3GM2A

Crystal structure of the focal adhesion targeting (fat) domain of pyk2
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
127
structure length
127
Chain Sequence
b'RTDDLVYLNVMELVRAVLELKNELAQLPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein tyrosine kinase 2 beta
publication title Crystal structures of free and ligand-bound focal adhesion targeting domain of Pyk2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 51
structure length 127
sequence length 127
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03623 Focal_AT Focal adhesion targeting region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3gm2A00
3AJMA 1JOGA 1ZZPA 3GM2A 3TULA 2Q00A 1UFBA 2L6GA 4NQFA 1KTMA 1OW8A 3O10A 3MFNA 4XEKA 1PV3A 3B71A 2HSBA 1WWPA 3U0CA 4EBJA 1K05A 4XEVA 2JX0A 1KNYA 1OW6A 4R32A 3C18A 4XEFA 3C8GD 2KK1A 2L6FA 3L8IA 3C8GA 3RQEA 5F28E 3JYYA 1WTYA 4EBKA 3GM3A 1O3UA 3C8GB 2YWAA 3K7DA 2L6HA 3S9OA 1OW7A 1WOLA 1K40A 2LK4A 3GM1A 3U3FA 3BRJA 1QVXA 2PBEA 3JZ0A 3RQFA 3RQGA 2JPUA 3L8JA 1K04A 1V4AA
chains in the Genus database with same CATH superfamily
5E3AA 3RF3A 3G50A 4O6NA 1RKCA 4U5DE 3FAPB 5JSLA 4N6HA 3VAYA 1OR3A 4J7YA 1T6UA 3NKEA 1OCCC 4E18A 2YLIA 1KNYA 2W4MA 1Q0GA 1G4WR 1M6TA 1HW2A 3C8GD 2J45A 1AVOB 3EZHA 3LEOA 4WJ0A 2NUPA 5F28E 1C17M 3PHF2 3EGXB 4BEMJ 3DMDA 4E7SA 3JRMO 3RIPA 3GM3A 2C04A 3GWLA 4EIYA 2HS5A 2NUPB 3HJCA 1QSPA 2MYSA 4J30B 1TKNA 1VK5A 1SZIA 3GM1A 1SR2A 4PJJA 3HKKA 3G4XA 5A6KA 1QVXA 3RFYA 3US6A 2KQ9A 4MVMA 4C3BA 3CQZA 4AL1A 3EH1A 1V74B 1BR4A 5EHHA 1J8MF 3FHDA 4EBBA 2KSFA 2D5RB 1OQCA 2NUTB 2NSFA 2RD9A 2DYSC 3K33A 1ZU5A 2DI3A 3POVA 1YZCA 2UUIA 2HUJA 3W2VA 3L34A 3LS1A 4P6IC 2G62A 1TFOB 3W2WA 3ITFA 3LAYA 2KK1A 4ANJA 2KC3A 4J32B 1YAUO 1Z23A 1ZHZA 1JMWA 1PCXA 5L3QA 1TQGA 2UUHA 1ZW3A 1BR2A 3JRTA 2DGJA 2R25A 4DOZA 1T5OA 1LKXA 1RCPA 2WZGA 2HJ3A 5DS5A 1CGNA 2G3KA 3S29A 1JR8A 1ORSC 2YEVA 4PJMA 3ZC4A 4LDQA 4CS9C 2GWWA 2XLEA 3JSEO 1E84A 2KJGA 2JPUA 2B0HA 4BG0A 3AG4C 4C7OA 3JSZA 1V4AA 2VCCA 5DLJA 3S0XA 256BA 2AU5A 3T6JA 4ULWA 1SF8A 1MMDA 4C7OB 4LLEA 3C62A 1NZEA 5KYXB 4KI2A 2ASRA 1BBHA 3NMKA 2XRHA 2CGEA 3KYJA 2JX0A 4D4NA 5JLIA 2ZXOA 3UGOA 3FAJA 4BJ6A 1D0XA 2YQYA 4MVZA 5GPGB 4AE4A 2MHRA 4PK4A 4HEAJ 3TD7A 4G7ZF 2EIKC 2LIGA 1ORYA 3I4UA 4PACA 1HY5A 3SYNA 3FDQA 5L0DA 1YDIA 1H9GA 3RW0A 4AL0A 2KNHA 2XL8A 4IRUA 3ZQVA 3AG1C 3VM6A 4YT4A 4MVQA 4E7ZA 2EPOA 2P1AA 1MQVA 2ZXRA 1NLXA 4MQ9F 3RVYA 3GEIA 1NG1A 4JW1A 1Z6AA 3T6GB 4DRHB 3LS0A 1YYJA 2R7WA 4QI0A 5A6JA 3Q6MA 3DJNB 2J9UA 4KBLA 2ZXPA 4JJFA 2J7PD 2W4BA 3AGTA 4AK9A 4BJTA 5KYYA 3M1CB 4BJ5C 5DS4A 2DYRC 4KNVA 1M2VA 