3GM2A

Crystal structure of the focal adhesion targeting (fat) domain of pyk2
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
127
structure length
127
Chain Sequence
RTDDLVYLNVMELVRAVLELKNELAQLPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein tyrosine kinase 2 beta
publication title Crystal structures of free and ligand-bound focal adhesion targeting domain of Pyk2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 51
structure length 127
sequence length 127
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03623 Focal_AT Focal adhesion targeting region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3gm2A00
4EBJA 4NQFA 3C8GB 1K40A 1ZZPA 1K04A 1OW7A 1OW6A 3L8JA 1WOLA 1QVXA 2L6FA 3RQGA 2JX0A 3RQEA 2L6HA 4R32A 3L8IA 4EBKA 3B71A 1K05A 2Q00A 2YWAA 3AJMA 3S9OA 3GM2A 3MFNA 4XEFA 1V4AA 2HSBA 2L6GA 3U3FA 1WWPA 3O10A 3C8GA 1UFBA 5F28E 3JYYA 3GM3A 3U0CA 3K7DA 1JOGA 1PV3A 3BRJA 1KNYA 1O3UA 4XEKA 3C18A 1KTMA 3C8GD 2JPUA 4XEVA 1WTYA 2KK1A 3GM1A 2PBEA 3JZ0A 3TULA 3RQFA 1OW8A 2LK4A
chains in the Genus database with same CATH superfamily
3LJBA 3C8GB 3UGPA 1YZAA 4H54A 3VM6A 2Y3BA 4D4XA 5JP7A 4CDAA 1E83A 2L6HA 4RDAA 2J9WA 3B71A 4MVQA 2CYDA 2J7PD 2KQ9A 3EFOB 3W2VA 2LIGA 2A6EF 2HSBA 2YLDA 4JJGA 3U8PA 3UNGC 4AE4A 3RIPA 3UMHA 3L1MA 4JURI 1Z63A 5DS6A 1SMYF 2XLVA 3NMKA 4DOZA 2XXAA 1JOGA 2WB7A 1M56C 2QLAA 1T5OA 3ABMC 3KKBA 4E0HA 5K0IA 1JPNA 2CNWD 3ABKC 1ZVZA 1SZIA 5HV9A 1YA7O 4PJJA 4N6CA 2ICWG 5L3QA 2R7OA 1PD0A 1D1CA 3Q7GA 3G50A 1ZYRF 4H4KC 4DVYP 1HE9A 3B0PA 1HE1A 1Z3IX 2I15A 3NYJA 1V74B 2XLMA 3F46A 3AQCA 3JRMO 1LIHA 2IYLD 3PMRA 3CZ6A 1EA8A 1Z5ZA 4G0HA 4MVUA 4YL1A 4UDVA 2NSFA 3QMKA 4FWVA 2B0JA 1G4US 3K1IA 3RVZA 5F5FA 1A41A 3QVZA 2OJED 3C8GA 4DBRA 3RYLA 4ANJA 1OCCC 1E86A 1O5HA 3K7DA 5FCLA 3HNJA 4RD9A 1FR0A 1T01A 1YDIA 2QE9A 4JCZA 4XEKA 4I1MA 1FFTC 4DRHB 3RF3A 5E3CA 2MWQA 3W4YA 3FAPB 3Q6NA 3RQFA 1W2WA 2XRHA 2QUPA 2IXOA 1Q0DA 3EGDA 5DQTA 4NCQA 1BR1A 3LLKA 4MTGA 4J7TA 1H7IA 4NTAA 2UUIA 1ORJA 5B1BC 4ZLDA 4U5CE 3RH3A 3RQGA 4B6IA 1EI7A 1RKCA 2EIKC 3R2PA 1FMWA 4MVSA 2GA0A 2Q9AA 4J32B 3LLIA 1LE2A 2WVNA 2XLEA 2E87A 2IM8A 4K0DA 3TK0A 4DRIB 1RJ9B 2QNLA 5E2QA 4A2NB 2NUPB 4BJTA 4YWQA 1H9TA 2H7BA 3ZIBA 2R7SA 3LAYA 3NG1A 5EK0A 4PFPA 1MMDA 3EH1A 1TFKB 3PHF2 3DKAA 1LS4A 1PV3A 4ULWA 2YL7A 4QI0A 1V55C 1YARO 4OIQF 2JPUA 5CI9A 5JLIA 1ZHYA 4FAPB 5BUOA 2DYRC 4G7HF 4YK5A 4PACA 3SP1A 1CGNA 5T3TA 3SXKA 1JAFA 3J06A 2KNHA 2LK4A 1TQGA 3SNHA 1VOMA 2AWCA 3SXMA 2J7PA 5L0JA 2MHRA 4CSAC 2L9JA 3TJ5A 1MMNA 4A4AA 3L34A 3LUTB 4U5GA 1CPQA 2M4EA 3A9CA 1NG1A 3S0XA 2A0BA 4WABA 1K05A 1YYXA 4Z9HA 