3GMBA

Crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
369
structure length
369
Chain Sequence
TRRAEVAGGGFAGLTAAIALKQNGWDVRLHEKSSELRAFGAGIYLWHNGLRVLEGLGALDDVLQGSHTPPTYETWMHNKSVSKETFNGLPWRIMTRSHLHDALVNRARALGVDISVNSEAVAADPVGRLTLQTGEVLEADLIVGADGVGSKVRDSIGFKQDRWVSKDGLIRLIVPRMKKELGHGEWDNTIDMWNFWPRVQRILYSPCNENELYLGLMAPAADPRGSSVPIDLEVWVEMFPFLEPCLIEAAKLKTARYDKYETTKLDSWTRGKVALVGDAAHAMCPALAQGAGCAMVNAFSLSQDLEEGSSVEDALVAWETRIRPITDRCQALSGDYAANRSLSKGNMFTPAALEAARYDPLRRVYSWPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
publication title Structure of the PLP degradative enzyme 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase from Mesorhizobium loti MAFF303099 and its mechanistic implications.
pubmed doi rcsb
source organism Mesorhizobium loti
molecule tags Oxidoreductase
total genus 106
structure length 369
sequence length 369
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01494 FAD_binding_3 FAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.50 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase; Chain A, domain 2 3gmbA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3gmbA01
3KA7A 4ECHA 4IA5A 2GB0A 3O0HA 2ARDA 2VVLA 2YLRA 3NG7X 5CKUA 2YQUA 4TM3A 3ALMA 4PABA 3AD7B 1N4VA 1E39A 3URHA 2BS4A 2YR4A 1VG0A 3GYIA 2WOVA 4H4SA 4H7UA 4A79A 1W4XA 3II4A 1Q9IA 2X8CA 4U8IA 3F8DA 4LA1A 4OPDA 1PBCA 2UZZA 3COXA 2VOUA 2DKHA 2ZZCA 5EB5A 1JRYA 5BULA 3Q6JA 4U2TA 1NG4A 1E1LA 2E5VA 4GUVA 2ZZBA 1FOHA 3NYCA 3FMWA 4H2QA 3SFDA 1GNDA 1YQ3A 1P2EA 1GRGA 4C3XA 4ADWA 1ZKQA 3EANA 3SQPA 2ACZA 2V6OA 3H8LA 3KVEA 4NEVA 4EMJA 1B8SA 3ATQA 4XWZA 3CPJG 5JCMA 4AP3A 4YTPA 3P4SA 2BA9A 1CC6A 2GMHA 2WDVA 3E1TA 4Z2UA 2Q7VA 4A5LA 4Z44A 3GMBA 1P2HA 1QLBA 4EM4A 4AT2A 2A87A 1VDCA 2A89A 3FBSA 4Z24A 1VG9A 2TMDA 2XLPA 2C7GA 4GDEA 4WX1A 2CVJA 2GAHB 2RABA 3NK0X 3NYFA 2IVDA 3GWDA 3UKKA 2DKIA 3BI2A 2X99A 3QSMA 3AE2A 2WOIA 3GRSA 3ICRA 1PXAA 2WPFA 4A6NB 5EB4A 4H4VA 2NVKX 2YVFA 4YTMA 4U8OA 2RGOA 4Y4MA 1Y0PA 3CGBA 4GR1A 4H4ZA 5EBKA 5HXIA 1ZOYA 1MOKA 3NHOX 5CQFA 1GRFA 2VZ2A 5HHFA 1KNPA 1TDKA 1E6EA 3VRBA 4Z26A 4B1BA 2BYBA 1H82A 1QO8A 4H4UA 1EL8A 2WQYA 2GH5A 1JNRA 3VR8A 1K4QA 2C73A 1CF3A 2WPEA 3GWFA 3CGDA 1TDFA 2Q6UA 2WDRA 1CBOA 3DGZA 2R0GA 4K8DA 4OPCA 4DSHA 2WEUA 3CNDA 3RNMA 1OJCA 2WP6A 1CHUA 4J31A 1JRZA 4JDRA 5HYMA 2B9XA 3UOXA 5M10A 3ALJA 1D4EA 4YWOA 3RHAA 2YM2A 1KNRA 4C3YA 4REKA 4BJZA 2XVFA 5GSNA 2GR0A 3NK1X 1PBEA 1N4UA 4EMIA 1GTHA 1PN0A 3KLJA 5U25A 3D8XA 1KSUA 1GRHA 2WS3A 3OC4A 1DXLA 3VR9A 4U8KA 4D03A 3UKPA 4J34A 1N1PA 1DJNA 2PYXA 2YLZA 3ZDNA 5BUKA 2JK6A 3G5QA 1O94A 2FBWA 2Y6QA 2OA1A 4KX6A 2YVJA 3ATRA 4UDRA 3LZWA 1KSSA 1LPFA 3B3RA 2Z5XA 3AE8A 2XCGA 1PHHA 3S5WA 3V3OA 3BNUA 3AD8B 1S3EA 2AQJA 1B4VA 1E7PA 4RG3A 1CJ3A 4U8MA 3KKJA 1EBDA 1XPQA 5J60A 2OLOA 3T37A 3AE6A 2Q0LA 1B37A 3CPIG 3KU9A 2GQFA 3PVCA 2IIDA 5KVIA 5KXJA 4Z43A 3KD9A 5U63A 4H4WA 4YTNA 2B76A 4B65A 2X8HA 5FS9A 1JU2A 3GD3A 2WESA 3S61A 1IJHA 1TRBA 3DMEA 2XYOA 4CY6A 1GETA 5J7XA 1BZLA 4EIQA 1ELIA 4GDPA 3GDNA 3I6DA 5KRQA 3PO7A 4YSYA 3QJ4A 3ALLA 4X9NA 5DBJA 5FMHA 4BV6A 4CCRA 2CFYA 2XLTA 4IVMB 4TM1A 2C67A 3HZLA 2JB2A 4P9SA 2XVEA 1XANA 3M0OA 4DGKA 1YKJA 1FL2A 4NEWA 3UTGA 4BURA 1LQTA 1BKWA 1OJTA 4UP3A 4J56A 3DGHA 2WU2A 1CC4A 2B7RA 1DOEA 2C75A 2YLSA 3EPTA 2C64A 3K7MX 3P4RA 1ZX9A 1KFYA 5GRTA 2YR6A 4J2WA 2XVHA 4OVIA 2BS2A 4JN9A 3UKAA 1DJQA 3GYJA 1L0VA 1ZOVA 1VRQB 2BXRA 2W0HA 5BRTA 2VVMA 1QJDA 3EAOA 4BJYA 3DJGX 3DK8A 3B6DA 1GEUA 1CJCA 2GEWA 4H4XA 3NIXA 1E1MA 4WCTA 1JEHA 4H50A 5JCLA 2NPXA 5FS8A 3P1WA 2BK5A 1NDAA 1GOSA 4LIIA 5KOXA 2ZBWA 3CNJA 3UOVA 4U8JA 4C77A 2BC1A 3AEGA 2Q0KA 5IQ4A 4UDPA 3I3LA 4HB9A 1FEBA 1EL7A 1K0JA 2EQ9A 2FJDA 1OJAA 1S2QA 1DNCA 3UKFA 1M64A 2C65A 1D7YA 4I58A 4JNQA 4NTEA 4I59A 4J57A 1H86A 3NKSA 4JNAA 1ONFA 4EIPA 3GRTA 4RG4A 1H7WA 2IVEA 4H4TA 3QSEA 4IVOB 1KDGA 2GR1A 3AE7A 1Q1WA 4AP1A 1IUTA 3CNPA 1BWCA 4IA6A 1MXTA 5FS7A 1EL9A 1PXCA 3F8RA 