUIA 3C3WA 2L4AA 5A2QK 5ILVA 3R60A 3T8RA 5ILSA 2VONA 5LEJA 4IRIA 3ZMVA 1JHFA 2L02A 3I5UA 2DK5A 2J5OA 4MNUA 5DEQA 1ODDA 3FF5A 2DPDA 3IWFA 1W5TA
chains in the Genus database with same CATH superfamily
4IOAF 2IBDA 1TSFA 2RQUA 4JRIA 2STTA 3FLGA 5L3FA 2DOEA 1F43A 4RGRA 2IIMA 3CJNA 2L8DA 2PU9B 3SEZA 3OSSC 4RMNA 2HQ5A 2DEQA 3VEPA 4BXXJ 5KE2A 3X28B 1Z9CA 1FP2A 1UG1A 1QVGA 3QWYA 1PG5B 2DBBA 4XTXA 1K9MC 3I58A 2M9UA 2KEAA 2QDLA 4RTTA 2JA2A 3CC7Q 3NWSA 4HRIA 1D0XA 5B66C 2KYBA 1IRGA 3I35A 3BG9A 3V8LA 4HEA2 2ATCB 4M78F 3E5UA 2ZJQF 2LT1A 2RO0A 5J6XA 3VDXA 3M07A 1VQ5I 3JCMV 4RLFA 3G71Q 3ZFJA 4M75B 2IGMA 2XASA 2XAQA 2RKHA 1AEYA 3QYBA 1MW7A 2A3LA 2WAEA 1YW7A 5E3MA 2BXZA 2ZPIB 4KBMB 3IL2A 4UVCA 3HOZJ 1VQ5T 1OLTA 3CCLI 4BE0A 2L7FP 1YP5A 2HMAA 3RERA 4FX0A 3QPTA 1MMNA 2KIMA 3CMEQ 3FXMA 1JB0E 2JA5J 1RAEB 4A3MJ 2DMUA 3BZCA 2E2HJ 1M4ZA 4ATOA 5HK3A 4UUTA 2AK5A 2JA7J 4YEJA 4LITA 4CC7A 1REPC 3OYMA 3K2AA 1IF1A 1Z67A 3K4NA 3E6DA 1YJ9T 1Q7YC 3C12A 2DD5A 4XR6A 5H20A 3ZQIA 1OULA 2A6HF 4EATA 3MP6A 3WTZA 4A4GA 2V6EA 4EDUA 5AT1B 4PJLA 1ORKA 2LKXA 4J00A 3IQLA 1VQ7T 3E6CC 1Y96B 1N8RC 2X6XA 3T1BA 3BJ6A 1LDDA 1A36A 2CP7A 1N25A 1Z7UA 2EJFA 1DPUA 2A36A 1WH5A 2XF7A 2JVGA 3E6MA 4MTDA 1K78B 2HDAA 1D09B 2K7AA 2CS7A 4JDSA 4EPCA 4GYGA 2KSSA 4HCCA 1MJBA 1JTYA 3O6BB 5E17F 5E8IA 4A3LJ 1LDKB 1YBYA 3FZVA 3PFIA 1ZGWA 1FMVA 2Y30A 4Q5SF 1Y0MA 1W7PA 2H8WA 4C2TA 3T8TA 5D5VB 1SEMA 3OL4A 4DA4A 5L3GA 3K70C 3A01B 1RAAB 1WSUA 2V26A 4A12A 1I1SA 4ZGJB 4Z89A 3HGYA 5I11A 2WY8Q 1OV3A 1M3CA 2V8KA 3OW2P 3SEQA 4A0YA 3NAUA 3VRZA 1M2VA 3CC4A 2EZKA 3HUGA 3M9AA 5CPRB 1ZH5A 1FYNA 2CKKA 4I2OA 2G7HA 2ESHA 3QU3A 4D7MA 1HDPA 4IO9F 3K7AJ 2M0MA 1G8XA 5CIUA 5J3LA 3EFSA 3IH4A 1PVEA 3BCAA 3BOQA 1C6VX 1LFPA 4XSZF 3MEAA 4HX8A 1IN6A 1IG7A 1VIEA 4XLPF 1YJWT 2R93J 5GANh 3F0CA 3BR3A 2LLKA 4FE7A 3WODF 2EIJH 1XOVA 3VYHB 2XDDA 5M9OA 1RUNA 3ML6A 3RIRA 4F7UE 1Q86U 2ZB9A 2R7VA 2M4GA 3LWHA 3ZR8X 5GAOr 3ZMUA 3OYDA 4M6YA 3GBQA 4M77F 2F4OB 4UXNA 3A8HB 3GYHX 4BQAA 4JK1X 2ELJA 3IAS2 5HVQC 1I4K1 3EYYA 2LZ6B 3M0QA 4I0AA 5GAN8 4NNJA 4IEJA 3G6EI 3RYRA 1BB9A 1IN8A 3PVLA 1TUGB 3WG9A 3J80E 3DPTA 3ZN0A 1Z91A 1IGNA 2HGCA 1D0YA 2HNHA 4OMYA 1P2FA 5J47A 4EGYA 4A3KJ 1UFMA 1VUBA 5M5XJ 1YJ9I 3SYTA 3GFMA 3VV0A 3CMMA 2YU9J 4XK8E 4LGWA 2JW4A 5HNFA 5DYMA 1VTNC 9ATCB 1W0TA 2OTLT 1QCOA 1IRXA 2HPMA 1LEAA 1WI7A 1M30A 2LP5A 1PRMC 2BV6A 1TT0A 5B1AH 1OZ3A 5IH2A 4GYIA 3VS7A 4WCGA 2KIUA 3A01A 4BKXA 2QTVA 3FIWA 5HY6A 3KXTA 1BI3A 1G3YA 3OYAA 4DZPA 1VQ8T 1T0FA 1F9NA 1LB2A 3FHNA 3D5SC 1KC8R 1R49A 2DVEA 4IHTA 3LAPA 4FTHA 2HQAA 1Z6TA 2ENMA 3JB9J 3M1CA 3I59A 2XRLA 1X1DA 3B02A 1SMYF 2DBMA 3FB9A 3UA6A 3K6GA 2GXBA 4QPQA 4LUEA 2CP0A 3CUQB 3JTGA 1U2WA 2DXBA 2JXBA 4IHSA 3FC3A 1YN8A 2GOXB 1Z1DA 1VQ5A 3E97A 4C30A 5LBQA 3IWZA 2BIVA 1LQ1A 1ZTRA 3PO2J 3LH5A 4F7UB 4F7UG 1VQ4A 5JHUA 4CXFA 3WU0A 3AFHA 1M3BA 5DM7R 2JJ7A 3QZ9B 1Z77A 2HI3A 4B1RA 4MZTA 3BE3A 3A52A 2K3YA 3M8FA 3PIOA 1GVJA 2VXDA 1I1JA 1J09A 5KCMA 2HEOA 5K5OA 4E6KG 3A5ZB 2E7XA 1SAUA 3IRRA 4ZC3A 3LWIA 2GXAA 4D1QA 4A3JJ 2DTOA 2FX0A 3ABMH 4ZTJA 5H6QA 2OV7A 2DW4A 2AKKA 2KL4A 2Z3YA 4XMYA 3VRYA 4IURA 2CFOA 1WCMJ 3EYIA 2AXTC 1KK7A 2M0OA 5FD6A 3AAFA 2SRCA 2LCCA 2LH9A 4E70A 1MIJA 1WDXA 3EH2A 1W2BS 1J75A 5FKOA 4HNVA 1KQ8A 1R7JA 4A93J 3OR1C 1QQJA 4OMPA 3PNTA 3KZZA 3WTTC 2P4WA 1PD1A 2QEXA 1C0WA 4E7IA 1B1BA 1B7TA 4JJDA 3TMOA 2BVMA 2QBYA 3PMIA 4FHTA 4LD5A 2QYZA 5GANg 1R4NB 2ZPBB 1YNZA 3RKQA 3SD4A 1IN7A 1YFNA 4QVZA 4BD3A 2XGDA 4PL6A 4HSRA 1Z05A 3SDBA 2XAUA 2A61A 3DPUA 9ANTA 2OF7A 3U1DA 1X6BA 3OS5A 1OCRH 2D0QB 3E0JB 2DOAA 3P7NA 2X48A 3CJRB 2DZ9A 4CO8A 1YFHA 1YW9A 2FRHA 4OOIA 2BE9B 1TTHB 2JNGA 5DLOA 2K9GA 2ESNA 4EV0A 3R6OA 4M7DC 2CUJA 1D1AA 2V4JC 2XAGA 4L0YB 3JAMR 1A6QA 4BH9A 2HQXA 5GJVB 2GA2A 2M1HA 1OISA 4QPOA 4IZZA 2D1XA 1CGPA 2A6EF 4C92C 4LDXA 3LSIA 2O4XA 3VS2A 3F9KA 1VQPI 2CSQA 2DETA 3LSHA 2HTSA 3OY9A 3CCEQ 3JREA 1S7AA 2RHXA 1BI2A 1HSJA 3I55Q 