3GLXA

Crystal structure analysis of the dtxr(e175k) complexed with ni(ii)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
221
structure length
211
Chain Sequence
DTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEACRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVPGTRVIDAATSMPRKVRIVQINEIFQVKTDQFTQLLDADIRVGSEVEIVDRDHITLSHKDVELLDDLAHTIRIEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diphtheria toxin repressor
publication title Decreased sensitivity to changes in the concentration of metal ions as the basis for the hyperactivity of DtxR(E175K).
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Transcription
total genus 63
structure length 211
sequence length 221
ec nomenclature
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3glxA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 3glxA02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3glxA03
4KT5C 1USTA 4A2UA 1UCRA 1TW2A 1ZG3A 1LJ9A 1W7PD 2WC2A 3IRRA 3IHUA 3O2PE 2IVMA 3KEOA 1FNNA 2D1HA 4MQVA 1IW7F 4GGGA 1SFEA 3HTUA 2IA2A 3WTWC 1LEAA 3GYHX 4MHGA 5E1WA 4I0BA 4F7ZA 4IHTA 4L9VA 4DNCA 1QGPA 3NRVA 4O5VA 3WGIA 3SZPA 4YFXF 1IN8A 2O8XA 1X3UA 1I6XA 5J8FA 3GWZA 3KP7A 4XRFA 1G6NA 2CO5A 3V7SA 5J6XA 2XROA 1IF1A 3S2WA 5HS7A 2LNBA 3I0TA 1HKTA 3ZQ7A 2JZYA 2V79A 4KMUX 3L00A 3JSPA 2QQBA 1MJBA 2HKOA 4I98B 4L0YB 1FBUA 1YG2A 2Q8KA 2L02A 1R5GA 4P9FA 2XRNA 2MH9A 2ZMEB 2QZ8A 3C1DA 1U8RA 1MGTA 5L3FA 3M8EA 5LRRA 4LB6B 4N0BA 2QBYA 3KEQA 1KU9A 2VBXA 3RPQA 4UNOA 2RN7A 1K79A 3K1MA 2PFBA 2YX4A 4KYWA 6PAXA 3FXRA 1MJ9A 1MKMA 2HQNA 3GLXA 2VT2A 3IKVA 5A2QK 2X4HA 3WTUC 4WWCA 3GF2A 3KLOA 2PG4A 3TDZC 2VBYA 1CF7A 4RB0A 3R0JA 4KN7X 4HQMA 2F5EA 2P5VA 3E6CC 4ZZDA 2VC1A 2DBBA 4G94A 3W6KB 1IAWA 4HLYA 1K7AA 2NNYA 1ZARA 5E1XA 4LK0F 2M1BA 3E6MA 1I1GA 4R1HA 3P9CA 4OINF 3V7RA 4OIRF 5FLXK 1T2KA 3K2ZA 1KU2A 4HQEA 1G3YA 3E19A 4P5OA 4FHTA 1B9MA 1ODDA 3ZMZA 3TO6A 4IVNA 3TDUC 4HV5A 5DCFA 1DUXC 2HTSA 1KU7A 4HDUA 3KCCA 3SXYA 4BQAA 2UWMA 3GFMA 1XN7A 1IXCA 4IRGA 3FMQA 3HHGA 1ONVA 2VOPA 3QAHA 4MTDA 1JXSA 1Z6TA 3GO5A 3CUQC 2P4WA 4HYEA 1HSTA 1BC8C 3FMRA 2PQ8A 5AIQA 1D8KA 3E5UA 3WGGA 2CSOA 2HEOA 1TLHB 2Z99A 4BH9A 1UHMA 2L3DA 2QWWA 3CLOA 1F5TA 3ELKA 1J0RA 2EFOA 2EB7A 2GQQA 1G3TA 4M72A 3ZP5A 1JGSA 4U7BA 2K4BA 2PJPA 1R23A 3CUOA 3SHFA 2HWVA 3BY6A 1U3EM 1E17A 2FEZA 4BHPA 4EVIA 3TO9A 2HGCA 2W24A 4WXHA 1B4AA 5JHUA 1BI2A 4U0WA 3K1NA 1ZRFA 5HVQC 4LK1F 1SAXA 4ZZLA 2ZO4A 1IXRC 3CUQA 2A68F 1P2FA 2OZUA 3FXUA 2COMA 1LEBA 1R1TA 1J5YA 1O57A 2QUFA 2XAQA 1DPUA 5DCMB 5BPDA 3F6OA 2L4MA 3J81Z 3I59B 3F8BA 3JTHA 4NQWA 5DD4A 2FNPA 3DF8A 1B6AA 2VBWA 5F64A 3MHXA 2HKXA 2Z9OA 3IKTA 3RDIA 2ZMEA 3F72A 2AXLA 3N97A 1WI9A 2D2WA 3EUHA 5LGUA 2XGXA 3PQJA 3TOAA 1D8JA 2WWYA 4BHCA 4KIBA 1KQ9A 3B02A 3JAMK 4K2EA 2FU4A 2A6HF 4ZYHA 2VE9A 2MD5A 3T8RA 4A6EA 1W5TA 4HX4A 1MZBA 4U0YA 4KA4A 3KP4A 3KLNA 4YFKF 3IL2A 1LDKB 1R22A 3F8MA 3HRMA 4RAZA 2PBIA 3HHHA 1YYVA 2XAFA 3I53A 1HW2A 2EV0A 2IPQX 1YFHA 3WU1B 3DPTA 1SMTA 3BJAA 2Y48A 2FE3A 4WK8F 3GZ6A 3C7JA 2F5FA 3HOTA 1XGNA 1ZLJA 3FWEA 1WQ2A 3P9IA 1IUYA 4M6YA 2G7UA 4ON0A 2FNAA 1PDNC 1IN4A 4L9JA 2OBPA 4RAYA 2M5WA 2JTVA 2BBYA 1S7AA 1ZG5A 1U6GA 2ZFWA 3N4MA 1U5TB 2VT3A 1PUEE 1OR7A 5FD5A 2EV6A 2O3FA 2ADUA 3KP3A 1G4DA 5TRDA 3ZMDA 3GUDA 5HLIA 2UXXA 1XGMA 1J7KA 2O61A 3R0AA 3ZMTA 1ZGJA 2R7DA 4PGGA 2M45A 1F9NA 2GXGA 3F3XA 3GXOA 2XAGA 3R4KA 3ZPLA 3J80Z 3O6BB 3ZMSA 1S29A 5H6QA 3LQQA 2IA0A 1OYIA 3BPVA 1E2XA 2IP2A 1TW3A 2H94A 2NAZA 2ISYA 2BGCA 4I02A 2GAUA 3KP6A 1XCVA 3HIFA 5K5OA 2PN6A 4HX7A 5L3CA 2HQRA 2ISZA 4S04A 1LDDA 2P7CB 2V1XA 2OZ6A 1TNSA 1T98A 4EJWA 4MNUA 2OAZA 3F6VA 1DP7P 1ZHFA 4LGWA 2W84A 2XIGA 2DT5A 4RGUA 2NNNA 4EGZA 2VOOA 4MQ9F 5CVJA 1W4MA 3SQNA 2PI0A 5HOOA 1O7FA 2FBIA 4GO1A 3FX3A 4N9HA 5FD6A 3MZYA 3R60A 4PCQA 2GWRA 1BIAA 1I1SA 2A69F 1TQIA 1AWCA 4HOBA 4I0AA 4M73A 2F2EA 1GVJA 5E1ZB 1VTNC 3V4GA 2EFQA 3H92A 4ENKA 4L5JA 4R8HA 4JQFA 4OIPF 2BEOA 4ENNA 5DCMA 1RI7A 3E6DA 1BIBA 3I59A 1GXPA 4EM2A 1KQ0A 2O03A 3E6BA 4MEXF 4EJOA 1TQMA 3GEZA 4OMYA 1KQ8A 2W25A 1P4WA 1GHCA 1IXSB 1YIOA 4MTEA 5JI6A 2W57A 4S05A 2HR3A 2KRFA 1D3YA 3CO7C 3F8FA 4U88A 4ZYDA 2P5LC 5LHGA 3OV8A 2DI3A 4A0ZA 4HLXA 3RTRA 4XSXF 4PZJA 3K0LA 5LEKA 4ESJA 3K69A 2XV4S 2DPDA 4L9TA 4OIOF 4NB5A 2K5FA 5CVRA 1O3SA 4G7ZF 5JFRA 5DV5A 3JW4A 2R7FA 3FMSA 1IN6A 1FPQA 4IRIA 1LVAA 3KZYA 3IC7A 3ML6A 5HDNA 3CDHA 5HS9A 1Z6RA 4A12A 4YG2F 5E18F 2OQGA 4I7HA 3RJPA 3ZMUA 1QVPA 5HDKA 2RV8A 4RB2C 1EH8A 2FQ3A 5IT3A 1KYWA 1BI1A 3RKXA 5F1RA 3BDDA 4RGRA 4LJZF 4KDPA 3WTZA 3KZZA 2EJRA 3M1EA 4Q5SF 1J75A 2RVCA 2DU9A 3DV8A 4HX8A 3EQLF 1C0WA 3QOPA 1XD7A 1R1VA 2K27A 1QW1A 4EMSA 1U5TA 4EJTA 3I71A 1IN5A 2OA4A 3QU3A 4GYIA 3IWZA 2GA1A 3LSTA 5DEQA 4AIJA 2H6CA 4LLGF 5AONA 5IT9K 3H3ZA 5TJJA 2F5DA 4L18B 2LF7A 3TQNA 4EV0A 3U2RA 3REOA 4XLNF 2P7VB 3WE2A 2IW5A 3BWGA 5LRSA 4O3MA 1SD5A 3HRTA 1R5HA 2YPRA 1F4KA 2DW4A 2YR2A 1Z91A 1I5ZA 1DDNA 5FB2A 5FO5A 2NS0A 4IRHA 3LAJA 2P6SA 5A2QZ 3E3VA 3D0SA 3HRUA 1HXDA 4WX9A 5D5WB 2D1VA 3TGNA 3QRFF 2ESNA 1G3WA 2K4JA 5DUKA 1WRJA 5DYMA 5LBQA 3KETA 3DEUA 4BAYA 2RDPA 1T0FA 2K4YA 4XBFA 1QZZA 2FMYA 1DPRA 1ZH5A 2QYOA 3K1PA 