2ZXRA 3DMDA 4E7SA 5L0IA 3U2LA 4XPWA 2CNWA 5AC5A 5E3AA 2EPLX 2O9XA 2YL3A 1QZXA 1ZW2A 2YHSA 5F28E 1NFOA 1AVOB 3U9JA 3S28A 2PP4A 4G7ZF 5L0CA 4C3EA 4PJNA 1D1BA 1QQ3A 1XWJA 2NG1A 3H2VA 3LS1A 3DZAA 4E17A 2Y69C 2A1DD 4N4WA 2AP3A 2Q3TA 3G4XA 3O6XA 3WAQA 3GWNA 5L3VA 1Q0MA 1RJ9A 3B0UX 2HS5A 1LKXA 1G4WR 1ZU5A 1OCRC 1ZU4A 4JRZA 2GAQA 3ITFA 3GEHA 4P9FA 4YT4A 3HKKA 4U5EE 4AE4B 4DJ9A 2NSGA 5BQIA 3B0VC 1GM5A 2G62A 1TWAA 2Y3HA 3UMKA 1NU7D 3CQZA 2WZGA 5CI8A 1FTSA 3RQEA 4CDVA 3AGUA 1Q0KA 2Q00A 3ZG1A 3L0IA 3NMJA 2P7VA 1RMVA 2YKZA 4X0RA 4LERA 2CDQA 2EIJC 3PDMP 1BDJB 4FX5A 1M2OA 5BQHA 3CEXA 3FVYA 1Y4CA 4I44A 3OEOA 4U5DE 1CPRA 4O79A 2VCAA 3NRHA 1MMGA 1LM3B 5COGA 1L7CA 4PJMA 2R9RB 4IWBA 2Q9CA 3EZHA 3GM1A 3LEOA 4J7YA 1L3PA 3TULA 1BR2A 2R02A 2Q4FA 3T6BA 4EBJA 1AUEA 3Q7LA 3QW0A 3DE8A 3HLZA 4LDKA 2AVKA 4CJOA 3U3BA 3DD7A 1EQ1A 2LD6A 2R05A 5DLJA 1Z7Qc 1R4TA 1CGOA 3NKDA 4MTFA 1LE4A 2LQGA 4OIPF 2GDCA 3K6BA 1E84A 2QTVA 2PFDA 3ZTMA 1TWGA 2R7WA 3EGXA 1YJGA 1SYQA 5L0HA 2PF4E 3DI5A 1E2XA 3DJUB 3O10A 3M1CB 4CS9A 5T1DB 3KYIA 2RSEB 1ZHZA 3EGDB 3AOUA 5JVEA 5JUAA 2W45A 4BJ6A 1KTMA 1M2VA 4IB4A 2W4BA 3FHDA 2EPMX 3ZWIA 4NTBA 3HJCA 4Q4ZF 3KL4A 3JZ0A 1ZHTA 2A0UA 4Q7CA 2WL8A 4MVZA 2CW0F 4OIOF 2WZLA 5TJ5E 1ZZPA 4BJ1A 4EHPA 4AL1A 5D92A 2LCHA 3ZSUA 1ZHXA 2NPUA 3EHNA 2D4UA 4JEAA 3E70C 4EBKA 4YT8A 2AU5A 1OCZC 4XLNF 3T9OA 4CS8A 1TR2A 2FAPB 2LFFA 2PNOA 4U5HA 1BBHA 4G7OF 4C7OB 1NZEA 1UFBA 1YYJA 3CAXA 2OKUA 1OKKD 3RVYA 4BEMJ 4MW3A 2GWWA 3LESA 2J9UA 2WVOA 2PX3A 1C02A 1VYIA 5GPGB 1WASA 3R7CA 3US6A 2AWYA 2XLOA 2XL8A 3B29A 3H2UA 5KYNA 1N1CA 4U9EA 4CIHA 4JE9A 2VH3A 1WN0A 2P61A 3S27A 3ZQVA 1G5ZA 1RXQA 5JRAA 3FDQA 5DS5A 5E33A 1MNDA 1YA9A 4OD5A 3U8VA 4BJ5C 1XZPA 2G3KA 1JPJA 4JTCB 3ATPA 2ZD9A 2XLDA 4ULVA 1ORYA 5A6AA 2HMQA 3N24A 4I3MA 3L8JA 1E85A 1B68A 2L6FA 3VF0A 2D5RB 2JX0A 4EIYA 4KI2A 3L8IA 2DI3A 3C8ZA 5A6KA 2HJMA 2ZXWC 4JVSA 4XLPF 4MQ9F 1LVKA 3O39A 2UUHA 4JKVA 1V4AA 1WWPA 2NUTB 4U5FE 3LS0A 4IAOA 2GFHA 4OIRF 2L7AA 2R7VA 1HY5A 2VCCA 1A0BA 1FNTc 1AEPA 1I5NA 4JCHA 1G8XA 4MVMA 5F5HA 3NMIA 4CS7A 2R7TA 3KMIA 2BC5A 3T4RA 3PCVA 4C7OA 3K33A 3ZTZA 4CX9A 2IOQA 2C03A 4WGZA 3BEHA 1U6HA 1Z23A 3EH2A 2Z15A 2L81A 4F4BA 4IJJA 3AQBA 3S84A 1WOLA 1EKYA 1NLXA 3AJMA 1ORSC 4GQHA 3DAGA 4WGYA 5COFA 4Q5SF 3EQLF 4CJGA 4HFFB 1LI5A 4YL0A 2YLIA 4G78A 1BR4A 4JC7A 1KNYA 1TWCA 4PFOA 3H65A 5KYXA 2HV6A 4E18A 4JZAA 1I4ZA 3UR3C 1S05A 5L0FA 3TD7A 1QKRA 3GEIA 2NUTA 2LFDA 4NY3A 3SZRA 1Z6AA 3DE9A 3MYFA 1LS1A 3EGXB 1F1MA 5FZTA 4EKWA 2R7XA 3FOPA 4OD4A 1HMDA 2HSQA 2V3CC 5AC4A 3TJ6A 2P6VA 3W8HA 1OKKA 2OOCA 2V26A 2IXPA 4P9TA 2LP4A 4R32A 3EZIA 3V7OA 1I4YA 