3NTAA 2CDUA 2H88A 4X4JA 1LVLA 2R9ZA 4XWRA 2I0ZA 2BK3A 2XVIA 1NHPA 3DJDA 4C74A 1S2YA 3QFBA 1F3PA 4GRTA 1COYA 1LV0A 4RSLA 3ZYXA 4OPUA 1F8RA 4YSHA 3GD4A 4FK1A 4TLXA 4H4QA 3G5RA 2R46A 4Z25A 3AE4A 1NHSA 1ZY8A 2APGA 4J33A 4U2SA 4BK3A 2EQ7A 1PJ6A 2QA1A 2X8GA 2OAMA 2QAEA 2R45A 1GSNA 2BS3A 4TLZA 3SFEA 4TM0A 3AYJA 4Y4LA 1D4CA 1IUUA 1NPXA 3LOVA 4HA6A 2GAGB 1CJ4A 4YKGA 4K7ZA 3L1RA 1F6MA 2F5ZA 1GALA 3SGLA 4K5SA 4D04A 4YSXA 3AEEA 4H2PA 3DH9A 4EMWA 1H7XA 2OALA 2HQMA 3PS9A 4H4PA 4GCMA 4ZN0A 1NG3A 1TDOA 3FIMB 2YAUA 4JY3A 2WBAA 2BC0A 3C4NA 3ICSA 1REOA 3P4PA 2V61A 3F8PA 2V3AA 1H84A 3L8KA 1S3BA 3P4QA 2R4EA 4JQ9A 3R9UA 3AE1A 2C76A 3H4KA 3NN6X 3UKLA 1BGNA 2YLTA 5BVAA 1MO9A 5KOWA 2YWLA 2XFNA 2AAQA 3VRDB 1NHQA 2VRMA 1RSGA 3GDPA 2BACA 1XHCA 2YM1A 1TDEA 4NTDA 3ICTA 2B7SA 2X50A 3H8IA 4B67A 2B9WA 4K22A 1CC2A 1DODA 1TDNA 1GXFA 2GR3A 1KF6A 1PJ7A 3BNMA 4B63A 3K30A 3RP8A 5LV9A 1PDHA 1EL5A 4K5RA 1TYPA 1GERA 2V5ZA 4AOXA 2J3NA 2R4JA 3UTFA 3AYLA 4UDQA 2YLXA 3WE0A 2WETA 2Y6RA 1DOCA 3AEFA 3VQRA 2EQ6A 1L9CA 5C3JA 1GT8A 4H4RA 1H83A 2WHDA 1PXBA 2C72A 2FJEA 4CCQA 2YG3A 4OPTA 2WDQA 3M13A 2E1MA 1H81A 1D4DA 1YQ4A 3AEBA 3Q9TA 1NENA 2XLUA 2YVGA 3IHMA 1YQZA 4BK2A 3NNEA 2V60A 2VVLG 5JCKA 5JCNA 3AEAA 4FX9A 3K7QX 1E1KA 2PHHA 3NH3X 2BABA 2XVJA 3P9UA 1Y56B 4H4YA 2XLRA 3NLCA 3C96A 3NN0X 3UCLA 4EQRA 5L46A 3UKQA 1CJ2A 2C70A 4LU6A 1N4WA 2H89A 1IUXA 4CRTA 4APNA 1BF3A 4EQSA 4BK1A 2AR8A 2JKCA 1X31B 1F8WA 4Z2TA 1GRBA 3DK9A 3ISHA 2ZZ0A 3RP7A 3UKHA 2VQBA 1GTEA 3CGCA 4IV9A 2TPRA 4USQA 4B68A 3NYEA 4FDCB 4EQXA 3UP5A 2R0CA 3UOZA 1L9EA 4OPGA 3CTYA 4Z2RA 4C5OA 2XFPA 3UTEA 3AE5A 2R0PA 2GF3A 4U8LA 2XFQA 1Q1RA 5EOWA 3KPFA 3DK4A 2GMJA 4A99A 3FG2P 1Y56A 2EQ8A 2C66A 5IPYA 2JBVA 2GVCA 1NEKA 2B9YA 1JRXA 1CL0A 3AXBA 3UTHA 2CULA 4O5UA 4AT0A 1GESA 2BK4A 5U1OA 3UOYA 1FCDA 3QFAA 4O5QA 4AOSA 3OZ2A 2GRTA 2XFOA 4YXDA 2YR5A 1ZK7A 1PJ5A 3AECA 3QVRA 4ZCCA 4N9XA 1D7LA 3IHGA 2QCUA 1BGJA 1RP0A 3V3NA 1GRTA 4U8NA 4JY2A 1IUWA 1PBFA 1OJDA 3GMCA 1NHRA 2BCGG 2E4GA 2V3BA 3NK2X 3AE9A 4MJWA 4OPLA 2JB1A 1M6IA 3NT6A 4X9MA 3AD9B 3UP4A 1D5TA 3M12A 4NTCA 2WP9A 2C3DA 5IQ1A 4FK1C 1TYTA 1HYUA 2JAEA 3C4AA 3DJEA 2Z5YA 5C2TA 4U2LA 3G5SA 3BHFA 3AEDA 4ZCDA 4E0VA 4OPIA 4H2RA 1SEZA 4A7AA 1PBDA 4Y4NA 3QSSA 1DOBA 1LJ1A 1B5QA 1GV4A 3AE3A 3CNTA 3NTDA 4H2NA 4OCGA 5KWFA 4GF7A 1VQWA 3LJPA 1LTXR 2QA2A 1IUVA 1YY5A 2GQWA 2RGHA 1GPEA 2XDOA 2C3CA 2YLWA 3IWAA 4ICYA 1FEAA 1JNZA 3ITJA 5M0ZA 2WU5A 4M52A 3BI5A 4YT0A 4EM3A 4NZHA 3AYIA 1K0LA 3LXDA 3V76A 1ZP0A 4CNKA 1H6VA 2YG5A 2A8XA 2FJAA 4J36A 2YG4A 4USRA 3VRAA 4XXGA 4A6NA 5KVHA 3LZXA 4B69A 1V59A 2VQ7A 1OJ9A 3JSKA 1AOGA 4KPRA 3ABVA 4K2XA 1LQUA 1O5WA 1XDIA 1ZMDA 2BCPA 4EQWA 1E1NA 3CGEA 1RYIA 2XFUA 3BHKA 3CPHG 3AWIA 1NAAA 3GSIA 5ER0A 4A9WA 3ADAB 2JB3A 2O9ZA 4DSGA 4YSZA 2XLSA 1ZMCA 1UKVG 3NRNA 2RGJA 4B64A 3CNSA 2YG6A 3REDA 2BXSA 4PAAA 1O95A 3CIRA 1K0IA 5FS6A 2OLNA 1ZDLA 1L9DA 4DNAA 3DA1A 4CNJA 2VRLA 3AB1A 5JCIA 3BI4A 3SM8A 2WPCA 3RP6A 3LB8A 2GV8A 3EF6A 2WOWA 4U8PA 4A65A 3K7TA 4YKFA 3DJJA 1IUSA 2GR2A 2WP5A 4TM4A 4CBQA 3FPZA 3NGCX 3LADA 3QVPA 3D1CA 1PBBA 1Z6LA 2YG7A 1PS9A 1F8SA 4B66A 5TR3A 3CN8A 3IF9A 5HY5A 1GREA 2FJBA 4CY8A 3IC9A 2X3NA 1JOAA 1GRAA 1FECA
chains in the Genus database with same CATH superfamily
3KA7A 4ECHA 4IA5A 2GB0A 3O0HA 2ARDA 2VVLA 2YLRA 3NG7X 5CKUA 2YQUA 4TM3A 3ALMA 4PABA 3AD7B 1N4VA 1E39A 3URHA 2BS4A 2YR4A 1VG0A 3T2YA 3GYXA 3GYIA 2WOVA 4H4SA 4H7UA 4A79A 1W4XA 3II4A 1EVIA 1Q9IA 2X8CA 3F8DA 4U8IA 4YJDA 4LA1A 1PBCA 2UZZA 4OPDA 3COXA 2VOUA 2DKHA 2ZZCA 5EB5A 1JRYA 5BULA 3Q6JA 4U2TA 1NG4A 1E1LA 2E5VA 4GUVA 2ZZBA 1FOHA 3NYCA 3FMWA 4H2QA 3SFDA 1GNDA 1YQ3A 1P2EA 1GRGA 4C3XA 4ADWA 1ZKQA 3EANA 3SQPA 2ACZA 2V6OA 3H8LA 3KVEA 4NEVA 4EMJA 1B8SA 4XWZA 3ATQA 3CPJG 5JCMA 4AP3A 4YTPA 3P4SA 2BA9A 1CC6A 2GMHA 2WDVA 3E1TA 4Z2UA 2Q7VA 4A5LA 4Z44A 3GMBA 1P2HA 1QLBA 4EM4A 4AT2A 3HYVA 2A89A 1VDCA 2A87A 3FBSA 4Z24A 1VG9A 2TMDA 2XLPA 2C7GA 4GDEA 