3GM2A

Crystal structure of the focal adhesion targeting (fat) domain of pyk2
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
127
structure length
127
Chain Sequence
RTDDLVYLNVMELVRAVLELKNELAQLPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of free and ligand-bound focal adhesion targeting domain of Pyk2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Protein tyrosine kinase 2 beta
total genus 51
structure length 127
sequence length 127
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03623 Focal_AT Focal adhesion targeting region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3gm2A00
3C18A 4NQFA 1KTMA 1KNYA 3RQEA 1WWPA 2L6HA 4R32A 4EBKA 5F28E 4XEFA 3O10A 4EBJA 3RQFA 2JPUA 1OW8A 1PV3A 2LK4A 3RQGA 1K04A 3C8GB 3S9OA 3MFNA 1JOGA 3BRJA 3C8GA 2L6GA 2JX0A 2L6FA 2KK1A 3U3FA 1WOLA 1UFBA 1K40A 4XEVA 3JYYA 3K7DA 3U0CA 3C8GD 3GM3A 2PBEA 3GM2A 3L8IA 3JZ0A 3AJMA 2Q00A 1K05A 3B71A 4XEKA 1QVXA 1V4AA 3TULA 2HSBA 1OW6A 3L8JA 1WTYA 2YWAA 1O3UA 3GM1A 1ZZPA 1OW7A
chains in the Genus database with same CATH superfamily
2PP4A 2H8AA 3UNGC 1YZCA 2A68F 4BJTA 2KSFA 3HLZA 4R32A 4U5FE 3V5YA 2PX3A 5L0DA 5L3VA 4CIHA 2XLDA 4FWVA 2Y69C 5EHHA 1OW8A 1LS1A 3VRCA 2ZD9A 3ZG1A 2HZ8A 5FCLA 1U6HA 1Z23A 3O55A 3TK0A 1Q0KA 2JX0A 4GQHA 4E17A 3K1HA 4G7HF 3RF3A 3ZTZA 1K40A 2W45A 3R7CA 2UUHA 5AC5A 1YYXA 2J0WA 1FMWA 1M56C 1NSGB 1CPQA 3GM3A 4K0DA 2HS5A 2V26A 3NRHA 3EJNA 1RKEA 1YJGA 3KMIA 2KC3A 4PR9A 1A7DA 1EKYA 3VF0A 4J30B 1MMAA 1APCA 2FAPB 1T6IA 3HTKC 2GDCA 4O6YA 5DQTA 3RQEA 3L34A 2KNHA 4X0RA 5A6BA 1VMAA 3LLIA 3FOOA 1OCRC 2MYSA 4EBJA 3LNRA 5DS6A 2A6HF 2GFHA 2J9WA 1ZHWA 1YYJA 3JRTA 3TJ6A 1RXQA 3HNIA 2J8WA 1OR2A 2X0CA 5L0FA 4KBLA 1FFTC 3EG9A 1S7ZA 1A7EA 2XSEA 3E70C 5JT4A 2ZXRA 3KYJA 2EPKX 2J9VA 1EQ1A 3KYIA 3U5SA 2EINC 4NY3A 3QW1A 3WODF 2I8BA 4N4WA 3Q6NA 4IARA 3EH2A 2H7VC 1JMWA 4E0HA 3DMDA 4C7OB 1E86A 1F1MA 2YWAA 1O3UA 4CS7A 1LVKA 3IQCA 3AG2C 5KYUB 3QTHA 4ULWA 1L3PA 4A2NB 4O6NA 4YT5A 5KYWA 1NFOA 1I4YA 2Q9BA 2EILC 3NYJA 5A69A 1BDJB 4ONSA 4C3DA 1OKKD 1G8XA 1VYIA 3UMIA 2O9XA 3K6BA 3U9JA 1ZU4A 1RKEB 2R9RB 3C8GA 4M63A 1C17M 3KL4A 3RKOF 1LM3B 2EIMC 3TQOA 2UUIA 2XS8A 3U3FA 3WAQA 4JRZA 3C62A 4DOZA 3ECSA 1RMVA 4WGYA 3RIPA 1KU2A 3DJUB 3C8GD 5L0CA 3L8IA 4IJJA 4CX9A 1LPEA 5B1BC 3V5XA 3S28A 3BEHA 4JEBA 1ZHYA 2HSBA 2XLMA 1V74B 2YKZA 1OKKA 3NKDA 4JVSA 4OINF 2CGEA 3JTLO 1GGQA 4UDVA 1UFBA 2C04A 4DXWA 2MHRA 3SYNA 1OCZC 4K1OA 3O39A 2A69F 1AEPA 4RD9A 4BPMA 2KGOA 4EBBA 4EWCA 2R7VA 2HKVA 1J8MF 3F46A 3M4BA 2HJ3A 3NKEA 2IBFA 2HSQA 2JPUA 2VCAA 2YL3A 1GM5A 2LFDA 5DS4A 4BJ6A 3NYMA 3PHF2 2HFIA 1YAUO 