4W8KA 5JT4A 1VTMP 1M2VB 1U0BB 1NU9C 4BEJA 2EIMC 2A69F 3AG3C 5HSWA 4EUKB 2OQMA 4HE8D 4YL3A 2XM0A 2C04A 3M4CA 4BG0A 1S7ZA 4MNDA 1DOVA 1WGWA 2DYSC 1O3UA 4KC9A 3X2QC 2XLWA 3IQ5A 3AG2C 2J8WA 1T6QA 3RW0A 1NSGB 4DVZA 3ASOC 3GODA 1YVIA 1KU2A 4PJLA 2ETSA 2WZFA 1OW8A 2YRFA 3G4ZA 3W8IA 2R7UA 3W2WA 3U5SA 5COMA 4BPMA 1ST6A 2R03A 1K04A 1A7VA 1OR3A 2H7OA 3M79A 4MS2A 3C62A 3LNRA 4C3BA 3FAJA 5KYUB 1OCOC 5CIVA 3NKEA 5DQZA 2YWAA 2A6HF 2BL2A 4N06A 1RKEB 5EHHA 4ZLCA 1LPEA 1HW2A 3V5YA 2Y3DA 4EWCA 3I5QA 5L0GA 2Y3GA 3DWWA 3EG9A 3EJNA 3EPVA 2YLGA 3K1HA 3F47A 4XWJA 4YJWA 4OINF 4EBBA 2DB4A 5B3SC 1J8MF 3C63A 2P1AA 2P0NA 1CGME 3A11A 4AL0A 4CIPA 1QSPA 1FAPB 3HNIA 3ECSA 3GANA 1R5ID 3NYMA 4FESA 4WJ0A 2IXMA 2IBFA 2KSFA 3E9VA 4HFKB 2PBEA 3UMIA 2A68F 3ABLC 4LDQA 3IHUA 3ZDLA 3GEEA 3I5PA 4PR9A 3RKOF 4KBLA 3WHNA 2DGJA 2KGOA 4IGGA 5L0DA 1OW7A 3N2ZB 4JIOA 3ZC4A 2X51A 1YAUO 2EPOA 4I1OB 3HNKA 4HEAJ 1MNEA 5A69A 2YQYA 2QY9A 2XL4A 4ONSA 4IRUA 4YN0B 3S9OA 5A6BD 3U3FA 2IXNA 1NBBA 3T6JA 2XS1A 1SR2A 4MVRA 4PK4A 5KYUA 2OG2A 3OWTA 2CGEA 2X0CA 3DJNB 1TWHA 3MBGA 4BJ5A 1WATA 4JW1A 1LI7A 3TOMA 5KYWA 1J8YF 3NDBB 1RCPA 3I4UA 4NC3A 3MYIA 5EGYA 3IQCA 1RKEA 4K7BA 1IW7F 3DM5A 4CS9C 3DAFA 2EILC 3M4BA 3VAYA 2XL6A 3KH2A 5DVWA 4QI2A 2HFIA 1GQAA 4IARA 3ASNC 1YLMA 4W8PA 1TKNA 4NQFA 4DRJB 3OA1A 4BJ6C 3DXJF 2BE5F 1JR8A 3K66A 3LNMB 2ZXPA 2WVQA 3EHMA 3SYNA 1SF8A 1MQVA 4LLEA 3TQOA 1D0XA 3IEEA 4Z9IA 2YL0A 3VYWA 4Z9JA 1QPUA 2ZPAA 5KYXB 4MVOA 1FMVA 3C7JA 2L6GA 3MFNA 3NYLA 2OEVA 3JTLO 5KYYB 3SXZA 3GWLA 3QTHA 3IQ6A 3KYJA 2W9YA 3JCUQ 2F22A 1Q0GA 5B1AC 1D0YA 1T6IA 2YVKA 3EFOA 4CS8C 1JRAA 4DBQA 3FXHA 3K1IC 3CSKA 4N6HA 4CSAA 3JSEO 4M63A 2TMVP 3FMSA 1HW1A 4KNVA 2RD9A 3QVYA 4YT2A 4E0IA 3QZCA 3WG7C 3X1OA 3ZVRA 3KPHA 2PX0A 2YZSA 1K40A 5BQGA 4GEHA 3M15A 1VYKA 1OW6A 4D4NA 3AG4C 1PD1A 2J9VA 2JD3A 3MX3A 3V5ZA 3POVA 4LDRA 2CCYA 4O6YA 2HV7A 4XTKA 1M6TA 2LSEA 3AGTA 1JMWA 2HKVA 2VCBA 3JT1A 4AK9A 3GM2A 4KNWA 2OEXA 3JYHA 4DXWA 3WODF 2R7RA 1D1AA 1VMAA 3GORA 2EPKX 3JYYA 1M57C 1OQCA 2J9BA 3GM3A 4JJFA 1DOWA 4LACB 1V54C 3V5XA 1NFNA 3TOLA 2G3VA 3RFYA 2R25A 1A7EA 1MMAA 2J46A 1Y6DA 3C18A 3HTKC 3N0TA 5D91A 4E7ZA 4AX2A 1Q0FA 1WTYA 5KYYA 4O7GA 1APCA 2Q7RA 1C03A 1D0ZA 4CDYA 4ER9A 2VC9A 3HNLA 1YZCA 4JTDB 1QLEC 5A6JA 3IQTA 5A6BA 3IPMO 4U9DA 3EG9B 1U89A 4YT5A 2R7QA 1O87A 1QVXA 2XSEA 1T9KA 5T3WA 3DM9B 3Q6MA 1OR2A 4J30B 1H6GA 1VLSA 1BZ4A 4CBEA 2Y39A 2YL1A 2I8BA 2VB6A 4JEBA 3SEOA 2XS8A 2B0HA 1UG7A 2OU6A 2J45A 1XZQA 1OXKA 3VRCA 2H8AA 4MTOA 4L6RA 3UGOA 2XLHA 1PCXA 1H9GA 3BRJA 256BA 2EPNA 4RBNA 4XPXA 3C8GD 5AGFA 2KYHA 3LEVA 3AG1C 2KW3C 2NUPA 2KC3A 1GS9A 2KJGA 3ZQYA 