1S7ZA 2W45A 4W8KA 5T3TA 1FNTc 3UGPA 1CGME 1GS9A 4MTGA 3NRHA 1YA9A 3ZWIA 5KYYB 4Q4ZF 1CGOA 3QVZA 1OW6A 4U5FE 1M2VB 2IXOA 3SXZA 5T3WA 1HW1A 1NSGB 2H7VC 4NY3A 1H9TA 2KYHA 4MW8A 1MNDA 3G4ZA 3PMRA 5COMA 4WABA 1WASA 3EZIA 3VRCA 3SXMA 2EINC 1GGQA 2XL6A 5A6BA 4H4KC 1LM3B 2D4UA 4XPWA 2BE5F 2XLWA 3QVYA 4JURI 1MMGA 4NTBA 2VC9A 3B0PA 3L0IA 3SNHA 3LNMB 5JS5A 1I5NA 3LLIA 3EPVA 5BQIA 1CPRA 2Q3TA 1R5ID 3CSKA 3GWNA 3ABMC 1NU9C 2EPNA 2OJQA 4XEVA 3AQBA 4R32A 3EGDA 1NBBA 4N4WA 3UNGC 4ZLCA 1RXQA 4MTFA 2PNOA 3L8IA 5AGFA 4MVSA 3ASOC 3M15A 3EGDB 3UR3C 4KNWA 4G0HA 5A69A 1ZHTA 2VB6A 1O3UA 1R4TA 3CAXA 2CNWD 2LSEA 3S28A 1VTMP 3DXJF 2VH3A 1VMAA 2J8WA 3BRJA 3VF0A 1ZHXA 4IGGA 1FAPB 2J9WA 2XLDA 2YHSA 4JRZA 3B29A 1ZYRF 3ABKC 1E85A 4YL1A 4JC7A 2CCYA 4MTOA 1U89A 3AJMA 2ETSA 3H2UA 1A7DA 3KKBA 3L1MA 3O10A 3I5PA 4YT8A 4MVRA 3JYHA 3B71A 2HSBA 4I1OB 4LDKA 4MNDA 1M56C 3ZTMA 4A4AA 1Y6DA 4JZAA 3ZDLA 2Y3HA 1O87A 1AUEA 3K66A 1Z5ZA 1F1MA 1BR1A 2ICWG 3C7JA 4N06A 1BZ4A 3DWWA 1G4US 3ZIBA 2QY9A 4EBKA 4HFFB 1HMOA 3ATPA 1QLEC 3R7CA 1OW7A 4E17A 3QZCA 5JT4A 4DXWA 2OG2A 3AOUA 2WVOA 3IQTA 3V5ZA 4IAQA 4O6MA 5L0FA 4K0DA 4DRIB 5F5FA 1U6HA 4O7GA 2HJMA 2C03A 5L0CA 1MMNA 2PX3A 2WVNA 1ZW2A 3LLKA 3UMKA 1HE1A 1T01A 1T9KA 5BQGA 4NQFA 3V5YA 2IM8A 3TOLA 4Z9IA 1OCZC 1YVIA 1T6IA 4U5GA 3HLZA 1WWPA 1TWGA 2WVQA 4GQHA 4IJJA 5K0IA 3T6BA 1LI7A 1B68A 1ZHWA 1QZXA 3Q7LA 4L6RA 5L0JA 3AG2C 5BQHA 3W8IA 5L3VA 2I8BA 3H2VA 1OCRC 3N2ZB 2PF4E 5DVWA 5FZTA 3UMIA 1E86A 3IQCA 4HE8D 4OD5A 1WTYA 2WZLA 2I15A 1T6QA 2L6HA 4CDYA 1WATA 5B1AC 1A0BA 4JTCB 3DD7A 2R7TA 4P9TA 2WB7A 2G3VA 4G7HF 3ECSA 2QTVA 4JEBA 2IXPA 1L7CA 1Z3IX 4G78A 4WGZA 5COFA 5DQZA 4DJ9A 2PP4A 1FR0A 2JD3A 3WHNA 1ZHYA 3I5QA 2P7VA 1D1BA 5CI8A 1FMVA 3E9VA 3DJUB 2P6VA 4LLCA 3EFOA 2A0UA 1G8XA 2CYDA 3K1IC 3NG1A 4Q7CA 3U8VA 4EUKB 3LNRA 4CS7A 1KU2A 2R7VA 2HFIA 1BDJB 5KYNA 1WGWA 1U0BB 1JAFA 5D92A 4ER9A 1TFKB 4BJ1A 3IHUA 1H6GA 1G5ZA 4AE4B 4CS8C 4BEJA 2EILC 2YLGA 1E2XA 3U3BA 2LQGA 4FWVA 3IEEA 1YZAA 2LD6A 3V5XA 4IB4A 2EPKX 3JZ0A 3QTHA 2ZPAA 4CJGA 4OIPF 3K6BA 1SYQA 2CW0F 2YL0A 3AGUA 3WAQA 2O9XA 1TWAA 1ZZPA 3TULA 4U9EA 1LS4A 1E83A 2L6GA 2EIMC 4PFOA 4G7OF 3HNLA 2ZD9A 1YARO 3MLGA 1JPNA 1S05A 4EBJA 1APCA 4QI2A 1IW7F 2X51A 3C18A 1MMAA 4XEFA 5EK0A 2EPLX 2GFHA 4OD4A 4XPXA 4D4XA 4DBRA 4FAPB 2H7OA 5DQTA 2KW3C 1NFOA 4OINF 2L7AA 4XLNF 3U2LA 3MYIA 1FTSA 4JEAA 4JCHA 3VYWA 5A6BD 1OKKA 4U9DA 2Y3DA 4FESA 5T1DB 5L0HA 1WOLA 3A11A 3FOOA 1LE2A 3NYLA 2Q4FA 4JIOA 2H8AA 4HFKB 3RH3A 2XS1A 2YZSA 4CX9A 5KYWA 3EH2A 3SXYA 3RVZA 5IY5C 4JE9A 3U5SA 1JOGA 4YL0A 4XTKA 1D1AA 2YKZA 3NMJA 5KYWB 1D0ZA 3IPMO 3LESA 3R2PA 3S90A 4WGYA 