1YA9A 2YRFA 4CJGA 3U2LA 3PCVA 4BJ5A 2PNOA 1E84A 2J9BA 2R7XA 1J8YF 4XEVA 1RCPA 5CI8A 3N2ZB 4CDAA 2B0JA 3U3BA 3OWTA 2C03A 3RVYA 2OG2A 3CSKA 3FAPB 2NSFA 3X2QC 1I5NA 1HMDA 5L3QA 1BBHA 2XLWA 3TULA 3GODA 2Q4FA 2W4MA 4KNWA 4PJLA 5K0IA 3QVYA 3UMHA 2OQMA 4K7BA 4YJWA 4EHPA 3HNLA 3FMSA 1LE4A 2PX0A 3EHMA 3JRMO 4OIRF 3ZIBA 1T6UA 2XLHA 3B0PA 1U89A 1EA8A 1MMDA 4LACB 1YLMA 4I44A 1RKCA 2KW3C 4JTAB 4MW8A 4BEMJ 2CDQA 3A11A 3ITFA 4MVMA 3ZDLA 4JKVA 2LCHA 2ICWG 2YLIA 3MFNA 4I1OB 2IM8A 2L6FA 2VH3A 2R05A 2FFHA 1YA7O 5TJ5E 4E7ZA 2J46A 1N1CA 1ZU5A 3EGXA 3EQLF 3K1IA 1E85A 4JC7A 4XLPF 3IPMO 4BJ6C 4XPYA 1LI7A 3T6BA 2EPOA 5COGA 3TJ5A 1TR2A 2EPLX 3JYHA 3JZ0A 4YL3A 3SXYA 4D4XA 4Q4ZF 1CGNA 4B6IA 3JCUQ 1NFNA 3T6JA 3AG4C 2D4UA 4HE8D 3SP1A 4EKWA 4U5GA 3ZQYA 2OOCA 1VK5A 3G50A 3JSEO 3L0IA 2XL4A 3RVZA 1OXBA 2FGYA 2R25A 4NC3A 5A6JA 4QI2A 2J9UA 5E3AA 1WWPA 3I4UA 2VASA 4YL1A 1UG7A 3HNJA 2F22A 3POVA 1LKXA 1OCOC 4FESA 3NMIA 5E33A 4FAPB 3WHNA 3LS1A 1M2OA 5BQGA 4XQ1A 2IXOA 3PDMP 4KC9A 4O7GA 3ZSUA 4Z9HA 4DVYP 1YVIA 1H9GA 1TWHA 4LDQA 2IOQA 1VB5A 2KK1A 1O87A 2XLEA 2YHSA 2TMVP 2Q9CA 1QSPA 3DD7A 5AGFA 5T3TA 2LFFA 4NCQA 4XLNF 3ZTMA 1CPRA 4DVZA 1M2VB 4FX5A 1RJ9A 5F5HA 1FNTc 3LUTB 4WJ0A 1H9TA 4PFPA 2XM4A 1A7VA 3US6A 4ZLDA 3Q6MA 4MTGA 3K1IC 5B3IA 4JE9A 1XWJA 2J7PA 3W4YA 1ZZPA 2EIKC 4AE4B 3MBGA 4NQFA 3IQ5A 3AGUA 3IEEA 5JP7A 4MNDA 2R7RA 2L6HA 3S84A 2RD9A 2XL8A 2EIJC 4W8PA 3KH2A 4PACA 1NZEA 3DAFA 4JCHA 2YLGA 3QZCA 3WG7C 2DI3A 1TWAA 5D92A 1K04A 4EIYA 1DOVA 1T6QA 1JOGA 3UGOA 2WZLA 3W8IA 2J0XA 1MMGA 4MS2A 2XLOA 2WZGA 5E3CA 2R7WA 3EGDA 1D1CA 5FZTA 3B0VC 5JRAA 1BR1A 1NG1A 1ZW3A 2BL2A 1VTMP 2Y3HA 1Q0MA 3EGXB 3RW0A 4G78A 1G5ZA 2L7AA 2P7VA 3I5QA 4CDVA 1WASA 2NPUA 4I3MA 4F4BA 4U5BE 1C03A 1HE9A 1AVOB 1V4AA 3M1CB 2HV6A 1OCCC 2H7OA 256BA 1B68A 5T1DB 4EUKB 1SMYF 3M15A 4Z9JA 2NUTB 4PFOA 1YARO 1RJ9B 2IXMA 4Q7CA 1M6TA 4LLEA 4IGGA 2YL0A 3EFOA 4MTOA 3V7OA 3KPHA 3RFYA 4OIPF 4JCZA 1ST6A 2OJED 2R7UA 2QUPA 2VC9A 4AL1A 4CDYA 2VCBA 2YQYA 5B1AC 3FOPA 4LDRA 4LERA 4N06A 1DOWA 1LIHA 5A6KA 4JZAA 2IYLD 1GQAA 2CYDA 1Q0DA 3K7DA 4MW3A 3W2VA 3U2MA 2HV7A 2M64A 3GEHA 1LI5A 1QVXA 2ZPAA 3ZQVA 4J7YA 3Q7LA 2J7PD 5GPGB 3Q7GA 2Y3DA 4PJJA 1KTMA 3DAGA 3W8HA 2QE9A 4H54A 3G4ZA 1MNDA 3OEOA 2H7BA 3W2WA 1H7IA 5F28E 2MWQA 5KYWB 2Q7RA 2PF4E 4NTAA 3MX3A 4CIPA 4PK4A 1E2XA 5JSLA 1I4ZA 3LS0A 2CNWA 1SYQA 1ZW2A 2E87A 2QTVA 2QNLA 3EH1A 1Z3IX 2KYHA 2HUJA 2OU6A 2NUPA 1G4WR 1WGWA 1Y6DA 2L81A 2OCCC 3PMRA 4CS9A 4OD4A 5L0HA 4BEJA 1PD0A 4ANJA 1BR4A 1U0BB 3B9QA 1AUEA 1VLSA 5JUAA 2NSGA 3B71A 3LNMB 2Y3BA 4U9DA 5COMA 2VB6A 1OW6A 3EZHA 1D0XA 3NYLA 4MQ9F 3K33A 2G3KA 3C18A 