4OMZA 4XSZF 2VODA 2PEXA 1BYMA 2EK5A 2RGVA 4M9ZA 3EYIA 2BE5F 3I64A 4L0ZB 5FLXZ 3C3WA 2VONA 4AD9A 5LGNA 2DK5A 3DXJF 3J7AO 2HOEA 3Q9SA 2EFWA 1FBSA 2XHKA 4KMFA 2MBFA 2DQLA 1FYKA 1XB4A 1W7PB 1S8NA 2K86A 3RKYA 1ZLKA 3F21A 2CG4A 5D5UB 1S7OA 1GXQA 1T39A 2Q0OA 4EJUA 1EV7A 3BROA 3MWMA 3WU0A 2MLGA 1XDUA 2VXZA 2D45A 4M74A 3SZTA 3HRSA 4P9UA 2DQRA 3RI4A 3TKYA 1YO5C 5JVTA 1K6OA 3F8CA 1SFUA 3P7NA 2H27A 3E97A 3EETA 1ON2A 5LGTA 4EM1A 4WF2A 4LD5A 2HDCA 3LAPA 2FXAA 1SD6A 4G6DA 2EV5A 3W6JB 2BV6A 1R7JA 3LWFA 5CVUA 2HYGD 4RGSA 1ZG1A 4HBLA 1BI0A 3I54A 2W85A 3FF5A 4LLNA 1REPC 2OQRA 3QPHA 3F22A 4P96A 2FMLA 1FSHA 4KICA 3U9GA 4BXUA 3RIRA 1YS6A 2DK8A 5BOXA 2DFIA 3G3ZA 3VEPA 3V8JA 1FOKA 3WODF 4BNCA 3GFJA 3FHZA 1KU3A 2UXNA 4CGZA 4YIIA 3HSFA 4XLPF 1MDMB 5E17F 2L4AA 1ULYA 2GZWA 4I01A 2XASA 5ERIA 2XKOA 2QM3A 4Z2YA 3L9FA 2XAHA 2O0YA 2ESHA 2K7LA 4HF2A 3ZN1A 5E8IA 3RYRA 3I58A 2FA5A 1RUOA 4G7HF 1MD0A 3T0YA 2KJBA 2R3SA 2PLYA 2FF4A 1R36A 2A3SA 3B73A 5H20A 1OPCA 4RS8A 1WSUA 2QBYB 2MLKA 4M71A 1YQAA 3L7WA 2CWEA 4ENJA 2K02A 4HDVA 4KUMA 1TQPA 3GX4X 2LF8A 2MH2A 1LDJA 4B09A 2KIMA 4CDGA 2LDUA 1BJAA 4FT8A 3TO7A 4ZYGA 1OYWA 4WCGA 3G73A 2RQPA 2FBHA 1UHWA 1LNWA 3M9AA 2M8EA 3ABTA 3WG9A 5CJ9A 4Y17A 3IRQA 4Y13A 3L09A 1SD4A 3T8TA 3L2CA 3JAMZ 4RB3C 2L01A 2E1NA 1F1ZA 1XSDA 2HFHA 5CLSA 1XGSA 2Z3YA 4AIKA 3V8KA 4AIHA 2FBKA 2KIUA 1FP2A 4N9IA 1O3QA 2STTA 1CGPA 2GIVA 1FYLA 3HYIA 5ICCA 4CZZA 4YFNF 4LG0B 2ETHA 1ZN2A 4MGRA 2PMHA 4Y15A 1UB9A 3E5XA 4M9XA 3FM5A 5LLQA 2MC3A 1Z1DA 1YW9A 5DDGA 4HA8A 1O3TA 1H0MA 2A07F 4QLCU 3Q9VA 5EEGA 1U78A 4D0PA 1TBXA 5L3BA 1G3SA 2ACJA 3HTSB 2E1CA 3FM3A 1HQCA 2XUBA 2ZNZA 2VN2A 4L5IA 5HDGA 3KE2A 3ABUA 1R58A 1XCBA 4Q47A 4A0YA 1XDSA 4UVCA 1NHAA 3M8FA 4L9NA 1L0OC 4ESBA 2HS5A 2M30A 1WKMA 3LA2A 4G9YA 2IT0A 1IRGA 5DUIA 5ILUA 1V3FA 3PFIA 1AOYA 3RKWA 3OOPA 2QVOA 5ICEA 2JSCA 4Q48A 2VBZA 1FYMA 2A5YB 1EH6A 1K78B 3HSEA 3VB2A 4HZFA 4G8XA 1OMIA 3BJOA 3GZ5A 4IHSA 4B8XA 3M7GA 2RKHA 2J5OA 4IPAA 1Z7UA 2CQKA 4H0EA 2QLZA 3D5LA 3LFKA 3QU6A 4Q4ZF 1SMYF 4I09A 4ESFA 1BOAA 4G7OF 5DD8A 2OD5A 3CUQB 5K1YA 3ROUA 2E7XA 4OOIA 1U5TC 3BOQA 3RPUA 3K9TA 4U7DA 1YTYA 1T38A 1MDMA 2HTJA 3LA3A 3LQRA 5K5QA 1MJAA 1J9IA 1XGOA 3I5UA 2J5PA 4A5MA 3DP7A 2LSOA 4QWQA 3QP5A 1SFXA 2GA2A 2FSWA 3JTGA 3O3KA 2QENA 2Q2EA 2YU3A 1BN5A 5L3DA 5D8KB 2LKPA 3DFGA 1RNLA 1ZREA 1BM9A 4YIFA 2ZCWA 2Y0MA 3GW2A 3PQKA 5BMZA 2FRHA 4ETSA 1P6RA 3EDPA 2MA3A 3BJ6A 2K5LA 1JHHA 1TNTA 5ILVA 5EEHA 1V4RA 1EH7A 2DO7A 3ISPA 1QQIA 1KYZA 2WTEA 4ENMA 3BZ6A 2Z5UA 2CW0F 4P55A 1LB2A 5L3EA 1ON1A 4ASNA 1FP1D 2EFNA 1O7LA 1UFMA 2JPCA 4RB1A 4UVAA 2H3JA 4WXCA 3WTYC 2XVCA 3SFZA 2IJLA 2ZKZA 1JHFA 5ILSA 3WTTC 1ZGAA 2O6GE 1ZRCA 1FC3A 1XMKA 1I27A 4R79A 5KVRA 2YSRA 1T6SA 4HF0A 2F5CA 1TTYA 4UV8A 1OYYA 3NQOA 5F6FA 3JSOA 1HBXG 4KIFA 1L3LA 2CFXA 5LHIA 4OIQF 2XKPA 1QNTA 2JRTA 4LG0A 2V1UA 2QQAA 5BQTA 2NRAC 1P4XA 3QP6A 5FFZA 4GXOA 1WWXA 1RIOH 3P9KA 4KIGA 2XAJA 5E8GA 1QPMA 4G6QA 5HS8A 1B59A 2P5KA 3MAJA 4M9SA 3I4PA 4TV7A 1ZRDA 2ZXJA 1ZAOA 1LQ1A 3IWFA 2V9VA 1Z05A 5HLHA 5D6FA 3F23A 4JBAA 4UXNA 3WE3A 2DTRA 1HKSA 1HSJA 2OU2A 4O6JA 3KP5A 3Q5FA 5IT9Z 3J81K 2H09A 4A6DA 3MZHA 3ECHA 3GVAA 4HAMA 3ECOA 5KK1A 2GCXA 4A0XA 2P8TA 4IXAA 2HYFA 4LFUA 2Z33A 2PMUA 1SD7A 1XSXA 4GCVA 2A6EF 1FY7A 4UV9A 5HLGA 3MFKA 1IRFA 3ZMVA 2ZBKA 1K78A 2H6BA 1RZ4A 1JE8A 5ICGA 1S6LA 1H9TA 1BI3A 2E7WA 3GFLA 3ERED 3FXQA 3EYYA 2VE8A 2DAOA 3F8NA 1BC7C 3VOEA 4FX0A 3HSRA 4OU0A 3V7CA 2CGPA 1P4AA 4M6XA 1RUNA 2EFPA 1KGSA 5L3GA 2L54A 2YX7A 3WTSC 2KIFA 1IN7A 2EA4A 1Y0UA 4UVBA 2V6CA 1QO0D 4EQQA 2AS5F 3H3UA 5AIPA 1FLIA 5E20A 5ICFA 5D4RA 1PP8F 4ZH4F 2IRFG 4BHBA 2VC0A 5LHHA 4LLLA 3VFZA 2NYXA 3WTXC 5H6RA 4DQ2A 5D6EA 1P92A 4LMYA 3DPLC 3KP2A 2CYYA 3WTVC 3HOSA 3V8LA 3C18A 2BYVE 4IJAA 5BS6A 5FFXA 3R6SA 3RYPA 3T1BA 2TDXA 1BBYA 4HW0A 4CXFA 1FT9A 2DLLA 3E5QA 5LEJA 4HF1A 2HZTA 4AWXB 5D8LB 2A61A 4KFCA 1FSEA 2K5IA 1IZ1A 2FOKA 1FX7A 4PGHA 4UHTA 4PDKA 4I2OA 3ZN0A 1FWZA 2M87A 1H9GA 5FGMA 1Z9CA 2UZKA 3J80K 5K5RA 4IF4A 4EM0B 4E70A 3DKWA 1PP7U 2C6YA 3ULQB 5D5VB 3HUGA 2JT1A 2RC4A 1D5VA 3R61A 1J2XA 3TOBA 4BYYA 1J59A 2ZNYA 1A04A 2G9WA 5D5XB 1CF7B 3AAFA 1YLFA 1USSA 1YW7A 5BPIA 1STZA 3NEUA 1QZYA 3QPTA 4GYGA 2LX9A 4CHUA 4CICA 4UUVA 3GFIA 3MEXA 4HV6A 1W5SA 3U1DA 3CJNA 5J8CA 4EJVA 1QBJA 2RNJA 4KNYA 1YW8A 5CYVA 5ED4A 4KN4X 1Q1HA 5CVVA 3T5XA 2WV0A 5JR3A 1XMAA 1FZPB 3WGHA 3DQVC 1KA8A 3BP8A 3FZVA 2KJCA 2V1DA 3BPXA 1R00A 1HW1A 1R1UA 3KFWX 5CVIA 4ZYEA 4EGYA 4FX4A 1HKQA 1OKRA 2EA2A 1B9NA 3VODA 3COAC 2JPBA 3CTAA 1S3JA 2EWNA 4CO8A 3LA7A 2B0LA 2G7HA 1B1BA 4U0VA 2ZJ2A 1U2WA 1O3RA 2X0LA 3CO6C 4CYDA 2IA1A 1W7PA 1FBQA 4RGXA 1XSVA 4LB5A 2P6TA 1HW5A 1YS7A 2DPUA 2QQ9A 2ELHA 4MEYF 5D4SA 2STWA 4WXDA 3MCZA 2KKOA 4AVPA 4JK1X 2GXBA 4NHJA 1ZYRF 4A5NA 3MQ0A 2Y75A
chains in the Genus database with same CATH superfamily