4WX1A 2CVJA 2GAHB 2RABA 3NK0X 3NYFA 2IVDA 3GWDA 3UKKA 2DKIA 3BI2A 2X99A 3ZNQA 3QSMA 3AE2A 2WOIA 3GRSA 3ICRA 1PXAA 2WPFA 3T31A 5EB4A 4A6NB 4H4VA 2NVKX 2YVFA 4YTMA 4U8OA 2RGOA 4Y4MA 3T2KA 1Y0PA 3CGBA 4GR1A 4H4ZA 5EBKA 5HXIA 1DDOA 1ZOYA 1MOKA 3NHOX 5CQFA 1GRFA 2VZ2A 5HHFA 1KNPA 1TDKA 1E6EA 5KMQA 3VRBA 4G9KA 4B1BA 2BYBA 1H82A 1QO8A 4H4UA 1EL8A 2WQYA 2GH5A 1JNRA 3VR8A 1K4QA 2C73A 1CF3A 2WPEA 3GWFA 3CGDA 1TDFA 2Q6UA 2WDRA 1CBOA 3DGZA 2R0GA 4K8DA 4OPCA 4DSHA 2WEUA 3CNDA 3RNMA 1OJCA 2WP6A 1CHUA 4J31A 5HYMA 1JRZA 4JDRA 4QFCA 2B9XA 3UOXA 5M10A 3ALJA 1D4EA 4YWOA 4NWZA 3RHAA 2YM2A 1KNRA 4C3YA 4REKA 4BJZA 2XVFA 5GSNA 2GR0A 3NK1X 1PBEA 1N4UA 3T0KA 1PN0A 1GTHA 3KLJA 4EMIA 5U25A 3D8XA 1KSUA 1GRHA 3W4IA 2WS3A 1DXLA 3OC4A 4U8KA 3VR9A 3UKPA 4J34A 1N1PA 1DJNA 2PYXA 2YLZA 3ZDNA 5BUKA 2JK6A 3G5QA 1O94A 2FBWA 2Y6QA 2OA1A 4KX6A 3SYIA 1C0LA 2YVJA 3ATRA 4UDRA 3LZWA 1KSSA 1LPFA 3B3RA 2Z5XA 3AE8A 2XCGA 1PHHA 3S5WA 3V3OA 3BNUA 3AD8B 1S3EA 2AQJA 2E48A 1B4VA 4YJHB 1E7PA 4RG3A 1CJ3A 4U8MA 3KKJA 1EBDA 1XPQA 5J60A 2OLOA 3T37A 3AE6A 2Q0LA 1B37A 3CPIG 3KU9A 2GQFA 3PVCA 3W4JA 2IIDA 5KVIA 5KXJA 3G3EA 3KD9A 5U63A 4H4WA 4YTNA 2B76A 4B65A 4Z43A 2X8HA 5FS9A 1JU2A 3GD3A 2WESA 3S61A 2DU8A 3DMEA 1IJHA 1TRBA 4NNJA 2XYOA 4CY6A 1GETA 5J7XA 1BZLA 1ELIA 4EIQA 4GDPA 3GDNA 3I6DA 5KRQA 3PO7A 4YSYA 3QJ4A 3ALLA 4X9NA 5DBJA 5FMHA 4BV6A 4CCRA 2CFYA 2XLTA 4IVMB 4TM1A 3HZLA 2C67A 2JB2A 4P9SA 4YJHA 2XVEA 1XANA 3M0OA 4DGKA 1YKJA 1FL2A 4NEWA 3UTGA 4BURA 1LQTA 1BKWA 4G6HA 1OJTA 4UP3A 4J56A 3ZNPA 3DGHA 2WU2A 1CC4A 3SY4A 2B7RA 1DOEA 2C75A 2YLSA 3EPTA 4GAPA 2C64A 4YJGB 3K7MX 3P4RA 1ZX9A 1KFYA 5GRTA 2YR6A 4J2WA 2XVHA 4OVIA 2BS2A 4JN9A 3UKAA 2E4AA 1DJQA 3GYJA 1L0VA 1ZOVA 1VRQB 2BXRA 2W0HA 5BRTA 2VVMA 1QJDA 4BJYA 3EAOA 3ZNNA 5KNLA 3DJGX 3DK8A 3B6DA 3T14A 1GEUA 1CJCA 2GEWA 4H4XA 3NIXA 4WCTA 1E1MA 3W4KA 1JEHA 4H50A 5JCLA 2NPXA 5FS8A 3P1WA 2BK5A 1NDAA 1GOSA 4LIIA 5KOXA 2ZBWA 3CNJA 3UOVA 4U8JA 4C77A 2BC1A 3AEGA 2Q0KA 5IQ4A 4UDPA 3I3LA 4HB9A 1K0JA 1EL7A 1FEBA 2C4CA 2EQ9A 2FJDA 1OJAA 1S2QA 1DNCA 3UKFA 4YJGA 1M64A 2C65A 3CMMA 1D7YA 4I58A 4JNQA 4NTEA 2BRYA 4I59A 1H86A 2BRAA 3NKSA 4J57A 4JNAA 1ONFA 4EIPA 3GRTA 4RG4A 1H7WA 2IVEA 4H4TA 3QSEA 4IVOB 1KDGA 2GR1A 3AE7A 3SXIA 1Q1WA 4AP1A 1IUTA 3CNPA 1BWCA 4IA6A 1MXTA 5FS7A 1EL9A 1PXCA 3F8RA 3NTAA 2CDUA 2H88A 4X4JA 1LVLA 2R9ZA 4XWRA 2I0ZA 2BK3A 2XVIA 1NHPA 3DJDA 4C74A 1S2YA 3QFBA 1F3PA 4GRTA 4RSLA 1COYA 4YSHA 1LV0A 4OPUA 1F8RA 3ZYXA 3GD4A 4FK1A 4TLXA 4H4QA 5KMSA 3G5RA 2R46A 4Z25A 3AE4A 1NHSA 1ZY8A 2APGA 4J33A 4U2SA 4BK3A 2EQ7A 1PJ6A 2QA1A 2X8GA 2OAMA 2QAEA 1C0KA 2R45A 1GSNA 2BS3A 4TLZA 3SFEA 4TM0A 3AYJA 3SZWA 4Y4LA 1D4CA 4D03A 1IUUA 1NPXA 3LOVA 4HA6A 2GAGB 1CJ4A 4YKGA 4K7ZA 3L1RA 1F6MA 2F5ZA 1GALA 3SGLA 4K5SA 4D04A 4YSXA 3SX6A 3AEEA 4H2PA 3DH9A 4EMWA 1H7XA 2OALA 3PS9A 2HQMA 4H4PA 4GCMA 4ZN0A 1NG3A 1TDOA 3FIMB 3T2ZA 2YAUA 3C4NA 4JY3A 2BC0A 2WBAA 3ICSA 1REOA 3P4PA 2V61A 3F8PA 2V3AA 1H84A 4YJFB 1S3BA 3L8KA 3P4QA 2R4EA 4JQ9A 3R9UA 4G74A 3AE1A 2C76A 3H4KA 3NN6X 3UKLA 1BGNA 2YLTA 5BVAA 1MO9A 5KOWA 2YWLA 2XFNA 2AAQA 3VRDB 1NHQA 2VRMA 1RSGA 3GDPA 2BACA 1XHCA 2YM1A 1TDEA 4NTDA 4G6GA 3ICTA 2B7SA 2X50A 3H8IA 4B67A 2B9WA 4K22A 1CC2A 1DODA 1TDNA 1GXFA 2GR3A 1KF6A 1PJ7A 3BNMA 4B63A 3K30A 3RP8A 5LV9A 1PDHA 1EL5A 4K5RA 1TYPA 1GERA 2V5ZA 4AOXA 2J3NA 2R4JA 3UTFA 3AYLA 4UDQA 2YLXA 1C0PA 2WETA 2Y6RA 1DOCA 3AEFA 3VQRA 4YJFA 2EQ6A 3WE0A 1L9CA 5KMRA 5C3JA 1GT8A 4G73A 1H83A 2WHDA 4H4RA 1PXBA 2C72A 2FJEA 4CCQA 2YG3A 4OPTA 2WDQA 3M13A 2E1MA 1H81A 1D4DA 1YQ4A 3AEBA 3Q9TA 1NENA 2XLUA 2YVGA 3IHMA 1YQZA 4BK2A 3NNEA 2V60A 2VVLG 5JCKA 4QFDA 5JCNA 3AEAA 1DAOA 4FX9A 3K7QX 1E1KA 2PHHA 3NH3X 2BABA 2XVJA 3P9UA 1Y56B 3HYXA 4H4YA 2XLRA 5L46A 3C96A 3NN0X 3NLCA 3UCLA 4II3A 4EQRA 3UKQA 1CJ2A 2C70A 4LU6A 1AN9A 1N4WA 2H89A 1IUXA 4CRTA 4APNA 1BF3A 3ZNOA 4BK1A 4EQSA 2AR8A 2JKCA 1X31B 1F8WA 3SZ0A 1GRBA 4Z2TA 3DK9A 3ISHA 2ZZ0A 3RP7A 3UKHA 2VQBA 