1BIBA 2RGVA 5GAEJ 1IO6A 3A4CA 2V1RA 4Y92A 4AC0A 4A3BJ 1VQ6A 3JCMd 1WPKA 5FLXR 1Y7XA 2VC1A 2ZPGB 1G83A 3OB9A 4V2FA 1CF7A 1N77A 1K4SA 1YRNA 2AT1B 4MIMA 4A0XA 2PTKA 4KGVB 8ATCB 1Z9QA 2D1VA 3DLMA 4B48A 3CMAQ 3BR6A 3ZMSA 1LNWA 5GAMe 2OAZA 1SD7A 4AU7A 1XSDA 1OYYA 2LSOA 3QHSA 2DT5A 3H1CA 3VSKA 4LJZF 2L9RA 1XTDA 2E4HA 3CDLA 2DMOA 2VE8A 2M2EA 4LG3A 5E79C 1YITI 1NEGA 5GANf 3I56T 5F64A 5KYXA 2E35A 1ABQA 2OAUA 2KJCA 5GADJ 3KZYA 4IX7A 1NK3P 2MIOA 1R23A 3HOUJ 1M1FA 2KK4A 4CC2A 3FMSA 4PUSA 3M8JA 3JAMZ 1JE8A 3BPVA 1VQ5Q 2VT2A 2L2PA 1HCRA 3VS6A 1OPLA 3G71I 4Z02A 3QAHA 1VQNA 4JX5A 5HS8A 5K7HA 2VQGA 4P9FA 2J6OA 5FO5A 4TVRA 3JB9H 5KYNA 5F0HA 4KT0E 4UV8A 4N9IA 2CUZA 2NOJB 1DU0A 2L3QA 2K9NA 4P1WA 4CC4B 4U7DA 4HV5A 2EYYA 3IWFA 3PL8A 3ZCOA 1JKRC 2O2OA 3WXMB 2JM8A 2ISYA 4CSWA 2XPUA 4L6V5 4LDYA 3S32A 5IPAA 5E3NA 2QQSA 3OSFA 1RPWA 1USTA 1W4MA 1NLPC 4JPBW 4G6QA 5CKFA 1WJQA 3JCMQ 2MH9A 3IV5A 1PNJA 2NVQJ 2H8HA 5IOYA 2DERA 3DLAA 4D9JA 4B9XA 5HLGA 3S17J 5BMZA 3CQZJ 1B6AA 3TOBA 2EIFA 1IUYA 2VBYA 3HP9A 3OW2A 4XN0A 1HYOA 4MO7A 1WX6A 5F27A 1QCFA 3H0IA 2NOGA 3TVTA 2EQKA 4XU1A 1JUMA 4WXDA 3L7WA 3GZ6A 1HC8A 4ZGEB 1CF7B 2XIGA 4DOVA 4BEHB 1YITA 1XDSA 4AIHA 2GM4A 3ER0A 1RESA 2BGCA 4JS4A 1I81A 3H6ZA 3TP0A 3CCUT 4YG2F 2E2JJ 5FWBA 6PAXA 3GTJJ 4AIJA 2JTMA 4LDVA 1FC3A 4IXAA 5L3BA 1VQPT 1GXIE 4IQJA 3FJ5A 4ZYHA 4RG2A 5GMKe 4MMLA 4X9DA 4HVVA 2EQRA 2K86A 3J80Z 5CKHA 1I3AA 2ZJ2A 5M5YJ 4C0FA 4BXFA 3AHUA 1ZLMA 1GCQA 3S6WA 5CR2A 3KP6A 1ZSZA 2V9KA 4PJ0C 2PMZA 4ZH4F 1S72Q 5EF6A 5J4VA 2H09A 1PP8F 3RMSA 4CRIA 3G4ST 5EEAA 1P4WA 2GZWA 2M87A 3H9QA 2O9VA 2X4WA 3CCMT 1W36C 1GCQC 3BROA 3KP2A 2R5YB 2FZCB 1KU7A 5A0LA 2HOSA 2YHTA 2VV5A 4H0EA 1V3FA 2BW3A 2EFOA 3DKWA 4L5GA 3BR2A 1DGRM 1TWCJ 5DUKA 3QOPA 3HJEA 4J6XA 4L9VA 5KNLA 4OMNA 1SANA 1IXDA 3RDIA 3QYEA 2ZJRF 1XGOA 1ZHIA 3HRTA 3E9GA 4N0AC 2TDXA 3INZA 2ZNZA 2QLZA 2GQIA 1HKSA 3EGUA 4S0HB 3OYBA 5L3EA 1DU6A 3DPLC 2KYMA 3GP8A 3TSZA 2JUCA 3GBGA 4DBHA 1XMAA 1A31A 3H5RA 3KYLA 1AOYA 4PJMA 1G4DA 2LQ8A 1ON1A 1MV0B 2RJDA 3PQJA 2M4KA 1BW6A 2HTJA 1EFNA 1QHHD 4ABZA 5GAN3 3CCRT 2LNBA 2AXLA 1HXDA 3L2VA 1RR7A 3F8BA 3BLYA 2M34A 1OCTC 4FU6A 3GIBA 2ZXIA 2ZKZA 4A6EA 3S16J 1N9SA 1X75C 1YIJQ 3ZN1A 2EIKH 5J1YA 1BR4A 4G6DA 1K6OA 3RBBB 2W85A 1W7PD 1R9TJ 4EIKA 1OCZH 3LSTA 3WTUC 2W25A 2R4GA 4A3FJ 4IHYA 2QI2A 1JU5C 5H2FC 4CGZA 1VA7A 2COWA 5GMKj 3LQQA 1P6RA 2F5DA 2MLKA 2JMCA 1W0UA 1QLYA 5HLTA 1JXSA 1UJ0A 5FLXE 4EM0B 3K2ZA 1A5JA 2KHMA 1ETVA 1X4OA 2A0FB 2WSCE 1SFKA 4L9TA 1ETWA 1X1BA 2EILH 1OI1A 4OMMA 4Y91A 5LHGA 5IHIA 4M7DA 2UV1A 2QAZA 1X3UA 2M7BA 5GMKm 2K9MA 2CUBA 2KXDA 2DYSH 4N4GA 4F04B 4U87A 3FMQA 3UA7A 3EUAA 4CCJA 3ZBDA 2X51A 5IYCJ 2Q0OA 2ICWG 3MD2A 1MBEA 3CMET 4G8XA 1WIEA 1ZA2B 3E1SA 1JXMA 1QVUA 4EMKC 1UFFA 4XSXF 5IN1A 2DJQA 2V9PA 4M7DG 1K1ZA 1S7EA 3KZIC 4AG1C 1R1UA 2Z1DA 3DEEA 4HLYA 1AHDP 4E4HA 3S2WA 1R77A 1PSEA 4HVWA 3VUBA 2WY7Q 2W82A 1NZ9A 1BC8C 3CC7A 1U3OA 3KPHA 1VQ6I 2DODA 2AZVA 3TOAA 3REBB 4RLQA 2MUNA 2VKHA 3X26B 2HYFA 4EM1A 3FEOA 3VS1A 5DCFA 4AFSC 1ZLKA 3QJYA 4UC4A 4IHVA 2Z99A 4QQGA 1K8AU 1FX7A 2DCEA 5F04A 1LEBA 2VI6A 2OTJA 1MBGA 2XKPA 4A3GJ 2H6CA 4XTVA 2A05A 2DQLA 1XJWB 4C2MJ 2DNUA 1TWBA 3T9NA 3UKGA 2O6GE 5IT9K 2KVQG 1QP2A 2PVDB 2CQQA 3BT9A 1APLC 4EMSA 2XRNA 4KJZA 4G12A 3CCVQ 3J81R 4M73A 3CCSQ 2R5AA 4XRSG 2VL8A 2JWTA 2O3FA 2P7VB 3U2RA 3OYHA 3O8GA 5FRNA 1NYFA 2KRHA 3K4KA 5EZGA 4I09A 1SG5A 3HOXJ 4V2SA 2XAJA 1V55H 3KEYA 3WG7H 3G1LA 3MN2A 4E7LA 4OIOF 2LY2A 3CCMA 5GTIC 2DT6A 3A2KA 3L00A 2G6FX 3G4SA 3HBLA 2LD5A 4DBQA 3FWEA 2HKNA 5D7UA 4M7AB 1K9MR 1YJWQ 2QQ9A 1GRIA 3FDRA 1WJ5A 1F1ZA 3UR3C 2DL3A 5GAN2 3I3LA 1X27A 2VQCA 2BY3A 4ELZC 2VPLA 1VQMQ 5BPDA 2JUFA 1B34B 4BUPA 2YXYA 3H3ZA 2VJ5A 3G73A 2XROA 1CKBA 2FG0A 3D7SB 3DTKA 4N4HA 2HVSA 2CGPA 1CKAA 2DYIA 2B9SA 5FKMA 2E10A 1FEXA 2FVUA 1VQPA 1R58A 1FSEA 3OSVA 4DYRA 2LDUA 1HW1A 1EA3A 3ERED 1ZG5A 2HYJA 2PMZN 4LN2A 4UV9A 1JKPC 5EG2A 2CUDA 1UG2A 