4KT5C 4D8DA 1Y96A 3TW6A 3Q1JA 1KHCA 3NMZC 1USTA 4A2UA 2XDPA 4ELYC 2BZTA 2JN0A 1UCRA 1OCZH 1TW2A 3IP4B 1TT5B 2O7OA 3OYAA 1ZG3A 1LJ9A 3KX2A 4BQQA 1W7PD 3CMEA 2WC2A 3GTGJ 4M7AG 4XORA 3IRRA 4JS4A 4PL6A 4MZTA 1ZQ3P 3GTKJ 4JLIA 5GPCA 1IB8A 1ZUUA 3IHUA 3SWNB 3DLAA 3FKJA 4A3FJ 1E7OA 1T3SA 3OY9A 3O2PE 3PE0A 5CPRB 1GFDA 4Y4RA 2R5YA 2LH9A 1VOMA 2FOWA 4MDWA 2BY0A 2E1OA 2IVMA 3C12A 2RH2A 4C30A 4C92E 3MJXA 2Y69H 4IOAF 3KEOA 4B3XA 1SAUA 2HNHA 1FNNA 2D1HA 3CCET 3JCMQ 3EUKL 1GBQA 4MQVA 4AC0A 3PJRA 3EG2A 2QA4T 3A8GB 4BY1J 1N9RA 1IW7F 4GGGA 1SFEA 1YWPA 1M1KC 3HTUA 2IA2A 5J40A 3RKQA 2BIVA 3WTWC 1LEAA 3GYHX 4MHGA 2CP6A 4HKEA 1YJ9T 1VQLA 3OS1A 5E1WA 3HL8A 1S72T 1VQ6A 2DYSH 4I0BA 1HC8A 4J6WA 1UJ0A 4ZNXA 1BA5A 4F7ZA 2CP2A 3MKDA 3OSSC 3CCMA 4IHTA 4YEJA 4BACA 4QPQA 2RQUA 2MMPA 4L9VA 4X9DA 4E7ZA 2ZPEB 1YJNT 4C0FA 1IV6A 3I56A 3OL3A 4QPOA 4DNCA 3K4MA 4M75A 4M78A 5EF6A 3MVPA 4YELA 1QGPA 3NRVA 1G2BA 8ATCB 4O5VA 5EDNA 5D6XA 5HKCA 4JJBA 1FMWA 1IRZA 3WGIA 2CZ1B 2MI6A 3CDIA 3SZPA 4YFXF 1IN8A 2O8XA 2E70A 2JXBA 3PNVA 4M77F 1X3UA 1I6XA 4RA2A 5FU6C 5J8FA 1W0UA 1LCKA 5KE2A 5B66C 2PVDB 3GWZA 3KP7A 5A0GA 4XRFA 3OS0A 1G6NA 2CO5A 3V7SA 5J6XA 1IUFA 2DOAA 3HC7A 2XROA 4IO9F 2QTXA 1AU7A 1IF1A 1FMKA 1WJRA 3H41A 3G6EA 3FHNA 3S2WA 3DU6A 5KYXB 2E3IA 5HS7A 2DL4A 1QCFA 3HTRA 2K3BA 2LNBA 3I0TA 4BEHB 5LFAA 1HKTA 3ZQ7A 2JZYA 2V79A 4KMUX 4NQWB 3EFOA 3L00A 3I35A 5LJ3f 3TU4K 3CCEQ 2QA4Q 3JSPA 1OCOH 2QQBA 2KT0A 5IPAA 1MJBA 4ORZA 1YJ9Q 1B7TA 2HKOA 4I98B 1R0BG 1TH7A 1HSQA 2LQNA 3BT9A 5L8RE 5GANd 1S72Q 4L0YB 1FBUA 2DOEA 4DOZA 2VJ5A 1HDDC 2KRMA 2QGFB 1YG2A 3FLGA 4AU7A 2Y4YA 2EINH 3CBMA 4EMKC 2A7YA 2Q8KA 2L02A 1R5GA 5F0HA 4GBQA 1T95A 4P9FA 2XRNA 2MH9A 1PVEA 4XL9A 2ZMEB 2QZ8A 2DDBA 1KC8C 3C1DA 2ME0A 1YRNB 3CC7T 1EKEA 1U8RA 2XDDA 3CCRT 2CQ7A 3KEYA 2XHCA 1MGQA 5GAMh 3RZOJ 1NYGA 1BCMA 4XU0A 1MGTA 2FX0A 5L3FA 3M8EA 2O9LA 1K4SA 2EJ9A 5LRRA 4LB6B 1ZSZC 2NYSA 2LDMA 4ZN3A 4N0BA 3FXKA 3RCOA 3VSKA 2QBYA 3KEQA 3CMYA 1QVUA 4IHVA 1UFFA 2F2XA 4IUVA 1B8IB 1UECA 3M4YA 3JAMR 1KU9A 1X6OA 2KI7A 1LFBA 3HHTB 2VKEA 2VBXA 4LDXA 2QGUA 3RPQA 4UNOA 1WPKA 2RN7A 2EQIA 2A36A 1WH5A 3JR9A 1K79A 5IN1A 3K1MA 3OMCA 2PFBA 3PT9A 4EMHA 2KT8A 2YX4A 4CA0A 2FRYA 4HXJA 1Q81R 2QSGX 2K7AA 4P5NA 2V7FA 1JQQA 3H0FA 2ED0A 3HOWJ 2DL7A 4KYWA 1W36C 6PAXA 4J9DA 2M35A 4DOWA 2VWFA 2W10A 1PHTA 3FXRA 2MABA 1MJ9A 3DEEA 3JRAA 1KQ1A 2P0QA 1MKMA 5GANf 2HQNA 4XR6A 3TSZA 3GLXA 4JRPA 2QXFA 2VT2A 4EMGA 3IKVA 3UKGA 5A2QK 2CZ7B 2X4YA 5J4YA 2R4GA 2E41A 2X4HA 1MBHA 1OCCH 2EQJA 2QAZA 3IH4A 4KH0B 1UG0A 2EQUA 3DWLE 3WTUC 4QQ6A 3VJPA 4IUUA 1QPIA 1Y57A 2DA9A 2Z0WA 1OLTA 3K70C 2CS7A 4WWCA 3GF2A 3CCLI 1DGWY 4BE2A 1IGQA 3FBNB 3KLOA 3D1NI 1MSEC 2IGMA 2RD1A 3NPFA 2DMUA 2PG4A 4F7UG 2EILH 1WI3A 1RAGB 3TDZC 2KROA 3ZGKA 2CMPA 2HNIA 2RI5A 3CC7Q 1WFXA 3SDZA 1X19A 3OS2A 1AZGB 3CCRQ 1WQ7A 1HK9A 2CW7A 2V1RA 3HPWA 2VBYA 2QCOA 1K76A 1UZCA 5K7FA 1TL8A 1K8AU 1CF7A 4RB0A 3PFYA 3R0JA 4KN7X 4HQMA 1JKOC 2F5EA 1NM7A 1FMVA 2P5VA 3E6CC 5FKOA 2CV0A 4ZZDA 2VC1A 2DBBA 4G94A 3W6KB 1IAWA 4DEXA 1QVGS 2WSFE 2OTJA 4LDUA 2PVOB 4KISA 1WGSA 4HLYA 2RI2A 3FRNA 4XIDA 1K7AA 2NNYA 1ZARA 2W4SA 5E1XA 3ZXSA 2JM8A 5IHKA 4LK0F 2M1BA 3E6MA 1BU1A 1I1GA 2L0KA 5EGOA 4R1HA 2CSIA 3P9CA 3M56A 4OINF 3V7RA 4XLAA 4HRIA 1LUJB 1R77A 4OIRF 5FLXK 2HQAA 4N4HA 3HFNA 3K10A 2E5NA 1T2KA 1F1BB 2KRSA 3G4ST 3J7YJ 4EMKA 3K2ZA 1KU2A 4HQEA 1JKPC 1G3YA 1WJFA 3EGXA 2J6FA 3P8BB 5D6WA 2LQ8A 3QWLA 3DKMA 4RDUA 4P5OA 2F4OB 3E19A 2AIRB 3CC2Q 1YJ9A 4LXCA 4FHTA 1B9MA 1ODDA 1PM3A 2M02A 1S72A 3LW5E 4I99C 4II1A 1VQ7T 1WZ2A 1VQ8T 4F04B 5GANg 3ZMZA 3TO6A 2D9TA 4IVNA 3TDUC 1ZSZA 5C0MA 1SRLA 3GP8A 1YJNA 4HV5A 5DCFA 1WYXA 2VUMJ 1DUXC 3CF5F 3CDLA 2JNGA 2OAUA 2ZJQF 2HSEB 1LE8A 2HTSA 2C0IA 2Y2ZA 3RQIA 2HZDA 1A35A 1KU7A 3W2VA 5CQYA 2O8KA 4HDUA 2ID3A 4D6WA 3VU3C 3CCUA 2XGEA 3KCCA 5EC7A 2YWWA 1PSFA 2FUG2 3SXYA 4BQAA 3JCMJ 1M3CA 5KAIC 1ACMB 2UWMA 3M59A 1AZEA 2EIMH 2O2OA 1V76A 2R7QA 3GFMA 3P8HA 4C8QA 5I22A 5IT9E 3L2ZA 1XN7A 3HPHA 4FSSA 3NAUA 1IXCA 1NTCA 1OEBA 2RQWA 2Y31A 1TT0A 2HDWA 4IRGA 1FTZA 3FMQA 4ZGJB 3HHGA 1ONVA 2CQNA 4U87A 2VOPA 3LX7A 3QAHA 3M0SA 3AG1H 1JJ2S 3CBPA 4XQFA 2EKHA 2ESWA 4PJOC 3L42A 3FJPA 4MTDA 2I5UA 3OYDA 1RR8C 1Z6TA 3GO5A 1JXSA 1HD3A 2EYXA 1QZEA 3CUQC 2BTTA 1KFZA 2P4WA 3HEFA 4HYEA 2NOGA 2JA8J 5J1YA 5GPAA 2CH4W 5GANj 1HSTA 4DZJA 2HI3A 2NUTA 2MFZA 2VXEA 1VQ7Q 3VS1A 1VQ8Q 4WCIA 1BC8C 2I10A 1W6XA 2JVGA 3SHWA 1NBEB 4PJ0C 4C8QD 3FMRA 2PQ8A 5AIQA 1TWFJ 1RAIB 2HQEA 4M7DF 1N25A 2L3QA 3ZQFA 3OL4A 5LJ5d 1D8KA 2M0OA 3BC8A 4PFZA 3E5UA 2HL5C 3WGGA 2A6TA 1X4PA 1ZELA 4IEJA 2CSOA 4XKBA 1PG5B 5HCKA 3J7ZI 2HEOA 3CLQA 2MVTA 1TLHB 2Z99A 4BH9A 1UG1A 2L8DA 1YITI 3CPWS 1UHMA 2L3DA 3DEWA 2EQKA 2QWWA 4FW1A 3CLOA 1F5TA 4C92F 3ELKA 1B3QA 1BW6A 4FT2A 1J0RA 1Y1WJ 1M1KU 2EFOA 3GTLJ 2I0NA 2KR3A 2XICA 2ZPIB 3FJ5A 2EB7A 2PUOB 2BKDN 3TEDA 1IXDA 1WIEA 5IP6A 2GQQA 3MP1A 3EHRA 1YHQT 2W48A 1E3HA 1G3TA 1T33A 1QKWA 4BE0A 4J9EA 2JT4A 4M72A 4RTYA 1OISA 4JLGA 2MOXA 5GAOp 1FYNA 2DYBA 2VKHA 5C4XJ 4RM2A 4KBMB 3RMSA 3ZP5A 3H9NA 1VQMI 1XS9A 4HSTA 3VS6A 1JGSA 1H641 4M3EA 4U7BA 2K4BA 3SWNA 3JCMd 2CS3A 2X1DA 2PJPA 4R55A 1R23A 2QDYB 2DT7B 1NG2A 4J6YA 3CUOA 1KQSS 2CT3A 1TZLA 3SHFA 4IHYA 4A3CJ 2HWVA 3BY6A 1U3EM 2YLCA 3H9JA 4RMNA 1AKHB 1E17A 2FEZA 4BHPA 4EVIA 3JRBA 2E2JJ 2R7TA 3GMEA 3TO9A 3J7AF 3LL7A 4LOCA 2GTOA 2O9VA 4AFZC 2HGCA 2W24A 4WXHA 1TWBA 2R57A 4C3JJ 1B4AA 5JHUA 4OWRB 2QI2A 2B9SA 2YUNA 1BI2A 1M5Q1 4FYXB 2CDTA 4U0WA 4XTYA 2LMDA 