1GTEA 3CGCA 4IV9A 2TPRA 4USQA 4B68A 3NYEA 3SZFA 4FDCB 4EQXA 3UP5A 2R0CA 3UOZA 1L9EA 4OPGA 3CTYA 4Z2RA 4C5OA 2XFPA 3UTEA 2E49A 3AE5A 2R0PA 2GF3A 4U8LA 2XFQA 1Q1RA 5EOWA 3KPFA 3DK4A 2GMJA 4A99A 3FG2P 1Y56A 2EQ8A 2E82A 2C66A 5IPYA 2JBVA 2GVCA 1NEKA 1JRXA 1CL0A 3AXBA 2B9YA 3UTHA 2CULA 4O5UA 4AT0A 1GESA 2BK4A 5U1OA 3UOYA 1FCDA 3QFAA 4O5QA 4AOSA 3OZ2A 2GRTA 2XFOA 4YXDA 2YR5A 1ZK7A 1PJ5A 3AECA 3QVRA 4ZCCA 4N9XA 1D7LA 3IHGA 2QCUA 1BGJA 1RP0A 3V3NA 1GRTA 4U8NA 1IUWA 1PBFA 4JY2A 1OJDA 3GMCA 1NHRA 2BCGG 2E4GA 2V3BA 3NK2X 3AE9A 4MJWA 4OPLA 2JB1A 1M6IA 3NT6A 4X9MA 3AD9B 3UP4A 3M12A 1D5TA 4NTCA 3SZCA 2WP9A 2C3DA 5IQ1A 4FK1C 1TYTA 1HYUA 3C4AA 2JAEA 3DJEA 2Z5YA 5C2TA 4U2LA 3G5SA 4GAVA 3BHFA 3AEDA 4ZCDA 4E0VA 4OPIA 4H2RA 1SEZA 4A7AA 1PBDA 4Y4NA 3QSSA 1DOBA 1LJ1A 1B5QA 1GV4A 3AE3A 3CNTA 3NTDA 4H2NA 4OCGA 5KWFA 4GF7A 1VQWA 3LJPA 1LTXR 2QA2A 1IUVA 2RGHA 3WGTA 1YY5A 1GPEA 2GQWA 2C3CA 2XDOA 2YLWA 3IWAA 4ICYA 1FEAA 1JNZA 3ITJA 5M0ZA 2WU5A 3KPKA 4M52A 3BI5A 4YT0A 4EM3A 4NZHA 3AYIA 1K0LA 3LXDA 3V76A 1ZP0A 4CNKA 1H6VA 2YG5A 2A8XA 2FJAA 4J36A 2YG4A 4USRA 3VRAA 4XXGA 4A6NA 5KVHA 3LZXA 4B69A 1VE9A 1V59A 1OJ9A 2VQ7A 3JSKA 4KPRA 1AOGA 3ABVA 4K2XA 1LQUA 1O5WA 1XDIA 1ZMDA 2BCPA 4EQWA 1E1NA 3CGEA 1RYIA 3BHKA 2XFUA 3CPHG 3AWIA 1NAAA 3GSIA 5ER0A 4A9WA 3ADAB 2JB3A 2O9ZA 4DSGA 4YSZA 2XLSA 1ZMCA 4Z26A 1UKVG 3NRNA 2RGJA 4B64A 3CNSA 2YG6A 3REDA 2BXSA 4II2A 4PAAA 1O95A 3CIRA 1K0IA 5FS6A 1C0IA 2OLNA 1ZDLA 1L9DA 4DNAA 3DA1A 4CNJA 2VRLA 3AB1A 5JCIA 3BI4A 3SM8A 3RP6A 2WPCA 3LB8A 2GV8A 3EF6A 3HYWA 2WOWA 4U8PA 4A65A 3K7TA 4YKFA 3DJJA 1IUSA 2GR2A 2WP5A 4TM4A 4CBQA 3FPZA 3NGCX 3CUKA 3LADA 1KIFA 3QVPA 3D1CA 1PBBA 1Z6LA 2YG7A 1PS9A 1F8SA 4B66A 5TR3A 3CN8A 3IF9A 5HY5A 5KMPA 1GREA 2FJBA 4CY8A 3IC9A 2X3NA 1JOAA 1GRAA 1FECA
chains in the Genus database with same CATH topology
3KA7A 4ECHA 4IA5A 2GB0A 3O0HA 2ARDA 2VVLA 2YLRA 3NG7X 5CKUA 2YQUA 4TM3A 3ALMA 4PABA 3AD7B 1N4VA 1E39A 3URHA 2BS4A 2YR4A 1VG0A 3T2YA 3GYXA 3GYIA 2WOVA 4H4SA 4H7UA 4A79A 1W4XA 3II4A 1Q9IA 2X8CA 4U8IA 3F8DA 4LA1A 4OPDA 1PBCA 2UZZA 3COXA 2VOUA 2DKHA 2ZZCA 5EB5A 1JRYA 5BULA 3Q6JA 4U2TA 1NG4A 1E1LA 2E5VA 4GUVA 2ZZBA 1FOHA 3NYCA 3FMWA 4H2QA 3SFDA 1GNDA 1YQ3A 1P2EA 1GRGA 4C3XA 4ADWA 1ZKQA 3EANA 3SQPA 2ACZA 2V6OA 3H8LA 3KVEA 4NEVA 4EMJA 1B8SA 3ATQA 4XWZA 3CPJG 5JCMA 4AP3A 4YTPA 3P4SA 2BA9A 1CC6A 2GMHA 2WDVA 3E1TA 4Z2UA 2Q7VA 4A5LA 4Z44A 3GMBA 1P2HA 1QLBA 4EM4A 4AT2A 3HYVA 2A87A 1VDCA 2A89A 3FBSA 4Z24A 1VG9A 2TMDA 2XLPA 2C7GA 4GDEA 4WX1A 2CVJA 2GAHB 2RABA 3NK0X 3NYFA 2IVDA 3GWDA 3UKKA 2DKIA 3BI2A 2X99A 3QSMA 3AE2A 2WOIA 3GRSA 3ICRA 1PXAA 2WPFA 3T31A 5EB4A 4A6NB 4H4VA 2NVKX 2YVFA 4YTMA 4U8OA 2RGOA 4Y4MA 3T2KA 1Y0PA 3CGBA 4GR1A 4H4ZA 5EBKA 5HXIA 1ZOYA 1MOKA 3NHOX 5CQFA 1GRFA 2VZ2A 5HHFA 1KNPA 1TDKA 1E6EA 5KMQA 3VRBA 4G9KA 4B1BA 2BYBA 1H82A 1QO8A 4H4UA 1EL8A 2WQYA 2GH5A 1JNRA 3VR8A 1K4QA 2C73A 1CF3A 2WPEA 3GWFA 3CGDA 1TDFA 2Q6UA 2WDRA 1CBOA 3DGZA 2R0GA 4K8DA 4OPCA 4DSHA 2WEUA 3CNDA 3RNMA 1OJCA 2WP6A 1CHUA 4J31A 5HYMA 1JRZA 4JDRA 2B9XA 3UOXA 5M10A 3ALJA 1D4EA 4YWOA 4NWZA 3RHAA 2YM2A 1KNRA 4C3YA 4REKA 4BJZA 2XVFA 5GSNA 2GR0A 3NK1X 1PBEA 1N4UA 3T0KA 1GTHA 1PN0A 3KLJA 4EMIA 5U25A 3D8XA 1KSUA 1GRHA 2WS3A 3OC4A 1DXLA 3VR9A 4U8KA 4D03A 3UKPA 4J34A 1N1PA 1DJNA 2PYXA 2YLZA 3ZDNA 5BUKA 2JK6A 3G5QA 1O94A 2FBWA 2Y6QA 2OA1A 4KX6A 3SYIA 2YVJA 3ATRA 4UDRA 3LZWA 1KSSA 1LPFA 3B3RA 2Z5XA 3AE8A 2XCGA 1PHHA 3S5WA 3V3OA 3BNUA 3AD8B 1S3EA 2AQJA 1B4VA 1E7PA 4RG3A 1CJ3A 4U8MA 3KKJA 1EBDA 1XPQA 5J60A 2OLOA 3T37A 3AE6A 2Q0LA 1B37A 3CPIG 3KU9A 2GQFA 3PVCA 2IIDA 5KVIA 5KXJA 4Z43A 3KD9A 5U63A 4H4WA 4YTNA 2B76A 4B65A 2X8HA 5FS9A 1JU2A 3GD3A 2WESA 3S61A 1IJHA 1TRBA 3DMEA 4NNJA 2XYOA 4CY6A 1GETA 5J7XA 1BZLA 4EIQA 1ELIA 4GDPA 3GDNA 3I6DA 5KRQA 3PO7A 4YSYA 3QJ4A 3ALLA 4X9NA 5DBJA 5FMHA 4BV6A 4CCRA 2CFYA 2XLTA 4IVMB 4TM1A 2C67A 3HZLA 2JB2A 4P9SA 2XVEA 1XANA 3M0OA 4DGKA 1YKJA 1FL2A 4NEWA 