2HZ8A 4QDLA 2XLHA 1OR2A 2AWYA 2HMZA 3ZVRA 3HNJA 2Q7RA 3B0VC 3KL4A 5E2QA 5AC4A 5COGA 3OEOA 4CBEA 3NDBB 4FX5A 1TR2A 2OCCC 4CS9A 1Q0DA 5KYUA 1RJ9A 1LI5A 1YJGA 4U5EE 1XZQA 3FVYA 3QW1A 2M64A 3GORA 3OWTA 4Z9HA 2KGOA 2LFFA 3KYIA 3RYLA 1A41A 2DB4A 1RJ9B 2OQMA 2PFDA 3KMIA 5JVEA 1WN0A 2GA0A 3NKDA 3Q6NA 2X0CA 1FMWA 2GAQA 1K40A 3K1IA 4NTAA 3RKOF 2NG1A 2A0BA 2V26A 4OIQF 1OXKA 3T4RA 4B6IA 1LS1A 5CIVA 2ZXWC 2L9JA 3AG3C 2GDCA 2YL1A 3SP1A 3U9MA 4X0RA 2IYLD 1UFBA 2A1DD 4H54A 1V55C 4IARA 3TJ6A 1OW8A 5L0IA 3HTKC 4UDVA 1PV3A 3LJBA 1Z7Qc 4MVOA 4CS8A 3U8PA 3C63A 2R7SA 2IBFA 4CDVA 4JKVA 1W2WA 4OIRF 4C3EA 2LP4A 1I4YA 5A6AA 1YLMA 1LVKA 5BUOA 4JCZA 4EKWA 2EIJC 4EHPA 2BL2A 4C3DA 3DM5A 4MS2A 2HMQA 3ZG1A 3PDMP 5D91A 3SEOA 4JTAB 4YT2A 1EQ1A 2YWAA 4ULVA 2XL4A 1HMDA 3DAGA 3S9OA 4BJ5A 1MNEA 4CSAC 1LIHA 3M4CA 1M57C 2QUPA 4RBNA 3KH2A 3DE9A 5E33A 2OEVA 1TWHA 2QNLA 4GEHA 4GYTA 4CIPA 4LERA 2XLMA 2A6EF 2Q9CA 5AC5A 2IXMA 3WODF 2IOQA 4O79A 2XSEA 5DS6A 1QQ3A 3V7OA 4JTDB 3EJNA 3TQOA 4A2NB 1GM5A 4I1MA 3U9JA 2A69F 3EGXA 2V3CC 4CDAA 1VOMA 2HSQA 5B1BC 1XZPA 4F4BA 1H7IA 4I3MA 3GEHA 2QLAA 3C8GA 3RQEA 3NYMA 3GEEA 4ZLDA 2VCBA 3HNIA 5B3SC 4DRJB 3F47A 1FFTC 3C8GB 3HNKA 4P9FA 4U5HA 1C02A 2Z15A 4LDRA 3Q7GA 4U5CE 3TJ5A 2AWCA 3U3FA 2J9BA 2E87A 3JT1A 1M2OA 1J8YF 2PBEA 2XS8A 3QW0A 3RQFA 2J0WA 1DOWA 2NUTA 3TK0A 1RKEA 2HKVA 1SMYF 1ZU4A 1K05A 5TJ5E 3BEHA 4YT5A 3GM2A 1PD0A 3JCUQ 1QKRA 1RKEB 1Y4CA 2EPMX 3DM9B 2WZFA 1VYKA 1NFNA 2VASA 1NU7D 1XWJA 2NSGA 3MFNA 4MW3A 1VLTA 4PFPA 2IXNA 4U5BE 1ST6A 3B9QA 3U0CA 3K1HA 3AQCA 4KC9A 3DZAA 3ZSUA 2XLOA 1IZMA 2YVKA 4JJGA 4CJOA 1EA8A 2J9VA 2YL7A 3EFOB 3U2MA 4N6CA 1VLSA 1CPQA 2J0XA 3MX3A 2QE9A 1Q0MA 3DAFA 4W8PA 2P0NA 3K7DA 2OKUA 4MVUA 1OCOC 4PR9A 2AP3A 4RD9A 3SZRA 2XLVA 3M4BA 1EI7A 2CDQA 1Q0KA 1D1CA 2YRFA 3H65A 3W4YA 5KYXA 2R7RA 1HE9A 4K1OA 4ONSA 2W9YA 3LUTB 3MYFA 2R03A 4IAOA 3A9CA 1A7EA 4XEKA 4EWCA 4BPMA 4NC3A 5F5HA 2XXAA 1VYIA 2L81A 2NPUA 4CSAA 3NYJA 4YWQA 2WL8A 2XXAB 3EHNA 3FXHA 2Q9AA 3FOPA 3N24A 2L6FA 1VB5A 3PCVA 2R7OA 1LPEA 3S84A 3DI5A 2R7QA 4YJWA 4Q5SF 5B3IA 1O5HA 2HV7A 5CI9A 5L0GA 5HSWA 4PJLA 1OKKD 2M4EA 4RDAA 3O39A 2R7XA 1JRAA 2R9RB 4K7BA 3GANA 1RMVA 3E70C 3W8HA 2R05A 5JP7A 2B0JA 5JRAA 3LEVA 1GQAA 2A6HF 3L8JA 4YL3A 1C03A 2RSEB 3J06A 2VCAA 2J7PA 2Y3GA 1KTMA 3DE8A 2AVKA 4XPYA 3TOMA 4XLPF 3ABLC 4JVSA 2YLDA 1AEPA 1A7VA 4YN0B 5E3CA 3O55A 4M63A 1LE4A 2OOCA 5EGYA 4DVZA 2XM0A 4XQ1A 2LCHA 3C8ZA 2OEXA 3FMSA 2FAPB 2P61A 4IWBA 1PD1A 3JYYA 4AX2A 4PJNA 1Z63A 3ASNC 3GODA 2Y3BA 3CEXA 2OJED 2FGYA 1I4ZA 5KYUB 1ZVZA 5FCLA 2LK4A 2Q9BA 1Q0FA 3IQ6A 4DBQA 1JPJA 4Z9JA 4O6YA 2BC5A 1D0YA 2LFDA 3X1OA 