3GM2A

Crystal structure of the focal adhesion targeting (fat) domain of pyk2
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
127
structure length
127
Chain Sequence
b'RTDDLVYLNVMELVRAVLELKNELAQLPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of free and ligand-bound focal adhesion targeting domain of Pyk2
pubmed doi rcsb
molecule keywords Protein tyrosine kinase 2 beta
source organism Homo sapiens
molecule tags Transferase
total genus 51
structure length 127
sequence length 127
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03623 Focal_AT Focal adhesion targeting region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3gm2A00
4NQFA 3S9OA 1OW7A 2KK1A 3GM1A 3K7DA 4R32A 1OW6A 1PV3A 2PBEA 3C8GA 1JOGA 3AJMA 3U3FA 3B71A 2JX0A 1OW8A 2L6HA 3C18A 3RQEA 3C8GD 3GM3A 1WOLA 4XEKA 1UFBA 3L8IA 1K05A 2Q00A 3U0CA 3BRJA 3JZ0A 3O10A 4XEVA 3L8JA 1V4AA 2L6FA 3TULA 1WWPA 2LK4A 1O3UA 2YWAA 3C8GB 5F28E 3GM2A 3RQGA 1K40A 2JPUA 4XEFA 4EBKA 3RQFA 1QVXA 1KNYA 2HSBA 2L6GA 3JYYA 1ZZPA 3MFNA 4EBJA 1KTMA 1K04A 1WTYA
chains in the Genus database with same CATH superfamily
1H9GA 2R7OA 1O5HA 2VCBA 4E0HA 1YA7O 4PACA 5JT4A 3EG9B 4NC3A 5T3WA 1VLSA 1T01A 4LERA 1BR4A 2PP4A 4AX2A 1Z23A 1OR2A 3LLIA 3QW0A 5COMA 1A41A 1QLEC 3V5ZA 4MQ9F 3O55A 1OCRC 2YLDA 4JCZA 2LIGA 2XLVA 3AOUA 1NZEA 1TFOB 4CX9A 3S0XA 2G3VA 4C3EA 3LLKA 3GANA 4P6IC 4NTBA 3C63A 4CIPA 4FX5A 4BJ6C 4CBEA 2GWWA 1E86A 4PFPA 4OIPF 1QSPA 2LCHA 2Y39A 4YJWA 3ZQYA 2A68F 1V4AA 1GS9A 2CNWD 3M1CB 4JRZA 1SMYF 4N4WA 2RD9A 3DJNB 3DZAA 3DAFA 4C7OA 5L0JA 2P61A 3AGUA 1KNYA 4A4AA 1HMDA 1W2WA 4MTOA 3GM3A 2KSFA 4U5HA 1Y6DA 4NQFA 2UUHA 3FAPB 3HKKA 1XZQA 4H54A 1A7DA 2P1AA 4CS9C 2LSEA 4YT8A 1ORSC 1MNDA 3TK0A 1FR0A 5L0IA 4AL0A 1V74B 2CCYA 3C62A 1APCA 1QQ3A 3DD7A 2LP4A 4YN0B 3IEEA 3FAJA 4IWBA 4O6YA 4RBNA 3U2MA 4EKWA 3HJCA 2ASRA 4MNDA 3SYNA 3WHNA 4ULVA 2AVKA 1YARO 3EQLF 2WZFA 5A6BA 3AG1C 2PF4E 5JUAA 1RCPA 3S27A 1VMAA 4LDRA 4QI2A 1NU7D 1JPNA 4DBRA 2KYHA 3K1IA 4MVUA 3T6GB 1R5ID 4WABA 3JRMO 2J9BA 4EBBA 3KMIA 1RKEA 1M56C 1J8YF 1EI7A 2OCCC 1KU2A 2YZSA 3UNGC 3OWTA 1EKYA 2QNLA 3I5PA 4O7GA 5HSWA 1T5OA 4C7OB 3G4ZA 2MHRA 3RIPA 3POVA 1RKCA 2Y3DA 4GQHA 4JVSA 5COGA 1MQVA 4O6NA 5F5HA 2BE5F 2KQ9A 2CYDA 4LDKA 1ZHZA 1YVIA 1E2XA 3JRTA 3ECSA 3NKDA 2V26A 4FESA 4PJNA 3TJ6A 4ER9A 1AUEA 5JVEA 3K33A 2HFIA 5EK0A 3DE9A 3R2PA 1GQAA 2OEXA 4J30B 5AGFA 5T3TA 1ZU5A 2J9UA 3GWLA 3L34A 1G4US 2J7PA 3BEHA 2A69F 3QVZA 2B0JA 3DM9B 2QTVA 4DOZA 3EHNA 1A0BA 4CDAA 1D1AA 1EQ1A 3FHDA 4OIQF 2PFDA 5AC4A 4XQ1A 1D0ZA 1VB5A 5TJ5E 3H65A 3T6JA 1OW6A 3H2VA 3TOLA 3FMSA 2H7BA 2QUPA 2R7SA 