3UTGA 4BURA 1LQTA 1BKWA 4G6HA 1OJTA 4UP3A 4J56A 3DGHA 2WU2A 1CC4A 3SY4A 2B7RA 1DOEA 2C75A 2YLSA 3EPTA 4GAPA 2C64A 3K7MX 3P4RA 1ZX9A 1KFYA 5GRTA 2YR6A 4J2WA 2XVHA 4OVIA 2BS2A 4JN9A 3UKAA 1DJQA 3GYJA 1L0VA 1ZOVA 1VRQB 2BXRA 2W0HA 5BRTA 2VVMA 1QJDA 4BJYA 3EAOA 5KNLA 3DJGX 3DK8A 3B6DA 3T14A 1GEUA 1CJCA 2GEWA 4H4XA 3NIXA 1E1MA 4WCTA 1JEHA 4H50A 5JCLA 2NPXA 5FS8A 3P1WA 2BK5A 1NDAA 1GOSA 4LIIA 5KOXA 2ZBWA 3CNJA 3UOVA 4U8JA 4C77A 2BC1A 3AEGA 2Q0KA 5IQ4A 4UDPA 3I3LA 4HB9A 1FEBA 1EL7A 1K0JA 2C4CA 2EQ9A 2FJDA 1OJAA 1S2QA 1DNCA 3UKFA 3CMMA 1M64A 2C65A 1D7YA 4I58A 4JNQA 4NTEA 2BRYA 4I59A 1H86A 2BRAA 3NKSA 4J57A 4JNAA 1ONFA 4EIPA 3GRTA 4RG4A 1H7WA 2IVEA 4H4TA 3QSEA 4IVOB 1KDGA 2GR1A 3AE7A 3SXIA 1Q1WA 4AP1A 1IUTA 3CNPA 1BWCA 4IA6A 1MXTA 5FS7A 1EL9A 1PXCA 3F8RA 3NTAA 2CDUA 2H88A 4X4JA 1LVLA 2R9ZA 4XWRA 2I0ZA 2BK3A 2XVIA 1NHPA 3DJDA 4C74A 1S2YA 3QFBA 1F3PA 4GRTA 1COYA 1LV0A 4RSLA 3ZYXA 4OPUA 1F8RA 4YSHA 3GD4A 4FK1A 4TLXA 4H4QA 5KMSA 3G5RA 2R46A 4Z25A 3AE4A 1NHSA 1ZY8A 2APGA 4J33A 4U2SA 4BK3A 2EQ7A 1PJ6A 2QA1A 2X8GA 2OAMA 2QAEA 2R45A 1GSNA 2BS3A 4TLZA 3SFEA 4TM0A 3AYJA 3SZWA 4Y4LA 1D4CA 1IUUA 1NPXA 3LOVA 4HA6A 2GAGB 1CJ4A 4YKGA 4K7ZA 3L1RA 1F6MA 2F5ZA 1GALA 3SGLA 4K5SA 4D04A 4YSXA 3SX6A 3AEEA 4H2PA 3DH9A 4EMWA 1H7XA 2OALA 2HQMA 3PS9A 4H4PA 4GCMA 4ZN0A 1NG3A 1TDOA 3FIMB 3T2ZA 2YAUA 4JY3A 2WBAA 2BC0A 3C4NA 3ICSA 1REOA 3P4PA 2V61A 3F8PA 2V3AA 1H84A 3L8KA 1S3BA 3P4QA 2R4EA 4JQ9A 3R9UA 4G74A 3AE1A 2C76A 3H4KA 3NN6X 3UKLA 1BGNA 2YLTA 5BVAA 1MO9A 5KOWA 2YWLA 2XFNA 2AAQA 3VRDB 1NHQA 2VRMA 1RSGA 3GDPA 2BACA 1XHCA 2YM1A 1TDEA 4NTDA 4G6GA 3ICTA 2B7SA 2X50A 3H8IA 4B67A 2B9WA 4K22A 1CC2A 1DODA 1TDNA 1GXFA 2GR3A 1KF6A 1PJ7A 3BNMA 4B63A 3K30A 3RP8A 5LV9A 1PDHA 1EL5A 4K5RA 1TYPA 1GERA 2V5ZA 4AOXA 2J3NA 2R4JA 3UTFA 3AYLA 4UDQA 2YLXA 3WE0A 2WETA 2Y6RA 1DOCA 3AEFA 3VQRA 2EQ6A 1L9CA 5KMRA 5C3JA 1GT8A 4G73A 1H83A 2WHDA 4H4RA 1PXBA 2C72A 2FJEA 4CCQA 2YG3A 4OPTA 2WDQA 3M13A 2E1MA 1H81A 1D4DA 1YQ4A 3AEBA 3Q9TA 1NENA 2XLUA 2YVGA 3IHMA 1YQZA 4BK2A 3NNEA 2V60A 2VVLG 5JCKA 5JCNA 3AEAA 4FX9A 3K7QX 1E1KA 2PHHA 3NH3X 2BABA 2XVJA 3P9UA 1Y56B 3HYXA 4H4YA 2XLRA 3NLCA 3C96A 3NN0X 3UCLA 4EQRA 4II3A 5L46A 3UKQA 1CJ2A 2C70A 4LU6A 1N4WA 2H89A 1IUXA 4CRTA 4APNA 1BF3A 4EQSA 4BK1A 2AR8A 2JKCA 1X31B 1F8WA 3SZ0A 1GRBA 4Z2TA 3DK9A 3ISHA 2ZZ0A 3RP7A 3UKHA 2VQBA 1GTEA 3CGCA 4IV9A 2TPRA 4USQA 4B68A 3NYEA 3SZFA 4FDCB 4EQXA 3UP5A 2R0CA 3UOZA 1L9EA 4OPGA 3CTYA 4Z2RA 4C5OA 2XFPA 3UTEA 3AE5A 2R0PA 2GF3A 4U8LA 2XFQA 1Q1RA 5EOWA 3KPFA 3DK4A 2GMJA 4A99A 3FG2P 1Y56A 2EQ8A 2C66A 5IPYA 2JBVA 2GVCA 1NEKA 2B9YA 1JRXA 1CL0A 3AXBA 3UTHA 2CULA 4O5UA 4AT0A 1GESA 2BK4A 5U1OA 3UOYA 1FCDA 3QFAA 4O5QA 4AOSA 3OZ2A 2GRTA 2XFOA 4YXDA 2YR5A 1ZK7A 1PJ5A 3AECA 3QVRA 4ZCCA 4N9XA 1D7LA 3IHGA 2QCUA 1BGJA 1RP0A 3V3NA 1GRTA 4U8NA 4JY2A 1IUWA 1PBFA 1OJDA 3GMCA 1NHRA 2BCGG 2E4GA 2V3BA 3NK2X 3AE9A 4MJWA 4OPLA 2JB1A 1M6IA 3NT6A 4X9MA 3AD9B 3UP4A 1D5TA 3M12A 4NTCA 3SZCA 2WP9A 2C3DA 5IQ1A 4FK1C 1TYTA 1HYUA 3C4AA 2JAEA 3DJEA 2Z5YA 5C2TA 4U2LA 3G5SA 4GAVA 3BHFA 3AEDA 4ZCDA 4E0VA 4OPIA 4H2RA 1SEZA 4A7AA 1PBDA 4Y4NA 3QSSA 1DOBA 1LJ1A 1B5QA 1GV4A 3AE3A 3CNTA 3NTDA 4H2NA 4OCGA 5KWFA 4GF7A 1VQWA 3LJPA 1LTXR 2QA2A 1IUVA 1YY5A 2GQWA 2RGHA 1GPEA 2XDOA 2C3CA 2YLWA 3IWAA 4ICYA 1FEAA 1JNZA 3ITJA 5M0ZA 2WU5A 3KPKA 4M52A 3BI5A 4YT0A 4EM3A 4NZHA 3AYIA 1K0LA 3LXDA 3V76A 1ZP0A 4CNKA 1H6VA 2YG5A 2A8XA 2FJAA 4J36A 2YG4A 4USRA 3VRAA 4XXGA 4A6NA 5KVHA 3LZXA 4B69A 1V59A 2VQ7A 1OJ9A 3JSKA 1AOGA 4KPRA 3ABVA 4K2XA 1LQUA 1O5WA 1XDIA 1ZMDA 2BCPA 4EQWA 1E1NA 3CGEA 1RYIA 2XFUA 3BHKA 3CPHG 3AWIA 1NAAA 3GSIA 5ER0A 4A9WA 3ADAB 2JB3A 2O9ZA 4DSGA 4YSZA 2XLSA 1ZMCA 4Z26A 1UKVG 3NRNA 2RGJA 4B64A 3CNSA 2YG6A 3REDA 2BXSA 4II2A 4PAAA 1O95A 3CIRA 1K0IA 5FS6A 2OLNA 1ZDLA 1L9DA 4DNAA 3DA1A 4CNJA 2VRLA 3AB1A 5JCIA 3BI4A 3SM8A 3RP6A 2WPCA 3LB8A 2GV8A 3EF6A 3HYWA 2WOWA 4U8PA 4A65A 3K7TA 4YKFA 3DJJA 1IUSA 