1UG7A 1K04A 3X2QC 3KPHA 3ZTZA 3QMKA 4I44A 2OU6A 2H7BA 3F46A 3EHMA 2TMVP 3B0UX 2Q00A 2A68F 1TWCA 4YK5A 3WG7C 2R7UA 1EKYA 1FFHA 5HV9A 1N1CA 3SXKA 3JTLO 2YL3A 3T9OA 1ORJA 3OA1A 3NMIA 1L3PA 3EG9A 2XM4A 4LACB 3DKAA 1OXBA 1DOVA 1YYXA 3MBGA 2R02A 2FFHA 3UMHA 3CZ6A 3EG9B 1V54C 1QPUA 4NTFA 3ZQYA 4E0IA 5JUAA 2Y39A 4J7TA 2PX0A 2CNWA 3EQLF 4XWJA 2J46A 3IQ5A 4CIHA 4OIOF 3S27A 2MWQA 2HV6A 4BJ6C 3M79A 3N0TA 4DVYP 4E0HA 4NCQA 3RQGA 1YA7O 3O6XA 2F22A 2Y69C
chains in the Genus database with same CATH topology
3AJMA 1JOGA 1ZZPA 3GM2A 3TULA 2Q00A 1UFBA 2L6GA 4NQFA 1KTMA 1OW8A 3O10A 3MFNA 4XEKA 1PV3A 3B71A 2HSBA 1WWPA 3U0CA 4EBJA 1K05A 4XEVA 2JX0A 1KNYA 1OW6A 4R32A 3C18A 4XEFA 3C8GD 2KK1A 2L6FA 3L8IA 3C8GA 3RQEA 5F28E 3JYYA 1WTYA 4EBKA 3GM3A 1O3UA 3C8GB 2YWAA 3K7DA 2L6HA 3S9OA 1OW7A 1WOLA 1K40A 2LK4A 3GM1A 3U3FA 3BRJA 1QVXA 2PBEA 3JZ0A 3RQFA 3RQGA 2JPUA 3L8JA 1K04A 1V4AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AJM A;  1JOG A;  1ZZP A;  3GM2 A;  3TUL A;  2Q00 A;  1UFB A;  2L6G A;  4NQF A;  1KTM A;  1OW8 A;  3O10 A;  3MFN A;  4XEK A;  1PV3 A;  3B71 A;  2HSB A;  1WWP A;  3U0C A;  4EBJ A;  1K05 A;  4XEV A;  2JX0 A;  1KNY A;  1OW6 A;  4R32 A;  3C18 A;  4XEF A;  3C8G D;  2KK1 A;  2L6F A;  3L8I A;  3C8G A;  3RQE A;  5F28 E;  3JYY A;  1WTY A;  4EBK A;  3GM3 A;  1O3U A;  3C8G B;  2YWA A;  3K7D A;  2L6H A;  3S9O A;  1OW7 A;  1WOL A;  1K40 A;  2LK4 A;  3GM1 A;  3U3F A;  3BRJ A;  1QVX A;  2PBE A;  3JZ0 A;  3RQF A;  3RQG A;  2JPU A;  3L8J A;  1K04 A;  1V4A A; 
#chains in the Genus database with same CATH topology
 5E3A A;  3RF3 A;  3G50 A;  4O6N A;  1RKC A;  4U5D E;  3FAP B;  5JSL A;  4N6H A;  3VAY A;  1OR3 A;  4J7Y A;  1T6U A;  3NKE A;  1OCC C;  4E18 A;  2YLI A;  1KNY A;  2W4M A;  1Q0G A;  1G4W R;  1M6T A;  1HW2 A;  3C8G D;  2J45 A;  1AVO B;  3EZH A;  3LEO A;  4WJ0 A;  2NUP A;  5F28 E;  1C17 M;  3PHF 2;  3EGX B;  4BEM J;  3DMD A;  4E7S A;  3JRM O;  3RIP A;  3GM3 A;  2C04 A;  3GWL A;  4EIY A;  2HS5 A;  2NUP B;  3HJC A;  1QSP A;  2MYS A;  4J30 B;  1TKN A;  1VK5 A;  1SZI A;  3GM1 A;  1SR2 A;  4PJJ A;  3HKK A;  3G4X A;  5A6K A;  1QVX A;  3RFY A;  3US6 A;  2KQ9 A;  4MVM A;  4C3B A;  3CQZ A;  4AL1 A;  3EH1 A;  1V74 B;  1BR4 A;  5EHH A;  1J8M F;  3FHD A;  4EBB A;  2KSF A;  2D5R B;  1OQC A;  2NUT B;  2NSF A;  2RD9 A;  2DYS C;  3K33 A;  1ZU5 A;  2DI3 A;  3POV A;  1YZC A;  2UUI A;  2HUJ A;  3W2V A;  3L34 A;  3LS1 A;  4P6I C;  2G62 A;  1TFO B;  3W2W A;  3ITF A;  3LAY A;  2KK1 A;  4ANJ A;  2KC3 A;  4J32 B;  1YAU O;  1Z23 A;  1ZHZ A;  1JMW A;  1PCX A;  5L3Q A;  1TQG A;  2UUH A;  1ZW3 