2R25A 2JX0A 4IGGA 3QTHA 1OW8A 3Q6NA 2ZPAA 5GPGB 2AU5A 2CW0F 2NSFA 2AWCA 2VC9A 3UMIA 2XM0A 2R7QA 4EIYA 4K0DA 5FZTA 1OKKD 1ORYA 5KYUB 4MTFA 2O9XA 1DOWA 3AG3C 1T9KA 2EIJC 3F47A 2FGYA 2L6FA 1BBHA 3EZIA 2YVKA 2LK4A 3NKEA 5DS6A 2QE9A 3ZTMA 1FMVA 4FAPB 4OD5A 2UUIA 3PMRA 3C7JA 2I15A 4G7OF 3K1HA 1Z63A 256BA 1AVOB 4CS9A 1ZYRF 3OA1A 2XLHA 4CIHA 4GEHA 2HUJA 2LQGA 2EIKC 2VCCA 4BEJA 2D5RB 4CJOA 3OEOA 1Q0KA 1LPEA 1TWCA 1YYXA 4CSAC 3EGDB 4JTDB 3S29A 4W8PA 3UGPA 4YT4A 2GFHA 3PHF2 1Z6AA 4O6MA 1TR2A 3S28A 1OCZC 2Q3TA 5JRAA 3E70C 4U5GA 2XXAA 3BRJA 3CEXA 4IJJA 4JZAA 3V5YA 4HFKB 4I1OB 4C3BA 4E7ZA 4U9DA 5KYYB 1E83A 3M79A 1LE4A 2H7OA 3C8GB 3QZCA 1AEPA 2V3CC 3RW0A 3ITFA 4DRHB 2AP3A 2XLDA 4JJFA 4U5DE 3LJBA 5L3VA 4U5FE 2NG1A 1TFKB 1ZHTA 4KBLA 4J32B 4ZLDA 4MW3A 4AK9A 1LM3B 2YHSA 1ZVZA 2X51A 4Q5SF 2EPOA 3K7DA 2IBFA 3SEOA 3IQ5A 3U9MA 3VYWA 3NDBB 2L7AA 3I4UA 2R7RA 3ASOC 3GEHA 2FAPB 2HS5A 2XSEA 5F5FA 4U5EE 3C8GD 3B0UX 1BR2A 3KH2A 3ABLC 3U3BA 4PR9A 2J46A 2R7UA 2FFHA 2I8BA 4IAOA 5DVWA 1R4TA 3W2WA 2NPUA 3DI5A 5JS5A 3L8JA 3AQCA 3Q6MA 2R7TA 1MMDA 1VOMA 2XLOA 1WWPA 1OXKA 2W4BA 2WVNA 4N6CA 2L81A 5JSLA 1H6GA 4D4XA 2GA0A 4I3MA 2KC3A 3EFOA 2H7VC 1LI7A 2EILC 2W9YA 3TOMA 1LE2A 5A6BD 3E9VA 2NUTB 4BJ5C 5A6AA 1WTYA 3N0TA 5AC5A 5DQZA 1QKRA 1E85A 2RSEB 3FVYA 1EA8A 3UMKA 2CGEA 4LLEA 1OXBA 3R7CA 5KYXA 2MWQA 1C03A 3EGXB 3ZC4A 1NSGB 4CDVA 2J45A 1H9TA 1HE1A 2QY9A 1IW7F 3QMKA 1D0YA 3X2QC 4YT5A 3ZSUA 4EUKB 3ZWIA 4F4BA 2LFDA 4YL1A 4MVZA 1CPRA 4FWVA 4XPWA 1ZHWA 1VK5A 2C03A 1JR8A 1CGNA 3H2UA 2H8AA 1I5NA 2L9JA 3HNJA 4JTCB 4ULWA 3HLZA 1Q0MA 4OINF 3V7OA 3JYHA 3W8IA 2YLGA 3QVYA 4NCQA 1T6QA 4MVQA 3V5XA 1S05A 4JURI 2YWAA 1F1MA 3NG1A 1RJ9A 1RMVA 1A7EA 1C17M 1YDIA 2OJQA 4YWQA 2XLWA 1PD1A 4U5BE 1NBBA 2J7PD 2OG2A 4IAQA 1DOVA 1M6TA 3ASNC 4K7BA 1Q0FA 1G5ZA 2QLAA 2XL8A 4AL1A 3KKBA 3RH3A 4EHPA 1M2OA 2DYRC 2YLIA 4RDAA 4YT2A 2M64A 2ZXWC 4G7HF 3IQCA 3FOOA 3PCVA 3ZTZA 2ZXOA 3N24A 4OD4A 1CGME 3LAYA 4OIOF 4WGZA 2CNWA 3EG9A 4Z9HA 1WASA 5L0GA 2IYLD 3J06A 3IQ6A 2VH3A 4CS8C 4Q4ZF 3FXHA 1YA9A 1TWHA 2WVQA 1O3UA 3ZQVA 2WZLA 5L0CA 3PDMP 2XL4A 4JKVA 5BUOA 3NMJA 4JE9A 4JJGA 5B1AC 2KGOA 5COFA 4DBQA 3FDQA 3A11A 3ZVRA 4RD9A 4A2NB 3WODF 2EIMC 5B1BC 5A6KA 1SF8A 1L7CA 3DAGA 1U0BB 1LS1A 5EGYA 4MVOA 4DXWA 4M63A 1L3PA 2ZXRA 1SR2A 3RVZA 2WL8A 3DE8A 4BJ6A 4NY3A 3AGTA 4YK5A 5JP7A 5EHHA 2X0CA 1M2VB 1XWJA 1ZHYA 2YKZA 3GORA 2R9RB 4XEVA 2DGJA 3JSEO 1NFOA 1UG7A 3O6XA 5A6JA 4BG0A 1JPJA 4DJ9A 2VB6A 3GWNA 5F28E 3GM2A 3M4CA 4LLCA 1K40A 2JPUA 4B6IA 3VAYA 4PK4A 3UGOA 3SP1A 1QVXA 3AQBA 2EINC 3SXZA 3U8PA 2R7XA 1VLTA 1KTMA 1K04A 4WJ0A 2WZGA 3GODA 4UDVA 5FCLA 1BZ4A 