1W4SA 4A2UA 2GTOA 3QPHA 2IGOA 3WTYC 1HDDC 1JT6A 1YRNB 1L0OC 1VQOQ 2DL7A 2QA4T 1VQ4I 1PKSA 2LTPA 1O4XA 2N8GA 2L01A 2YS9A 2IGKA 4M6XA 2QYOA 2X0LA 4A0ZA 2FQ3A 4M78D 1U6GA 2LQWA 3V8JA 2BHZA 3M54A 2OTLQ 3CPWA 3REAB 2RD1A 1FIAA 3C7JA 1BIAA 2ZZDA 1JEGA 4FYXB 1M1KR 4VUBA 5I2SA 2QA4I 3P5JA 4RS8A 2HQEA 4N4IA 4ZYEA 3MO8A 4FT4A 4XKBA 4ON0A 3IRQA 3DEUA 3M8EA 1E7OA 4J5YA 3X25B 2XVCA 4WXHA 2R7FA 4LLNA 1G2BA 4ZN1A 1KD1C 1HJDA 4XORA 4J9EA 2LC4A 2VLAA 5KH6A 2OCEA 2FBKA 1X1PA 2R7ZJ 1WQWA 1X43A 4M7AG 1U3EM 1ZRCA 1OMIA 2QUFA 3OIPA 1L3LA 4Q4ZF 1JKQC 2P6TA 4FISA 2W57A 2PJPA 4MEXF 2DAOA 1KQ9A 2IS6A 4PJOB 4OB1B 5CVJA 1M2VB 2AQEA 4OINF 1VQNI 1W1FA 5JI6A 3J7AW 3J81E 2ZXHA 4S05A 3HKSA 1BA5A 2MWPA 3B73A 2IPOB 2QG9B 3N5BB 1VQLT 1QKWA 2OJ2A 4Y15A 4JJNK 3OYCA 2PQ8A 2HDCA 1PUFB 3A8OB 3HRSA 3HM5A 2DD4A 5IY5H 2VXFA 3MKDA 2XICA 2OI3A 5FFZA 2MOXA 5K7ZA 3I56A 1MZBA 1U5TB 3S1QJ 4MFDA 2JRTA 3PUFA 3ECOA 3QOEA 3F3XA 4HAMA 3X24B 1KZHA 1KQ0A 1UAAA 1WHKA 1WNLA 1Q86C 2K5CA 1JGGA 2F69A 1I5LA 4B6MA 3CLOA 3QWLA 5KYYA 3CCQA 2UUZA 4BJ6C 4HOBA 2F4IA 2PN6A 5CKBA 5A0DA 3G6EA 3J81K 3UDCA 2JA8J 1PJRA 2EA4A 4B9WA 2YR2A 3S2DJ 3OYNA 2CW0F 2Z16A 2QK0A 5LJ5f 4OAZA 2QDYB 5KVRA 2B0LA 2VJJA 2LKPA 4TV7A 3D1NI 1XGNA 1SD6A 5J4YA 1B8IA 2F4MB 4JQFA 1BOBA 2YUNA 1KQ1A 2HXIA 2P0PA 1HW5A 3JCMX 1USSA 4F55A 4C92E 1FBQA 1XSVA 3HFNA 3HFOA 4IUQA 2EFQA 1N6AA 1OCOH 2XUBA 2LKSA 3VYRB 2EKHA 1BBYA 2ID3A 3PVQA 2MAMA 5GPCA 3CD6A 2COZA 3QDRB 2WV1A 4XOPA 2YUOA 1TNSA 3EFOB 5IYDJ 5IAYA 2EQUA 1FT9A 2IA1A 3HPHA 5AIQA 2QSGX 1RUWA 1U1TA 2HSPA 1ULYA 5LJ3h 1ZQ3P 2Y31A 5GMKl 1VQ9I 4QQ6A 3OA6A 2DRMA 5CO7A 2K9QA 1H8AC 1IGUA 1TW3A 3DBRB 3C1DA 1B72A 1YWOA 4QT7A 3VKIA 2ECBA 1MDMA 2DO3A 2RN8A 3GNGA 2IRFG 2RQVA 2VGNA 5HLHA 5DY9A 5LL6S 4AYBA 3GTMJ 2RI3A 1RAGB 1VOMA 4EVIA 2A3SA 1QVTA 2DN0A 2K02A 3ELKA 2NVYJ 4F91B 4OMQA 2Y9YA 4M9ZA 2NNNA 1BOAA 2CMPA 2VBZA 2QEXT 4I02A 4LUDA 2H6BA 1A6IA 3M0PA 2CS3A 2MD0A 2X1EA 3F8CA 2W4SA 1EJ9A 4XICA 3H3VK 1OQKA 3BG7A 1JBMA 4A5NA 2A08A 2E12A 4F7ZA 4C92A 1F4KA 3FIFA 4JBAA 5D6FA 1UCRA 1ZG3A 3P9CA 2OCCH 1T39A 1LCKA 1YQAA 5GAN6 3LQRA 1JO8A 2DOFA 1G6NA 3DLLF 4XLEA 3V42A 1I50J 1FOYA 2BE7D 2L3RA 2O8KA 2CH4A 3A03A 1E3PA 5CCAA 1ZSGA 2JTFA 1TWHJ 2Y0MA 4F3QA 3JRDA 1BU1A 2J06A 2VQLA 2BEOA 1MNEA 4L5JA 1AHJB 2NUPB 5EDNA 3VYTB 1KD1R 4AIKA 4GCVA 3GFLA 2OX7A 3UT1A 3M4GA 2Y0SA 4I7HA 2DA2A 1JJ6C 1HF0A 4RAYA 1VQ4T 2LCSA 1RAIB 2W84A 3S93A 2VXEA 2CREA 1Y39A 2XAFA 2X4JA 4PNOA 4RB0A 4Z88A 1GBRA 5KAIC 1RKWA 4UVAA 5D6XA 3CPWP 3VWBA 3CF2A 3I5RA 4R56A 2NUTA 2DEUA 3CCLQ 1R5ID 3PM1A 2L9VA 4JUVA 1RI7A 3EDPA 2R5YA 1MMSA 2LF7A 2J7IA 3JRBA 2UXXA 4IHWA 1VQ8A 4ZDPA 4BHCA 1WHGA 2KRMA 4JJBA 4HKEA 4C0DC 1RACB 1GV2A 3URGA 3JCMh 1R71A 2LJ0A 2EV0A 2R7OA 3A8MB 4HF2A 1IGQA 3HSBA 4RGUA 4WTOB 2MC4A 2IA0A 4EJVA 2JUGA 3AG1H 3Q3SA 5GTHC 2KFDA 2Y69H 2KE9A 2FUG2 2CZ7B 5FU7B 3RNJA 3JCMe 4QKUA 1ETOA 1E6HA 2D0NA 3PFYA 2MH2A 4RAGA 1UJYA 1KD1U 5J8CA 1R0CB 4EMHA 3A0HC 5CAIA 5CVVA 2PVOB 2VKDA 5EGOA 4JRPA 3MEWA 4M77C 2AHQA 2OC6A 4RB2C 2E1HA 3KLNA 3G1JA 3PFSA 5CYVA 2BW3B 2QKLB 3CO6C 1Q81C 2DQRA 2VKEA 2HSEB 1SFOJ 4HF1A 2PUKB 1EX4A 3PGGA 4LG0B 3WGIA 3SXYA 3X2QH 2KR3A 2MW8A 5M3FJ 1ZREA 2MLGA 2JOYA 2O31A 1QZYA 2VBWA 5KYWA 1NYGA 5LEKA 1V54H 2IJLA 3SWNC 2XDVA 3M57A 5GPAA 3VB2A 3FRNA 4BY7J 1K7AA 2IG0A 3CCVT 2FRYA 1SSHA 1EKEA 1R22A 3FKJA 1GFCA 5C0MA 1R1TA 4YRVA 5DCMB 3C2BA 3LH0A 1QZEA 3FBIB 3K4JA 3VOEA 3J7YJ 4RTVA 4ZNXA 4C0GA 1U06A 1VQPQ 3LA3A 2ED0A 2AQFA 3LA7A 3ABLH 4UY8I 2DFUA 2AZSA 3MEUA 4BY6C 1AWWA 2HR3A 3HZJA 3SDGA 1TC3C 4IUVA 4PJOD 4LD9K 1R5GA 3KFVA 5CVIA 4OGEA 2GF7A 2MD5A 1KQSS 3DEWA 2TRTA 3WTSC 5IT9R 5FFXA 2ZAEA 1AWXA 2RNGA 1NPRA 2F2WA 3PE0A 1K79A 2HEQA 3CC4T 2MYSA 2DAQA 1B34A 4YIFA 3G4SQ 3LSKA 2E1CA 3CCET 3NRVA 3ZRGA 3SFMA 5K1YA 4AT1B 2HQHA 2RQQA 2IP2A 3JW4A 3NWTA 1R5HA 2F5KA 3M7GA 1LDJA 2JQ7A 2EQMA 1NG7A 3NTIA 1X19A 5M3MJ 4F93B 1YX5A 2XGEA 1M1GA 3CCQI 3CCJI 3CXCA 2ZFUA 