A;  1BR2 A;  3JRT A;  2DGJ A;  2R25 A;  4DOZ A;  1T5O A;  1LKX A;  1RCP A;  2WZG A;  2HJ3 A;  5DS5 A;  1CGN A;  2G3K A;  3S29 A;  1JR8 A;  1ORS C;  2YEV A;  4PJM A;  3ZC4 A;  4LDQ A;  4CS9 C;  2GWW A;  2XLE A;  3JSE O;  1E84 A;  2KJG A;  2JPU A;  2B0H A;  4BG0 A;  3AG4 C;  4C7O A;  3JSZ A;  1V4A A;  2VCC A;  5DLJ A;  3S0X A;  256B A;  2AU5 A;  3T6J A;  4ULW A;  1SF8 A;  1MMD A;  4C7O B;  4LLE A;  3C62 A;  1NZE A;  5KYX B;  4KI2 A;  2ASR A;  1BBH A;  3NMK A;  2XRH A;  2CGE A;  3KYJ A;  2JX0 A;  4D4N A;  5JLI A;  2ZXO A;  3UGO A;  3FAJ A;  4BJ6 A;  1D0X A;  2YQY A;  4MVZ A;  5GPG B;  4AE4 A;  2MHR A;  4PK4 A;  4HEA J;  3TD7 A;  4G7Z F;  2EIK C;  2LIG A;  1ORY A;  3I4U A;  4PAC A;  1HY5 A;  3SYN A;  3FDQ A;  5L0D A;  1YDI A;  1H9G A;  3RW0 A;  4AL0 A;  2KNH A;  2XL8 A;  4IRU A;  3ZQV A;  3AG1 C;  3VM6 A;  4YT4 A;  4MVQ A;  4E7Z A;  2EPO A;  2P1A A;  1MQV A;  2ZXR A;  1NLX A;  4MQ9 F;  3RVY A;  3GEI A;  1NG1 A;  4JW1 A;  1Z6A A;  3T6G B;  4DRH B;  3LS0 A;  1YYJ A;  2R7W A;  4QI0 A;  5A6J A;  3Q6M A;  3DJN B;  2J9U A;  4KBL A;  2ZXP A;  4JJF A;  2J7P D;  2W4B A;  3AGT A;  4AK9 A;  4BJT A;  5KYY A;  3M1C B;  4BJ5 C;  5DS4 A;  2DYR C;  4KNV A;  1M2V A;  1S7Z A;  2W45 A;  4W8K A;  5T3T A;  1FNT c;  3UGP A;  1CGM E;  1GS9 A;  4MTG A;  3NRH A;  1YA9 A;  3ZWI A;  5KYY B;  4Q4Z F;  1CGO A;  3QVZ A;  1OW6 A;  4U5F E;  1M2V B;  2IXO A;  3SXZ A;  5T3W A;  1HW1 A;  1NSG B;  2H7V C;  4NY3 A;  1H9T A;  2KYH A;  4MW8 A;  1MND A;  3G4Z A;  3PMR A;  5COM A;  4WAB A;  1WAS A;  3EZI A;  3VRC A;  3SXM A;  2EIN C;  1GGQ A;  2XL6 A;  5A6B A;  4H4K C;  1LM3 B;  2D4U A;  4XPW A;  2BE5 F;  2XLW A;  3QVY A;  4JUR I;  1MMG A;  4NTB A;  2VC9 A;  3B0P A;  3L0I A;  3SNH A;  3LNM B;  5JS5 A;  1I5N A;  3LLI A;  3EPV A;  5BQI A;  1CPR A;  2Q3T A;  1R5I D;  3CSK A;  3GWN A;  3ABM C;  1NU9 C;  2EPN A;  2OJQ A;  4XEV A;  3AQB A;  4R32 A;  3EGD A;  1NBB A;  4N4W A;  3UNG C;  4ZLC A;  1RXQ A;  4MTF A;  2PNO A;  3L8I A;  5AGF A;  4MVS A;  3ASO C;  3M15 A;  3EGD B;  3UR3 C;  4KNW A;  4G0H A;  5A69 A;  1ZHT A;  2VB6 A;  1O3U A;  1R4T A;  3CAX A;  2CNW D;  2LSE A;  3S28 A;  1VTM P;  3DXJ F;  2VH3 A;  1VMA A;  2J8W A;  3BRJ A;  3VF0 A;  1ZHX A;  4IGG A;  1FAP B;  2J9W A;  2XLD A;  2YHS A;  4JRZ A;  3B29 A;  1ZYR F;  3ABK C;  1E85 A;  4YL1 A;  4JC7 A;  2CCY A;  4MTO A;  1U89 A;  3AJM A;  2ETS A;  3H2U A;  1A7D A;  3KKB A;  3L1M A;  3O10 A;  3I5P A;  4YT8 A;  4MVR A;  3JYH A;  3B71 A;  2HSB A;  4I1O B;  4LDK A;  4MND A;  1M56 C;  3ZTM A;  4A4A A;  1Y6D A;  4JZA A;  3ZDL A;  2Y3H A;  1O87 A;  1AUE