4OD5A 2G3VA 4OIQF 2JD3A 3GM1A 4GYTA 1SR2A 1YZAA 2KJGA 3C8ZA 3I5PA 1Z7Qc 4MVRA 1C02A 4JEAA 3UGPA 4MTFA 5CI9A 1YDIA 1QQ3A 1NLXA 1FMVA 2LK4A 3FXHA 3S0XA 4QDLA 3DKAA 3C8GB 2LSEA 3BRJA 4NTFA 2Y3GA 2X51A 3AG1C 3H2VA 2I15A 4XWJA 3RH3A 4CS8A 4WABA 4J7TA 1M2VA 5IY5C 2OKUA 4ER9A 5DS5A 1TKNA 2ETSA 1H6GA 2P61A 2Y39A 1JAFA 4E18A 3G4XA 2OJQA 1HW1A 4BJ5C 1VLTA 1Z5ZA 1ZHXA 1L7CA 4JURI 4U9EA 4YN0B 2Q3TA 4C7OA 1WATA 2XM0A 1MQVA 2ZXPA 4DRIB 2WB7A 3TD7A 4Q5SF 3L8JA 2DYSC 2NUPB 1OW7A 5JVEA 1V55C 1OQCA 1MNEA 1XZQA 2XRHA 4CJOA 4IAOA 4YT2A 1LS4A 3O10A 4J32B 3NG1A 4N6HA 4C3BA 4L6RA 3GANA 2R7QA 3B29A 3KKBA 1HY5A 4N6CA 3S9OA 1NU7D 1VYKA 5T3WA 5EK0A 2L9JA 5DVWA 3ATPA 4JJGA 1WOLA 5BQHA 4PJNA 5KYUA 5F5FA 3C63A 2WVOA 2DB4A 3QMKA 4P9FA 4E0IA 4MVQA 4RDAA 3VYWA 3SZRA 2EPMX 1FTSA 1MMNA 2YEVA 5KYXA 4CS8C 2WVNA 2GWWA 1QPUA 4P9TA 3SNHA 4BG0A 1EI7A 4XEKA 4HFFB 1D1BA 4PJMA 2PFDA 4OIOF 5KYNA 4G7OF 2OEXA 2LP4A 4DJ9A 4Z9IA 2NG1A 3DM9B 2LIGA 3H2UA 3DE9A 1WN0A 3LLKA 1TQGA 4JW1A 3UR3C 3CAXA 1GS9A 5HV9A 1NBBA 1OR3A 3TOLA 2OEVA 3FHDA 4U5HA 3E9VA 1SF8A 4HEAJ 4JTCB 3CZ6A 3JT1A 4CS9C 3EG9B 3LESA 3DWWA 1R5ID 1HE1A 3N0TA 4MVSA 2XL6A 5CIVA 2V3CC 4JIOA 1A0BA 1D1AA 1W2WA 1O5HA 1ZHZA 1JPJA 3A9CA 4O6MA 1FR0A 3AQCA 4P6IC 3X1OA 1Z63A 1T01A 3B0UX 2WZFA 3ZWIA 2PBEA 2R7TA 1LE2A 3EFOB 1JPNA 2WVQA 3LEOA 2P1AA 4U5EE 3SEOA 3T9OA 3DM5A 1TWGA 2HJMA 2Z15A 4U5CE 3V5ZA 2R7SA 3AOUA 4MVOA 3GEIA 3NMKA 3VM6A 1A41A 1XZPA 1KNYA 2YL7A 3M4CA 3DZAA 1Q0GA 2W9YA 5B3SC 2YVKA 4AX2A 1CGOA 3K66A 2QLAA 1D0ZA 4XEFA 3EZIA 4CSAC 1PV3A 2AVKA 3RQGA 3SXMA 2XXAB 3ZVRA 1SZIA 2LQGA 4YWQA 3DI5A 3FAJA 3DXJF 2P0NA 3EPVA 2KQ9A 1QKRA 2R02A 4XTKA 1V54C 4A4AA 1IZMA 3S90A 3QW0A 1Q0FA 2AP3A 3JYYA 3U9MA 4U5DE 3U0CA 4XPWA 3GM2A 3FDQA 3F47A 5KYYA 3NMJA 4DRJB 2A6EF 2YZSA 3S27A 5L0JA 1BR2A 4AL0A 3H65A 4IAQA 4C3EA 4EBKA 3C7JA 5DLJA 5L0GA 4I1MA 2AU5A 4RBNA 3ABMC 2Q9AA 2ZXOA 1D0YA 2AWCA 3LAYA 4IWBA 4ULVA 2VCCA 4KNVA 1NU9C 4IB4A 4WGZA 3U8PA 5E2QA 2XLVA 4CSAA 1G4US 2P6VA 1ZVZA 1ZYRF 1OXKA 2D5RB 3IHUA 3ZC4A 5A6AA 3S29A 1QLEC 2QY9A 3HJCA 3T4RA 3ABKC 4GEHA 3LJBA 2DGJA 4W8KA 1E83A 1ZHTA 3R2PA 3JSZA 1HW2A 3CQZA 3GWNA 1WTYA 4G7ZF 3AQBA 2BE5F 2LD6A 2EPNA 3QVZA 4JTDB 3GWLA 3VAYA 2A1DD 1T5OA 2R03A 2XS1A 1FFHA 2YL1A 4YK5A 3HKKA 5KYYB 1TWCA 2HMZA 3TOMA 5HSWA 1ORJA 2M4EA 2HMQA 3M79A 4CBEA 4HFKB 1JR8A 1S05A 2L6GA 3EHNA 4QI0A 4YT8A 5DQZA 2G62A 3ASNC 2IXNA 4IRUA 2W4BA 2WL8A 4LDKA 3MLGA 3FVYA 4AK9A 4AE4A 2GAQA 2ZXWC 3GEEA 4BJ1A 5JLIA 3T6GB 2A0UA 5KYXB 4H4KC 3GORA 3SXKA 5BUOA 3SXZA 1VOMA 2Q00A 1M57C 2ASRA 1PD1A 2CW0F 1R4TA 1K05A 1FAPB 4JJFA 2XXAA 4DBRA 4D4NA 4DRHB 3DE8A 2GA0A 