3I9V2 1J9IA 3ZP5A 2K3FA 1N75A 4IUPA 3U23A 1XGMA 2H3EB 3TCJA 1K0SA 4M77E 2ETHA 4C5EA 2COMA 1KC8C 2OTJQ 3LFKA 3M0TA 3CUOA 5D4RA 4D7NA 1BCOA 3RTRA 3G7ZA 1VQ7A 1RQ6A 3P9IA 2O8XA 3REOA 2Y4XA 4BXUA 3K1NA 2JMWA 1Q1HA 3ZGKA 1J0RA 1R6RA 4HQMA 4PGGA 4XU3A 3MCZA 3U9GA 5DLQE 1ZK8A 2IVMA 4WWCA 3HC7A 4M77B 1R4MB 2IAIA 5DDGA 3QIIA 1S6LA 5DCMA 3JSOA 3RZOJ 1X1CA 2OD5A 3E3VA 3H8ZA 1H9GA 2ELHA 4CICA 1WKMA 3GTKJ 1X3WB 3E7LA 2JK3A 2ELKA 3PSFA 4GXOA 4I0BA 2CQNA 2ZFWA 4M71A 1IC8A 1YJNT 3D5LA 2Y4YA 4GLKA 2HS5A 3BP8A 4HG2A 1N78A 1G2HA 2LNVA 4KIFA 5JFRA 1U9OA 3FXKA 4B3AA 3F22A 3SB2A 1RABB 1TP4A 4YIRX 3OMGA 5JVGF 2PX9A 2HCKA 1IHVA 2IS4A 1K73R 2F5VA 5CK9A 1EIFA 1IZ6A 1AKHB 2XV4S 4J9BA 4OMFB 3VSLA 2IGNA 3EUKL 2KDSA 2HBWA 1UZCA 5DV5A 3M4YA 4D0PA 2EW3A 4CYDA 3ZEHA 2X3XD 3DLLA 1V5FA 3JCMb 2VQHA 1FXXA 2EB7A 3RPUA 3K9TA 2NVUB 2LRQA 3KEQA 1GT0C 1JTXA 1TTYA 1MNMC 4FCYA 4C92F 2M1BA 3CMAI 1WA7A 1PKTA 1MBFA 2XAHA 2JPBA 2HQRA 5CVRA 4DBRA 1VZ0A 1C1AA 3VFZA 3PUBA 4UUSA 1YIOA 3DKYA 2PMHA 3K4CA 4NHJA 2XDBA 4M7DE 3CJTB 1HKTA 5C6SA 2L5QA 2M5WA 4CYCB 5FKNA 3T0YA 4NOYA 5FU7C 1O3RA 2X3WD 2KKOA 4CCLA 5FLXK 3EG9A 3CCJT 5GAOn 2HYGD 3Q0WA 3TKYA 3HTSB 5E1ZB 3M59A 2GXGA 1DP3A 2RHUA 2A7YA 3RKWA 3VU3C 3Q0UA 1D5VA 5GAHJ 4DGWB 4BJ5C 3G3ZA 1NEBA 4M9SA 1OYXA 1T6SA 4HXJA 1J59A 5D5UB 3U21A 2M0YA 3FMRA 1TQMA 1ETYA 1K76A 2D9TA 1X4PA 3I71A 1A0NB 2E1NA 1RC9A 3OIQA 1FLIA 2YLCA 3EETA 4CCKA 3JAMK 3JRFA 1M1EB 2QEXI 2V8IA 3CCVI 1T0JA 3UPUA 4ENKA 2DXTA 3PT9A 3PNWC 4JLIA 4II3A 5D8LB 1PUFA 2WADA 2FHDA 3P8DA 3QQAA 2QQ8A 2LREA 2NVXJ 1FTTA 3LSPA 1Q7YU 4E2FB 2NWMA 4LDUA 4M3EA 2ACJA 2A6TA 3S15J 2B63J 4M75F 2KGTA 2LBFA 1BL0A 2LJ3A 3RQIA 2YUPA 3I9QA 3RI4A 2O4XB 4U0YA 3ZMDA 1TU0B 2KJBA 3F72A 1X69A 2ZPHB 4K11A 1VQMT 3UATA 1UGSB 4PLIA 4EMGA 3QDFA 4XNFA 1KHCA 2CFXA 2FMYA 3QP5A 2L7KA 2EAYA 2ZNYA 1M8MA 3M56A 3FBNB 5D6WA 4QVDA 4A5MA 1YITQ 1STZA 4RB1A 5IP7J 2CH0A 2ZCFB 2JPCA 4IJAA 5HODA 2LQNA 2BYVE 1U5TA 2LMDA 1UMQA 2DMPA 4CZZA 4ESJA 2ID6A 2XDPA 4KULA 2DU9A 3ULRB 1QVGS 3VODA 1GVDA 3C4SA 1QVGP 4CC3A 2K4YA 4L9NA 1ZGAA 4JZ3A 1FNNA 1MH4A 3ULQB 4KH1B 1RAHB 2Y75A 5GANj 3CMAT 3T5XA 3C95A 1WJBA 4MTEA 4GFBA 3M0RA 4GO1A 4HT9A 3VUZA 4I76A 1HK9A 3MMYB 2O9SA 3FK6A 4Q48A 5EZHA 1W2BA 3GUDA 1IV8A 2IW5A 3GCMA 3J81Z 1Y07A 1IDYA 2AHJB 3I56Q 1RADB 1I6XA 1TW2A 1Y6IA 2C6YA 2EFPA 4I6ZA 4A4FA 1U5TC 1F1BB 2MF2A 4LXCA 4NC8A 1LFBA 2GNCA 4OWRB 1WZ2A 5L3CA 2QGUA 4ANJA 5EG0B 4BE2A 1B72B 3NGPA 3HSRA 1W5SA 5DD8A 2O88A 3JRHA 1WZOA 4XKWA 2YRVA 4M7DB 1KSWA 3TSWA 3NEUA 4PJNA 4U88A 1FMWA 2G7UA 2F5FA 1YI2I 2CV1A 4OMOA 4RMOA 1D3BB 3QXEB 4Z6YA 3TGNA 3EFOA 3GXOA 3R0AA 2RNAA 4P5OA 4KT6A 4N4OB 5C44J 3BDUA 3OQ5A 1VF9A 1JJ2S 2QCOA 3META 3TDUC 1HBXG 5IYBJ 2QSHX 1R0BG 3SQNA 2FO0A 4QVCA 1YWPA 2EV5A 3CPFA 3SDZA 5A2QE 3LAJA 4B3XA 4KYWA 1VYUA 1QPMA 2K9LA 4BYYA 2JS2A 3JCMW 1H0MA 2WSEE 4M4ZA 1YG2A 2DI3A 2XF6A 5GAOm 3CMAA 1T08B 1ZUKA 3HPGA 2V6CA 3ME9A 2OBPA 3QYFA 2JN0A 3K0LA 3HPWA 4PFPA 3PNVA 2RHIA 2X85A 1KA8A 3MZYA 5JLXA 3BR0A 2ZSIB 2EK5A 4BAYA 4M77D 4BI3A 2KNBB 1X2QA 2WB1A 3DBHB 5E8GA 4A6DA 2JS0A 4JX4A 1UTIA 3EQLF 3S8PA 3WU2C 1VQKT 2ZXJA 2EJ9A 1F5TA 4C92B 1JJ8C 4C3IJ 1P9QC 4AUXA 1TBXA 2M02A 4M6VA 2CDTA 2DPUA 1T33A 3KP3A 1B07A 4J9HA 3CC2I 2BHYA 3F6VA 3W3CA 2DJZA 1LPQA 1R8OB 4X6AJ 1S72T 4A53A 1QA6A 1K9AA 3IKTA 1FYMA 5IT9E 1VQMA 4IL6C 4R0KA 4EM2A 1Q86R 4RUGA 1WVRA 2NS0A 2HWVA 2I2LA 1TZLA 2OJED 3G1MA 5K7FA 5LLQA 1JHHA 3L2QA 4PJOC 1OQYA 2V1UA 2GBQA 3MEVA 2DFFA 3RQ4A 3H5NA 3D0SA 4HLXA 3RKYA 3R6SA 1QKXA 2MK5A 3WE3A 4ESRA 2LJ1A 5ICFA 1QO0D 1H92A 2YSRA 4C0DB 2O01E 1ZR2A 1G3WA 3ESWB 1PSFA 2XPWA 3KP7A 4KN4X 3CO7C 4B4CA 4UVBA 3FXRA 2R7RA 1G3SA 3S3NA 4BY1J 2R7TA 2XGXA 1WHHA 3CCSA 2LRDA 2QEXQ 1J3TA 4F16A 4O3MA 2A68F 2DXIA 5FWCA 4C0ZA 4IOCF 3OS1A 4RA2A 3S14J 5HLIA 3NTKA 1ON2A 5AIPA 3HSEA 1N27A 5KYUB 2JVVA 1MMGA 4BU2A 1E3OC 1PM3A 4I01A 1A04A 1O7LA 1XX5A 3GLLA 4XLNF 2E41A 3HL8A 3WGGA 3EGDB 3LX7A 