3N2ZB 2A0UA 2CDQA 1OW7A 3LUTB 4XLNF 4MVSA 3JSZA 4XPYA 3U3FA 2OOCA 2LFFA 5B3IA 2HV6A 3UMHA 3B9QA 5BQIA 3C18A 3US6A 2XRHA 5T1DB 2YRFA 1U6HA 4WGYA 4CS7A 2YL1A 2D4UA 1HY5A 1OCCC 4OIRF 4DRJB 5KYXB 3LS0A 4XPXA 1H7IA 3RKOF 4CDYA 4LDQA 3WAQA 2YL0A 5BQHA 2DB4A 1FAPB 2OKUA 4JC7A 5KYWA 2IOQA 4XLPF 2HSBA 1ZHXA 2L6GA 1ZZPA 5E33A 3ABKC 1HMOA 3T4RA 1MMAA 2EPKX 2GAQA 3AJMA 4NTFA 4CJGA 1WN0A 3CSKA 1T6IA 1ORJA 3K1IC 2R03A 2KK1A 3M15A 3U8VA 5DQTA 4ZLCA 1Z3IX 1Z5ZA 1T6UA 2VCAA 1PD0A 4D4NA 4O79A 1OKKA 4KNWA 1D1CA 2IXNA 1IZMA 4JW1A 5L0DA 1VYKA 3JT1A 4XTKA 1HW2A 3JCUQ 1YLMA 1V54C 2LD6A 2Q7RA 2BL2A 1TWAA 1GGQA 1ST6A 1FMWA 4N06A 1RKEB 1V55C 1YZCA 1FNTc 1FFTC 2KNHA 1NG1A 3RQGA 4L6RA 1HW1A 2R02A 2NUPA 2NSGA 1B68A 4AE4A 3NYLA 2YEVA 5KYUA 3L1MA 3Q7LA 2R05A 2F22A 5CI8A 3CAXA 3MYIA 1OCOC 4JTAB 1NLXA 1A7VA 3NYJA 1MMNA 1SZIA 1U89A 3GEIA 3ZG1A 5CIVA 1QZXA 2HSQA 1VYIA 3G4XA 1NFNA 1CGOA 4BEMJ 2EPLX 1LKXA 1OQCA 2IXOA 2ZXPA 4G78A 4JCHA 2HV7A 2IXMA 2WB7A 3DM5A 5E3AA 3SXMA 2L6HA 2P6VA 3TQOA 3O39A 2PX3A 3VF0A 5BQGA 1NU9C 2Q00A 5L3QA 3U0CA 4KI2A 2IM8A 1TWGA 3HTKC 1QPUA 3FOPA 4X0RA 1SYQA 3SZRA 1LI5A 1YZAA 1FFHA 2JD3A 1LVKA 3EGDA 4I1MA 1S7ZA 2WVOA 2HZ8A 3EH2A 1XZPA 1C02A 3NMKA 4I44A 4GYTA 1JAFA 3TD7A 3W8HA 4E17A 3HNIA 2M4EA 3SXKA 1BDJB 2TMVP 5KYYA 1GM5A 4CSAA 3KYIA 4PJLA 3C8GA 3EH1A 3K66A 2J8WA 2Q9AA 5JLIA 5IY5C 1YYJA 3IHUA 2PNOA 3CQZA 3QW1A 3S84A 3ZDLA 4PFOA 4ANJA 2A6EF 3G50A 2G62A 4Z9IA 2ICWG 3JZ0A 4MTGA 4MW8A 2OU6A 2Y3HA 3AG2C 4NTAA 3RYLA 5DLJA 4BJTA 4E18A 2EPMX 3K6BA 4H4KC 3A9CA 3MLGA 3DJUB 3RVYA 1CPQA 1LS4A 1WATA 3LESA 1O87A 5HV9A 3JYYA 1YAUO 3MFNA 2OJED 4K1OA 2HJ3A 5L0HA 4N6HA 2XLMA 5KYNA 3B0VC 2VASA 3B71A 4Z9JA 3W2VA 3ATPA 3KPHA 1Z7Qc 2XXAB 1M57C 5A69A 2XL6A 2Y69C 3GM1A 2BC5A 2XS8A 4KNVA 4LACB 1Y4CA 3LNMB 4BJ1A 1D0XA 4IRUA 2OQMA 5E2QA 4G0HA 2J9VA 5KYWB 4IARA 2NUTA 4P9FA 5D91A 4XEKA 3I5QA 3KL4A 3L8IA 4YL0A 2W45A 2A6HF 2R7VA 3B29A 3MBGA 3DMDA 4E7SA 1G4WR 3EGXA 3IPMO 4W8KA 1ZW2A 1MMGA 2Q9CA 2XM4A 3DXJF 4HEAJ 4IB4A 2YL7A 4P9TA 1Q0DA 2YL3A 5DS4A 1N1CA 1FTSA 2A1DD 2IXPA 2J0WA 2OEVA 2Q9BA 3DWWA 3EJNA 3KYJA 1JRAA 3LEVA 4U5CE 4XEFA 1RXQA 4BJ5A 3HNKA 3S90A 5K0IA 4XWJA 4QI0A 2HMZA 2ZD9A 3ABMC 3U9JA 3LEOA 1ZW3A 2KW3C 2J9WA 2P7VA 3L0IA 3DKAA 5B3SC 2PBEA 3U2LA 5CI9A 4PJMA 3RF3A 2C04A 2B0HA 5DS5A 4MS2A 2J0XA 2NUPB 3TJ5A 2Y3BA 1D1BA 2AWYA 4MVMA 3RQEA 4AE4B 3EFOB 3B0PA 3SNHA 2G3KA 4PJJA 3RFYA 3X1OA 1K05A 2R7WA 4HE8D 4EWCA 1TKNA 4YL3A 3HNLA 2DI3A 2PX0A 2E87A 2HMQA 2HKVA 3T9OA 1BR1A 2GDCA 2A0BA 1I4YA 4J7YA 4E0IA 5E3CA 1ZU4A 2ETSA 4U9EA 3M4BA 3Q7GA 2HJMA 3VM6A 3ZIBA 4DVYP 3MYFA 5D92A 1Q0GA 2Q4FA 4ONSA 3NRHA 