1ORSC 5COFA 3AGTA 3NDBB 2AWYA 2J45A 3EGDB 1HMOA 1QZXA 4YL0A 5EGYA 1Z6AA 3AG3C 3IQTA 2A0BA 2NUTA 5A6BD 4KI2A 2RSEB 2IXPA 3OA1A 3RQFA 2CNWD 1TFKB 3ASOC 1ORYA 3HNKA 3L1MA 4LLCA 4XPXA 1PCXA 3UMKA 3ABLC 4NTBA 1JRAA 4MVUA 4MVZA 3MYFA 1CGME 1IW7F 4E7SA 1Y4CA 3DJNB 5JS5A 4ZLCA 1T9KA 2DYRC 3RYLA 5L0IA 3LEVA 5AC4A 3O6XA 2B0HA 3AJMA 4YT4A 1BZ4A 2BC5A 3CEXA 4O79A 3U8VA 1TFOB 3IQ6A 5BQIA 4DBQA 3MYIA 3N24A 4G0HA 2CCYA 3J06A 2YLDA 2R7OA 5D91A
chains in the Genus database with same CATH topology
3C18A 4NQFA 1KTMA 1KNYA 3RQEA 1WWPA 2L6HA 4R32A 4EBKA 5F28E 4XEFA 3O10A 4EBJA 3RQFA 2JPUA 1OW8A 1PV3A 2LK4A 3RQGA 1K04A 3C8GB 3S9OA 3MFNA 1JOGA 3BRJA 3C8GA 2L6GA 2JX0A 2L6FA 2KK1A 3U3FA 1WOLA 1UFBA 1K40A 4XEVA 3JYYA 3K7DA 3U0CA 3C8GD 3GM3A 2PBEA 3GM2A 3L8IA 3JZ0A 3AJMA 2Q00A 1K05A 3B71A 4XEKA 1QVXA 1V4AA 3TULA 2HSBA 1OW6A 3L8JA 1WTYA 2YWAA 1O3UA 3GM1A 1ZZPA 1OW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C18 A;  4NQF A;  1KTM A;  1KNY A;  3RQE A;  1WWP A;  2L6H A;  4R32 A;  4EBK A;  5F28 E;  4XEF A;  3O10 A;  4EBJ A;  3RQF A;  2JPU A;  1OW8 A;  1PV3 A;  2LK4 A;  3RQG A;  1K04 A;  3C8G B;  3S9O A;  3MFN A;  1JOG A;  3BRJ A;  3C8G A;  2L6G A;  2JX0 A;  2L6F A;  2KK1 A;  3U3F A;  1WOL A;  1UFB A;  1K40 A;  4XEV A;  3JYY A;  3K7D A;  3U0C A;  3C8G D;  3GM3 A;  2PBE A;  3GM2 A;  3L8I A;  3JZ0 A;  3AJM A;  2Q00 A;  1K05 A;  3B71 A;  4XEK A;  1QVX A;  1V4A A;  3TUL A;  2HSB A;  1OW6 A;  3L8J A;  1WTY A;  2YWA A;  1O3U A;  3GM1 A;  1ZZP A;  1OW7 A; 
#chains in the Genus database with same CATH topology
 2PP4 A;  2H8A A;  3UNG C;  1YZC A;  2A68 F;  4BJT A;  2KSF A;  3HLZ A;  4R32 A;  4U5F E;  3V5Y A;  2PX3 A;  5L0D A;  5L3V A;  4CIH A;  2XLD A;  4FWV A;  2Y69 C;  5EHH A;  1OW8 A;  1LS1 A;  3VRC A;  2ZD9 A;  3ZG1 A;  2HZ8 A;  5FCL A;  1U6H A;  1Z23 A;  3O55 A;  3TK0 A;  1Q0K A;  2JX0 A;  4GQH A;  4E17 A;  3K1H A;  4G7H F;  3RF3 A;  3ZTZ A;  1K40 A;  2W45 A;  3R7C A;  2UUH A;  5AC5 A;  1YYX A;  2J0W A;  1FMW A;  1M56 C;  1NSG B;  1CPQ A;  3GM3 A;  4K0D A;  2HS5 A;  2V26 A;  3NRH A;  3EJN A;  1RKE A;  1YJG A;  3KMI A;  2KC3 A;  4PR9 A;  1A7D A;  1EKY A;  3VF0 A;  4J30 B;  1MMA A;  1APC A;  2FAP B;  1T6I A;  3HTK C;  2GDC A;  4O6Y A;  5DQT A;  3RQE A;  3L34 A;  2KNH A;  4X0R A;  5A6B A;  1VMA A;  3LLI A;  3FOO A;  1OCR C;  2MYS A;  4EBJ A;  3LNR A;  5DS6 A;  2A6H F;  2GFH A;  2J9W A;  1ZHW A;  1YYJ A;  3JRT A;  3TJ6 A;  1RXQ A;  3HNI A;  2J8W A;  1OR2 A;  2X0C A;  5L0F A;  4KBL A;  1FFT C;  3EG9 A;  1S7Z A;  1A7E A;  2XSE A;  3E70 C;  5JT4 A;  2ZXR A;  3KYJ A;  2EPK X;  2J9V