2GR2A 2WP5A 4TM4A 4CBQA 3FPZA 3NGCX 3LADA 3QVPA 3D1CA 1PBBA 1Z6LA 2YG7A 1PS9A 1F8SA 4B66A 5TR3A 3CN8A 3IF9A 5HY5A 5KMPA 1GREA 2FJBA 4CY8A 3IC9A 2X3NA 1JOAA 1GRAA 1FECA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KA7 A;  4ECH A;  4IA5 A;  2GB0 A;  3O0H A;  2ARD A;  2VVL A;  2YLR A;  3NG7 X;  5CKU A;  2YQU A;  4TM3 A;  3ALM A;  4PAB A;  3AD7 B;  1N4V A;  1E39 A;  3URH A;  2BS4 A;  2YR4 A;  1VG0 A;  3GYI A;  2WOV A;  4H4S A;  4H7U A;  4A79 A;  1W4X A;  3II4 A;  1Q9I A;  2X8C A;  4U8I A;  3F8D A;  4LA1 A;  4OPD A;  1PBC A;  2UZZ A;  3COX A;  2VOU A;  2DKH A;  2ZZC A;  5EB5 A;  1JRY A;  5BUL A;  3Q6J A;  4U2T A;  1NG4 A;  1E1L A;  2E5V A;  4GUV A;  2ZZB A;  1FOH A;  3NYC A;  3FMW A;  4H2Q A;  3SFD A;  1GND A;  1YQ3 A;  1P2E A;  1GRG A;  4C3X A;  4ADW A;  1ZKQ A;  3EAN A;  3SQP A;  2ACZ A;  2V6O A;  3H8L A;  3KVE A;  4NEV A;  4EMJ A;  1B8S A;  3ATQ A;  4XWZ A;  3CPJ G;  5JCM A;  4AP3 A;  4YTP A;  3P4S A;  2BA9 A;  1CC6 A;  2GMH A;  2WDV A;  3E1T A;  4Z2U A;  2Q7V A;  4A5L A;  4Z44 A;  3GMB A;  1P2H A;  1QLB A;  4EM4 A;  4AT2 A;  2A87 A;  1VDC A;  2A89 A;  3FBS A;  4Z24 A;  1VG9 A;  2TMD A;  2XLP A;  2C7G A;  4GDE A;  4WX1 A;  2CVJ A;  2GAH B;  2RAB A;  3NK0 X;  3NYF A;  2IVD A;  3GWD A;  3UKK A;  2DKI A;  3BI2 A;  2X99 A;  3QSM A;  3AE2 A;  2WOI A;  3GRS A;  3ICR A;  1PXA A;  2WPF A;  4A6N B;  5EB4 A;  4H4V A;  2NVK X;  2YVF A;  4YTM A;  4U8O A;  2RGO A;  4Y4M A;  1Y0P A;  3CGB A;  4GR1 A;  4H4Z A;  5EBK A;  5HXI A;  1ZOY A;  1MOK A;  3NHO X;  5CQF A;  1GRF A;  2VZ2 A;  5HHF A;  1KNP A;  1TDK A;  1E6E A;  3VRB A;  4Z26 A;  4B1B A;  2BYB A;  1H82 A;  1QO8 A;  4H4U A;  1EL8 A;  2WQY A;  2GH5 A;  1JNR A;  3VR8 A;  1K4Q A;  2C73 A;  1CF3 A;  2WPE A;  3GWF A;  3CGD A;  1TDF A;  2Q6U A;  2WDR A;  1CBO A;  3DGZ A;  2R0G A;  4K8D A;  4OPC A;  4DSH A;  2WEU A;  3CND A;  3RNM A;  1OJC A;  2WP6 A;  1CHU A;  4J31 A;  1JRZ A;  4JDR A;  5HYM A;  2B9X A;  3UOX A;  5M10 A;  3ALJ A;  1D4E A;  4YWO A;  3RHA A;  2YM2 A;  1KNR A;  4C3Y A;  4REK A;  4BJZ A;  2XVF A;  5GSN A;  2GR0 A;  3NK1 X;  1PBE A;  1N4U A;  4EMI A;  1GTH A;  1PN0 A;  3KLJ A;  5U25 A;  3D8X A;  1KSU A;  1GRH A;  2WS3 A;  3OC4 A;  1DXL A;  3VR9 A;  4U8K A;  4D03 A;  3UKP A;  4J34 A;  1N1P A;  1DJN A;  2PYX A;  2YLZ A;  3ZDN A;  5BUK A;  2JK6 A;  3G5Q A;  1O94 A;  2FBW A;  2Y6Q A;  2OA1 A;  4KX6 A;  2YVJ A;  3ATR A;  4UDR A;  3LZW A;  1KSS A;  1LPF A;  3B3R A;  2Z5X A;  3AE8 A;  2XCG A;  1PHH A;  3S5W A;  3V3O A;  3BNU A;  3AD8 B;  1S3E A;  2AQJ A;  1B4V A;  1E7P A;  4RG3 A;  1CJ3 A;  4U8M A;  3KKJ A;  1EBD A;  1XPQ A;  5J60 A;  2OLO A;  3T37 A;  3AE6 A;  2Q0L A;  1B37 A;  3CPI G;  3KU9 A;  2GQF A;  3PVC A;  2IID A;  5KVI A;  5KXJ A;  4Z43 A;  3KD9 A;  5U63 A;  4H4W A;  4YTN A;  2B76 A;  4B65 A;  2X8H A;  5FS9 A;  1JU2 A;  3GD3 A;  2WES A;  3S61 A;  1IJH A;  1TRB A;  3DME A;  2XYO A;  4CY6 A;  1GET A;  5J7X A;  1BZL A;  4EIQ A;  1ELI A;  4GDP A;  3GDN A;  3I6D A;  5KRQ A;  3PO7 A;  4YSY A;  3QJ4 A;  3ALL A;  4X9N A;  5DBJ A;  5FMH A;  4BV6 A;  4CCR A;  2CFY A;  2XLT A;  4IVM B;  4TM1 A;  2C67 A;  3HZL A;  2JB2 A;  4P9S A;  2XVE A;  1XAN A;  3M0O A;  4DGK A;  1YKJ A;  1FL2 A;  4NEW A;  3UTG A;  4BUR A;  1LQT A;  1BKW A;  1OJT A;  4UP3 A;  4J56 A;  3DGH A;  2WU2 A;  1CC4 A;  2B7R A;  1DOE A;  2C75 A;  2YLS A;  3EPT A;  2C64 A;  3K7M X;  3P4R A;  1ZX9 A;  1KFY A;  5GRT A;  2YR6 A;  4J2W A;  2XVH A;  4OVI A;  2BS2 A;  4JN9 A;  3UKA A;  1DJQ A;  3GYJ A;  1L0V A;  1ZOV A;  1VRQ B;  2BXR A;  2W0H A;  5BRT A;  2VVM A;  1QJD A;  3EAO A;  4BJY A;  3DJG X;  3DK8 A;  3B6D A;  1GEU A;  1CJC A;  2GEW A;  4H4X A;  3NIX A;  1E1M A;  4WCT A;  1JEH A;  4H50 A;  5JCL A;  2NPX A;  5FS8 A;  3P1W A;  2BK5 A;  1NDA A;  1GOS A;  4LII A;  5KOX A;  2ZBW A;  3CNJ A;  3UOV A;  4U8J A;  4C77 A;  2BC1 A;  3AEG A;  2Q0K A;  5IQ4 A;  4UDP A;  