3RQFA 3UR3C 4EBKA 2EPNA 2XS1A 1J8MF 2W4MA 3EZHA 3SXYA 1OR3A 1YJGA 3S9OA 1TQGA 3NMIA 3WG7C 4R32A 1JMWA 3EPVA 1PV3A 1JOGA 4J7TA 1WGWA 4JIOA 4QDLA 1RJ9B 3LNRA 3T6BA 3F46A 4Q7CA 1WOLA 3LS1A 3IQTA 4G7ZF 4MVRA 1UFBA 1G8XA 1I4ZA 1LIHA 3CZ6A 4CS8A 1HE9A 3O10A 3VRCA 3MX3A 2DYSC 3EHMA 3GEEA 2KJGA 4JEAA 4DRIB 3TULA 1MNEA 3U5SA 5L0FA 4DVZA 1VTMP 3AG4C 2P0NA 2XLEA 3NYMA 3W4YA 4BPMA 1E84A 2Y3GA 3C8ZA 2YQYA 3JTLO 2Z15A 4C3DA 4JEBA 4EBJA 1M2VA 2MYSA 1PCXA 4HFFB 4KC9A
chains in the Genus database with same CATH topology
4NQFA 3S9OA 1OW7A 2KK1A 3GM1A 3K7DA 4R32A 1OW6A 1PV3A 2PBEA 3C8GA 1JOGA 3AJMA 3U3FA 3B71A 2JX0A 1OW8A 2L6HA 3C18A 3RQEA 3C8GD 3GM3A 1WOLA 4XEKA 1UFBA 3L8IA 1K05A 2Q00A 3U0CA 3BRJA 3JZ0A 3O10A 4XEVA 3L8JA 1V4AA 2L6FA 3TULA 1WWPA 2LK4A 1O3UA 2YWAA 3C8GB 5F28E 3GM2A 3RQGA 1K40A 2JPUA 4XEFA 4EBKA 3RQFA 1QVXA 1KNYA 2HSBA 2L6GA 3JYYA 1ZZPA 3MFNA 4EBJA 1KTMA 1K04A 1WTYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NQF A;  3S9O A;  1OW7 A;  2KK1 A;  3GM1 A;  3K7D A;  4R32 A;  1OW6 A;  1PV3 A;  2PBE A;  3C8G A;  1JOG A;  3AJM A;  3U3F A;  3B71 A;  2JX0 A;  1OW8 A;  2L6H A;  3C18 A;  3RQE A;  3C8G D;  3GM3 A;  1WOL A;  4XEK A;  1UFB A;  3L8I A;  1K05 A;  2Q00 A;  3U0C A;  3BRJ A;  3JZ0 A;  3O10 A;  4XEV A;  3L8J A;  1V4A A;  2L6F A;  3TUL A;  1WWP A;  2LK4 A;  1O3U A;  2YWA A;  3C8G B;  5F28 E;  3GM2 A;  3RQG A;  1K40 A;  2JPU A;  4XEF A;  4EBK A;  3RQF A;  1QVX A;  1KNY A;  2HSB A;  2L6G A;  3JYY A;  1ZZP A;  3MFN A;  4EBJ A;  1KTM A;  1K04 A;  1WTY A; 
#chains in the Genus database with same CATH topology
 1H9G A;  2R7O A;  1O5H A;  2VCB A;  4E0H A;  1YA7 O;  4PAC A;  5JT4 A;  3EG9 B;  4NC3 A;  5T3W A;  1VLS A;  1T01 A;  4LER A;  1BR4 A;  2PP4 A;  4AX2 A;  1Z23 A;  1OR2 A;  3LLI A;  3QW0 A;  5COM A;  1A41 A;  1QLE C;  3V5Z A;  4MQ9 F;  3O55 A;  1OCR C;  2YLD A;  4JCZ A;  2LIG A;  2XLV A;  3AOU A;  1NZE A;  1TFO B;  4CX9 A;  3S0X A;  2G3V A;  4C3E A;  3LLK A;  3GAN A;  4P6I C;  4NTB A;  3C63 A;  4CIP A;  4FX5 A;  4BJ6 C;  4CBE A;  2GWW A;  1E86 A;  4PFP A;  4OIP F;  1QSP A;  2LCH A;  2Y39 A;  4YJW A;  3ZQY A;  2A68 F;  1V4A A;  1GS9 A;  2CNW D;  3M1C B;  4JRZ A;  1SMY F;  4N4W A;  2RD9 A;  3DJN B;  3DZA A;  3DAF A;  4C7O A;  5L0J A;  2P61 A;  3AGU A;  1KNY A;  4A4A A;  1HMD A;  1W2W A;  4MTO A;  3GM3 A;  2KSF A;  4U5H A;  1Y6D A;  4NQF A;  2UUH A;  3FAP B;  3HKK A;  1XZQ A;  4H54 A;  1A7D A;  2P1A A;  4CS9 C;  2LSE A;  4YT8 A;  1ORS C;  1MND A;  3TK0 A;  1FR0 A;  5L0I A;  4AL0 A;  1V74 B;  2CCY A;  3C62 A;  1APC A;  1QQ3 A;  3DD7 A;  2LP4 A;  4YN0 B;  3IEE