A;  1EQ1 A;  3KYI A;  3U5S A;  2EIN C;  4NY3 A;  3QW1 A;  3WOD F;  2I8B A;  4N4W A;  3Q6N A;  4IAR A;  3EH2 A;  2H7V C;  1JMW A;  4E0H A;  3DMD A;  4C7O B;  1E86 A;  1F1M A;  2YWA A;  1O3U A;  4CS7 A;  1LVK A;  3IQC A;  3AG2 C;  5KYU B;  3QTH A;  4ULW A;  1L3P A;  4A2N B;  4O6N A;  4YT5 A;  5KYW A;  1NFO A;  1I4Y A;  2Q9B A;  2EIL C;  3NYJ A;  5A69 A;  1BDJ B;  4ONS A;  4C3D A;  1OKK D;  1G8X A;  1VYI A;  3UMI A;  2O9X A;  3K6B A;  3U9J A;  1ZU4 A;  1RKE B;  2R9R B;  3C8G A;  4M63 A;  1C17 M;  3KL4 A;  3RKO F;  1LM3 B;  2EIM C;  3TQO A;  2UUI A;  2XS8 A;  3U3F A;  3WAQ A;  4JRZ A;  3C62 A;  4DOZ A;  3ECS A;  1RMV A;  4WGY A;  3RIP A;  1KU2 A;  3DJU B;  3C8G D;  5L0C A;  3L8I A;  4IJJ A;  4CX9 A;  1LPE A;  5B1B C;  3V5X A;  3S28 A;  3BEH A;  4JEB A;  1ZHY A;  2HSB A;  2XLM A;  1V74 B;  2YKZ A;  1OKK A;  3NKD A;  4JVS A;  4OIN F;  2CGE A;  3JTL O;  1GGQ A;  4UDV A;  1UFB A;  2C04 A;  4DXW A;  2MHR A;  3SYN A;  1OCZ C;  4K1O A;  3O39 A;  2A69 F;  1AEP A;  4RD9 A;  4BPM A;  2KGO A;  4EBB A;  4EWC A;  2R7V A;  2HKV A;  1J8M F;  3F46 A;  3M4B A;  2HJ3 A;  3NKE A;  2IBF A;  2HSQ A;  2JPU A;  2VCA A;  2YL3 A;  1GM5 A;  2LFD A;  5DS4 A;  4BJ6 A;  3NYM A;  3PHF 2;  2HFI A;  1YAU O;  1YA9 A;  2YRF A;  4CJG A;  3U2L A;  3PCV A;  4BJ5 A;  2PNO A;  1E84 A;  2J9B A;  2R7X A;  1J8Y F;  4XEV A;  1RCP A;  5CI8 A;  3N2Z B;  4CDA A;  2B0J A;  3U3B A;  3OWT A;  2C03 A;  3RVY A;  2OG2 A;  3CSK A;  3FAP B;  2NSF A;  3X2Q C;  1I5N A;  1HMD A;  5L3Q A;  1BBH A;  2XLW A;  3TUL A;  3GOD A;  2Q4F A;  2W4M A;  4KNW A;  4PJL A;  5K0I A;  3QVY A;  3UMH A;  2OQM A;  4K7B A;  4YJW A;  4EHP A;  3HNL A;  3FMS A;  1LE4 A;  2PX0 A;  3EHM A;  3JRM O;  4OIR F;  3ZIB A;  1T6U A;  2XLH A;  3B0P A;  1U89 A;  1EA8 A;  1MMD A;  4LAC B;  1YLM A;  4I44 A;  1RKC A;  2KW3 C;  4JTA B;  4MW8 A;  4BEM J;  2CDQ A;  3A11 A;  3ITF A;  4MVM A;  3ZDL A;  4JKV A;  2LCH A;  2ICW G;  2YLI A;  3MFN A;  4I1O B;  2IM8 A;  2L6F A;  2VH3 A;  2R05 A;  2FFH A;  1YA7 O;  5TJ5 E;  4E7Z A;  2J46 A;  1N1C A;  1ZU5 A;  3EGX A;  3EQL F;  3K1I A;  1E85 A;  4JC7 A;  4XLP F;  3IPM O;  4BJ6 C;  4XPY A;  1LI7 A;  3T6B A;  2EPO A;  5COG A;  3TJ5 A;  1TR2 A;  2EPL X;  3JYH A;  3JZ0 A;  4YL3 A;  3SXY A;  4D4X A;  4Q4Z F;  1CGN A;  4B6I A;  3JCU Q;  1NFN A;  3T6J A;  3AG4 C;  2D4U A;  4HE8 D;  3SP1 A;  4EKW A;  4U5G A;  3ZQY A;  2OOC A;  1VK5 A;  3G50 A;  3JSE O;  3L0I A;  2XL4 A;  3RVZ A;  1OXB A;  2FGY A;  2R25 A;  4NC3 A;  5A6J A;  4QI2 A;  2J9U A;  5E3A A;  1WWP A;  3I4U A;  2VAS A;  4YL1 A;  1UG7 A;  3HNJ A;  2F22 A;  3POV