2HZ8A 5IY5C 1FFHA 2Q9BA 5JSLA 4GYTA 4MW8A 4NTFA 5B3IA 1TFOB 3JSZA 4O6MA 2XXAB 3U9MA 2ASRA 5JS5A 5KYWB 2J0WA 2FFHA 2J0XA 2OCCC 3S29A 2XM4A 1T6UA 4XEFA 4JTAB 2H7VC 3MLGA 1C17M 3U2MA 2FGYA 1A7DA 2HUJA 3FOOA 3JRTA 2VASA 4IAQA 4O6NA 4C3DA 1OXBA 2OJQA 2HJ3A 3O55A 4U5BE 4XQ1A 3S90A 3U0CA 2EINC 3B9QA 1GGQA 1VLTA 2MYSA 4K1OA 1HMOA 3QW1A 4P6IC 1IZMA 4QDLA 4XPYA 4XEVA 1ZHWA 2M64A 2ZXOA 3T6GB 1VB5A 2KK1A 2W4MA 5DS4A 1ZW3A 3SXYA 4LLCA 1VK5A 2YEVA 2HMZA
chains in the Genus database with same CATH topology
4EBJA 4NQFA 3C8GB 1K40A 1ZZPA 1K04A 1OW7A 1OW6A 3L8JA 1WOLA 1QVXA 2L6FA 3RQGA 2JX0A 3RQEA 2L6HA 4R32A 3L8IA 4EBKA 3B71A 1K05A 2Q00A 2YWAA 3AJMA 3S9OA 3GM2A 3MFNA 4XEFA 1V4AA 2HSBA 2L6GA 3U3FA 1WWPA 3O10A 3C8GA 1UFBA 5F28E 3JYYA 3GM3A 3U0CA 3K7DA 1JOGA 1PV3A 3BRJA 1KNYA 1O3UA 4XEKA 3C18A 1KTMA 3C8GD 2JPUA 4XEVA 1WTYA 2KK1A 3GM1A 2PBEA 3JZ0A 3TULA 3RQFA 1OW8A 2LK4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EBJ A;  4NQF A;  3C8G B;  1K40 A;  1ZZP A;  1K04 A;  1OW7 A;  1OW6 A;  3L8J A;  1WOL A;  1QVX A;  2L6F A;  3RQG A;  2JX0 A;  3RQE A;  2L6H A;  4R32 A;  3L8I A;  4EBK A;  3B71 A;  1K05 A;  2Q00 A;  2YWA A;  3AJM A;  3S9O A;  3GM2 A;  3MFN A;  4XEF A;  1V4A A;  2HSB A;  2L6G A;  3U3F A;  1WWP A;  3O10 A;  3C8G A;  1UFB A;  5F28 E;  3JYY A;  3GM3 A;  3U0C A;  3K7D A;  1JOG A;  1PV3 A;  3BRJ A;  1KNY A;  1O3U A;  4XEK A;  3C18 A;  1KTM A;  3C8G D;  2JPU A;  4XEV A;  1WTY A;  2KK1 A;  3GM1 A;  2PBE A;  3JZ0 A;  3TUL A;  3RQF A;  1OW8 A;  2LK4 A; 
#chains in the Genus database with same CATH topology
 3LJB A;  3C8G B;  3UGP A;  1YZA A;  4H54 A;  3VM6 A;  2Y3B A;  4D4X A;  5JP7 A;  4CDA A;  1E83 A;  2L6H A;  4RDA A;  2J9W A;  3B71 A;  4MVQ A;  2CYD A;  2J7P D;  2KQ9 A;  3EFO B;  3W2V A;  2LIG A;  2A6E F;  2HSB A;  2YLD A;  4JJG A;  3U8P A;  3UNG C;  4AE4 A;  3RIP A;  3UMH A;  3L1M A;  4JUR I;  1Z63 A;  5DS6 A;  1SMY F;  2XLV A;  3NMK A;  4DOZ A;  2XXA A;  1JOG A;  2WB7 A;  1M56 C;  2QLA A;  1T5O A;  3ABM C;  3KKB A;  4E0H A;  5K0I A;  1JPN A;  2CNW D;  3ABK C;  1ZVZ A;  1SZI A;  5HV9 A;  1YA7 O;  4PJJ A;  4N6C A;  2ICW G;  5L3Q A;  2R7O A;  1PD0 A;  1D1C A;  3Q7G A;  3G50 A;  1ZYR F;  4H4K C;  4DVY P;  1HE9 A;  3B0P A;  1HE1 A;  1Z3I X;  2I15 A;  3NYJ A;  1V74 B;  2XLM A;  3F46 A;  3AQC A;  3JRM O;  1LIH A;  2IYL D;  3PMR A;  3CZ6 A;  1EA8 A;  1Z5Z A;  4G0H A;  4MVU A;  4YL1 A;  4UDV A;  2NSF A;  3QMK A;  4FWV A;  2B0J A;  1G4U S;  3K1I A;  3RVZ A;  5F5F A;  1A41 A;  3QVZ A;  2OJE D;  3C8G A;  4DBR A;  3RYL A;  4ANJ A;  1OCC C;  1E86 A;  1O5H A;  3K7D A;  5FCL