3NARA 3TO6A 2BBYA 3DKXA 4HA8A 5D8KB 1RETA 4KMUX 1U8RA 1IW7F 1ZGJA 3I5SA 3WHBA 4EQQA 2XB5A 3ABTA 2PG4A 1C0MA 4M75A 1SPKA 5LHIA 2IVWA 1ETQA 2ZMEC 3ZQ7A 5J3BA 3C2HA 1NPPA 2AKLA 2M16A 3BZ6A 5BNGA 2JVHA 2GFUA 1WJCA 3IC7A 1KQ2A 3I53A 4PK4A 2ZJPF 3VYSB 5HDNA 2V1NA 4UB6C 1YJWI 2QKMB 1LOJA 2DJIA 4BI8B 3RSNA 3ZQFA 4DQ2A 4QIWN 3ZPLA 3J80R 3WTXC 1ABOA 1GBQA 5IXBA 4D5CA 4ASNA 3CCLT 3HKZN 1VQ4Q 5CKEA 5D5WB 1H88C 4EMKB 2GLOA 2WV0A 1UHSA 2IXSA 1SMTA 3FXLA 1Q95G 1MD0A 1WGXA 5FLXZ 4XL9A 2VGMA 5F0CA 1XMXA 4M77G 4D8KA 2VB6A 4OIPF 4L59A 1WJFA 1ZARA 4LMYA 2HZTA 1JRIA 3GFIA 2MWOA 2K40A 4L5IA 3S3MA 2K7LA 1FZPB 1IRFA 1S72I 1HW2A 1QMCA 3QYGB 2P8TA 3VS0A 3CC2T 1SHGA 1YI2A 2DA9A 2A5YB 2DTZA 1TWGJ 2XSJC 5GP9A 4CCNA 1M5Q1 1MBJA 4GGGA 3H0FA 2ZO4A 1DGWY 3KP4A 4XLCA 3EG2A 5A2QR 4J8OA 4C3HJ 2ROLA 1W70A 2VKNA 2W7NA 2RQPA 1MH3A 2L7MP 3TL4X 1GL5A 4Y4RA 1B9NA 1BM9A 1SVLA 4RB3C 1YIJA 3K70D 2VC0A 5HNHA 5TRDA 1OOTA 3L42A 5E1XA 3TQNA 3QPSA 2K2MA 4OVAA 3CCJQ 1ZG1A 4XRSA 3LA2A 3GF2A 2EZIA 3MQ0A 1VQ7I 1V76A 1ZUUA 2C0IA 2CP2A 4OP0A 1ENHA 2RC4A 4AIDA 4BNCA 2EVRA 2ECCA 3JSPA 4WF2A 2MSYA 5K5QA 1KGSA 3HUGB 1UGPB 2LT4A 3M55A 5A2QZ 1D1CA 3JTHA 3GZNB 3CJQB 2PZ1A 3A98A 1IB8A 1UGRB 2LX7A 1T2KA 2FNPA 4DOZA 1WYXA 3H9NA 4AG2C 5LRRA 3D5RC 4XKVA 1IN4A 4LB6B 3MVPA 4ZJZA 3K4LA 3QKJA 4NL2A 4F7UA 3WU1B 3R4KA 3E6BA 4KH0B 4F7UF 1WI9A 4KT5C 1W7PB 2ZCWA 4BUGA 5J8FA 1WJAA 3I4MJ 2WB1N 2RREA 3S1MJ 4RM3A 1KJWA 4C8QF 2MI6A 1IN5A 4HX4A 2KT1A 1HSTA 2HXOA 1ACMB 4P9UA 1D5YA 3CDHA 5AONA 2L3PA 3MKYB 3WVDB 1QVFS 3AKZA 1I3QJ 3MEXA 1U5SA 3CBOA 2R7SA 3NHNA 5LJ5j 3CC4Q 1JJ2P 2FPFA 3HIFA 2CH4W 1RKTA 3OR2C 2YU3A 4Y13A 4OAYA 3G4SI 2CSOA 1U0JA 3WGHA 1AD5A 3WTWC 4QSHA 2Z2SB 4XLFA 3SFZA 4A3EJ 2DF6A 3RDVA 4PSWA 1HOMA 4YTLA 1WJEA 4Y33A 4WK8F 2I5UA 5E3OA 4FYWB 1VQOT 2A69F 1AWOA 2L0AA 1FBSA 2H8RA 4YFNF 1SFXA 4HF0A 3ASNH 5H6RA 5FB2A 1ONVA 1AKHA 4NC7A 1UELB 1EZZB 2WC2A 3I56I 4IIMA 1Y1VJ 2F6CA 1E6GA 1IAWA 2CP3A 3R6NA 2K5FA 5LJ3d 2M9HA 2COYA 2KPMA 2HOTA 2I0NA 1PHTA 2W0ZA 4E7KA 2GA1A 4MZPA 4DNCA 3HG9A 4M7DF 2K5IA 2EFNA 2Q2EB 1QBJA 1ZX6A 4ZZLA 3C2GA 3QRFF 1YTYA 1GCPA 3DBLB 4NDLA 4C92G 3LYIA 3JR9A 3FM5A 1V5EA 1XNIA 1Y1WJ 3EHQA 1IHWA 3TQ7P 4JYKA 4ZYAA 4P96A 1QWEA 2ZC2A 4CA0A 4XQ3A 3HB9A 4CDGA 4II1A 5I22A 4HDUA 2DXCA 5J26A 3KUFA 4OU0A 3L2UA 4E7ZA 5EJCA 2QXFA 1YI2Q 4G7HF 2P0TA 4ESBA 1H3ZA 1KU2A 5FU6B 3DWLE 1MSFC 3MWMA 1O9SA 5CJ9A 4RTUA 4JRKA 1YHQA 1JJ2A 2GIZA 3CF5F 1YI2T 2B86A 2E7WA 3HTUA 4A4HA 2CV2A 5GAOl 1HSQA 2BE5F 2BXYA 1K9MU 4ZDLA 1NM7A 2DA1A 3OWTA 2E36A 2M30A 1YX3A 1ERDA 2LTOA 2RMOA 1VQNQ 5F08A 1MBHA 2X9DA 1OX8A 4UNOA 2CYYA 2XHKA 1DUXC 1XB4A 3ECHA 3MJXA 2C0TA 3G71A 2OZ6A 5EYRA 3SHFA 1BC7C 1N9RA 4M7AC 3PIPA 2COBA 3I4NJ 1NE8A 2J6KA 3GPLA 1WXBA 1IUFA 2HVRA 4PZJA 1T0FC 2AO9A 3HKZA 4RDUA 6AT1B 2KQRA 3HRUA 2CW8A 4LLLA 2PQWA 3TBIA 1D8KA 2O61A 1IV6A 2FYKA 1TQIA 5IOZA 2CW7A 3AG3H 1OEBA 3ABKH 3A1PA 4OB0B 1Z6RA 1XGSA 4G7OF 2DA6A 1K8AR 1UECA 4HPQA 1FOXA 1LVAA 2W1OA 4RBOA 1SD4A 1RR8C 3PQKA 3V4GA 4FM4B 2Z0WA 2BY2A 3DF8A 4G6TB 4MEYF 3CMYA 3I55A 1ZN2A 4LD6A 4J19A 3S1RJ 1Q82R 1LKXA 2V79A 4AVZA 2V9VA 3ZQLA 3VYGA 5E18F 4HX7A 2X6YA 1YHQI 1E0EA 2ROTA 4JP0A 2ZGWA 1SFUA 4KISA 1TOVA 2DK3A 1T98A 1X1AA 1QNTA 1T95A 5KCHA 1AZEA 1M3AA 2QTXA 3BG6A 1NTCA 2O7OA 3J7ZI 2RN7A 3O2PE 4BQOA 3SJMA 1O3TA 4KUIA 1PYVA 3UF4A 5GAN4 4A69C 4Y52J 3CCST 1B9MA 3M5AA 4KA4A 4RTXA 1GUUA 1MHNA 2DLLA 2EV6A 2MZ4A 2A28A 3BFMA 1TT5B 1WHUA 5CLSA 3QUIA 1VQ9A 4EEFG 3J7AY 1ZLJA 2JM9A 2DDBA 2K4BA 2KRSA 4XQFA 4FX4A 1FBUA 1QPIA 2K5LA 4IIOA 3RMQA 2CQ7A 3KE2A 2K27A 4ZYGA 1S1NA 2Y90A 2YX7A 1UB4A 4MQVA 4PJOF 5JR3A 2Y2ZA 2FF4A 4RM2A 3KBGA 2KXCA 2X4XA 4ENNA 4J7IA 4M75E 4RCBA 4HBLA 4MQ9F 3OW2S 2E6ZA 4M3GA 3I55T 2WBMA 2KISA 1PWTA 3CD6T 2FEZA 2K9SA 3DTEA 1UJ8A 4BACA 1EH8A 5ICEA 1PP7U 3BG5A 3I0TA 1AU7A 3GTPJ 4DZJA 4RCCA 2UXNA 1N8RR 1XTAA 3MCAB 2MABA 1SD5A 2GQQA 3I55I 2RDPA 4XOTA 4B44A 1G59A 5CQXA 5GMKh 3SWNB 