3OIPA 4FE7A 3K1NA 2KYBA 3M54A 1ZRFA 1Q7YR 2R7SA 1R5ID 1K6YA 4H4KC 3JCMc 3ZL7C 2LYCA 4RMOA 3ZQCA 1QVFP 4VUBA 3GNFB 1FIAA 3OQ5A 1UUEA 2H3EB 2WB1A 1MMGA 3GPLA 5KCOA 4AFSC 5DTDA 1NG7A 2ECZA 4M7AE 3CCJT 5HVQC 1R8OB 4Z02A 2ME6A 1GCPA 1JRIA 1YI2I 3JB9J 2R7OA 4LK1F 3CC2I 4PJNA 1YHQQ 1SAXA 3A8HB 1B07A 4XM3A 2CP7A 4ZZLA 3X2QH 2ZO4A 3OIOA 1WJDA 2OC6A 5M5YJ 1VQNI 3VUZA 1IXRC 1MUZA 1ZUYA 3CUQA 2A68F 1WLPB 2VI6A 4JRKA 1M30A 1P2FA 2OZUA 3FXUA 2COMA 1LEBA 1R1TA 1VQ9I 1J5YA 1O57A 2ENMA 2JTFA 3OWTA 1V54H 4D5FA 5CKFA 2QUFA 2VQGA 2Z16A 3IH3A 3VDXA 1Z3XA 3GBGA 2R58A 1V1CA 3G4SA 2DT6A 2XAQA 1K4TA 1DPUA 5DCMB 2FEIA 3MCAB 1TWHJ 2FVUA 5BPDA 5KYXA 3F6OA 2L4MA 3J81Z 1WDXA 2XC7A 3BR1A 3HZJA 3I59B 2KSSA 4F17A 3F8BA 4AYBN 4BEHA 3LWHA 1Q82R 3JTHA 4NQWA 4B47A 3PNWC 1K61A 5DD4A 1MMSA 2KBTA 3W3CA 2FNPA 1Z9QA 3DF8A 3BCAA 2DAQA 1B6AA 2Y90A 2JOYA 4BY6B 2DO3A 2VBWA 5F64A 4W97A 2HKXA 2ICWG 3BY7A 3MHXA 4PJOD 2Z9OA 1M9SA 3RESA 1GT0C 3CP8A 1Z3YA 4RTWA 3IKTA 4E7SA 5IYCJ 3CCJQ 2DXTA 4CC7A 2JSPA 4KGXB 5LJ5g 3RDIA 2ZMEA 3BQYA 3F72A 3JREA 2AXLA 2BZYA 2ZPGB 5KYWA 2KIQA 4LD9K 1YRNA 3CQZJ 3N97A 1SFKA 1UMQA 1WI9A 2E36A 2D2WA 2DIGA 3TEEA 3EUHA 4LITA 5LGUA 1WXTA 3AHUA 2XGXA 1U1SA 1A36A 3PQJA 3TOAA 2JVVA 1D8JA 5GANe 2CQQA 2ZXHA 2KYMA 2LQWA 2M0MA 4GLMA 2WWYA 1NE8A 1PUFB 2CFOA 3K6GA 1OR7C 4BHCA 3OBWA 3IAM2 1B8IA 1VQKI 3I55A 4KIBA 1VQOI 5LL6S 1KQ9A 3B02A 3JAMK 2DM1A 1U3OA 4K2EA 2FU4A 2GTJA 2A6HF 1TWGJ 3GTPJ 3S2DJ 1GCQC 2X1CA 1GRIA 3M1CA 4KRTA 2VPRA 2JA7J 3C2HA 4ZYHA 2VE9A 5IYDJ 5GAOq 2MD5A 3T8RA 2R7XA 4FASD 3C2GA 1PRMC 4A6EA 4BE1A 4JJCA 5CKBA 1W5TA 1GV5A 4Y33A 2F4MB 1RRJA 3MKYB 1X43A 1HF0A 3HP9A 4HX4A 5HK3A 2VV5A 1AEYA 1MZBA 4UUSB 4U0YA 3CMAQ 5LJ5h 2EYZA 4KA4A 1LFPA 3MP8A 2XI9A 1JUMA 3CCSQ 2CUBA 3KP4A 3C94A 3KLNA 2AKKA 4XTXA 3PIPA 4YFKF 2CUZA 2ABLA 4GDFA 3QHSA 2EYQA 1OCRH 2DE0X 3IL2A 1LDKB 1R22A 5JHFA 1NK3P 2WAQA 5LJ5j 4JJNK 3F8MA 1WQWA 3HRMA 4RAZA 5IHIA 1JT6A 5CO7A 2PBIA 4IURA 3HHHA 1YYVA 2XAFA 3I53A 1WXUA 3MEVA 2EGAA 5HNHA 1HW2A 3EG3A 2ECBA 2EV0A 2M7BA 1QP3A 2IPQX 4AMCA 3MMYB 5IYBJ 1YFHA 3WU1B 1X3ZB 2QQSA 3E9FA 1Q95G 3HG9A 3JCMP 3ASOH 1WHHA 2JS0A 3DPTA 3UR3C 1SMTA 3BJAA 2HOAA 1HLVA 2IPOB 1SANA 2Y48A 2LCCA 4C0DB 2KDSA 3G1LA 5GAEJ 4PSXA 2J6OA 3FISA 2EZHA 4Q5WA 1M1GA 2DOFA 2FE3A 1OOTA 3JCMh 4E2FB 2G6FX 3CCYA 4WK8F 3A0HC 4BJ5C 2XB5A 2KDZA 2LFBA 2PTKA 1X6BA 4B48A 3GZ6A 4FSXA 2AHJB 4LG3A 5IP7J 3C7JA 3BR0A 2E19A 2KT1A 1WGXA 3RUXA 1M3AA 1GXIE 4OP0A 1ENHA 2XU8A 3A8OB 4JRIA 4BBRJ 1M1FA 2F2WA 4F14A 2X3XD 2F5FA 3HOTA 4XRSA 1H3HA 1XGNA 1ZLJA 4XU2A 1FOXA 3FWEA 4R56A 3E1SA 4XLCA 1WQ2A 1YFNA 3P9IA 2GBYA 4M6YA 1IUYA 2G7UA 4ON0A 2FNAA 4PJOG 4F7UE 1PDNC 2EZIA 2KXDA 1A0NB 1IN4A 2KP6A 4L9JA 3KYLA 2DXIA 2LP5A 3UA6A 2EIJH 4N0AC 2OBPA 2M3AA 3G1JA 4RAYA 2M5WA 2JRMA 2JTVA 1JJ2A 2BBYA 1SC7A 1S7AA 1KJWA 4UB8C 5I11A 2HVRA 1MIJA 1BR2A 2LC4A 3FC3A 2DA4A 1ZG5A 1X4OA 1U6GA 2ZFWA 1Z21A 3N4MA 1X1PA 1U8BA 4C2UA 1U5TB 2TRTA 1IHVA 4RTXA 1SEUA 2VT3A 5FKKA 2R93J 4ZDLA 1KZHA 3UF4A 2N8GA 4C92B 1J3TA 2BY1A 4CCLA 2FPFA 2VL8A 1PUEE 1ACIA 1OR7A 1H89C 5FD5A 1EZZB 2D8HA 3CC4A 3VSLA 4YRVA 2EV6A 2O3FA 1OI1A 2ROLA 2ZJPF 2QEXI 2ADUA 1HYOA 3KP3A 1G4DA 4RTVA 1M90U 2QF7A 3SDGA 5TRDA 5FLMJ 3VUBA 3AL0B 4A3MJ 1VFCA 3HKZN 3ZMDA 2J6KA 2CZ6B 3GUDA 3Q0VA 5HLIA 7AT1B 2BY2A 2X1EA 1Q81C 2E35A 2UXXA 3CPWA 1B72B 2ZB9A 3H1CA 1XGMA 3L2QA 4RTTA 4OGEA 1T3LA 3CCQA 1WVRA 2G3RA 3H3VK 1J7KA 1RKWA 2O61A 3R0AA 1P7JA 4OMOA 3ZMTA 1VI0A 2NOJB 1ZGJA 2L9NA 2R7DA 5K7HA 2HPMA 4PGGA 4FCYA 4IHXA 2V8KA 2M45A 3M0RA 1MV3A 1F9NA 1IGUA 1WH7A 2GXGA 3F3XA 3GXOA 2XAGA 1Z9ZA 1VZ0A 3R4KA 2KDOA 2E5ZA 3ZPLA 4QKUA 1N8RR 3EGUA 3GBQA 3A1YA 4AG1C 3J80Z 1JJ8C 2P0TA 2L7KA 2EFIA 3NHNA 3PVQA 3HM5A 4D8KA 4D9JA 2PJRB 3PSIA 2R5AA 3FXMA 3O6BB 3M3YJ 4OF1A 1KQSA 3ZMSA 1XNIA 1S29A 5H6QA 1O75A 3TQ7P 4NL3A 3LQQA 2FG0A 4M75C 2IA0A 1OYIA 1FOYA 4M78C 4RM3A 1JTXA 3BPVA 3OYBA 1ZSGA 2Y0SA 2I2LA 2EGCA 1E2XA 3S8PA 3CCVQ 3CCLT 3I9V2 4C3HJ 2IP2A 2JJ7A 3LSIA 4G6TB 1YIJI 1NPPA 1TW3A 2H94A 2LR8A 2NAZA 2ISYA 4D7NA 1C1AA 1OZ3A 2BGCA 4I02A 1AWXA 1TU0B 2GAUA 3RBBB 3E0JB 4BL0B 1PWTA 4M77A 3KP6A 5FKMA 3VYTB 1JT0A 1C6VX 4CYCB 1XCVA 1SRMA 3HIFA 3CMAI 5I2MA 5K5OA 2PN6A 1FJLA 4HX7A 5L3CA 2HQRA 2ISZA 1WZOA 4KULA 4YTLA 3CCSI 4L5EA 4S04A 1LDDA 2P7CB 1BR1A 1SSFA 2VC8A 2V1XA 3S1NJ 2OZ6A 2E60A 1TNSA 1T98A 4IQ4A 4EJWA 5LJ5e 1IO2A 4MNUA 4N0AA 5CQXA 1M2VB 2OAZA 3F6VA 1DP7P 1ZHFA 2Z1DA 4LGWA 3ONQA 3VS0A 2W84A 1PKTA 2XIGA 4L5GA 2DT5A 2LY1A 4RGUA 3CD6A 5M3FJ 2NNNA 4EGZA 2VOOA 2OX7A 3LGFA 1ZUKA 3SD4A 4MQ9F 5CVJA 3TCJA 4C2MJ 5F0FA 3HOXJ 1JXMA 4M7AF 1MV0B 3S1QJ 2KK4A 4HCBA 3DBHB 1W4MA 3SQNA 2PI0A 4A53A 2HDAA 3PO3J 5HOOA 1O7FA 3SZGA 4M77D 2AQEA 1TUDA 2EW3A 5E3NA 2K85A 2UUZA 1QWEA 5GMKj 1BKBA 5FLVA 2VKDA 4XONA 2FBIA 4GO1A 4XRSG 2X9HA 4M7DC 2LD5A 3PO2J 1CSKA 3FX3A 4N9HA 3S32A 5FD6A 2L3PA 3CCLQ 3MZYA 3R60A 2WA0A 2XMFA 3K4KA 1WHGA 1X1CA 2DIQA 1R71A 1FEXA 3ABKH 4PCQA 3BW1A 2COYA 2GWRA 2WBMA 1BIAA 1K1ZA 5DY9A 5EZGA 1I1SA 4BD3A 2JWTA 1QVFA 1IZ6A 2A69F 1TQIA 4AUXA 3HOVJ 2AT1B 2DILA 1AWCA 3VYRB 4HOBA 1K9MR 4I0AA 2E65A 2DA3A 2H1LA 2V4JC 4M73A 3VS3A 3OOUA 2F2EA 3UT1A 3LSHA 1GVJA 5E1ZB 