A;  3HNJ A;  4RD9 A;  1FR0 A;  1T01 A;  1YDI A;  2QE9 A;  4JCZ A;  4XEK A;  4I1M A;  1FFT C;  4DRH B;  3RF3 A;  5E3C A;  2MWQ A;  3W4Y A;  3FAP B;  3Q6N A;  3RQF A;  1W2W A;  2XRH A;  2QUP A;  2IXO A;  1Q0D A;  3EGD A;  5DQT A;  4NCQ A;  1BR1 A;  3LLK A;  4MTG A;  4J7T A;  1H7I A;  4NTA A;  2UUI A;  1ORJ A;  5B1B C;  4ZLD A;  4U5C E;  3RH3 A;  3RQG A;  4B6I A;  1EI7 A;  1RKC A;  2EIK C;  3R2P A;  1FMW A;  4MVS A;  2GA0 A;  2Q9A A;  4J32 B;  3LLI A;  1LE2 A;  2WVN A;  2XLE A;  2E87 A;  2IM8 A;  4K0D A;  3TK0 A;  4DRI B;  1RJ9 B;  2QNL A;  5E2Q A;  4A2N B;  2NUP B;  4BJT A;  4YWQ A;  1H9T A;  2H7B A;  3ZIB A;  2R7S A;  3LAY A;  3NG1 A;  5EK0 A;  4PFP A;  1MMD A;  3EH1 A;  1TFK B;  3PHF 2;  3DKA A;  1LS4 A;  1PV3 A;  4ULW A;  2YL7 A;  4QI0 A;  1V55 C;  1YAR O;  4OIQ F;  2JPU A;  5CI9 A;  5JLI A;  1ZHY A;  4FAP B;  5BUO A;  2DYR C;  4G7H F;  4YK5 A;  4PAC A;  3SP1 A;  1CGN A;  5T3T A;  3SXK A;  1JAF A;  3J06 A;  2KNH A;  2LK4 A;  1TQG A;  3SNH A;  1VOM A;  2AWC A;  3SXM A;  2J7P A;  5L0J A;  2MHR A;  4CSA C;  2L9J A;  3TJ5 A;  1MMN A;  4A4A A;  3L34 A;  3LUT B;  4U5G A;  1CPQ A;  2M4E A;  3A9C A;  1NG1 A;  3S0X A;  2A0B A;  4WAB A;  1K05 A;  1YYX A;  4Z9H A;  2ZXR A;  3DMD A;  4E7S A;  5L0I A;  3U2L A;  4XPW A;  2CNW A;  5AC5 A;  5E3A A;  2EPL X;  2O9X A;  2YL3 A;  1QZX A;  1ZW2 A;  2YHS A;  5F28 E;  1NFO A;  1AVO B;  3U9J A;  3S28 A;  2PP4 A;  4G7Z F;  5L0C A;  4C3E A;  4PJN A;  1D1B A;  1QQ3 A;  1XWJ A;  2NG1 A;  3H2V A;  3LS1 A;  3DZA A;  4E17 A;  2Y69 C;  2A1D D;  4N4W A;  2AP3 A;  2Q3T A;  3G4X A;  3O6X A;  3WAQ A;  3GWN A;  5L3V A;  1Q0M A;  1RJ9 A;  3B0U X;  2HS5 A;  1LKX A;  1G4W R;  1ZU5 A;  1OCR C;  1ZU4 A;  4JRZ A;  2GAQ A;  3ITF A;  3GEH A;  4P9F A;  4YT4 A;  3HKK A;  4U5E E;  4AE4 B;  4DJ9 A;  2NSG A;  5BQI A;  3B0V C;  1GM5 A;  2G62 A;  1TWA A;  2Y3H A;  3UMK A;  1NU7 D;  3CQZ A;  2WZG A;  5CI8 A;  1FTS A;  3RQE A;  4CDV A;  3AGU A;  1Q0K A;  2Q00 A;  3ZG1 A;  3L0I A;  3NMJ A;  2P7V A;  1RMV A;  2YKZ A;  4X0R A;  4LER A;  2CDQ A;  2EIJ C;  3PDM P;  1BDJ B;  4FX5 A;  1M2O A;  5BQH A;  3CEX A;  3FVY A;  1Y4C A;  4I44 A;  3OEO A;  4U5D E;  1CPR A;  4O79 A;  2VCA A;  3NRH A;  1MMG A;  1LM3 B;  5COG A;  1L7C A;  4PJM A;  2R9R B;  4IWB A;  2Q9C A;  3EZH A;  3GM1 A;  3LEO A;  4J7Y A;  1L3P A;  3TUL A;  1BR2 A;  2R02 A;  2Q4F A;  3T6B A;  4EBJ A;  1AUE A;  3Q7L A;  3QW0 A;  3DE8 A;  3HLZ A;  4LDK A;  2AVK A;  4CJO A;  3U3B A;  3DD7 A;  1EQ1 A;  2LD6 A;  2R05 A;  5DLJ A;  1Z7Q c;  1R4T A;  1CGO A;  3NKD A;  4MTF A;  1LE4 A;  2LQG A;  4OIP F;  2GDC