3GNFB 1TH7A 4PKCC 1FYLA 2BTTA 1ZAOA 4UUVA 3QZ5B 3RESA 1DPRA 4IUUA 1KFZA 1I07A 5EEGA 2GWRA 5J40A 2R0QC 2G0EA 1VQOI 3OMYA 3J7AO 2OUMA 2F48A 2J05A 3M9QA 4JJCA 2XU8A 4JRQA 4MFEA 1MSEC 1UEBA 2DXUA 4M7AE 1NLOC 2LNHB 2A07F 3E5XA 3BWGA 3RKXA 1ZSZC 3G6ET 1UHWA 4G94A 2CGHA 3EGDA 2QQRA 5I2MA 3G71T 3OBWA 2FL7A 3HOWJ 1H3HA 1UG0A 3E5QA 4M77A 4X34A 3O8HA 2X6WA 3QP6A 4BDYA 4PJJA 2EGCA 5HS7A 2NVTJ 3H5AA 2BVLA 4XBFA 2FZGB 3DV8A 3CCYA 2IPQX 3QO3A 4OGCA 3PTAA 1X3ZB 3P8HA 2YDLA 2DFEA 5ECAA 2XHCA 3OMCA 4QWQA 4M7AF 1TWFJ 5GAN7 1YHQT 3G2BA 5B1BH 1M90R 3OYGA 2PJRB 2JZ2A 3DB4A 2JJ9A 4X9CA 4PCQA 2E65A 4K2EA 2QGFB 1YHQQ 1T38A 1HA8A 1YO5C 3KCCA 2RK2A 3UNGC 2R7QA 4HW0A 1RIOH 2QGGA 2MCNA 4UHTA 1K8AC 2LC2A 3CCSI 1OCPA 4J83A 3BTCA 2VPRA 3SZGA 1O3QA 2R5ZA 1XD7A 3DU6A 3VJPA 2CWEA 3ASOH 4Y17A 2E70A 1ARKA 2MG4A 1TQPA 4X1EA 2DZCA 3LL7A 1R00A 1GV5A 1Y8QB 4GDFA 2P0QA 3WHCA 5F0FA 2H3JA 5E1WA 3MHXA 2UWMA 2HOAA 4AFQC 3TP3A 3Q9VA 1ETXA 2HKXA 3LMMA 3B6AA 2FRWA 1VI0A 4XU0A 1MNDA 5GAOp 3G1OA 5M5WJ 2TCTA 1HKQA 3E2UA 1I39A 4A3IJ 2VBXA 5EGOB 3GO5A 5BQTA 4BQNA 5C4XJ 4E6RA 2LOOA 4WCIA 3HHTB 2KIQA 1Y0NA 3F6OA 3VPRA 3BR1A 3CUQC 4KGXB 3EH1A 3CCUI 2KRFA 1VNDA 4BBSJ 3H0HA 1P4AA 5BS6A 2ZPFB 1PDNC 4EMKA 2J5PA 3MKWB 2D8JA 2DA7A 1JKOC 1ZYRF 4XN3A 5DM7F 1SF9A 2DL8A 2NUPA 2EQJA 2KQWA 4LNPA 3AL0B 5BOXA 4KUDK 2L54A 4ITVA 1GXPA 2NRAC 1NJIU 1PCXA 3H3UA 1WRJA 3MKLA 4JOMA 1Y96A 2NNYA 1D0ZA 4AVPA 4A63B 2DJNA 2F1LA 3V7CA 2NAZA 2WAQN 2LP0A 3CCMI 3N05A 3FHZA 1T8IA 2EJRA 1A35A 4C8QC 1UHMA 2CUEA 3CP2A 1IZ1A 2CUFA 2HU9A 2RNJA 1I5ZA 4IKFA 2E64A 3RCOA 3RYPA 1IXSB 2K85A 4RTYA 3RR6A 4CHUA 3FXUA 2QM3A 1K61A 2DBKA 1NJIR 4EJWA 4N0BA 3ONQA 1Y0UA 2IS1A 3CCRQ 1K73C 1KHIA 2PEXA 1RZ4A 4B47A 5ICGA 1WGSA 3HTRA 3M58A 5LJ3g 4HQEA 2A37A 2FOKA 2OTLI 1AOJA 4LIUA 3QYHB 4DBFA 2RJEA 2NUZA 4LIVA 4BGDA 4BI4A 2KT0A 5F1RA 3I4PA 3CCJA 2DA3A 3BC8A 3CP8A 4FSXA 1IXRC 3M3YJ 3A0BC 4MHGA 2GIVA 2O0YA 4U7BA 2PI0A 2CZ6B 3QBYA 2EIMH 1DDNA 3QWXX 1M90C 3NFCA 3CCRI 4RGSA 1AVZC 2GFAA 3OYEA 1SVOA 2YSQA 1SC7A 3QG1A 2BZXA 1OU8A 2GTJA 3H41A 3FDYA 3R0JA 4CZCA 3WE2A 1X6GA 5LJ5e 3TW7A 2L89A 3CC7T 2K3PA 4Z2YA 4I99C 1YS6A 1MGTA 4HCZA 2LG4A 4PDKA 2HL3A 4M3BA 3OYKA 4M72A 1YCYA 3DKMA 1K83J 2VASA 1VIFA 2DMQA 1TLHB 1BR1A 3BJOA 2KI7A 5K5RA 1O3SA 2DX1A 4OF1A 4D5FA 2FBIA 2LMJA 5CQEA 3CMEA 2CZ1B 1DQUA 3CMEI 5IHNA 2DYRH 1EF4A 1HQCA 3MKZA 2KLOA 4FIBA 2K4JA 4J9FA 1RRJA 4N9HA 3E19A 2QF7A 5TGTA 2H1LA 4KIGA 2M8EA 1SKUB 3KEOA 2Y48A 1SAXA 2X1DA 4KN7X 2QVOA 2R7WA 3GX4X 1M2OA 2K2VA 1BW5A 4M75C 5IHKA 1SVMA 3EG1A 2CT4A 2R7DA 1PUEE 2I8DA 3OYIA 4J7FA 1W2BP 3MP1A 3CC2Q 2EINH 2X4YA 1J7KA 3RUXA 5GANd 2HNIA 5CQYA 3Q9SA 1M9SA 1FIPA 1OYIA 2DFHA 3AG2H 5D5XB 4F17A 5J1UA 3FX3A 4CYCA 4DYQA 4RAFA 2Z33A 2D45A 1WXTA 2FBHA 2D1HA 1G5VA 3K1MA 1CSKA 2K6DA 1EV7A 2KP6A 2KRCA 3CDIA 1WHLA 1X2KA 2BUDA 2M7AA 3HSFA 1LJOA 1UHCA 2F2VA 3UWNA 4N0AA 3J80K 2Z9OA 4G7ZF 2P6SA 1AZGB 3CLQA 4UB8C 5ILUA 3LW5E 2E1OA 1XQHA 1S29A 1ZHFA 2HPIA 2QQAA 4L0ZB 4M75D 1QWFA 5L3DA 3IH3A 1KU3A 1XS9A 1AWCA 1RI9A 4E7SA 2L3DA 1EH7A 1UUEA 5BPIA 3EAEA 3W6JB 3GFJA 4UUSB 3K69A 2IEKA 1FY7A 3MAJA 5FROA 3BDDA 2EH3A 1G3TA 1K78A 3PSIA 2VVKA 2H94A 4QLCU 3EGXB 2W00A 4DYCA 2RI2A 3QJ6A 1OYWA 2NYSA 3VS5A 3H36A 5HKCA 2Z5UA 4RKUE 2DTIA 2KY9A 2OU2A 3MZ8A 2L4MA 2P0WA 3OOUA 4B43A 1LE8A 4C5HA 3TEDA 5KYYB 2CZ0B 2MPXC 1XN7A 1QRYA 2RVCA 1TG0A 3V8KA 4LE9A 3W2WA 2EWNA 1WWXA 1QHGA 3CD6I 2CT3A 1DJ7B 1TWAJ 1WHMA 4ZDOA 4KICA 2X6OA 1TL8A 1BBZA 2KROA 2ZPEB 3FK7A 2E5NA 1O75A 1GFDA 4XLAA 2GGRA 1SEUA 3QU6A 4X0GA 2XIDA 1P7JA 2FJ1A 3BDLA 4NQWB 2RF0A 4PFZA 4M7AA 4L9JA 4PLLA 3P9KA 4N4NB 2CG4A 2RJCA 3LSJA 1D1BA 2P5KA 1KONA 4ZTFA 2F5TX 4OIRF 3PJRA 5CQGA 2VJ4A 2EKOA 3NPFA 2V7FA 3FXQA 5HS9A 2WAFA 4FYYB 3BR5A 1Y8RB 1JQQA 1QVPA 1ZELA 3CCUA 2PBIA 1RLQC 4E47A 2L7ZA 2WA0A 1TXQA 1I6HJ 1YITT 1LVKA 5TJJA 2M0CA 1P92A 2DKGA 3CESA 2PUOB 2CO5A 3J7AF 4FYVB 1KU9A 3BQYA 1W5CC 2DFIA 1LE8B 1SRLA 