4DIQA 1VNDA 2CREA 1VTNC 5GAN4 2DEUA 2CV1A 3V4GA 4RG8A 1IV8A 2EFQA 3A02A 2DDAA 3CMMA 1I4K1 1WJ5A 2HSPA 3H92A 4ENKA 4L5JA 4M3GA 4C2TA 2VYTA 4R8HA 2YDLA 2XPVA 3B6AA 4LDYA 3VKIA 2BW3B 2MC4A 3DLMA 2OJED 3WHBA 3W2AA 4BB7A 2KHMA 4W1UA 4JQFA 1B34B 2EJFA 2WADA 4XKVA 2RHYA 2X4XA 4C0GA 2JUGA 4OIPF 2BEOA 4ENNA 5DCMA 1RI7A 2OTLQ 1WHMA 2FZKB 3E6DA 4GRIA 2F69A 1VQ4A 1MNEA 2M51A 3WHCA 1FXXA 2DXCA 1BIBA 3I59A 1C0MA 1GXPA 1RAFB 5C4JJ 4EM2A 2MIOA 1KQ0A 2O03A 4DOVA 3E6BA 3VRZA 4MEXF 2Q1ZB 2LKSA 3E7LA 2XIDA 4AFQC 3CMEI 4LDWA 5JLWA 4BJ6C 1XTDA 3M0UA 1T08B 2ED1A 4EJOA 2R7WA 2EYWA 2HL3A 1TQMA 2M2EA 2DJIA 5GTIC 3ASKA 3GEZA 4OMYA 1RC9A 5HK0A 2VVKA 3O8VA 2L7MP 4KJZA 5GAMg 2RQRA 1KQ8A 3KIOA 3VYSB 2AKLA 2W25A 3PL8A 2L89A 1P4WA 4LUDA 1DGRM 2R0QC 1VIFA 1GHCA 1IXSB 1YIOA 4MTEA 2KISA 5JI6A 1KSWA 2W57A 1Z67A 4S05A 2HR3A 2E4HA 2KRFA 1VQPI 1D3YA 3CO7C 1JKRC 1VYTA 2COBA 2LOOA 3F8FA 3CD6Q 3KBGA 2YS9A 3MKLA 4U88A 4ZYDA 3OYIA 4M75D 1YITT 4M78D 2R5ZB 5DM7F 2D5VA 2P5LC 2V8JA 2CJJA 2JS2A 5LHGA 3OV8A 2BXZA 2DI3A 1I07A 4A0ZA 2PNIA 2KQWA 3G71A 4HLXA 1YJWQ 1KONA 3RTRA 2LY9A 4PZJA 4XSXF 3S3NA 3K0LA 5LEKA 1PUFA 1VQ6I 3A2KA 4ESJA 1KK7A 5LD2C 3BDUA 3HXLA 1WHLA 3K69A 2MPXC 2ELJA 2W7NA 3CCMI 4EDUA 4LIVA 2K79A 2MG4A 4P1WA 3X28B 1JBMA 3JCMX 3CCVI 2JJ9A 2XV4S 3I56I 2DPDA 3OYYA 2A08A 2M1HA 1JTYA 1OYXA 4L9TA 4M7DA 3HPGA 4OIOF 4NB5A 2K5FA 1VQMT 2HQHA 2R7RA 5CVRA 1V5FA 2XF6A 2RI3A 4ZTFA 5IOYA 4OAZA 1O3SA 4LD6A 4DGWB 4G7ZF 2H8WA 2LC2A 2M16A 3NWSA 4F52A 4UUSA 2ZCFB 5JFRA 5DV5A 3TBIA 4ZJZA 1XPXA 1AHJB 2KY9A 2QG9B 3LGLA 4M77B 5GAMj 3JW4A 2R7FA 1VQ5I 1D3BB 1Y71A 6AT1B 3CJTB 2FPEA 3H36A 1QVGP 4ITVA 2QKMB 3FMSA 3AFHA 3G6EI 3CCLA 2CKKA 3A8LB 4DEYA 1RLPC 1WXBA 1IN6A 4PJJA 4A4EA 1FPQA 3OR2C 4IRIA 1Y1VJ 1LVAA 3ESWB 4MZMA 2DMNA 2DTZA 2G0EA 3KZYA 3IC7A 2IS2A 3ML6A 1ABOA 5HDNA 2O31A 4C8QC 3V42A 3S1MJ 3CDHA 5F1JA 2YLBA 2JA6J 2M8GX 5CKTA 5HS9A 2WSEE 1YITQ 1Z6RA 4F7UF 2HAXA 4M7DD 4A12A 5FWBA 1PNJA 4E6KG 4UB6C 4YG2F 5E18F 4B1RA 3TMOA 1D1BA 2VIXA 2OQGA 4I7HA 3RJPA 2VB6A 3TP3A 4C3IJ 3ZMUA 1ZGWA 1OULA 1QVPA 1ZBJA 3REBB 5GMKe 1YI2T 5HDKA 2RV8A 3CC2T 1K8AR 4RB2C 1EH8A 2DFEA 2FQ3A 2IGKA 2D1XA 2IAIA 5IT3A 1KYWA 3A01B 1Q82C 1BI1A 3RKXA 1VQNT 5F1RA 1T0HA 2ZSIB 1VQMQ 3T9NA 3ZFJA 3CXCS 3BDDA 1FOWA 2FQ4A 4RGRA 3ZOBA 3D5RC 3CBOA 3LH0A 5CAIA 1VQ9T 3M0QA 4LJZF 4KDPA 4C0ZA 5C6SA 3WTZA 1U9NA 3KZZA 2EJRA 3OYKA 1YP5A 2RJFA 2LCSA 3G2BA 4QVCA 1IHWA 5A0LA 2EH3A 1Q81U 3M1EA 4Q5SF 3IV5A 1E3OC 3ZQGA 1J75A 3S1RJ 1IREB 3C95A 2RVCA 2DU9A 4PLIA 2JZ2A 1NG6A 3DV8A 2A5WA 3W2WA 4HX8A 4AIDA 1F43A 3JCMW 3EQLF 1C0WA 3QOPA 5I2SA 4QW2A 3VS4A 1XD7A 4PJMA 4B4CA 3GTJJ 5GJVB 2KZVA 1ETVA 2XGCA 1W2BS 2XSJC 4M75G 1R1VA 2K27A 1NLPC 1QW1A 1ETWA 4EMSA 3H8ZA 4M78G 1D1CA 2RHZA 1U5TA 2M4KA 2WAEA 4EJTA 3I71A 1IN5A 2E1MB 2OA4A 3QU3A 3OR1C 3IWZA 4GYIA 4CCMA 4HCZA 2GA1A 4OB3B 4Y91A 2OTLI 4J9IA 3LSTA 2PX9A 5DEQA 1JJ2P 2HBPA 3CCEA 4AIJA 1QHHD 2H6CA 4F91B 5KE3A 1YI2Q 4RCCA 4LLGF 2QA4A 5AONA 2HDDA 5IT9K 3H3ZA 1ZA1B 3I4NJ 3P8DA 3CZ6A 5TJJA 5M5XJ 3OYGA 2F5DA 3OYMA 3PUFA 5KCMA 5M5WJ 2R7ZJ 1PKSA 4L18B 2XDBA 2W82A 2DJNA 3SWNC 2LF7A 3TQNA 3A03A 4LIUA 4EV0A 3U2RA 1VQNQ 4PJOE 1CQTA 3M4OJ 1X01A 2FZCB 3MKZA 5GAOm 3REOA 1VQ9Q 4M7AB 4ZDOA 4XLNF 1M2OA 1WCMJ 1G83A 4MFDA 2P7VB 1VQKT 2NXNB 2GLOA 3IQLA 2JUCA 1VQOT 1I39A 3QSUA 3LSJA 3WE2A 2IW5A 3BWGA 2F6CA 5LRSA 5GAGJ 3JRIA 4O3MA 2AHQA 1SD5A 2QYZA 3HRTA 1R5HA 2ZC2A 1I5LA 3S3OA 2OTJI 2X6YA 2YPRA 1F4KA 2DW4A 3CD6I 3GLLA 3H0IA 2YR2A 1Z91A 1I5ZA 4RG2A 2MWOA 3CPWP 3LSMA 2AK5A 1K73R 4PUSA 2XPWA 4QTRA 1DDNA 5FB2A 1YJWI 5FO5A 2NS0A 4UY8I 2PJRA 2EJGA 4IRHA 2DMPA 3FKIJ 3LAJA 1BR4A 1BCOA 2YUPA 5FU7B 2P6SA 2DERA 2FHDA 4M7DG 3PVLA 2E6ZA 2I8DA 4Y7NJ 5A2QZ 2JTEA 2HXIA 3E3VA 1LPLA 1OFCX 1ZLMA 3D0SA 5KHDA 1VUBA 2DD5A 3HRUA 4BQOA 1HXDA 4CCOA 2DL8A 1RL2A 4WX9A 5D5WB 3B6CA 2JVHA 2D1VA 1APLC 3TGNA 3PIOF 2EBIA 2YUSA 3J7AW 3QRFF 3DB4A 4NS5A 1KQSP 2DFUA 2ESNA 1MMAA 4CYCA 3OYLA 1G3WA 4FL6A 2K4JA 5CQEA 1WRJA 5DUKA 1DJ7B 2EYYA 2MSYA 5DLOA 5DYMA 3LSGA 1UHCA 3QQAA 5LBQA 2BXYA 3EG9B 5GAMe 3KETA 1OU9A 3DEUA 1R49A 3A4CA 4BAYA 5JVGF 1VQKQ 2RDPA 3HB9A 3DPUA 1ZR4A 2RJCA 1VQOQ 1PD1A 4OMLA 2IXSA 2DEQA 2RNGA 2XF7A 1T0FA 1WHKA 2K4YA 4HPQA 4XBFA 1UB4A 5L23A 4BY7J 1QZZA 3ZR8X 3CC7A 2RQQA 2FMYA 1VQMA 1M1KR 1DPRA 2W1OA 3CCRA 1ZH5A 2QYOA 3K1PA 3FIWA 3QPSA 3CCUI 1VIEA 2EAYA 2X35A 4OMZA 4FU6A 2QTVA 4XSZF 1QCOA 3TREA 2VODA 3DTEA 2PEXA 1BYMA 4FIBA 2EK5A 2RGVA 4M9ZA 1MMNA 4BXXJ 1Z0XA 3EYIA 2JMWA 2X98A 2XAUA 1K4US 2BE5F 1O4XA 3I64A 3SJMA 4L0ZB 1YWOA 3OA6A 2RM4A 5FLXZ 4KT6A 3C3WA 2CP5A 2VONA 2BE7D 3MKWB 1RADB 4AD9A 5LGNA 4X6AJ 2C06A 2ZMEC 2BZ8A 5EEAA 3JB9D 4OB1B 1DU6A 1HOMA 1TUCA 2DK5A 1LVKA 4PFPA 5GAN7 3DXJF 1M8VA 3EUHC 4FT4A 3J7AO 2HOEA 2ZFUA 3Q9SA 2E71A 3NFCA 1YX3A 2EFWA 2GF7A 2VJJA 1FBSA 2XHKA 3CQTA 1U9OA 1MBGA 4KMFA 1Y56A 1CKBA 2MBFA 1W0TA 2DQLA 1FYKA 1X2NA 1XB4A 1W7PB 1IDZA 2JW4A 4QVZA 1ETOA 1S8NA 2K86A 2VXDA 3CESA 3RKYA 1ZLKA 3F21A 3OBYA 3TVTA 2CG4A 3BLYA 3CC2A 1BOBA 2K6DA 2QEXT 5D5UB 3RZDJ 1S7OA 2DZ9A 1GXQA 1T39A 2PZ1A 2Q0OA 5EYRA 1WA7A 4EJUA 1ZA2B 4J9BA 2FPDA 2ZPHB 3S93A 1WHUA 4A3LJ 1EV7A 3BROA 3MWMA 1O9SA 3QODA 