A;  3K6B A;  1E84 A;  2QTV A;  2PFD A;  3ZTM A;  1TWG A;  2R7W A;  3EGX A;  1YJG A;  1SYQ A;  5L0H A;  2PF4 E;  3DI5 A;  1E2X A;  3DJU B;  3O10 A;  3M1C B;  4CS9 A;  5T1D B;  3KYI A;  2RSE B;  1ZHZ A;  3EGD B;  3AOU A;  5JVE A;  5JUA A;  2W45 A;  4BJ6 A;  1KTM A;  1M2V A;  4IB4 A;  2W4B A;  3FHD A;  2EPM X;  3ZWI A;  4NTB A;  3HJC A;  4Q4Z F;  3KL4 A;  3JZ0 A;  1ZHT A;  2A0U A;  4Q7C A;  2WL8 A;  4MVZ A;  2CW0 F;  4OIO F;  2WZL A;  5TJ5 E;  1ZZP A;  4BJ1 A;  4EHP A;  4AL1 A;  5D92 A;  2LCH A;  3ZSU A;  1ZHX A;  2NPU A;  3EHN A;  2D4U A;  4JEA A;  3E70 C;  4EBK A;  4YT8 A;  2AU5 A;  1OCZ C;  4XLN F;  3T9O A;  4CS8 A;  1TR2 A;  2FAP B;  2LFF A;  2PNO A;  4U5H A;  1BBH A;  4G7O F;  4C7O B;  1NZE A;  1UFB A;  1YYJ A;  3CAX A;  2OKU A;  1OKK D;  3RVY A;  4BEM J;  4MW3 A;  2GWW A;  3LES A;  2J9U A;  2WVO A;  2PX3 A;  1C02 A;  1VYI A;  5GPG B;  1WAS A;  3R7C A;  3US6 A;  2AWY A;  2XLO A;  2XL8 A;  3B29 A;  3H2U A;  5KYN A;  1N1C A;  4U9E A;  4CIH A;  4JE9 A;  2VH3 A;  1WN0 A;  2P61 A;  3S27 A;  3ZQV A;  1G5Z A;  1RXQ A;  5JRA A;  3FDQ A;  5DS5 A;  5E33 A;  1MND A;  1YA9 A;  4OD5 A;  3U8V A;  4BJ5 C;  1XZP A;  2G3K A;  1JPJ A;  4JTC B;  3ATP A;  2ZD9 A;  2XLD A;  4ULV A;  1ORY A;  5A6A A;  2HMQ A;  3N24 A;  4I3M A;  3L8J A;  1E85 A;  1B68 A;  2L6F A;  3VF0 A;  2D5R B;  2JX0 A;  4EIY A;  4KI2 A;  3L8I A;  2DI3 A;  3C8Z A;  5A6K A;  2HJM A;  2ZXW C;  4JVS A;  4XLP F;  4MQ9 F;  1LVK A;  3O39 A;  2UUH A;  4JKV A;  1V4A A;  1WWP A;  2NUT B;  4U5F E;  3LS0 A;  4IAO A;  2GFH A;  4OIR F;  2L7A A;  2R7V A;  1HY5 A;  2VCC A;  1A0B A;  1FNT c;  1AEP A;  1I5N A;  4JCH A;  1G8X A;  4MVM A;  5F5H A;  3NMI A;  4CS7 A;  2R7T A;  3KMI A;  2BC5 A;  3T4R A;  3PCV A;  4C7O A;  3K33 A;  3ZTZ A;  4CX9 A;  2IOQ A;  2C03 A;  4WGZ A;  3BEH A;  1U6H A;  1Z23 A;  3EH2 A;  2Z15 A;  2L81 A;  4F4B A;  4IJJ A;  3AQB A;  3S84 A;  1WOL A;  1EKY A;  1NLX A;  3AJM A;  1ORS C;  4GQH A;  3DAG A;  4WGY A;  5COF A;  4Q5S F;  3EQL F;  4CJG A;  4HFF B;  1LI5 A;  4YL0 A;  2YLI A;  4G78 A;  1BR4 A;  4JC7 A;  1KNY A;  1TWC A;  4PFO A;  3H65 A;  5KYX A;  2HV6 A;  4E18 A;  4JZA A;  1I4Z A;  3UR3 C;  1S05 A;  5L0F A;  3TD7 A;  1QKR A;  3GEI A;  2NUT A;  2LFD A;  4NY3 A;  3SZR A;  1Z6A A;  3DE9 A;  3MYF A;  1LS1 A;  3EGX B;  1F1M A;  5FZT A;  4EKW A;  2R7X A;  3FOP A;  4OD4 A;  1HMD A;  2HSQ A;  2V3C C;  5AC4 A;  3TJ6 A;  2P6V A;  3W8H A;  1OKK A;  2OOC A;  2V26 A;  2IXP A;  4P9T A;  2LP4 A;  4R32 A;  3EZI A;  3V7O A;  1I4Y A;  4W8K A;  5JT4 A;  1VTM P;  1M2V B;  1U0B B;  1NU9 C;  4BEJ A;  2EIM C;  2A69 