A;  3FAJ A;  4IWB A;  4O6Y A;  4RBN A;  3U2M A;  4EKW A;  3HJC A;  2ASR A;  4MND A;  3SYN A;  3WHN A;  4ULV A;  2AVK A;  1YAR O;  3EQL F;  2WZF A;  5A6B A;  3AG1 C;  2PF4 E;  5JUA A;  1RCP A;  3S27 A;  1VMA A;  4LDR A;  4QI2 A;  1NU7 D;  1JPN A;  4DBR A;  2KYH A;  3K1I A;  4MVU A;  3T6G B;  1R5I D;  4WAB A;  3JRM O;  2J9B A;  4EBB A;  3KMI A;  1RKE A;  1M56 C;  1J8Y F;  1EI7 A;  2OCC C;  1KU2 A;  2YZS A;  3UNG C;  3OWT A;  1EKY A;  2QNL A;  3I5P A;  4O7G A;  5HSW A;  1T5O A;  4C7O B;  3G4Z A;  2MHR A;  3RIP A;  3POV A;  1RKC A;  2Y3D A;  4GQH A;  4JVS A;  5COG A;  1MQV A;  4O6N A;  5F5H A;  2BE5 F;  2KQ9 A;  2CYD A;  4LDK A;  1ZHZ A;  1YVI A;  1E2X A;  3JRT A;  3ECS A;  3NKD A;  2V26 A;  4FES A;  4PJN A;  3TJ6 A;  4ER9 A;  1AUE A;  5JVE A;  3K33 A;  2HFI A;  5EK0 A;  3DE9 A;  3R2P A;  1GQA A;  2OEX A;  4J30 B;  5AGF A;  5T3T A;  1ZU5 A;  2J9U A;  3GWL A;  3L34 A;  1G4U S;  2J7P A;  3BEH A;  2A69 F;  3QVZ A;  2B0J A;  3DM9 B;  2QTV A;  4DOZ A;  3EHN A;  1A0B A;  4CDA A;  1D1A A;  1EQ1 A;  3FHD A;  4OIQ F;  2PFD A;  5AC4 A;  4XQ1 A;  1D0Z A;  1VB5 A;  5TJ5 E;  3H65 A;  3T6J A;  1OW6 A;  3H2V A;  3TOL A;  3FMS A;  2H7B A;  2QUP A;  2R7S A;  2R25 A;  2JX0 A;  4IGG A;  3QTH A;  1OW8 A;  3Q6N A;  2ZPA A;  5GPG B;  2AU5 A;  2CW0 F;  2NSF A;  2AWC A;  2VC9 A;  3UMI A;  2XM0 A;  2R7Q A;  4EIY A;  4K0D A;  5FZT A;  1OKK D;  1ORY A;  5KYU B;  4MTF A;  2O9X A;  1DOW A;  3AG3 C;  1T9K A;  2EIJ C;  3F47 A;  2FGY A;  2L6F A;  1BBH A;  3EZI A;  2YVK A;  2LK4 A;  3NKE A;  5DS6 A;  2QE9 A;  3ZTM A;  1FMV A;  4FAP B;  4OD5 A;  2UUI A;  3PMR A;  3C7J A;  2I15 A;  4G7O F;  3K1H A;  1Z63 A;  256B A;  1AVO B;  4CS9 A;  1ZYR F;  3OA1 A;  2XLH A;  4CIH A;  4GEH A;  2HUJ A;  2LQG A;  2EIK C;  2VCC A;  4BEJ A;  2D5R B;  4CJO A;  3OEO A;  1Q0K A;  1LPE A;  1TWC A;  1YYX A;  4CSA C;  3EGD B;  4JTD B;  3S29 A;  4W8P A;  3UGP A;  4YT4 A;  2GFH A;  3PHF 2;  1Z6A A;  4O6M A;  1TR2 A;  3S28 A;  1OCZ C;  2Q3T A;  5JRA A;  3E70 C;  4U5G A;  2XXA A;  3BRJ A;  3CEX A;  4IJJ A;  4JZA A;  3V5Y A;  4HFK B;  4I1O B;  4C3B A;  4E7Z A;  4U9D A;  5KYY B;  1E83 A;  3M79 A;  1LE4 A;  2H7O A;  3C8G B;  3QZC A;  1AEP A;  2V3C C;  3RW0 A;  3ITF A;  4DRH B;  2AP3 A;  2XLD A;  4JJF A;  4U5D E;  3LJB A;  5L3V A;  4U5F E;  2NG1 A;  1TFK B;  1ZHT A;  4KBL A;  4J32 B;  4ZLD A;  4MW3 A;  4AK9 A;  1LM3 B;  2YHS A;  1ZVZ A;  2X51 A;  4Q5S F;  2EPO A;  3K7D A;  2IBF A;  3SEO A;  3IQ5 A;  3U9M A;  3VYW A;  3NDB B;  2L7A A;  3I4U A;  2R7R A;  3ASO C;  3GEH A;  2FAP B;  2HS5 A;  2XSE A;  5F5F A;  4U5E E;  3C8G D;  