4LNPA 2V9PA 3DLLF 3WU0A 2BY3A 5FROA 1I5OB 2K2MA 3L1AA 2CP0A 2XD0A 2MLGA 3RSNA 1XDUA 4DYCA 4FM4B 2VXZA 1HA8A 5H2FC 2JMAA 2O4XB 3MD2A 1B34A 4ELZC 3M8JA 1BK2A 2MF2A 2E2HJ 2E6NA 2D45A 1RAAB 4M74A 3SZTA 1R4NB 2YRVA 3HRSA 2L3SA 3CEYA 2K3FA 2DQRA 3DKYA 4P9UA 3RI4A 1Q1VA 3TKYA 4RKUE 1YO5C 1D1AA 2A0FB 5JVTA 1K6OA 2E3HA 2OJ2A 1LNXA 3F8CA 4ZC3A 1T0JA 1GFCA 3EG0A 2D6FA 2NWMA 1SFUA 3P7NA 2H27A 3E97A 4AG2C 2BVMA 2IGOA 2KXCA 3KUFA 2DXUA 3EETA 1ON2A 1P7IA 5LGTA 4FYVB 2MCNA 4EM1A 2NVTJ 2HCKA 1KC8U 1UJYA 3N5BB 2CGHA 4RUGA 4WF2A 4F7UB 4HT8A 1ZQ1A 2CV2A 4LD5A 2LLKA 1RKTA 2HDCA 4HCCA 1PC0A 4A63B 3LAPA 2FXAA 1SD6A 4G6DA 2EV5A 5IY5H 2X51A 2BV6A 3W6JB 3P5JA 4C8QG 1T8IA 1R7JA 1YIJT 3QUIA 2QEXQ 1LKXA 3LWFA 4AFUC 2EVRA 5CVUA 2HYGD 1UHSA 4RGSA 1ZG1A 4JOMA 1RETA 2R5ZA 1VQ7A 1VQ8A 3CMAT 3GTQJ 4HBLA 4XLEA 1BI0A 3I54A 1IJWC 2W85A 2NLUA 3FF5A 4LLNA 1QP2A 1REPC 2OQRA 3QPHA 4NOYA 1AHDP 2OI3A 3WVDB 4CRIA 3CCST 1YITA 3F22A 3KZIC 2WB1N 4X0GA 4P96A 3BFMA 1H3ZA 2CQXA 3ERMA 2FMLA 4M6VA 1FSHA 2IS1A 4KICA 3U9GA 2PU9B 4KGVB 4MMLA 2BHZA 4BXUA 3RIRA 4BXFA 2XGDA 4CZCA 4F3QA 4HVWA 3SFIA 1YS6A 3FEOA 1UE9A 2DK8A 5BOXA 2DFIA 3G3ZA 3VEPA 4LN2A 3FXOA 2J7IA 1E3PA 1XX5A 2EZKA 3U1KA 3V8JA 4MIMA 5IP9J 1D0XA 1IDYA 1FOKA 2DA1A 2CSQA 3BTJA 3WODF 2YSQA 4BNCA 2YT6A 2WACA 2Y9YA 3GFJA 3CXCA 2LRDA 3DBLB 2K2VA 4BJTA 4LUEA 3FHZA 1KU3A 4A3IJ 2UXNA 3QPLA 4YIIA 3HSFA 4CGZA 1D3BA 2ECCA 1PCXA 3OYFA 4XLPF 4MLOA 1MDMB 4IIMA 5CR2A 1U1TA 5E17F 2L4AA 4J9HA 1W70A 1ULYA 1QVGA 3M0PA 1K9MC 3ULRB 2GZWA 4PFOA 3BQZA 3G1OA 4I01A 2XASA 1LJOA 5ERIA 4AM3A 1RAEB 2VASA 2Y4XA 2XKOA 2XDVA 2QM3A 3MZ8A 4Z2YA 3L9FA 2EQMA 4CI0C 2XAHA 3GCMA 2O0YA 2ESHA 3JCMg 3OYHA 2K7LA 2DTIA 1W2BA 5GAOr 1ETQA 3DCFA 2F4IA 3ZN1A 4HF2A 5E8IA 2LNVA 4RCBA 3RYRA 3I58A 2GQVA 4J8OA 1EJ9A 3WU2C 2Q2EB 1M1EB 2FA5A 3L2UA 1UJ8A 2ATCB 3KXTA 2EPFA 1RUOA 4G7HF 2HMAA 1UAAA 2YRDA 2Y9ZA 1MD0A 3T0YA 2P4TA 1GUUA 1JGGA 5J1UA 3VPRA 1X75C 2CH0A 2K9GA 2KJBA 2R3SA 2PLYA 1N78A 5FW9A 2FF4A 1R36A 2RB6A 3FXJA 2ZXIA 2A3SA 1U5SA 3UDCA 2DN0A 2JK3A 3B73A 5H20A 2M7AA 2E1HA 1OPCA 4RS8A 1WSUA 2P0WA 2QBYB 2MLKA 2IEKA 4JS5A 1TOVA 1HJDA 2RQVA 3OSVA 4M71A 3A5ZB 1YQAA 2HOTA 3L7WA 5EG0B 3FDYA 1IRXA 2CWEA 4ENJA 1YHQA 2LVSA 1QRYA 1ITYA 4A93J 5EZHA 4A4FA 2K02A 3I55I 2E10A 1V5GA 2DZCA 1VF9A 4NUBA 4HDVA 5JLXA 4D5CA 3DB3A 4PJOF 3F9KA 3H35A 1UTIA 3WXMB 4KUMA 2ZJRF 1TQPA 3GX4X 1SFOJ 4M77C 4XAXB 3CMET 3ZRGA 2LF8A 2COWA 2LRQA 1X1DA 3BCBA 2PUKB 2B7EA 2MH2A 4CCKA 1TC3C 2VQCA 4A54A 1YX5A 2VQLA 1SHFA 1LDJA 4V2GA 5GAHJ 3LOCA 2VKVA 4B09A 2KEAA 2X4WA 2KIMA 2DF6A 3M9QA 1T56A 4PK4A 4CDGA 2LDUA 1XMXA 4XOPA 4QIWN 2P84A 3QWXX 1BJAA 3ZQLA 3CJRB 1OCTC 2O01E 3BG9A 4OMNA 1VQPT 2L9RA 3FK6A 5LJ3d 2L2OA 2WAQN 4FT8A 4F55A 3TO7A 2KAFA 1SVOA 3HKZA 3DU5A 2KVQG 1KD1R 1Q86R 4ZYGA 1OYWA 4IKFA 4WCGA 3G73A 2RQPA 2FBHA 1OZ2A 3QO3A 1UHWA 5FU6B 5HY6A 2JM9A 1I0CA 1LNWA 4GY5A 4HNTA 1PD0A 1AOJA 2LK2A 3M9AA 2M8EA 3ABTA 3G7ZA 3WG9A 5CJ9A 5I21A 1D0ZA 4Y17A 1LPQA 1M90R 4QT7A 3CCJA 1BJZA 3H5NA 3IRQA 4Y13A 3L09A 3MEUA 1SD4A 3T8TA 3L2CA 3J80E 3JAMZ 3CCMT 4DJAA 4F93B 4RB3C 3CCVT 3MEWA 2L01A 2DMOA 2NVUB 1BBZA 1IC8A 2CUDA 2E1NA 5C3EJ 5IT9R 3EUAA 2M34A 2ZZDA 4C5EA 4M75E 3I56T 3BG6A 2QQRA 1F1ZA 1XSDA 2HFHA 3HBLA 4M78E 1A6QA 2PVGB 5FRMA 5CLSA 3EG1A 1ETKA 1XG1A 1XGSA 4HVVA 2Z3YA 1SPKA 3EGDB 3D7SB 4A4KA 2LZ6B 4AIKA 2XF5A 3V8KA 3CMEQ 4M3BA 2PMZN 2HD0A 1NYFA 4JJDA 4AIHA 2FBKA 4HG2A 2KIUA 1VQ5T 2OV7A 1FP2A 2XPUA 4UC4A 4N9IA 1O3QA 2RJDA 4MFEA 4X9CA 2STTA 1NZ9A 3G6ET 2CW8A 4EMKB 2F2VA 3PFSA 5FJ8J 5IAYA 1CGPA 2GIVA 2L9VA 4N4NB 4L59A 3O8HA 1FYLA 2R92J 1VQPQ 3HYIA 1K8AC 5ICCA 4CZZA 4YFNF 1D5YA 2O88A 3LFUA 4LG0B 3CMAA 4NDLA 3M5AA 2DFHA 2ETHA 4IL6C 1ZN2A 2NS7A 2PMHA 4MGRA 1G59A 1DQUA 3CCSA 3SFMA 4DBQA 1AWJA 2K9QA 4Y15A 1ZSZB 3OYNA 2P0KA 1UB9A 3E5XA 4M9XA 3R6OA 1VQ6Q 3FM5A 2F1LA 5LLQA 2P4RA 2W0ZA 3R6NA 1ARKA 1TWCJ 2MC3A 1OQKA 5M3MJ 1WNLA 3CCMQ 1NEBA 1W4SA 5GJWB 3CC4I 1OPLA 3AKZA 3RMQA 5LJ5f 1Z1DA 2HKNA 1RACB 3I56Q 3OIQA 4J00A 3OW2S 2XK0A 2R5MA 1NJIR 1YW9A 3QYHB 5DDGA 1VA7A 4HA8A 1O3TA 4M7DE 1H0MA 2A07F 4DYRA 3G1MA 4QLCU 2RNAA 2X3WD 4BY6C 4JRQA 3Q9VA 3K2AA 3K7AJ 5EEGA 1U78A 1QKXA 4R0KA 5J3BA 4D0PA 2AXTC 1TBXA 5L3BA 3FIFA 1XJWB 5BNGA 3LH5A 4DYQA 2CUFA 3JRZA 1ZHIA 4GLKA 2OF7A 3CCQI 1VQ5Q 2NVYJ 2R7UA 1JKQC 1G3SA 2ACJA 3HTSB 3G6EQ 4F16A 4II2A 1SEMA 2CRGA 2E1CA 3FM3A 1SF9A 3JRCA 3LSRA 1HQCA 4IHWA 1K73C 2XUBA 2ZNZA 4CCNA 4E7IA 3GNGA 2GBQA 2VN2A 4L5IA 1D09B 3GOXA 5J1RA 2KZGA 2WY7Q 5HDGA 5GAN3 1UGPB 2MZ4A 3KE2A 2W00A 3EPZA 3OYJA 2RA2A 3QJYA 4XQ3A 2EQRA 2HYJA 4XLHA 2RN8A 2KRHA 3HL2A 2X4JA 3ER0A 3S15J 4C5IA 3ABUA 4C5HA 1RESA 2F48A 1AKHA 2FRWA 2OTLT 1R58A 1WJAA 3GTOJ 4OMQA 2HVSA 1XCBA 4ZGEB 4Q47A 4A0YA 1OX8A 1XDSA 3J81R 4UVCA 1NHAA 3NTIA 2X9DA 2BUDA 2A05A 3M8FA 2H8RA 1TWAJ 4L9NA 4B6MA 1L0OC 5LJ3g 2D0NA 4Z88A 4ESBA 2HS5A 2M30A 3JB9H 2GXAA 3QZ5B 1JXOA 3M57A 1Y6IA 2GFUA 3MEAA 3JCMe 1WKMA 3LA2A 4D7MA 4G9YA 2IT0A 1IRGA 3Q0UA 5KNLA 2ID6A 2RK2A 2O4XA 1P9QC 4HNUA 5DUIA 2Y30A 1DP3A 2DJZA 1TS9A 4CC3A 2HOSA 1XQHA 3JCUC 3FDRA 1LOJA 1NEGA 2DYIA 5ILUA 1QA6A 1V3FA 2LT1A 2RHUA 1PRLC 3PFIA 2KMTA 5FLXE 2OTJT 1OX9A 1AOYA 