F;  3AG3 C;  5HSW A;  4EUK B;  2OQM A;  4HE8 D;  4YL3 A;  2XM0 A;  2C04 A;  3M4C A;  4BG0 A;  1S7Z A;  4MND A;  1DOV A;  1WGW A;  2DYS C;  1O3U A;  4KC9 A;  3X2Q C;  2XLW A;  3IQ5 A;  3AG2 C;  2J8W A;  1T6Q A;  3RW0 A;  1NSG B;  4DVZ A;  3ASO C;  3GOD A;  1YVI A;  1KU2 A;  4PJL A;  2ETS A;  2WZF A;  1OW8 A;  2YRF A;  3G4Z A;  3W8I A;  2R7U A;  3W2W A;  3U5S A;  5COM A;  4BPM A;  1ST6 A;  2R03 A;  1K04 A;  1A7V A;  1OR3 A;  2H7O A;  3M79 A;  4MS2 A;  3C62 A;  3LNR A;  4C3B A;  3FAJ A;  5KYU B;  1OCO C;  5CIV A;  3NKE A;  5DQZ A;  2YWA A;  2A6H F;  2BL2 A;  4N06 A;  1RKE B;  5EHH A;  4ZLC A;  1LPE A;  1HW2 A;  3V5Y A;  2Y3D A;  4EWC A;  3I5Q A;  5L0G A;  2Y3G A;  3DWW A;  3EG9 A;  3EJN A;  3EPV A;  2YLG A;  3K1H A;  3F47 A;  4XWJ A;  4YJW A;  4OIN F;  4EBB A;  2DB4 A;  5B3S C;  1J8M F;  3C63 A;  2P1A A;  2P0N A;  1CGM E;  3A11 A;  4AL0 A;  4CIP A;  1QSP A;  1FAP B;  3HNI A;  3ECS A;  3GAN A;  1R5I D;  3NYM A;  4FES A;  4WJ0 A;  2IXM A;  2IBF A;  2KSF A;  3E9V A;  4HFK B;  2PBE A;  3UMI A;  2A68 F;  3ABL C;  4LDQ A;  3IHU A;  3ZDL A;  3GEE A;  3I5P A;  4PR9 A;  3RKO F;  4KBL A;  3WHN A;  2DGJ A;  2KGO A;  4IGG A;  5L0D A;  1OW7 A;  3N2Z B;  4JIO A;  3ZC4 A;  2X51 A;  1YAU O;  2EPO A;  4I1O B;  3HNK A;  4HEA J;  1MNE A;  5A69 A;  2YQY A;  2QY9 A;  2XL4 A;  4ONS A;  4IRU A;  4YN0 B;  3S9O A;  5A6B D;  3U3F A;  2IXN A;  1NBB A;  3T6J A;  2XS1 A;  1SR2 A;  4MVR A;  4PK4 A;  5KYU A;  2OG2 A;  3OWT A;  2CGE A;  2X0C A;  3DJN B;  1TWH A;  3MBG A;  4BJ5 A;  1WAT A;  4JW1 A;  1LI7 A;  3TOM A;  5KYW A;  1J8Y F;  3NDB B;  1RCP A;  3I4U A;  4NC3 A;  3MYI A;  5EGY A;  3IQC A;  1RKE A;  4K7B A;  1IW7 F;  3DM5 A;  4CS9 C;  3DAF A;  2EIL C;  3M4B A;  3VAY A;  2XL6 A;  3KH2 A;  5DVW A;  4QI2 A;  2HFI A;  1GQA A;  4IAR A;  3ASN C;  1YLM A;  4W8P A;  1TKN A;  4NQF A;  4DRJ B;  3OA1 A;  4BJ6 C;  3DXJ F;  2BE5 F;  1JR8 A;  3K66 A;  3LNM B;  2ZXP A;  2WVQ A;  3EHM A;  3SYN A;  1SF8 A;  1MQV A;  4LLE A;  3TQO A;  1D0X A;  3IEE A;  4Z9I A;  2YL0 A;  3VYW A;  4Z9J A;  1QPU A;  2ZPA A;  5KYX B;  4MVO A;  1FMV A;  3C7J A;  2L6G A;  3MFN A;  3NYL A;  2OEV A;  3JTL O;  5KYY B;  3SXZ A;  3GWL A;  3QTH A;  3IQ6 A;  3KYJ A;  2W9Y A;  3JCU Q;  2F22 A;  1Q0G A;  5B1A C;  1D0Y A;  1T6I A;  2YVK A;  3EFO A;  4CS8 C;  1JRA A;  4DBQ A;  3FXH A;  3K1I C;  3CSK A;  4N6H A;  4CSA A;  3JSE O;  4M63 A;  2TMV P;  3FMS A;  1HW1 A;  4KNV A;  2RD9 A;  3QVY A;  4YT2 A;  4E0I A;  3QZC A;  3WG7 C;  3X1O A;  3ZVR A;  3KPH A;  2PX0 A;  2YZS A;  1K40 A;  5BQG A;  4GEH A;  3M15 A;  1VYK A;  1OW6 A;  4D4N