A;  1LKX A;  1OCO C;  4FES A;  3NMI A;  5E33 A;  4FAP B;  3WHN A;  3LS1 A;  1M2O A;  5BQG A;  4XQ1 A;  2IXO A;  3PDM P;  4KC9 A;  4O7G A;  3ZSU A;  4Z9H A;  4DVY P;  1YVI A;  1H9G A;  1TWH A;  4LDQ A;  2IOQ A;  1VB5 A;  2KK1 A;  1O87 A;  2XLE A;  2YHS A;  2TMV P;  2Q9C A;  1QSP A;  3DD7 A;  5AGF A;  5T3T A;  2LFF A;  4NCQ A;  4XLN F;  3ZTM A;  1CPR A;  4DVZ A;  1M2V B;  4FX5 A;  1RJ9 A;  5F5H A;  1FNT c;  3LUT B;  4WJ0 A;  1H9T A;  4PFP A;  2XM4 A;  1A7V A;  3US6 A;  4ZLD A;  3Q6M A;  4MTG A;  3K1I C;  5B3I A;  4JE9 A;  1XWJ A;  2J7P A;  3W4Y A;  1ZZP A;  2EIK C;  4AE4 B;  3MBG A;  4NQF A;  3IQ5 A;  3AGU A;  3IEE A;  5JP7 A;  4MND A;  2R7R A;  2L6H A;  3S84 A;  2RD9 A;  2XL8 A;  2EIJ C;  4W8P A;  3KH2 A;  4PAC A;  1NZE A;  3DAF A;  4JCH A;  2YLG A;  3QZC A;  3WG7 C;  2DI3 A;  1TWA A;  5D92 A;  1K04 A;  4EIY A;  1DOV A;  1T6Q A;  1JOG A;  3UGO A;  2WZL A;  3W8I A;  2J0X A;  1MMG A;  4MS2 A;  2XLO A;  2WZG A;  5E3C A;  2R7W A;  3EGD A;  1D1C A;  5FZT A;  3B0V C;  5JRA A;  1BR1 A;  1NG1 A;  1ZW3 A;  2BL2 A;  1VTM P;  2Y3H A;  1Q0M A;  3EGX B;  3RW0 A;  4G78 A;  1G5Z A;  2L7A A;  2P7V A;  3I5Q A;  4CDV A;  1WAS A;  2NPU A;  4I3M A;  4F4B A;  4U5B E;  1C03 A;  1HE9 A;  1AVO B;  1V4A A;  3M1C B;  2HV6 A;  1OCC C;  2H7O A;  256B A;  1B68 A;  5T1D B;  4EUK B;  1SMY F;  3M15 A;  4Z9J A;  2NUT B;  4PFO A;  1YAR O;  1RJ9 B;  2IXM A;  4Q7C A;  1M6T A;  4LLE A;  4IGG A;  2YL0 A;  3EFO A;  4MTO A;  3V7O A;  3KPH A;  3RFY A;  4OIP F;  4JCZ A;  1ST6 A;  2OJE D;  2R7U A;  2QUP A;  2VC9 A;  4AL1 A;  4CDY A;  2VCB A;  2YQY A;  5B1A C;  3FOP A;  4LDR A;  4LER A;  4N06 A;  1DOW A;  1LIH A;  5A6K A;  4JZA A;  2IYL D;  1GQA A;  2CYD A;  1Q0D A;  3K7D A;  4MW3 A;  3W2V A;  3U2M A;  2HV7 A;  2M64 A;  3GEH A;  1LI5 A;  1QVX A;  2ZPA A;  3ZQV A;  4J7Y A;  3Q7L A;  2J7P D;  5GPG B;  3Q7G A;  2Y3D A;  4PJJ A;  1KTM A;  3DAG A;  3W8H A;  2QE9 A;  4H54 A;  3G4Z A;  1MND A;  3OEO A;  2H7B A;  3W2W A;  1H7I A;  5F28 E;  2MWQ A;  5KYW B;  2Q7R A;  2PF4 E;  4NTA A;  3MX3 A;  4CIP A;  4PK4 A;  1E2X A;  5JSL A;  1I4Z A;  3LS0 A;  2CNW A;  1SYQ A;  1ZW2 A;  2E87 A;  2QTV A;  2QNL A;  3EH1 A;  1Z3I X;  2KYH A;  2HUJ A;  2OU6 A;  2NUP A;  1G4W R;  1WGW A;  1Y6D A;  2L81 A;  2OCC C;  3PMR A;  4CS9 A;  4OD4 A;  5L0H A;  4BEJ A;  1PD0 A;  4ANJ A;  1BR4 A;  1U0B B;  3B9Q A;  1AUE A;  1VLS A;  5JUA A;  2NSG A;  3B71 A;  3LNM B;  2Y3B A;  4U9D A;  5COM A;  2VB6 A;  1OW6 A;  3EZH A;  1D0X A;  3NYL A;  4MQ9 F;  3K33 A;  2G3K A;  3C18 A;  4OD5 A;  2G3V A;  4OIQ F;  2JD3 A;  3GM1 A;  4GYT A;  