3B0U X;  1BR2 A;  3KH2 A;  3ABL C;  3U3B A;  4PR9 A;  2J46 A;  2R7U A;  2FFH A;  2I8B A;  4IAO A;  5DVW A;  1R4T A;  3W2W A;  2NPU A;  3DI5 A;  5JS5 A;  3L8J A;  3AQC A;  3Q6M A;  2R7T A;  1MMD A;  1VOM A;  2XLO A;  1WWP A;  1OXK A;  2W4B A;  2WVN A;  4N6C A;  2L81 A;  5JSL A;  1H6G A;  4D4X A;  2GA0 A;  4I3M A;  2KC3 A;  3EFO A;  2H7V C;  1LI7 A;  2EIL C;  2W9Y A;  3TOM A;  1LE2 A;  5A6B D;  3E9V A;  2NUT B;  4BJ5 C;  5A6A A;  1WTY A;  3N0T A;  5AC5 A;  5DQZ A;  1QKR A;  1E85 A;  2RSE B;  3FVY A;  1EA8 A;  3UMK A;  2CGE A;  4LLE A;  1OXB A;  3R7C A;  5KYX A;  2MWQ A;  1C03 A;  3EGX B;  3ZC4 A;  1NSG B;  4CDV A;  2J45 A;  1H9T A;  1HE1 A;  2QY9 A;  1IW7 F;  3QMK A;  1D0Y A;  3X2Q C;  4YT5 A;  3ZSU A;  4EUK B;  3ZWI A;  4F4B A;  2LFD A;  4YL1 A;  4MVZ A;  1CPR A;  4FWV A;  4XPW A;  1ZHW A;  1VK5 A;  2C03 A;  1JR8 A;  1CGN A;  3H2U A;  2H8A A;  1I5N A;  2L9J A;  3HNJ A;  4JTC B;  4ULW A;  3HLZ A;  1Q0M A;  4OIN F;  3V7O A;  3JYH A;  3W8I A;  2YLG A;  3QVY A;  4NCQ A;  1T6Q A;  4MVQ A;  3V5X A;  1S05 A;  4JUR I;  2YWA A;  1F1M A;  3NG1 A;  1RJ9 A;  1RMV A;  1A7E A;  1C17 M;  1YDI A;  2OJQ A;  4YWQ A;  2XLW A;  1PD1 A;  4U5B E;  1NBB A;  2J7P D;  2OG2 A;  4IAQ A;  1DOV A;  1M6T A;  3ASN C;  4K7B A;  1Q0F A;  1G5Z A;  2QLA A;  2XL8 A;  4AL1 A;  3KKB A;  3RH3 A;  4EHP A;  1M2O A;  2DYR C;  2YLI A;  4RDA A;  4YT2 A;  2M64 A;  2ZXW C;  4G7H F;  3IQC A;  3FOO A;  3PCV A;  3ZTZ A;  2ZXO A;  3N24 A;  4OD4 A;  1CGM E;  3LAY A;  4OIO F;  4WGZ A;  2CNW A;  3EG9 A;  4Z9H A;  1WAS A;  5L0G A;  2IYL D;  3J06 A;  3IQ6 A;  2VH3 A;  4CS8 C;  4Q4Z F;  3FXH A;  1YA9 A;  1TWH A;  2WVQ A;  1O3U A;  3ZQV A;  2WZL A;  5L0C A;  3PDM P;  2XL4 A;  4JKV A;  5BUO A;  3NMJ A;  4JE9 A;  4JJG A;  5B1A C;  2KGO A;  5COF A;  4DBQ A;  3FDQ A;  3A11 A;  3ZVR A;  4RD9 A;  4A2N B;  3WOD F;  2EIM C;  5B1B C;  5A6K A;  1SF8 A;  1L7C A;  3DAG A;  1U0B B;  1LS1 A;  5EGY A;  4MVO A;  4DXW A;  4M63 A;  1L3P A;  2ZXR A;  1SR2 A;  3RVZ A;  2WL8 A;  3DE8 A;  4BJ6 A;  4NY3 A;  3AGT A;  4YK5 A;  5JP7 A;  5EHH A;  2X0C A;  1M2V B;  1XWJ A;  1ZHY A;  2YKZ A;  3GOR A;  2R9R B;  4XEV A;  2DGJ A;  3JSE O;  1NFO A;  1UG7 A;  3O6X A;  5A6J A;  4BG0 A;  1JPJ A;  4DJ9 A;  2VB6 A;  3GWN A;  5F28 E;  3GM2 A;  3M4C A;  4LLC A;  1K40 A;  2JPU A;  4B6I A;  3VAY A;  4PK4 A;  3UGO A;  3SP1 A;  1QVX A;  3AQB A;  2EIN C;  3SXZ A;  3U8P A;  2R7X A;  1VLT A;  1KTM A;  1K04 A;  4WJ0 A;  2WZG A;  3GOD A;  4UDV A;  5FCL A;  1BZ4 A;  3N2Z B;  2A0U A;  2CDQ A;  1OW7 A;  3LUT B;  4XLN F;  4MVS A;  3JSZ A;  4XPY A;  3U3F A;  