A;  3AG4 C;  1PD1 A;  2J9V A;  2JD3 A;  3MX3 A;  3V5Z A;  3POV A;  4LDR A;  2CCY A;  4O6Y A;  2HV7 A;  4XTK A;  1M6T A;  2LSE A;  3AGT A;  1JMW A;  2HKV A;  2VCB A;  3JT1 A;  4AK9 A;  3GM2 A;  4KNW A;  2OEX A;  3JYH A;  4DXW A;  3WOD F;  2R7R A;  1D1A A;  1VMA A;  3GOR A;  2EPK X;  3JYY A;  1M57 C;  1OQC A;  2J9B A;  3GM3 A;  4JJF A;  1DOW A;  4LAC B;  1V54 C;  3V5X A;  1NFN A;  3TOL A;  2G3V A;  3RFY A;  2R25 A;  1A7E A;  1MMA A;  2J46 A;  1Y6D A;  3C18 A;  3HTK C;  3N0T A;  5D91 A;  4E7Z A;  4AX2 A;  1Q0F A;  1WTY A;  5KYY A;  4O7G A;  1APC A;  2Q7R A;  1C03 A;  1D0Z A;  4CDY A;  4ER9 A;  2VC9 A;  3HNL A;  1YZC A;  4JTD B;  1QLE C;  5A6J A;  3IQT A;  5A6B A;  3IPM O;  4U9D A;  3EG9 B;  1U89 A;  4YT5 A;  2R7Q A;  1O87 A;  1QVX A;  2XSE A;  1T9K A;  5T3W A;  3DM9 B;  3Q6M A;  1OR2 A;  4J30 B;  1H6G A;  1VLS A;  1BZ4 A;  4CBE A;  2Y39 A;  2YL1 A;  2I8B A;  2VB6 A;  4JEB A;  3SEO A;  2XS8 A;  2B0H A;  1UG7 A;  2OU6 A;  2J45 A;  1XZQ A;  1OXK A;  3VRC A;  2H8A A;  4MTO A;  4L6R A;  3UGO A;  2XLH A;  1PCX A;  1H9G A;  3BRJ A;  256B A;  2EPN A;  4RBN A;  4XPX A;  3C8G D;  5AGF A;  2KYH A;  3LEV A;  3AG1 C;  2KW3 C;  2NUP A;  2KC3 A;  1GS9 A;  2KJG A;  3ZQY A;  2HZ8 A;  5IY5 C;  1FFH A;  2Q9B A;  5JSL A;  4GYT A;  4MW8 A;  4NTF A;  5B3I A;  1TFO B;  3JSZ A;  4O6M A;  2XXA B;  3U9M A;  2ASR A;  5JS5 A;  5KYW B;  2J0W A;  2FFH A;  2J0X A;  2OCC C;  3S29 A;  2XM4 A;  1T6U A;  4XEF A;  4JTA B;  2H7V C;  3MLG A;  1C17 M;  3U2M A;  2FGY A;  1A7D A;  2HUJ A;  3FOO A;  3JRT A;  2VAS A;  4IAQ A;  4O6N A;  4C3D A;  1OXB A;  2OJQ A;  2HJ3 A;  3O55 A;  4U5B E;  4XQ1 A;  3S90 A;  3U0C A;  2EIN C;  3B9Q A;  1GGQ A;  1VLT A;  2MYS A;  4K1O A;  1HMO A;  3QW1 A;  4P6I C;  1IZM A;  4QDL A;  4XPY A;  4XEV A;  1ZHW A;  2M64 A;  2ZXO A;  3T6G B;  1VB5 A;  2KK1 A;  2W4M A;  5DS4 A;  1ZW3 A;  3SXY A;  4LLC A;  1VK5 A;  2YEV A;  2HMZ A; 
#chains in the Genus database with same CATH homology
 4EBJ A;  4NQF A;  3C8G B;  1K40 A;  1ZZP A;  1K04 A;  1OW7 A;  1OW6 A;  3L8J A;  1WOL A;  1QVX A;  2L6F A;  3RQG A;  2JX0 A;  3RQE A;  2L6H A;  4R32 A;  3L8I A;  4EBK A;  3B71 A;  1K05 A;  2Q00 A;  2YWA A;  3AJM A;  3S9O A;  3GM2 A;  3MFN A;  4XEF A;  1V4A A;  2HSB A;  2L6G A;  3U3F A;  1WWP A;  3O10 A;  3C8G A;  1UFB A;  5F28 E;  3JYY A;  3GM3 A;  3U0C A;  3K7D A;  1JOG A;  1PV3 A;  3BRJ A;  1KNY A;  1O3U A;  4XEK A;  3C18 A;  1KTM A;  3C8G D;  2JPU A;  4XEV A;  1WTY A;  2KK1 A;  3GM1 A;  2PBE A;  3JZ0 A;  3TUL A;  3RQF A;  1OW8 A;  2LK4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...