3I3L A;  4HB9 A;  1FEB A;  1EL7 A;  1K0J A;  2EQ9 A;  2FJD A;  1OJA A;  1S2Q A;  1DNC A;  3UKF A;  1M64 A;  2C65 A;  1D7Y A;  4I58 A;  4JNQ A;  4NTE A;  4I59 A;  4J57 A;  1H86 A;  3NKS A;  4JNA A;  1ONF A;  4EIP A;  3GRT A;  4RG4 A;  1H7W A;  2IVE A;  4H4T A;  3QSE A;  4IVO B;  1KDG A;  2GR1 A;  3AE7 A;  1Q1W A;  4AP1 A;  1IUT A;  3CNP A;  1BWC A;  4IA6 A;  1MXT A;  5FS7 A;  1EL9 A;  1PXC A;  3F8R A;  3NTA A;  2CDU A;  2H88 A;  4X4J A;  1LVL A;  2R9Z A;  4XWR A;  2I0Z A;  2BK3 A;  2XVI A;  1NHP A;  3DJD A;  4C74 A;  1S2Y A;  3QFB A;  1F3P A;  4GRT A;  1COY A;  1LV0 A;  4RSL A;  3ZYX A;  4OPU A;  1F8R A;  4YSH A;  3GD4 A;  4FK1 A;  4TLX A;  4H4Q A;  3G5R A;  2R46 A;  4Z25 A;  3AE4 A;  1NHS A;  1ZY8 A;  2APG A;  4J33 A;  4U2S A;  4BK3 A;  2EQ7 A;  1PJ6 A;  2QA1 A;  2X8G A;  2OAM A;  2QAE A;  2R45 A;  1GSN A;  2BS3 A;  4TLZ A;  3SFE A;  4TM0 A;  3AYJ A;  4Y4L A;  1D4C A;  1IUU A;  1NPX A;  3LOV A;  4HA6 A;  2GAG B;  1CJ4 A;  4YKG A;  4K7Z A;  3L1R A;  1F6M A;  2F5Z A;  1GAL A;  3SGL A;  4K5S A;  4D04 A;  4YSX A;  3AEE A;  4H2P A;  3DH9 A;  4EMW A;  1H7X A;  2OAL A;  2HQM A;  3PS9 A;  4H4P A;  4GCM A;  4ZN0 A;  1NG3 A;  1TDO A;  3FIM B;  2YAU A;  4JY3 A;  2WBA A;  2BC0 A;  3C4N A;  3ICS A;  1REO A;  3P4P A;  2V61 A;  3F8P A;  2V3A A;  1H84 A;  3L8K A;  1S3B A;  3P4Q A;  2R4E A;  4JQ9 A;  3R9U A;  3AE1 A;  2C76 A;  3H4K A;  3NN6 X;  3UKL A;  1BGN A;  2YLT A;  5BVA A;  1MO9 A;  5KOW A;  2YWL A;  2XFN A;  2AAQ A;  3VRD B;  1NHQ A;  2VRM A;  1RSG A;  3GDP A;  2BAC A;  1XHC A;  2YM1 A;  1TDE A;  4NTD A;  3ICT A;  2B7S A;  2X50 A;  3H8I A;  4B67 A;  2B9W A;  4K22 A;  1CC2 A;  1DOD A;  1TDN A;  1GXF A;  2GR3 A;  1KF6 A;  1PJ7 A;  3BNM A;  4B63 A;  3K30 A;  3RP8 A;  5LV9 A;  1PDH A;  1EL5 A;  4K5R A;  1TYP A;  1GER A;  2V5Z A;  4AOX A;  2J3N A;  2R4J A;  3UTF A;  3AYL A;  4UDQ A;  2YLX A;  3WE0 A;  2WET A;  2Y6R A;  1DOC A;  3AEF A;  3VQR A;  2EQ6 A;  1L9C A;  5C3J A;  1GT8 A;  4H4R A;  1H83 A;  2WHD A;  1PXB A;  2C72 A;  2FJE A;  4CCQ A;  2YG3 A;  4OPT A;  2WDQ A;  3M13 A;  2E1M A;  1H81 A;  1D4D A;  1YQ4 A;  3AEB A;  3Q9T A;  1NEN A;  2XLU A;  2YVG A;  3IHM A;  1YQZ A;  4BK2 A;  3NNE A;  2V60 A;  2VVL G;  5JCK A;  5JCN A;  3AEA A;  4FX9 A;  3K7Q X;  1E1K A;  2PHH A;  3NH3 X;  2BAB A;  2XVJ A;  3P9U A;  1Y56 B;  4H4Y A;  2XLR A;  3NLC A;  3C96 A;  3NN0 X;  3UCL A;  4EQR A;  5L46 A;  3UKQ A;  1CJ2 A;  2C70 A;  4LU6 A;  1N4W A;  2H89 A;  1IUX A;  4CRT A;  4APN A;  1BF3 A;  4EQS A;  4BK1 A;  2AR8 A;  2JKC A;  1X31 B;  1F8W A;  4Z2T A;  1GRB A;  3DK9 A;  3ISH A;  2ZZ0 A;  3RP7 A;  3UKH A;  2VQB A;  1GTE A;  3CGC A;  4IV9 A;  2TPR A;  4USQ A;  4B68 A;  3NYE A;  4FDC B;  4EQX A;  3UP5 A;  2R0C A;  3UOZ A;  1L9E A;  4OPG A;  3CTY A;  4Z2R A;  4C5O A;  2XFP A;  3UTE A;  3AE5 A;  2R0P A;  2GF3 A;  4U8L A;  2XFQ A;  1Q1R A;  5EOW A;  3KPF A;  3DK4 A;  2GMJ A;  4A99 A;  3FG2 P;  1Y56 A;  2EQ8 A;  2C66 A;  5IPY A;  2JBV A;  2GVC A;  1NEK A;  2B9Y A;  1JRX A;  1CL0 A;  3AXB A;  3UTH A;  2CUL A;  4O5U A;  4AT0 A;  1GES A;  2BK4 A;  5U1O A;  3UOY A;  1FCD A;  3QFA A;  4O5Q A;  4AOS A;  3OZ2 A;  2GRT A;  2XFO A;  4YXD A;  2YR5 A;  1ZK7 A;  1PJ5 A;  3AEC A;  3QVR A;  4ZCC A;  4N9X A;  1D7L A;  3IHG A;  2QCU A;  1BGJ A;  1RP0 A;  3V3N A;  1GRT A;  4U8N A;  4JY2 A;  1IUW A;  1PBF A;  1OJD A;  3GMC A;  1NHR A;  2BCG G;  2E4G A;  2V3B A;  3NK2 X;  3AE9 A;  4MJW A;  4OPL A;  2JB1 A;  1M6I A;  3NT6 A;  4X9M A;  3AD9 B;  3UP4 A;  1D5T A;  3M12 A;  4NTC A;  2WP9 A;  2C3D A;  5IQ1 A;  4FK1 C;  1TYT A;  1HYU A;  2JAE A;  3C4A A;  3DJE A;  2Z5Y A;  5C2T A;  4U2L A;  3G5S A;  3BHF A;  3AED A;  4ZCD A;  4E0V A;  4OPI A;  4H2R A;  1SEZ A;  4A7A A;  1PBD A;  4Y4N A;  3QSS A;  1DOB A;  1LJ1 A;  1B5Q A;  1GV4 A;  3AE3 A;  3CNT A;  3NTD A;  4H2N A;  4OCG A;  5KWF A;  4GF7 A;  1VQW A;  3LJP A;  1LTX R;  