4A54A 2L9SA 1OR7C 1BCMA 1FPQA 2LVSA 2OQGA 3ERMA 1VYVA 2RQRA 3CBPA 2W24A 3JRGA 4M3FA 2E5ZA 2FA5A 4DW6A 5KE3A 3F8NA 1BJAA 3ZXSA 2STWA 3I59B 4HSTA 4O6JA 3RPQA 3EG0A 2F5CA 3OL3A 2DL5A 2LVMA 4ZN3A 2VN2A 4B8XA 2BOLA 1ZKGA 4MGRA 4U0VA 3OS2A 1K4TA 2VOOA 4EGZA 2R7XA 2YRCA 1UB9A 2XC7A 2SEMA 1YW8A 2HDWA 3NQOA 1VQLQ 2CJJA 5D4SA 4AYBN 1M27C 1NK2P 1YJNQ 1K73U 5HCKA 3HOTA 1VQ8Q 1E17A 4D6WA 1QZZA 2LYCA 4E7HA 1YJNI 4AMCA 4KITB 2C0OA 8AT1B 1KQSA 5FKLA 1RLPC 1Z3YA 1VQNT 3FISA 3L9FA 1R1VA 4FW2A 2LK2A 1VQLI 2PLYA 1TUDA 1PC0A 3A8GB 2YT6A 2E2IJ 2P4TA 2OZUA 2YUSA 3V7RA 1M1KC 2FEIA 1Y71A 2L0KA 3VS4A 5LFAA 4LK1F 2RHZA 1TNTA 3N4MA 4GRIA 5J1RA 4WXCA 3L1PA 2UZKA 3DFGA 2CP5A 1UGVA 2DRKA 2DVJA 3M0SA 3TDZC 2WWYA 4A4KA 1D3BA 3JCMg 1NHAA 3KYDB 2X1CA 1GLNA 1OZ2A 2ME6A 2G3RA 3FM3A 2R5ZB 1KQSP 1BYMA 2M45A 2XPVA 2EPFA 5L23A 4FE4A 1Q82U 1I0CA 2A5WA 2NUTB 2L9NA 4FT2A 3M1EA 1MKMA 4IPAA 1BI1A 2FSWA 2NLUA 1QQIA 1OFCX 3KLOA 3OYFA 1VQ6T 3MZHA 5DTDA 3B6CA 3OBYA 1RAFB 4EJTA 1U9NA 2DO7A 2RQTA 5HOOA 2BZTA 4RGXA 1VQKQ 1I1GA 5FLVA 1XC5A 3L1AA 1M90U 2LR8A 2EFWA 1PRLC 5DM6F 3HEFA 2EGAA 5C3EJ 2NS8A 4KNYA 3GLXA 2LF8A 1LJ9A 4JX6A 4P55A 5IT3A 5LD2C 3C94A 2HBPA 1S8NA 1S7OA 2LCLA 1SRMA 4AFUC 3E9FA 2AIRB 3EGXA 4KIBA 3KETA 1V5GA 3H92A 1Y56A 3BY7A 2KRNA 2QWWA 3ZMZA 3JRCA 1MV3A 1B3QA 5KHDA 2QENA 2XD0A 2XMFA 3JB9I 4FETA 1BN5A 2VOPA 1XCBA 4CH7A 1O57A 2XK0A 2JZYA 4S04A 2FPDA 3SZTA 5FU6C 4ORZA 2MVTA 4DEXA 1OR7A 2EZHA 1X2NA 3OYYA 5EG0A 5HK0A 4I98B 4B09A 1T3LA 5GAN5 3GEZA 3Q0VA 2EQIA 2PJRA 2MGQA 1LNXA 3LGLA 3BTJA 3IAM2 1QP3A 1YCSB 4AWXB 4J9DA 2JTVA 3ZQHA 4V19K 1FJLA 2D2WA 2XB0X 1X01A 2M51A 2LY9A 4FSSA 3KYCB 3CC7I 1YYVA 2HZYA 2XF5A 3F70A 4M7DD 5HDKA 2JRMA 2F2EA 3OOPA 1B4AA 3M53A 1FSHA 3DU5A 2HQNA 2GAUA 2CRGA 4ZZDA 4M78E 4MZMA 3G6EQ 1I27A 2B8AA 2HZDA 1MUZA 2EPDA 2GCXA 3CCQQ 2YX4A 2Q2EA 2ZXWH 1I8FA 2DIQA 3BTIA 2GQVA 3I54A 4ENMA 1BK2A 2VIXA 3OS0A 2P4RA 3HGGA 3R61A 1X6OA 3HHGA 2FB7A 2MMPA 5GAMh 2L3SA 3LFUA 1JT0A 3L2WA 5B5EC 4KRTA 2FQ4A 3GTOJ 2Q8KA 2HKOA 3LSGA 5IXFA 1XCVA 3GOXA 1WXUA 3CZ6A 1IJWC 2VWFA 1UHFA 2R58A 4DEYA 4RTZA 4WX9A 4JS5A 1M1KU 1FP1D 5GJWB 2FPEA 4M78G 4OB3B 5GAMj 1NH3A 3HYIA 5LGTA 4IRHA 1TS9A 2KMUA 1IDZA 4ME7A 5IP9J 2JT4A 4ELYC 4FT8A 2ED1A 2OAWA 5B3SH 3RPUD 3IUOA 2VC8A 3JSCA 3W6KB 2R3SA 2P0KA 4RG8A 1ETKA 1YJNA 1KYZA 2EBPA 3EUHA 3GZ5A 3LGFA 1VQLA 3FJPA 3OYJA 1YJ9Q 3KFWX 2XKOA 2LBFB 4II2A 2AS5F 3LWFA 4XRMA 5LGUA 1KIKA 4M78A 2M3AA 4LG0A 1R36A 2DTHA 2GOMA 2ZMEB 3C18A 2M8GX 4M9XA 3BCBA 3ZQGA 3ROUA 3TO7A 1K6YA 4J9IA 2QASA 5GAOq 1S5LC 1S9HA 2MC3A 2R7UA 2CSIA 4MDXA 2B7EA 2BY0A 1AWJA 3LSMA 3TREA 1QW1A 4HCKA 1ZR4A 4HYEA 1SFEA 2RPNA 1JUPA 1WFWA 1W1WE 2JA6J 3OV8A 4M7AD 2KZVA 5FRMA 4J01A 2ECZA 2ESWA 2OTLA 1VQ7Q 3S3OA 4O5VA 3CCUQ 2DK8A 4XIDA 2EYZA 1HLVA 3JCMf 2HAXA 2RV8A 4YFXF 3PO3J 3ISPA 1VQOA 1OPKA 2E60A 1VYTA 1ZBXA 2BY1A 2G9WA 5D6EA 5LJ5h 2QA4A 1U78A 2R92J 4HDVA 1V29B 2V8JA 4OMLA 1W36D 3U1KA 3GVAA 2IS2A 3GTGJ 1ZQ1A 3NTHA 3VS3A 1Q82C 3GTLJ 4C8QG 2CP6A 4IUTA 2DMNA 4PSXA 3PMTA 5LJ3j 1WPYA 4ZGDB 3CCEA 4CCMA 4LK0F 3HHHA 3N97A 3GWZA 3CCEI 1NBEB 1D3YA 2Y0SN 2H1KA 3QODA 1MBKA 2HFHA 1LPLA 1ZUYA 4GY5A 1YJWA 2DYBA 4HZFA 4BE1A 5LGNA 1TUCA 1XDUA 2P84A 4MDWA 1F36A 4MLOA 3SZPA 2EYQA 3ZMTA 1DP7P 1YE9A 5FKKA 1IO2A 2VKVA 2VODA 1V4RA 4C8QE 5KCOA 1ZSZB 3JAME 2JMAA 1BR2A 1WH7A 2FE3A 3KP5A 4AM3A 2RB6A 4M3DA 4BHPA 3CC4I 3HDDA 1H8KA 2J6FA 4AD9A 1Z21A 1XMKA 3BJAA 3JRIA 3ZQCA 3M0UA 2DDAA 2KZGA 2V1XA 3CCVA 2YRDA 3M4OJ 3GMEA 3JRAA 2KAFA 2XKOC 3Q1JA 2PVGB 2RH2A 4M78B 2JSCA 4BQQA 3EFRA 4LFUA 4EJUA 2EYXA 4HCBA 2EYWA 3S2HJ 2QA4Q 2FOWA 4M74A 3BG3A 3AG4H 2OTJI 2PNIA 2RQWA 3A8LB 1JI8A 4FL6A 4J6YA 1OJLA 2WACA 3ZL7C 5LHHA 4C5IA 4YELA 1YIJT 2R57A 2DPPB 5GAMg 3K10A 3ASKA 4R55A 2OTJT 2VT3A 2KBTA 4BDZA 4M78C 1W6XA 2ME0A 4JLGA 4BHBA 1UE9A 1Z7LA 2O9LA 4OB2B 1YIJI 1ZRDA 2V1DA 1ACIA 3COAC 2O5RA 4J9GA 3CBMA 4ETSA 3FXJA 1B59A 3F8MA 1MMAA 2QZ8A 4L18B 2HVQA 