2OOC A;  2LFF A;  5B3I A;  2HV6 A;  3UMH A;  3B9Q A;  5BQI A;  3C18 A;  3US6 A;  2XRH A;  5T1D B;  2YRF A;  1U6H A;  4WGY A;  4CS7 A;  2YL1 A;  2D4U A;  1HY5 A;  1OCC C;  4OIR F;  4DRJ B;  5KYX B;  3LS0 A;  4XPX A;  1H7I A;  3RKO F;  4CDY A;  4LDQ A;  3WAQ A;  2YL0 A;  5BQH A;  2DB4 A;  1FAP B;  2OKU A;  4JC7 A;  5KYW A;  2IOQ A;  4XLP F;  2HSB A;  1ZHX A;  2L6G A;  1ZZP A;  5E33 A;  3ABK C;  1HMO A;  3T4R A;  1MMA A;  2EPK X;  2GAQ A;  3AJM A;  4NTF A;  4CJG A;  1WN0 A;  3CSK A;  1T6I A;  1ORJ A;  3K1I C;  2R03 A;  2KK1 A;  3M15 A;  3U8V A;  5DQT A;  4ZLC A;  1Z3I X;  1Z5Z A;  1T6U A;  2VCA A;  1PD0 A;  4D4N A;  4O79 A;  1OKK A;  4KNW A;  1D1C A;  2IXN A;  1IZM A;  4JW1 A;  5L0D A;  1VYK A;  3JT1 A;  4XTK A;  1HW2 A;  3JCU Q;  1YLM A;  1V54 C;  2LD6 A;  2Q7R A;  2BL2 A;  1TWA A;  1GGQ A;  1ST6 A;  1FMW A;  4N06 A;  1RKE B;  1V55 C;  1YZC A;  1FNT c;  1FFT C;  2KNH A;  1NG1 A;  3RQG A;  4L6R A;  1HW1 A;  2R02 A;  2NUP A;  2NSG A;  1B68 A;  4AE4 A;  3NYL A;  2YEV A;  5KYU A;  3L1M A;  3Q7L A;  2R05 A;  2F22 A;  5CI8 A;  3CAX A;  3MYI A;  1OCO C;  4JTA B;  1NLX A;  1A7V A;  3NYJ A;  1MMN A;  1SZI A;  1U89 A;  3GEI A;  3ZG1 A;  5CIV A;  1QZX A;  2HSQ A;  1VYI A;  3G4X A;  1NFN A;  1CGO A;  4BEM J;  2EPL X;  1LKX A;  1OQC A;  2IXO A;  2ZXP A;  4G78 A;  4JCH A;  2HV7 A;  2IXM A;  2WB7 A;  3DM5 A;  5E3A A;  3SXM A;  2L6H A;  2P6V A;  3TQO A;  3O39 A;  2PX3 A;  3VF0 A;  5BQG A;  1NU9 C;  2Q00 A;  5L3Q A;  3U0C A;  4KI2 A;  2IM8 A;  1TWG A;  3HTK C;  1QPU A;  3FOP A;  4X0R A;  1SYQ A;  3SZR A;  1LI5 A;  1YZA A;  1FFH A;  2JD3 A;  1LVK A;  3EGD A;  4I1M A;  1S7Z A;  2WVO A;  2HZ8 A;  3EH2 A;  1XZP A;  1C02 A;  3NMK A;  4I44 A;  4GYT A;  1JAF A;  3TD7 A;  3W8H A;  4E17 A;  3HNI A;  2M4E A;  3SXK A;  1BDJ B;  2TMV P;  5KYY A;  1GM5 A;  4CSA A;  3KYI A;  4PJL A;  3C8G A;  3EH1 A;  3K66 A;  2J8W A;  2Q9A A;  5JLI A;  5IY5 C;  1YYJ A;  3IHU A;  2PNO A;  3CQZ A;  3QW1 A;  3S84 A;  3ZDL A;  4PFO A;  4ANJ A;  2A6E F;  3G50 A;  2G62 A;  4Z9I A;  2ICW G;  3JZ0 A;  4MTG A;  4MW8 A;  2OU6 A;  2Y3H A;  3AG2 C;  4NTA A;  3RYL A;  5DLJ A;  4BJT A;  4E18 A;  2EPM X;  3K6B A;  4H4K C;  3A9C A;  3MLG A;  3DJU B;  3RVY A;  1CPQ A;  1LS4 A;  1WAT A;  3LES A;  1O87 A;  5HV9 A;  3JYY A;  1YAU O;  3MFN A;  2OJE D;  4K1O A;  2HJ3 A;  5L0H A;  4N6H A;  2XLM A;  5KYN A;  3B0V C;  2VAS A;  3B71 A;  4Z9J A;  3W2V A;  3ATP A;  3KPH A;  1Z7Q c;  2XXA B;  1M57 C;  5A69 A;  2XL6 A;  2Y69 C;  3GM1 A;  2BC5 A;  2XS8 A;  4KNV A;  4LAC B;  1Y4C A;  3LNM B;  4BJ1 A;  1D0X A;  4IRU A;  2OQM A;  5E2Q