1SR2 A;  1YZA A;  2KJG A;  3C8Z A;  3I5P A;  1Z7Q c;  4MVR A;  1C02 A;  4JEA A;  3UGP A;  4MTF A;  5CI9 A;  1YDI A;  1QQ3 A;  1NLX A;  1FMV A;  2LK4 A;  3FXH A;  3S0X A;  4QDL A;  3DKA A;  3C8G B;  2LSE A;  3BRJ A;  4NTF A;  2Y3G A;  2X51 A;  3AG1 C;  3H2V A;  2I15 A;  4XWJ A;  3RH3 A;  4CS8 A;  4WAB A;  4J7T A;  1M2V A;  5IY5 C;  2OKU A;  4ER9 A;  5DS5 A;  1TKN A;  2ETS A;  1H6G A;  2P61 A;  2Y39 A;  1JAF A;  4E18 A;  3G4X A;  2OJQ A;  1HW1 A;  4BJ5 C;  1VLT A;  1Z5Z A;  1ZHX A;  1L7C A;  4JUR I;  4U9E A;  4YN0 B;  2Q3T A;  4C7O A;  1WAT A;  2XM0 A;  1MQV A;  2ZXP A;  4DRI B;  2WB7 A;  3TD7 A;  4Q5S F;  3L8J A;  2DYS C;  2NUP B;  1OW7 A;  5JVE A;  1V55 C;  1OQC A;  1MNE A;  1XZQ A;  2XRH A;  4CJO A;  4IAO A;  4YT2 A;  1LS4 A;  3O10 A;  4J32 B;  3NG1 A;  4N6H A;  4C3B A;  4L6R A;  3GAN A;  2R7Q A;  3B29 A;  3KKB A;  1HY5 A;  4N6C A;  3S9O A;  1NU7 D;  1VYK A;  5T3W A;  5EK0 A;  2L9J A;  5DVW A;  3ATP A;  4JJG A;  1WOL A;  5BQH A;  4PJN A;  5KYU A;  5F5F A;  3C63 A;  2WVO A;  2DB4 A;  3QMK A;  4P9F A;  4E0I A;  4MVQ A;  4RDA A;  3VYW A;  3SZR A;  2EPM X;  1FTS A;  1MMN A;  2YEV A;  5KYX A;  4CS8 C;  2WVN A;  2GWW A;  1QPU A;  4P9T A;  3SNH A;  4BG0 A;  1EI7 A;  4XEK A;  4HFF B;  1D1B A;  4PJM A;  2PFD A;  4OIO F;  5KYN A;  4G7O F;  2OEX A;  2LP4 A;  4DJ9 A;  4Z9I A;  2NG1 A;  3DM9 B;  2LIG A;  3H2U A;  3DE9 A;  1WN0 A;  3LLK A;  1TQG A;  4JW1 A;  3UR3 C;  3CAX A;  1GS9 A;  5HV9 A;  1NBB A;  1OR3 A;  3TOL A;  2OEV A;  3FHD A;  4U5H A;  3E9V A;  1SF8 A;  4HEA J;  4JTC B;  3CZ6 A;  3JT1 A;  4CS9 C;  3EG9 B;  3LES A;  3DWW A;  1R5I D;  1HE1 A;  3N0T A;  4MVS A;  2XL6 A;  5CIV A;  2V3C C;  4JIO A;  1A0B A;  1D1A A;  1W2W A;  1O5H A;  1ZHZ A;  1JPJ A;  3A9C A;  4O6M A;  1FR0 A;  3AQC A;  4P6I C;  3X1O A;  1Z63 A;  1T01 A;  3B0U X;  2WZF A;  3ZWI A;  2PBE A;  2R7T A;  1LE2 A;  3EFO B;  1JPN A;  2WVQ A;  3LEO A;  2P1A A;  4U5E E;  3SEO A;  3T9O A;  3DM5 A;  1TWG A;  2HJM A;  2Z15 A;  4U5C E;  3V5Z A;  2R7S A;  3AOU A;  4MVO A;  3GEI A;  3NMK A;  3VM6 A;  1A41 A;  1XZP A;  1KNY A;  2YL7 A;  3M4C A;  3DZA A;  1Q0G A;  2W9Y A;  5B3S C;  2YVK A;  4AX2 A;  1CGO A;  3K66 A;  2QLA A;  1D0Z A;  4XEF A;  3EZI A;  4CSA C;  1PV3 A;  2AVK A;  3RQG A;  3SXM A;  2XXA B;  3ZVR A;  1SZI A;  2LQG A;  4YWQ A;  3DI5 A;  3FAJ A;  3DXJ F;  2P0N A;  3EPV A;  2KQ9 A;  1QKR A;  2R02 A;  4XTK A;  1V54 C;  4A4A A;  1IZM A;  3S90 A;  3QW0 A;  1Q0F A;  2AP3 A;  3JYY A;  3U9M A;  4U5D E;  3U0C A;  4XPW A;  3GM2 A;  3FDQ A;  3F47 A;  5KYY A;  3NMJ A;  4DRJ B;  2A6E F;  2YZS A;  3S27 A;  