3TW6A 5LJ3f 1LFUP 1BKBA 4FASD 2CV0A 1EH6A 2RAEA 3H9JA 3CC2A 1MJ9A 2NYXA 4U0WA 4C8QD 4V2GA 1H89C 4NUBA 4AFZC 4HT8A 1T56A 4XK4A 1YJ9A 4X1VA 4NS5A 2ABLA 1MJAA 1VFCA 2WAQA 2CU7A 4F52A 3MPUB 3K4MA 3JB9F 4YFKF 3HOSA 2MA3A 5KK1A 1WQ7A 5LJ3e 5F1JA 2FD5A 4RTWA 1MDMB 1T3SA 2JN6A 2QQBA 4C8QB 3PIOF 3FXOA 1PD0A 3JCMP 3CCLA 1J2XA 2KIFA 2RHYA 2YUQA 1HD3A 2P5LC 3BZKA 3S1NJ 1Z9ZA 3WVEB 5IT9Z 3DQVC 4LB5A 2FNAA 5L8RE 2RJFA 3F21A 3JB9G 1FOKA 3OSGA 3EPZA 2EZLA 5ICCA 3AL0C 1Q81R 3HOYJ 4XLHA 4IQ4A 4PFOA 1Y57A 1OU9A 1QVFA 5GANe 4FQGA 5GAGJ 3H0DA 3ABUA 2E5QA 1OCCH 4BS9A 1VQKI 2E71A 1X58A 1YS7A 5CKTA 2JT1A 2CYZB 3EG9B 1WJDA 5D6YA 5GAMf 2RA2A 5J39A 4NL3A 2X98A 2EGEA 2E1MB 5JVTA 2Q1ZB 4BEHA 3K1PA 1U1SA 1IXCA 1AT1B 4XAXB 1MMDA 2DLPA 2QSFX 1YOVB 2O03A 3RJPA 2CQKA 2MBFA 1XSXA 3O8VA 3CEYA 5EEHA 5LRSA 3LSRA 2LX9A 1X2MA 2D8HA 1NG6A 5TISC 4F92B 1RUOA 3SFIA 1IREB 1J5YA 1RL2A 3NMZC 4Y28E 3LNQA 1RNLA 1BI0A 3Q5FA 2E3HA 1U8BA 3CCRA 4G9YA 1IRZA 4C8QA 5A0GA 4C5GA 1WJRA 3H9GA 4KMFA 2E1MC 5DS9A 1ZRFA 5EC7A 4OMZA 4BL0B 1POGA 2XI9A 5LJ5d 2FZKB 4IHXA 4XM3A 2VJIA 5KAFC 3OIOA 2EJGA 4ESFA 5ED4A 5FJ8J 2GBYA 4XKCA 4FW1A 4QW2A 3IKVA 2KDOA 4R79A 1RI0A 5CKDA 3L2ZA 2RI5A 2ADUA 3K4BA 1H641 3EUHC 3X20B 2LFBA 4PGHA 2FXAA 2ISZA 4J6WA 2E19A 4A4EA 1M8VA 5CVUA 1OX9A 4XTZA 4PJOE 4IVNA 1XG1A 1WHJA 3JCMc 1VQMI 7AT1B 3IP4B 1ITYA 2E34A 2EA2A 4IF4A 1S72A 5JLWA 2DILA 1FTZA 5E20A 1FWZA 2LQKA 1SSFA 2I10A 4IRGA 3CD6Q 4Y7NJ 4XRFA 3WTVC 3GTQJ 4C9YA 4Z8AA 4R1HA 3SWNA 2P5VA 2VUMJ 4XU2A 2EBIA 4P5NA 2H27A 1VQKA 2NXNB 3DXJF 3ZOBA 3JCUC 4PJOG 1NG2A 2OQRA 5FGMA 3CXCS 1P7IA 4KFCA 2E3IA 4GLMA 2X4HA 4E7JA 2F5EA 3F23A 1V1CA 4QQDA 1CQTA 3TO9A 1ZA1B 4XTUA 2YPRA 3QSUA 3L09A 3QPLA 2BZYA 3CPWS 4LDWA 3ZQQA 4EJOA 3PNYA 2WSFE 3O5ZA 4C2UA 4KUMA 4XTWA 4F14A 5GMKi 2P7CB 1QCNA 1VQ9T 3CCQT 5F6FA 2DTRA 3V7SA 4Q5WA 4NB5A 2JTEA 4PJOA 5GAMd 3HRMA 2F2XA 1UGQB 2NS7A 4L5EA 2VXZA 2DT7B 3W2VA 2KT8A 1Z0XA 4RAZA 2HD0A 4YIIA 2MFZA 2HOEA 3H35A 2BKDN 3LOCA 5FLMJ 2HDDA 2OA4A 2BZ8A 1MGQA 4HVUA 2VE9A 1GXQA 3JCMJ 3FKIJ 3HL2A 2K57A 1YLFA 4XONA 3RZDJ 2PFBA 2KMTA 1Q1VA 2QBYB 2RM4A 2V1QA 4BJTA 3EHRA 3CTAA 5ERIA 2OPTA 3IHUA 1JUSA 4NC6A 4KDPA 2E6NA 4A3DJ 1WQ2A 3DTIA 1OPCA 1OKRA 3DCFA 1WLPB 2W10A 2C06A 2FU4A 2IA2A 5I21A 2WTEA 2VYTA 5HDGA 4DJAA 3TU4K 1VQ8I 2PMUA 4GBQA 5AYFA 1N8RU 2XSDC 2FMLA 4HNUA 3BY6A 1Q7YR 4CI0C 3W2AA 1KYWA 1P4XA 3DP7A 5JHFA 3HOVJ 3IH2A 5DD4A 3EG3A 3CUQA 1ZBJA 1N5ZA 3MP8A 1KG1A 5FD5A 4OIQF 2HL5C 4Q47A 2L2OA 1XPXA 4H4KC 4NQWA 4NBQA 1AA7A 3VYUB 2DA4A 1D8JA 3HXLA 3P8BB 4DIQA 2K3BA 2ZBKA 2HKQB 2YLBA 3DB3A 1FMKA 5IP6A 1H9TA 4HV6A 3F8FA 4MMKA 2RK1A 4QTRA 3O3KA 2KDZA 4ENJA 1UDLA 5KYXB 1QGPA 3A1YA 3CXCP 2DL4A 3THKA 3A02A 1SHFA 2W48A 4C3JJ 2IT0A 2ZMEA 2K79A 2YWWA 4KGZB 3L2RA 2M35A 1WI3A 4M75G 1VQ6Q 1QVFP 1JXOA 3L2CA 3SHWA 2D5VA 1KC8U 4LLGF 3GW2A 4ZYDA 1GHCA 3I64A 1T0HA 4J9CA 4Y3OA 2K3XA 2VUBA 2DMTA 3BQZA 2EFIA 5C4JJ 1S3JA 1B8IB 1JGSA 4BBRJ 1WJSA 2R5MA 3GF5A 1FYKA 3JRZA 1E2XA 3BPXA 1O7FA 4R8HA 5DUIA 3MFKA 3BW1A 2D6FA 2X35A 4A3CJ 3C3WA 3TEEA 2L4AA 1NJIC 5A2QK 1WFXA 1GDTA 4HNTA 4CUGA 4LOCA 5ILVA 3R60A 3T8RA 4CCOA 5ILSA 2VONA 2LDMA 4W97A 1K0XA 4W1UA 3PIPF 3AT1B 2JSPA 3CQTA 3H0GJ 1LUJB 2DA5A 5LEJA 4D8DA 2Y9ZA 2DIGA 1Z3XA 5E3LA 4IRIA 1VQ9Q 1FOWA 1BJZA 3LLRA 3KX2A 2XGCA 1QU3A 1I5OB 4BB7A 3ZMVA 4JZ4A 3CCMQ 2P81A 1JHFA 2L02A 5LJ5g 2DE0X 4BY6B 3JV3A 2X9HA 1Q81U 3I5UA 2DK5A 3SEMA 5KYUA 2J5OA 4MNUA 5DEQA 3KIOA 3C0CA 3OYLA 4C92D 4DOWA 5KYWB 2XG8D 1ODDA 2CQXA 3FF5A 4XTYA 3BTLA 2DPDA 5FW9A 1K4US 3W6VA 2ZSHB 1W5TA 2DM1A 2LY1A 2E5KA 1E3HA 3JB9D
chains in the Genus database with same CATH topology
4JRIA 2STTA 5L3FA 4RGRA 2L8DA 3CJNA 2PU9B 3OSSC 2DEQA 3VEPA 5KE2A 3X28B 1Z9CA 1FP2A 1QVGA 2DBBA 4XTXA 1K9MC 3I58A 2M9UA 1IRGA 3V8LA 4M78F 3E5UA 2LT1A 2RO0A 5J6XA 3JCMV 3ZFJA 4M75B 2RKHA 2XASA 2XAQA 2A3LA 1YW7A 2ZPIB 4KBMB 3IL2A 4UVCA 1VQ5T 4BE0A 4FX0A 3QPTA 2KIMA 1JB0E 1M4ZA