A;  4G0H A;  2J9V A;  5KYW B;  4IAR A;  2NUT A;  4P9F A;  5D91 A;  4XEK A;  3I5Q A;  3KL4 A;  3L8I A;  4YL0 A;  2W45 A;  2A6H F;  2R7V A;  3B29 A;  3MBG A;  3DMD A;  4E7S A;  1G4W R;  3EGX A;  3IPM O;  4W8K A;  1ZW2 A;  1MMG A;  2Q9C A;  2XM4 A;  3DXJ F;  4HEA J;  4IB4 A;  2YL7 A;  4P9T A;  1Q0D A;  2YL3 A;  5DS4 A;  1N1C A;  1FTS A;  2A1D D;  2IXP A;  2J0W A;  2OEV A;  2Q9B A;  3DWW A;  3EJN A;  3KYJ A;  1JRA A;  3LEV A;  4U5C E;  4XEF A;  1RXQ A;  4BJ5 A;  3HNK A;  3S90 A;  5K0I A;  4XWJ A;  4QI0 A;  2HMZ A;  2ZD9 A;  3ABM C;  3U9J A;  3LEO A;  1ZW3 A;  2KW3 C;  2J9W A;  2P7V A;  3L0I A;  3DKA A;  5B3S C;  2PBE A;  3U2L A;  5CI9 A;  4PJM A;  3RF3 A;  2C04 A;  2B0H A;  5DS5 A;  4MS2 A;  2J0X A;  2NUP B;  3TJ5 A;  2Y3B A;  1D1B A;  2AWY A;  4MVM A;  3RQE A;  4AE4 B;  3EFO B;  3B0P A;  3SNH A;  2G3K A;  4PJJ A;  3RFY A;  3X1O A;  1K05 A;  2R7W A;  4HE8 D;  4EWC A;  1TKN A;  4YL3 A;  3HNL A;  2DI3 A;  2PX0 A;  2E87 A;  2HMQ A;  2HKV A;  3T9O A;  1BR1 A;  2GDC A;  2A0B A;  1I4Y A;  4J7Y A;  4E0I A;  5E3C A;  1ZU4 A;  2ETS A;  4U9E A;  3M4B A;  3Q7G A;  2HJM A;  3VM6 A;  3ZIB A;  4DVY P;  3MYF A;  5D92 A;  1Q0G A;  2Q4F A;  4ONS A;  3NRH A;  3RQF A;  3UR3 C;  4EBK A;  2EPN A;  2XS1 A;  1J8M F;  2W4M A;  3EZH A;  3SXY A;  1OR3 A;  1YJG A;  3S9O A;  1TQG A;  3NMI A;  3WG7 C;  4R32 A;  1JMW A;  3EPV A;  1PV3 A;  1JOG A;  4J7T A;  1WGW A;  4JIO A;  4QDL A;  1RJ9 B;  3LNR A;  3T6B A;  3F46 A;  4Q7C A;  1WOL A;  3LS1 A;  3IQT A;  4G7Z F;  4MVR A;  1UFB A;  1G8X A;  1I4Z A;  1LIH A;  3CZ6 A;  4CS8 A;  1HE9 A;  3O10 A;  3VRC A;  3MX3 A;  2DYS C;  3EHM A;  3GEE A;  2KJG A;  4JEA A;  4DRI B;  3TUL A;  1MNE A;  3U5S A;  5L0F A;  4DVZ A;  1VTM P;  3AG4 C;  2P0N A;  2XLE A;  3NYM A;  3W4Y A;  4BPM A;  1E84 A;  2Y3G A;  3C8Z A;  2YQY A;  3JTL O;  2Z15 A;  4C3D A;  4JEB A;  4EBJ A;  1M2V A;  2MYS A;  1PCX A;  4HFF B;  4KC9 A; 
#chains in the Genus database with same CATH homology
 4NQF A;  3S9O A;  1OW7 A;  2KK1 A;  3GM1 A;  3K7D A;  4R32 A;  1OW6 A;  1PV3 A;  2PBE A;  3C8G A;  1JOG A;  3AJM A;  3U3F A;  3B71 A;  2JX0 A;  1OW8 A;  2L6H A;  3C18 A;  3RQE A;  3C8G D;  3GM3 A;  1WOL A;  4XEK A;  1UFB A;  3L8I A;  1K05 A;  2Q00 A;  3U0C A;  3BRJ A;  3JZ0 A;  3O10 A;  4XEV A;  3L8J A;  1V4A A;  2L6F A;  3TUL A;  1WWP A;  2LK4 A;  1O3U A;  2YWA A;  3C8G B;  5F28 E;  3GM2 A;  3RQG A;  1K40 A;  2JPU A;  4XEF A;  4EBK A;  3RQF A;  1QVX A;  1KNY A;  2HSB A;  2L6G A;  3JYY A;  1ZZP A;  3MFN A;  4EBJ A;  1KTM A;  1K04 A;  1WTY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...