4IUQA 3CD6T 3RKWA 2EBPA 3OOPA 4PSWA 3QZ9B 3FXLA 5E3OA 5F27A 1YE9A 5M9OA 3SEMA 2RQTA 2QVOA 5ICEA 1X1BA 2JSCA 4Q48A 2SEMA 1XC5A 2VBZA 3VYHB 1YJWT 5KYUB 9ANTA 2HXOA 1FYMA 1HDPA 1WJCA 5GMKi 1KG1A 2GIZA 4F7UA 2A5YB 3DTIA 1EH6A 1K78B 5LJ3h 3H0DA 1U06A 1MBKA 2FD5A 1Y7XA 4IUTA 4C0DC 3HSEA 5J3LA 1IGNA 3C2BA 1VQPA 5B3SH 1D0YA 2NS8A 3VB2A 4HZFA 4A3EJ 2GQIA 1N8RC 3PSFA 4G8XA 4BUPA 1BW5A 4J9GA 1OMIA 5LJ3j 3JV3A 3M58A 1AD5A 1UHFA 1VQ6T 1OQYA 1QMCA 3URGA 3BJOA 2OAWA 2QGGA 3GZ5A 5FKNA 1TUGB 3ZBDA 4B9WA 4IHSA 4B8XA 3M7GA 2IVWA 2LJ0A 2RKHA 4YIRX 3JCMb 2J5OA 2MAMA 3K4BA 2VKNA 1K9MU 4IPAA 1Z7UA 2CQKA 3QYEA 4H0EA 2QLZA 4I76A 1V55H 3D5LA 3LFKA 2KRCA 1H88C 3BTCA 4HSRA 3CCVA 1MBJA 3QU6A 2M9UA 3MN2A 4Q4ZF 2B86A 3CF2A 2LNHB 4XNFA 3ZQQA 1SMYF 4BI3A 3VS7A 1UDLA 1S1NA 4I09A 4ESFA 1BOAA 4G7OF 3M0TA 3O5ZA 2KE9A 1SVMA 1ORKA 2GM4A 3CCUT 2OTJQ 1OCPA 1TSFA 4PJOB 3HJEA 3GTMJ 5DD8A 4XTUA 2OD5A 1RAHB 3CUQB 3QWYA 5K1YA 3K4CA 3ROUA 4XK8E 2E7XA 4OOIA 2AZSA 1U5TC 1MNMC 3HOYJ 3TSWA 2X85A 3BOQA 1J09A 1VQLI 4C8QE 1VQ5A 5C44J 3I5RA 4C92C 4FETA 3RPUA 3K9TA 2EZLA 4U7DA 5EG2A 4AVZA 2DJQA 3BG7A 1N5ZA 1YTYA 2CYZB 2DK3A 1T38A 1MDMA 2LTOA 4M77G 3H6ZA 1RR7A 2HTJA 3LA3A 3LQRA 3HKSA 5K5QA 2IGNA 1MJAA 1YIJQ 1J9IA 1S5LC 1Y0MA 1R6RA 1XTAA 3AL0C 1VQ4I 5DM7R 1XGOA 3I5UA 2RREA 3UNGC 5GADJ 2J5PA 5A0DA 4A5MA 3PMTA 3CXCP 3DP7A 1ZK8A 4DBFA 2LSOA 2H8HA 4WTOB 4ZYAA 1Q7YC 4B9XA 4QWQA 3QP5A 2K9MA 1SFXA 2GA2A 2WSCE 2FSWA 4C5GA 3JTGA 4J9CA 3O3KA 4CUGA 3L1PA 1MBFA 4J5YA 1POGA 2QENA 2Q2EA 1YJNQ 2YU3A 1BN5A 5L3DA 2JA2A 5D8KB 2VXFA 1BB9A 2LKPA 4QVDA 3DFGA 1RNLA 3RPUD 2HVQA 5KYWB 3FK7A 1ZREA 2KPMA 4FTHA 4FQGA 1BM9A 4OB0B 4YIFA 3CCUQ 3M07A 1W2BP 2ZCWA 2Y0MA 2LQKA 3L2VA 2NUPB 1RI0A 4BQNA 2XB0X 3FBIB 5CIUA 3HGYA 4XRMA 2DRKA 1ZBXA 3GW2A 3PQKA 4A4HA 5GMKl 5BMZA 3N05A 2FRHA 4MO7A 4ETSA 3G71I 1M27C 5EG0A 1P6RA 4FISA 4PJLA 3EDPA 1MH4A 2MA3A 3BJ6A 2K5LA 2K9NA 1JHHA 1TNTA 4BU2A 5ILVA 4L6V5 4HNVA 5F0CA 4E4HA 4XTWA 5EEHA 1V4RA 4JX5A 3BR3A 1EH7A 5CK9A 2DO7A 1HCRA 4TVRA 2L9SA 3ISPA 1QQIA 3VV0A 1KYZA 5B1BH 2VPLA 4OMFB 3PIOA 2C0OA 3A0BC 2WTEA 4ENMA 2VGMA 4M3DA 2HPIA 2YXYA 3FB9A 3QKJA 4ZGDB 2NVQJ 3BZ6A 3A98A 5J39A 5KYYB 2EPDA 2Z5UA 2CW0F 4P55A 2DL3A 2RF0A 5GAN2 2OTLA 2KGTA 1LB2A 4M75F 2QKLB 1N77A 5L3EA 1UGVA 1ON1A 1Y0NA 1T0FC 3F0CA 2K5CA 1Y39A 1SKUB 4ASNA 4M78F 1FP1D 3QDFA 2EFNA 3SYTA 4XICA 3S17J 2M0YA 1KIKA 1O7LA 3C4SA 1UFMA 2JPCA 2DX1A 3OMGA 4RB1A 3HSBA 4UVAA 5FKLA 2CT4A 4A3GJ 2H3JA 2MW8A 2RHIA 3J80R 1GV2A 1OJLA 4WXCA 3WTYC 2XVCA 3H5AA 4PKCC 2DA7A 4MDXA 2LP0A 2L5QA 3SFZA 4E7HA 1UGQB 4IX7A 1I50J 1WPYA 2DNUA 4B44A 4BUGA 2IJLA 1XOVA 2ZKZA 1JHFA 5ILSA 3WTTC 3L2RA 1JB0E 2KRNA 2NUZA 1ZGAA 3K4JA 3HUGB 2O6GE 2RJEA 4J7FA 2OCCH 1ZRCA 2K3XA 1FC3A 4NL2A 4PLLA 1XMKA 2X6WA 1I27A 4R79A 5KVRA 2YSRA 4B3AA 1JJ6C 4Y3OA 1T6SA 5TGTA 4QQDA 1G8XA 5DLQE 1GVDA 5LJ3e 2IS6A 4V2SA 4HF0A 1YCSB 5A2QE 4KUDK 2F5CA 2LY2A 1SHGA 1TTYA 2VQHA 2LBFB 1KHIA 2F5KA 2IIMA 3CPFA 3EGDA 4JZ4A 4Y28E 3OW2A 4UV8A 2ELKA 1OYYA 4A3BJ 4RTZA 2KLOA 3UATA 1B72A 2LCLA 3NQOA 1ZTRA 4NNJA 2IG0A 8AT1B 5F6FA 1NPRA 3JSOA 2WAFA 4IUPA 1VYVA 4BGDA 1HBXG 4KIFA 5K7ZA 1L3LA 3UPUA 4ME7A 2CFXA 5HNFA 4M3FA 4XOTA 5LHIA 2QQ8A 4C92D 4QSHA 2V8IA 4OIQF 2RO0A 3EH2A 2XKPA 3H9QA 1QNTA 2ZSHB 5EJCA 2JRTA 3OB9A 1K0XA 2DMTA 5B5EC 4LG0A 1WJEA 2V1UA 3LLRA 3LNQA 3RQ4A 2QQAA 3QDRB 3DLLA 3LSKA 2LT4A 5BQTA 2NRAC 3A8MB 1N9SA 2ZAEA 1K73U 3PNTA 1P4XA 3QP6A 1QU3A 1YN8A 3PMIA 5GAMf 2DRMA 2OPTA 5F08A 3E2UA 2ZGWA 2PQWA 2RMOA 4E47A 2VLAA 5FFZA 2DVEA 2LX7A 2ZPBB 3BG5A 3JCMV 2WV1A 4GXOA 3TL4X 1WJBA 3BDLA 5E3MA 4KUIA 1WWXA 2M0CA 5E3LA 3LWIA 2DMQA 1MNDA 4XMYA 3BG3A 3CCEI 1RIOH 4BDZA 1E0EA 1RQ6A 2MK5A 3P9KA 3EFSA 2QA4I 4KIGA 2XAJA 5E8GA 2QSHX 2CH4A 1QPMA 1ZKGA 4G6QA 5HS8A 1I6HJ 2GFAA 3OYCA 1B59A 2RHXA 5J26A 3GIBA 1YJ9I 2P5KA 2BE9B 3MAJA 4F92B 4M9SA 2QASA 5GAOn 1A6IA 1S72I 5IH2A 3I4PA 3BR2A 1WX6A 3W6VA 3QBYA 2V26A 4TV7A 5F04A 1ZRDA 4NC7A 4RLFA 2ZXJA 4KGZB 1ZAOA 4GFBA 1YJNI 1LQ1A 3I55T 3IWFA 2DTHA 2Z2SB 5J47A 1MW7A 2B8AA 1NLOC 2V9VA 3G4SQ 1QHGA 1Z05A 3EHQA 1M2VA 1OU8A 5HLHA 2L7FP 4FW2A 5D6FA 5GANh 2J05A 4OMMA 2K57A 1GBRA 3F23A 1E6GA 4LE9A 3J81E 1JO8A 4JBAA 2L2PA 1KD1C 5E79C 1Q86C 4HCKA 4XU1A 4UXNA 2BHYA 3X24B 3WE3A 3PM1A 2KFDA 3ZCOA 5GP9A 3RNJA 4IOCF 3M55A 2P81A 3VS5A 2E64A 1M90C 2X48A 4FYWB 2DTRA 1TG0A 1HKSA 1HSJA 3HGGA 2OU2A 4O6JA 3SEZA 2V9KA 3KP5A 1W36D 1EFNA 1EX4A 1X2QA 2BZXA 3Q5FA 5IT9Z 2KQRA 5B1AH 3J81K 4DA4A 2H09A 1JI8A 3DKXA 4EIKA 4BKXA 2DA5A 2VJ4A 4A6DA 3MZHA 2DBMA 1QVTA 3ECHA 4IIOA 3GVAA 3LYIA 3HOZJ 1GDTA 4HAMA 3JRGA 3RDVA 3ECOA 1Y8RB 5KK1A 1MSFC 2TCTA 2GCXA 4A0XA 3K70D 2K9LA 3J7AY 3TW7A 1UELB 2P8TA 3S3MA 2DBKA 2O9SA 3NTHA 3JB9I 1YI2A 4BS9A 2DODA 4IXAA 3ME9A 1CKAA 4FYYB 1V29B 3EH1A 4OMPA 1ABQA 1W1WE 4ZTJA 3Q0WA 3ZQIA 3QJ6A 3I55Q 2HYFA 2C0TA 3QXEB 2XKOC 1VQNA 2L3RA 3CP2A 3PNYA 4LFUA 3IAS2 2Z33A 2PMUA 2F5VA 1Z7LA 3CC7I 5IHNA 4C92G 1SD7A 2A37A 1VQ9A 3CCRI 1XSXA 4GCVA 2LMJA 1GL5A 2A6EF 3K4LA 3U21A 2EKOA 1FY7A 5KYUA 4UV9A 5HLGA 3LSPA 2BW3A 4Z6YA 3BTIA 3MFKA 5AT1B 5CCAA 2FL7A 1IRFA 2HBWA 3MO8A 2YHTA 3ZMVA 5CKDA 1JEGA 3KPHA 2ZBKA 4OAYA 1K78A 2H6BA 1R9TJ 2JQ7A 