A;  3K66 A;  1Z5Z A;  1F1M A;  1BR1 A;  2ICW G;  3C7J A;  4N06 A;  1BZ4 A;  3DWW A;  1G4U S;  3ZIB A;  2QY9 A;  4EBK A;  4HFF B;  1HMO A;  3ATP A;  1QLE C;  3R7C A;  1OW7 A;  4E17 A;  3QZC A;  5JT4 A;  4DXW A;  2OG2 A;  3AOU A;  2WVO A;  3IQT A;  3V5Z A;  4IAQ A;  4O6M A;  5L0F A;  4K0D A;  4DRI B;  5F5F A;  1U6H A;  4O7G A;  2HJM A;  2C03 A;  5L0C A;  1MMN A;  2PX3 A;  2WVN A;  1ZW2 A;  3LLK A;  3UMK A;  1HE1 A;  1T01 A;  1T9K A;  5BQG A;  4NQF A;  3V5Y A;  2IM8 A;  3TOL A;  4Z9I A;  1OCZ C;  1YVI A;  1T6I A;  4U5G A;  3HLZ A;  1WWP A;  1TWG A;  2WVQ A;  4GQH A;  4IJJ A;  5K0I A;  3T6B A;  1LI7 A;  1B68 A;  1ZHW A;  1QZX A;  3Q7L A;  4L6R A;  5L0J A;  3AG2 C;  5BQH A;  3W8I A;  5L3V A;  2I8B A;  3H2V A;  1OCR C;  3N2Z B;  2PF4 E;  5DVW A;  5FZT A;  3UMI A;  1E86 A;  3IQC A;  4HE8 D;  4OD5 A;  1WTY A;  2WZL A;  2I15 A;  1T6Q A;  2L6H A;  4CDY A;  1WAT A;  5B1A C;  1A0B A;  4JTC B;  3DD7 A;  2R7T A;  4P9T A;  2WB7 A;  2G3V A;  4G7H F;  3ECS A;  2QTV A;  4JEB A;  2IXP A;  1L7C A;  1Z3I X;  4G78 A;  4WGZ A;  5COF A;  5DQZ A;  4DJ9 A;  2PP4 A;  1FR0 A;  2JD3 A;  3WHN A;  1ZHY A;  3I5Q A;  2P7V A;  1D1B A;  5CI8 A;  1FMV A;  3E9V A;  3DJU B;  2P6V A;  4LLC A;  3EFO A;  2A0U A;  1G8X A;  2CYD A;  3K1I C;  3NG1 A;  4Q7C A;  3U8V A;  4EUK B;  3LNR A;  4CS7 A;  1KU2 A;  2R7V A;  2HFI A;  1BDJ B;  5KYN A;  1WGW A;  1U0B B;  1JAF A;  5D92 A;  4ER9 A;  1TFK B;  4BJ1 A;  3IHU A;  1H6G A;  1G5Z A;  4AE4 B;  4CS8 C;  4BEJ A;  2EIL C;  2YLG A;  1E2X A;  3U3B A;  2LQG A;  4FWV A;  3IEE A;  1YZA A;  2LD6 A;  3V5X A;  4IB4 A;  2EPK X;  3JZ0 A;  3QTH A;  2ZPA A;  4CJG A;  4OIP F;  3K6B A;  1SYQ A;  2CW0 F;  2YL0 A;  3AGU A;  3WAQ A;  2O9X A;  1TWA A;  1ZZP A;  3TUL A;  4U9E A;  1LS4 A;  1E83 A;  2L6G A;  2EIM C;  4PFO A;  4G7O F;  3HNL A;  2ZD9 A;  1YAR O;  3MLG A;  1JPN A;  1S05 A;  4EBJ A;  1APC A;  4QI2 A;  1IW7 F;  2X51 A;  3C18 A;  1MMA A;  4XEF A;  5EK0 A;  2EPL X;  2GFH A;  4OD4 A;  4XPX A;  4D4X A;  4DBR A;  4FAP B;  2H7O A;  5DQT A;  2KW3 C;  1NFO A;  4OIN F;  2L7A A;  4XLN F;  3U2L A;  3MYI A;  1FTS A;  4JEA A;  4JCH A;  3VYW A;  5A6B D;  1OKK A;  4U9D A;  2Y3D A;  4FES A;  5T1D B;  5L0H A;  1WOL A;  3A11 A;  3FOO A;  1LE2 A;  3NYL A;  2Q4F A;  4JIO A;  2H8A A;  4HFK B;  3RH3 A;  2XS1 A;  2YZS A;  4CX9 A;  5KYW A;  3EH2 A;  3SXY A;  3RVZ A;  5IY5 C;  4JE9 A;  3U5S A;  1JOG A;  4YL0 A;  4XTK A;  1D1A A;  2YKZ A;  3NMJ A;  5KYW B;  1D0Z A;  3IPM O;  3LES A;  3R2P A;  3S90 A;  4WGY A;  2HZ8 A;  4QDL A;  2XLH A;  1OR2 A;  2AWY A;  2HMZ A;  3ZVR A;  3HNJ A;  2Q7R