5L0J A;  1BR2 A;  4AL0 A;  3H65 A;  4IAQ A;  4C3E A;  4EBK A;  3C7J A;  5DLJ A;  5L0G A;  4I1M A;  2AU5 A;  4RBN A;  3ABM C;  2Q9A A;  2ZXO A;  1D0Y A;  2AWC A;  3LAY A;  4IWB A;  4ULV A;  2VCC A;  4KNV A;  1NU9 C;  4IB4 A;  4WGZ A;  3U8P A;  5E2Q A;  2XLV A;  4CSA A;  1G4U S;  2P6V A;  1ZVZ A;  1ZYR F;  1OXK A;  2D5R B;  3IHU A;  3ZC4 A;  5A6A A;  3S29 A;  1QLE C;  2QY9 A;  3HJC A;  3T4R A;  3ABK C;  4GEH A;  3LJB A;  2DGJ A;  4W8K A;  1E83 A;  1ZHT A;  3R2P A;  3JSZ A;  1HW2 A;  3CQZ A;  3GWN A;  1WTY A;  4G7Z F;  3AQB A;  2BE5 F;  2LD6 A;  2EPN A;  3QVZ A;  4JTD B;  3GWL A;  3VAY A;  2A1D D;  1T5O A;  2R03 A;  2XS1 A;  1FFH A;  2YL1 A;  4YK5 A;  3HKK A;  5KYY B;  1TWC A;  2HMZ A;  3TOM A;  5HSW A;  1ORJ A;  2M4E A;  2HMQ A;  3M79 A;  4CBE A;  4HFK B;  1JR8 A;  1S05 A;  2L6G A;  3EHN A;  4QI0 A;  4YT8 A;  5DQZ A;  2G62 A;  3ASN C;  2IXN A;  4IRU A;  2W4B A;  2WL8 A;  4LDK A;  3MLG A;  3FVY A;  4AK9 A;  4AE4 A;  2GAQ A;  2ZXW C;  3GEE A;  4BJ1 A;  5JLI A;  3T6G B;  2A0U A;  5KYX B;  4H4K C;  3GOR A;  3SXK A;  5BUO A;  3SXZ A;  1VOM A;  2Q00 A;  1M57 C;  2ASR A;  1PD1 A;  2CW0 F;  1R4T A;  1K05 A;  1FAP B;  4JJF A;  2XXA A;  4DBR A;  4D4N A;  4DRH B;  3DE8 A;  2GA0 A;  1ORS C;  5COF A;  3AGT A;  3NDB B;  2AWY A;  2J45 A;  3EGD B;  1HMO A;  1QZX A;  4YL0 A;  5EGY A;  1Z6A A;  3AG3 C;  3IQT A;  2A0B A;  2NUT A;  5A6B D;  4KI2 A;  2RSE B;  2IXP A;  3OA1 A;  3RQF A;  2CNW D;  1TFK B;  3ASO C;  1ORY A;  3HNK A;  3L1M A;  4LLC A;  4XPX A;  1PCX A;  3UMK A;  3ABL C;  4NTB A;  1JRA A;  4MVU A;  4MVZ A;  3MYF A;  1CGM E;  1IW7 F;  4E7S A;  1Y4C A;  3DJN B;  5JS5 A;  4ZLC A;  1T9K A;  2DYR C;  3RYL A;  5L0I A;  3LEV A;  5AC4 A;  3O6X A;  2B0H A;  3AJM A;  4YT4 A;  1BZ4 A;  2BC5 A;  3CEX A;  4O79 A;  3U8V A;  1TFO B;  3IQ6 A;  5BQI A;  4DBQ A;  3MYI A;  3N24 A;  4G0H A;  2CCY A;  3J06 A;  2YLD A;  2R7O A;  5D91 A; 
#chains in the Genus database with same CATH homology
 3C18 A;  4NQF A;  1KTM A;  1KNY A;  3RQE A;  1WWP A;  2L6H A;  4R32 A;  4EBK A;  5F28 E;  4XEF A;  3O10 A;  4EBJ A;  3RQF A;  2JPU A;  1OW8 A;  1PV3 A;  2LK4 A;  3RQG A;  1K04 A;  3C8G B;  3S9O A;  3MFN A;  1JOG A;  3BRJ A;  3C8G A;  2L6G A;  2JX0 A;  2L6F A;  2KK1 A;  3U3F A;  1WOL A;  1UFB A;  1K40 A;  4XEV A;  3JYY A;  3K7D A;  3U0C A;  3C8G D;  3GM3 A;  2PBE A;  3GM2 A;  3L8I A;  3JZ0 A;  3AJM A;  2Q00 A;  1K05 A;  3B71 A;  4XEK A;  1QVX A;  1V4A A;  3TUL A;  2HSB A;  1OW6 A;  3L8J A;  1WTY A;  2YWA A;  1O3U A;  3GM1 A;  1ZZP A;  1OW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...