1R4MB 1Y96B 1RZ4A 2MGQA 1JE8A 4XN3A 2DPPB 5ICGA 1S6LA 1S9HA 4DW6A 1OV3A 2LJ3A 1H9TA 3BR6A 4X1EA 1KC8R 2LREA 4AYBA 1N27A 2L0AA 1BI3A 5KH6A 2MYSA 1TP4A 2E7WA 4Y52J 3HDDA 1UEBA 2DA6A 3S16J 3GFLA 3RR6A 5KAFC 3I4MJ 4C8QF 3ERED 1QWFA 1W1FA 1YCYA 1NJIC 4PNOA 3PGGA 3FXQA 2JTMA 2DA2A 3EYYA 1DU0A 3JB9F 2R5YB 1Y8QB 2VE8A 1I1JA 2F5TX 3ABLH 2DAOA 3F8NA 2IBDA 5D7UA 4IZZA 1BL0A 3X20B 4MZPA 1BC7C 1PJRA 2V6EA 2QDLA 4CC4B 3VOEA 2FJ1A 4FX0A 3CC4T 3HSRA 4BI4A 1Q7YU 1AWWA 2VJIA 4OU0A 1FTTA 3V7CA 3QOEA 2CGPA 3PTAA 4RBOA 1P4AA 3IUOA 1H8KA 4M6XA 2E12A 3BE3A 4PJOA 1RUNA 2EFPA 1KGSA 3S14J 5L3GA 2EIFA 4XKCA 2GOMA 4Y92A 5CKHA 1RPWA 1IG7A 2ZPFB 2LG4A 1X1AA 2L54A 4ESRA 2YX7A 2E2IJ 3WTSC 1VQKA 1VQOA 2KIFA 2E1MC 1M8MA 1IN7A 2EA4A 1Y0UA 3CCQT 1Z77A 3H5RA 1I81A 4UVBA 4M75B 1I3QJ 4JP0A 2V6CA 1TTHB 1PYVA 4M78B 5GAN8 1QO0D 1YOVB 4JYKA 4EQQA 2AZVA 3C0CA 3I9QA 2IS4A 1NH3A 3S2HJ 4V19K 2AS5F 4J83A 1JUPA 3JB9G 3H3UA 5AIPA 3O8GA 1FLIA 3ASNH 1X27A 4V2FA 5E20A 5ICFA 2CU7A 5CQGA 3OSFA 2HQXA 5D4RA 2HZYA 3AG3H 2GGRA 3VWBA 4M7AC 1PP8F 1QVFS 4ZH4F 2A28A 4ATOA 2IRFG 2QSFX 4BHBA 2VC0A 2MUNA 1Q82U 5LHHA 4DZPA 3GZNB 1ZX6A 4ABZA 4BI8B 4LLLA 4E7KA 2OCEA 4CH7A 4JPBW 3X25B 1H8AC 3VFZA 2FZGB 1EIFA 4JDSA 4G12A 2NYXA 3WTXC 5H6RA 3SDBA 4DQ2A 1ETXA 5D6EA 1P92A 3BZKA 3G4SI 4LMYA 1QLYA 1SG5A 2KNBB 3CC4Q 3DPLC 3HFOA 3KP2A 2HEQA 3EFRA 3EFOB 4UUTA 2CYYA 1M3BA 4N4OB 4NC8A 4HVUA 2A3LA 5GAN5 3WTVC 3HOSA 3M53A 3V8LA 2JUFA 5GAOl 3LMMA 3C18A 1WJSA 2DETA 2BYVE 4IJAA 1V5EA 2NUPA 1ETYA 5BS6A 4M77E 5FFXA 3H0HA 2RK1A 5FU7C 1VQ7I 1JU5C 1VQ8I 3K4NA 2GNCA 2HKQB 4KH1B 3L2WA 1K0SA 4ANJA 1WI7A 3NARA 3IH2A 3R6SA 2DTOA 1X2MA 3RYPA 3T1BA 1WJQA 3JRHA 2JMCA 3RERA 1WHJA 3CCQQ 1X69A 5IXBA 4HEA2 3KYCB 2H1KA 3THKA 5DS9A 2TDXA 1BBYA 3I5SA 1X58A 4HW0A 4CXFA 4M7DB 1FT9A 2K9SA 2KL4A 2DLLA 3E5QA 5LEJA 4HF1A 3A01A 4N4IA 5FWCA 2HZTA 4AWXB 5D8LB 4OVAA 1YNZA 1N6AA 2A61A 4KFCA 1FSEA 3PUBA 4J6XA 4B43A 4S0HB 5KYYA 2YU9J 4RAFA 1MMDA 1NK2P 2K5IA 1IZ1A 2FOKA 3DTKA 1FX7A 4PGHA 2D0QB 2AQFA 2O5RA 1SVLA 4UHTA 3UA7A 4PDKA 4I2OA 1ERDA 3ZN0A 1X6GA 5KCHA 2DXBA 1FWZA 2M87A 1AWOA 3U23A 2D8JA 1H9GA 2YUOA 5AYFA 1UG2A 3JAME 5FGMA 1EF4A 1Z9CA 2UZKA 3CJQB 3BR5A 2BVLA 1A5JA 3J80K 5K5RA 2K40A 3NTKA 4OB2B 3Q3SA 1G5VA 1W5CC 4IF4A 4EM0B 2KMUA 4E70A 3DKWA 4X34A 1PP7U 5HODA 4EPCA 1EA3A 2DCEA 2K3PA 4JX6A 3ULQB 2C6YA 5A2QR 3META 2QEXA 5D5VB 3NWTA 1FIPA 2GOXB 4A3JJ 3HUGA 1SSHA 2DL5A 2YUQA 2JT1A 4JZ3A 3VYGA 2CUJA 3AT1B 1RUWA 2RC4A 5CKEA 4MMKA 3VYUB 1Y07A 4N4GA 1D5VA 2M4GA 3R61A 3OMYA 2XRLA 2LBFA 2K3YA 3OSGA 1J2XA 3TOBA 2ZXWH 4BYYA 1KQ2A 2PMZA 1J59A 2RAEA 1VQLT 1U0JA 2ZNYA 1X2KA 1A04A 4RTUA 2G9WA 4D1QA 3JRFA 5D5XB 4E6RA 3INZA 1CF7B 3BZCA 3AAFA 2AO9A 4M7AA 1YLFA 1MH3A 1USSA 1GLNA 3H9GA 5IOZA 1YW7A 5BPIA 4E7LA 4ZN1A 4CSWA 4NC6A 2FB7A 1QCNA 4E7JA 1STZA 3NEUA 1YJWA 3BTLA 1QZYA 1YHQI 2MD0A 3QPTA 4M4ZA 2X6OA 4J7IA 1VQ4T 3OW2P 1AVZC 4JUVA 3NGPA 4Z8AA 2XG8D 2XSDC 2CZ0B 4GYGA 2LX9A 4CHUA 2YRCA 9ATCB 4XTVA 3X26B 5EGOB 4A4GA 3F70A 2JA5J 3D5SC 3ZQHA 3HOUJ 4CICA 4XN0A 1ZR2A 4UUVA 1I8FA 2RPNA 5FLXR 3GFIA 3MEXA 1OPKA 2FO0A 2E5KA 4HV6A 4RAGA 1KD1U 1W5SA 3U1DA 2CP3A 2L7ZA 1Q86U 4C9YA 3CJNA 3S6WA 1YIJA 5J8CA 1N75A 4EJVA 1AT1B 1WFWA 4M7AD 3EGXB 2V1NA 1QBJA 3M4GA 2RNJA 3H0GJ 2R7VA 1GCQA 3E9GA 4NBQA 4II3A 4KNYA 3GF5A 1YW8A 5CYVA 3SEQA 5ED4A 4AT1B 2DFFA 3WG7H 3QYBA 4KN4X 1Q1HA 1R0CB 5DM6F 5CVVA 1RABB 3I3LA 4BBSJ 1VQLQ 3KFVA 2HU9A 3EG9A 3T5XA 2WV0A 5JR3A 1XMAA 3G71T 1FZPB 3PIPF 2ROTA 2NVXJ 3SB2A 3WGHA 1H92A 2EGEA 5D6YA 3DQVC 4CC2A 2CUEA 1JUSA 5GMKm 1KA8A 3BP8A 3AG4H 3CCJI 1LE8B 3FZVA 4KT0E 2DLPA 3QYFA 2DYRH 1S7EA 4LDVA 2MWPA 1MBEA 2KJCA 2V1DA 3BPXA 2DKGA 4QQGA 2VGNA 1R00A 2X6XA 1HW1A 1VQ4Q 1A31A 1G2HA 3ABMH 1R1UA 4C8QB 4XU3A 3KFWX 4EATA 5ECAA 4RLQA 4XLFA 5CVIA 4ZYEA 2LTPA 4EGYA 4FX4A 2DD4A 3A1PA 3QYGB 3MP6A 1HKQA 1OKRA 2EA2A 1B9NA 2LKXA 3VODA 1TXQA 1LFUP 5GAMd 3A52A 4EEFG 5GAN6 3COAC 3ZEHA 1IO6A 3EAEA 1N8RU 3VRYA 2JPBA 3CTAA 2VUBA 1S3JA 2EWNA 4CO8A 2E5QA 3QIIA 3LA7A 4J19A 2B0LA 3MPUB 1M4ZA 2M9HA 3UWNA 2G7HA 4XK4A 4IQJA 1PSEA 1UGRB 2V1QA 1B1BA 4U0VA 5GTHC 1MHNA 2LVMA 4I6ZA 2ZJ2A 1U2WA 4JX4A 2WY8Q 2DVJA 2UV1A 3JCMf 3VS2A 1O3RA 4A69C 5FRNA 3WVEB 4J9FA 2X0LA 1E6HA 1QQJA 5KYNA 3CO6C 4CYDA 2BOLA 2NUTB 4DBHA 1K83J 4KITB 2COZA 2J06A 3OYEA 4XTZA 2IA1A 1W7PA 1F36A 1FBQA 4RGXA 1VYUA 1RLQC 1XSVA 4LB5A 2QK0A 2P6TA 3OS5A 1HW5A 3G71Q 1NJIU 1AA7A 1I3AA 1YS7A 4ZDPA 2DPUA 2QQ9A 2ELHA 4MEYF 5D4SA 1UGSB 2P0PA 5IXFA 2STWA 2Y0SN 2OUMA 1X3WB 3JRDA 1K9AA 4WXDA 5TISC 2EIKH 5J4VA 4CCJA 3MCZA 4A3DJ 4J01A 2LJ1A 4A3KJ 4K11A 2FYKA 4X1VA 2HQ5A 3AG2H 2JN6A 2KKOA 3KYDB 4AVPA 4JK1X 2B63J 2GXBA 4NHJA 4Z89A 4BDYA 3REAB 5HLTA 1RI9A 1ZYRF 2SRCA 5GMKh 4A5NA 4C92A 1YBYA 4HT9A 3QG1A 4XKWA 2E34A 3TP0A 3JSCA 4OGCA 3DBRB 4DBRA 3MQ0A 4FE4A 2Y75A
chains in the Genus database with same CATH topology
4KT5C 1Y96A 3Q1JA 1KHCA 1USTA 4A2UA 2XDPA 4ELYC 2JN0A 1UCRA 1TW2A 3OYAA 1ZG3A 1LJ9A 1W7PD 3CMEA 2WC2A 4M7AG 3IRRA 4JS4A 4PL6A 4MZTA 4JLIA 3IHUA 3SWNB 3OY9A 3O2PE 4MDWA 2IVMA 3C12A 2RH2A 4C92E 3KEOA 1FNNA 2D1HA 3CCET 3JCMQ 4MQVA 2QA4T 3A8GB 1N9RA 1IW7F 4GGGA 1SFEA 1M1KC 3HTUA