A;  3B0V C;  3KL4 A;  5E2Q A;  5AC4 A;  5COG A;  3OEO A;  4CBE A;  3NDB B;  4FX5 A;  1TR2 A;  2OCC C;  4CS9 A;  1Q0D A;  5KYU A;  1RJ9 A;  1LI5 A;  1YJG A;  4U5E E;  1XZQ A;  3FVY A;  3QW1 A;  2M64 A;  3GOR A;  3OWT A;  4Z9H A;  2KGO A;  2LFF A;  3KYI A;  3RYL A;  1A41 A;  2DB4 A;  1RJ9 B;  2OQM A;  2PFD A;  3KMI A;  5JVE A;  1WN0 A;  2GA0 A;  3NKD A;  3Q6N A;  2X0C A;  1FMW A;  2GAQ A;  1K40 A;  3K1I A;  4NTA A;  3RKO F;  2NG1 A;  2A0B A;  2V26 A;  4OIQ F;  1OXK A;  3T4R A;  4B6I A;  1LS1 A;  5CIV A;  2ZXW C;  2L9J A;  3AG3 C;  2GDC A;  2YL1 A;  3SP1 A;  3U9M A;  4X0R A;  2IYL D;  1UFB A;  2A1D D;  4H54 A;  1V55 C;  4IAR A;  3TJ6 A;  1OW8 A;  5L0I A;  3HTK C;  4UDV A;  1PV3 A;  3LJB A;  1Z7Q c;  4MVO A;  4CS8 A;  3U8P A;  3C63 A;  2R7S A;  2IBF A;  4CDV A;  4JKV A;  1W2W A;  4OIR F;  4C3E A;  2LP4 A;  1I4Y A;  5A6A A;  1YLM A;  1LVK A;  5BUO A;  4JCZ A;  4EKW A;  2EIJ C;  4EHP A;  2BL2 A;  4C3D A;  3DM5 A;  4MS2 A;  2HMQ A;  3ZG1 A;  3PDM P;  5D91 A;  3SEO A;  4JTA B;  4YT2 A;  1EQ1 A;  2YWA A;  4ULV A;  2XL4 A;  1HMD A;  3DAG A;  3S9O A;  4BJ5 A;  1MNE A;  4CSA C;  1LIH A;  3M4C A;  1M57 C;  2QUP A;  4RBN A;  3KH2 A;  3DE9 A;  5E33 A;  2OEV A;  1TWH A;  2QNL A;  4GEH A;  4GYT A;  4CIP A;  4LER A;  2XLM A;  2A6E F;  2Q9C A;  5AC5 A;  2IXM A;  3WOD F;  2IOQ A;  4O79 A;  2XSE A;  5DS6 A;  1QQ3 A;  3V7O A;  4JTD B;  3EJN A;  3TQO A;  4A2N B;  1GM5 A;  4I1M A;  3U9J A;  2A69 F;  3EGX A;  2V3C C;  4CDA A;  1VOM A;  2HSQ A;  5B1B C;  1XZP A;  4F4B A;  1H7I A;  4I3M A;  3GEH A;  2QLA A;  3C8G A;  3RQE A;  3NYM A;  3GEE A;  4ZLD A;  2VCB A;  3HNI A;  5B3S C;  4DRJ B;  3F47 A;  1FFT C;  3C8G B;  3HNK A;  4P9F A;  4U5H A;  1C02 A;  2Z15 A;  4LDR A;  3Q7G A;  4U5C E;  3TJ5 A;  2AWC A;  3U3F A;  2J9B A;  2E87 A;  3JT1 A;  1M2O A;  1J8Y F;  2PBE A;  2XS8 A;  3QW0 A;  3RQF A;  2J0W A;  1DOW A;  2NUT A;  3TK0 A;  1RKE A;  2HKV A;  1SMY F;  1ZU4 A;  1K05 A;  5TJ5 E;  3BEH A;  4YT5 A;  3GM2 A;  1PD0 A;  3JCU Q;  1QKR A;  1RKE B;  1Y4C A;  2EPM X;  3DM9 B;  2WZF A;  1VYK A;  1NFN A;  2VAS A;  1NU7 D;  1XWJ A;  2NSG A;  3MFN A;  4MW3 A;  1VLT A;  4PFP A;  2IXN A;  4U5B E;  1ST6 A;  3B9Q A;  3U0C A;  3K1H A;  3AQC A;  4KC9 A;  3DZA A;  3ZSU A;  2XLO A;  1IZM A;  2YVK A;  4JJG A;  4CJO A;  1EA8 A;  2J9V A;  2YL7 A;  3EFO B;  3U2M A;  4N6C A;  1VLS A;  1CPQ A;  2J0X A;  3MX3 A;  2QE9 A;  1Q0M A;  3DAF A;  4W8P A;  2P0N A;  3K7D A;  2OKU A;  4MVU A;  1OCO C;  4PR9 A;  2AP3 A;  4RD9 A;  3SZR A;  2XLV A;  3M4B A;  1EI7 A;  2CDQ A;  1Q0K A;  1D1C A;  2YRF A;  3H65 A;  3W4Y A;  5KYX A;  2R7R A;  1HE9 A;  4K1O A;  4ONS A;  2W9Y A;  3LUT B;  3MYF A;  2R03 A;  4IAO A;  3A9C A;  1A7E A;  4XEK A;  4EWC A;  4BPM A;  4NC3 A;  5F5H A;  2XXA A;  1VYI A;  2L81 A;  2NPU A;  4CSA A;  3NYJ A;  4YWQ A;  2WL8 A;  2XXA B;  3EHN A;  3FXH A;  2Q9A A;  3FOP A;  3N24 A;  2L6F A;  1VB5 A;  3PCV A;  2R7O A;  1LPE A;  3S84 A;  3DI5 A;  2R7Q A;  4YJW A;  4Q5S F;  5B3I A;  1O5H A;  2HV7 A;  5CI9 A;  5L0G A;  5HSW A;  4PJL A;  1OKK D;  2M4E A;  4RDA A;  3O39 A;  2R7X A;  1JRA A;  2R9R B;  4K7B A;  3GAN A;  1RMV A;  3E70 C;  3W8H A;  2R05 A;  5JP7 A;  2B0J A;  5JRA A;  3LEV A;  1GQA A;  2A6H F;  3L8J A;  4YL3 A;  1C03 A;  2RSE B;  3J06 A;  2VCA A;  2J7P A;  2Y3G A;  1KTM A;  3DE8 A;  2AVK A;  4XPY A;  3TOM A;  4XLP F;  3ABL C;  4JVS A;  2YLD A;  1AEP A;  1A7V A;  4YN0 B;  5E3C A;  3O55 A;  4M63 A;  1LE4 A;  2OOC A;  5EGY A;  4DVZ A;  2XM0 A;  4XQ1 A;  2LCH A;  3C8Z A;  2OEX A;  3FMS A;  2FAP B;  2P61 A;  4IWB A;  1PD1 A;  3JYY A;  4AX2 A;  4PJN A;  1Z63 A;  3ASN C;  3GOD A;  2Y3B A;  3CEX A;  2OJE D;  2FGY A;  1I4Z A;  5KYU B;  1ZVZ A;  5FCL A;  2LK4 A;  2Q9B A;  1Q0F A;  3IQ6 A;  4DBQ A;  1JPJ A;  4Z9J A;  4O6Y A;  2BC5 A;  1D0Y A;  2LFD A;  3X1O A;  1UG7 A;  1K04 A;  3X2Q C;  3KPH A;  3ZTZ A;  3QMK A;  4I44 A;  2OU6 A;  2H7B A;  3F46 A;  3EHM A;  2TMV P;  3B0U X;  2Q00 A;  2A68 F;  1TWC A;  4YK5 A;  3WG7 C;  2R7U A;  1EKY A;  1FFH A;  5HV9 A;  1N1C A;  3SXK A;  3JTL O;  2YL3 A;  3T9O A;  1ORJ A;  3OA1 A;  3NMI A;  1L3P A;  3EG9 A;  2XM4 A;  4LAC B;  3DKA A;  1OXB A;  1DOV A;  1YYX A;  3MBG A;  2R02 A;  2FFH A;  3UMH A;  3CZ6 A;  3EG9 B;  1V54 C;  1QPU A;  4NTF A;  3ZQY A;  4E0I A;  5JUA A;  2Y39 A;  4J7T A;  2PX0 A;  2CNW A;  3EQL F;  4XWJ A;  2J46 A;  3IQ5 A;  4CIH A;  4OIO F;  3S27 A;  2MWQ A;  2HV6 A;  4BJ6 C;  3M79 A;  3N0T A;  4DVY P;  4E0H A;  4NCQ A;  3RQG A;  1YA7 O;  3O6X A;  2F22 A;  2Y69 C; 
#chains in the Genus database with same CATH homology
 3AJM A;  1JOG A;  1ZZP A;  3GM2 A;  3TUL A;  2Q00 A;  1UFB A;  2L6G A;  4NQF A;  1KTM A;  1OW8 A;  3O10 A;  3MFN A;  4XEK A;  1PV3 A;  3B71 A;  2HSB A;  1WWP A;  3U0C A;  4EBJ A;  1K05 A;  4XEV A;  2JX0 A;  1KNY A;  1OW6 A;  4R32 A;  3C18 A;  4XEF A;  3C8G D;  2KK1 A;  2L6F A;  3L8I A;  3C8G A;  3RQE A;  5F28 E;  3JYY A;  1WTY A;  4EBK A;  3GM3 A;  1O3U A;  3C8G B;  2YWA A;  3K7D A;  2L6H A;  3S9O A;  1OW7 A;  1WOL A;  1K40 A;  2LK4 A;  3GM1 A;  3U3F A;  3BRJ A;  1QVX A;  2PBE A;  3JZ0 A;  3RQF A;  3RQG A;  2JPU A;  3L8J A;  1K04 A;  1V4A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...