2QA2 A;  1IUV A;  1YY5 A;  2GQW A;  2RGH A;  1GPE A;  2XDO A;  2C3C A;  2YLW A;  3IWA A;  4ICY A;  1FEA A;  1JNZ A;  3ITJ A;  5M0Z A;  2WU5 A;  4M52 A;  3BI5 A;  4YT0 A;  4EM3 A;  4NZH A;  3AYI A;  1K0L A;  3LXD A;  3V76 A;  1ZP0 A;  4CNK A;  1H6V A;  2YG5 A;  2A8X A;  2FJA A;  4J36 A;  2YG4 A;  4USR A;  3VRA A;  4XXG A;  4A6N A;  5KVH A;  3LZX A;  4B69 A;  1V59 A;  2VQ7 A;  1OJ9 A;  3JSK A;  1AOG A;  4KPR A;  3ABV A;  4K2X A;  1LQU A;  1O5W A;  1XDI A;  1ZMD A;  2BCP A;  4EQW A;  1E1N A;  3CGE A;  1RYI A;  2XFU A;  3BHK A;  3CPH G;  3AWI A;  1NAA A;  3GSI A;  5ER0 A;  4A9W A;  3ADA B;  2JB3 A;  2O9Z A;  4DSG A;  4YSZ A;  2XLS A;  1ZMC A;  1UKV G;  3NRN A;  2RGJ A;  4B64 A;  3CNS A;  2YG6 A;  3RED A;  2BXS A;  4PAA A;  1O95 A;  3CIR A;  1K0I A;  5FS6 A;  2OLN A;  1ZDL A;  1L9D A;  4DNA A;  3DA1 A;  4CNJ A;  2VRL A;  3AB1 A;  5JCI A;  3BI4 A;  3SM8 A;  2WPC A;  3RP6 A;  3LB8 A;  2GV8 A;  3EF6 A;  2WOW A;  4U8P A;  4A65 A;  3K7T A;  4YKF A;  3DJJ A;  1IUS A;  2GR2 A;  2WP5 A;  4TM4 A;  4CBQ A;  3FPZ A;  3NGC X;  3LAD A;  3QVP A;  3D1C A;  1PBB A;  1Z6L A;  2YG7 A;  1PS9 A;  1F8S A;  4B66 A;  5TR3 A;  3CN8 A;  3IF9 A;  5HY5 A;  1GRE A;  2FJB A;  4CY8 A;  3IC9 A;  2X3N A;  1JOA A;  1GRA A;  1FEC A; 
#chains in the Genus database with same CATH topology
 3KA7 A;  4ECH A;  4IA5 A;  2GB0 A;  3O0H A;  2ARD A;  2VVL A;  2YLR A;  3NG7 X;  5CKU A;  2YQU A;  4TM3 A;  3ALM A;  4PAB A;  3AD7 B;  1N4V A;  1E39 A;  3URH A;  2BS4 A;  2YR4 A;  1VG0 A;  3T2Y A;  3GYX A;  3GYI A;  2WOV A;  4H4S A;  4H7U A;  4A79 A;  1W4X A;  3II4 A;  1EVI A;  1Q9I A;  2X8C A;  3F8D A;  4U8I A;  4YJD A;  4LA1 A;  1PBC A;  2UZZ A;  4OPD A;  3COX A;  2VOU A;  2DKH A;  2ZZC A;  5EB5 A;  1JRY A;  5BUL A;  3Q6J A;  4U2T A;  1NG4 A;  1E1L A;  2E5V A;  4GUV A;  2ZZB A;  1FOH A;  3NYC A;  3FMW A;  4H2Q A;  3SFD A;  1GND A;  1YQ3 A;  1P2E A;  1GRG A;  4C3X A;  4ADW A;  1ZKQ A;  3EAN A;  3SQP A;  2ACZ A;  2V6O A;  3H8L A;  3KVE A;  4NEV A;  4EMJ A;  1B8S A;  4XWZ A;  3ATQ A;  3CPJ G;  5JCM A;  4AP3 A;  4YTP A;  3P4S A;  2BA9 A;  1CC6 A;  2GMH A;  2WDV A;  3E1T A;  4Z2U A;  2Q7V A;  4A5L A;  4Z44 A;  3GMB A;  1P2H A;  1QLB A;  4EM4 A;  4AT2 A;  3HYV A;  2A89 A;  1VDC A;  2A87 A;  3FBS A;  4Z24 A;  1VG9 A;  2TMD A;  2XLP A;  2C7G A;  4GDE A;  4WX1 A;  2CVJ A;  2GAH B;  2RAB A;  3NK0 X;  3NYF A;  2IVD A;  3GWD A;  3UKK A;  2DKI A;  3BI2 A;  2X99 A;  3ZNQ A;  3QSM A;  3AE2 A;  2WOI A;  3GRS A;  3ICR A;  1PXA A;  2WPF A;  3T31 A;  5EB4 A;  4A6N B;  4H4V A;  2NVK X;  2YVF A;  4YTM A;  4U8O A;  2RGO A;  4Y4M A;  3T2K A;  1Y0P A;  3CGB A;  4GR1 A;  4H4Z A;  5EBK A;  5HXI A;  1DDO A;  1ZOY A;  1MOK A;  3NHO X;  5CQF A;  1GRF A;  2VZ2 A;  5HHF A;  1KNP A;  1TDK A;  1E6E A;  5KMQ A;  3VRB A;  4G9K A;  4B1B A;  2BYB A;  1H82 A;  1QO8 A;  4H4U A;  1EL8 A;  2WQY A;  2GH5 A;  1JNR A;  3VR8 A;  1K4Q A;  2C73 A;  1CF3 A;  2WPE A;  3GWF A;  3CGD A;  1TDF A;  2Q6U A;  2WDR A;  1CBO A;  3DGZ A;  2R0G A;  4K8D A;  4OPC A;  4DSH A;  2WEU A;  3CND A;  3RNM A;  1OJC A;  2WP6 A;  1CHU A;  4J31 A;  5HYM A;  1JRZ A;  4JDR A;  4QFC A;  2B9X A;  3UOX A;  5M10 A;  3ALJ A;  1D4E A;  4YWO A;  4NWZ A;  3RHA A;  2YM2 A;  1KNR A;  4C3Y A;  4REK A;  4BJZ A;  2XVF A;  5GSN A;  2GR0 A;  3NK1 X;  1PBE A;  1N4U A;  3T0K A;  1PN0 A;  1GTH A;  3KLJ A;  4EMI A;  5U25 A;  3D8X A;  1KSU A;  1GRH A;  3W4I A;  2WS3 A;  1DXL A;  3OC4 A;  4U8K A;  3VR9 A;  3UKP A;  4J34 A;  1N1P A;  1DJN A;  2PYX A;  2YLZ A;  3ZDN A;  5BUK A;  2JK6 A;  3G5Q A;  1O94 A;  2FBW A;  2Y6Q A;  2OA1 A;  4KX6 A;  3SYI A;  1C0L A;  2YVJ A;  3ATR A;  4UDR A;  3LZW A;  1KSS A;  1LPF A;  3B3R A;  2Z5X A;  3AE8 A;  2XCG A;  1PHH A;  3S5W A;  3V3O A;  3BNU A;  3AD8 B;  1S3E A;  2AQJ A;  2E48 A;  1B4V A;  4YJH B;  1E7P A;  4RG3 A;  1CJ3 A;  4U8M A;  3KKJ A;  1EBD A;  1XPQ A;  5J60 A;  2OLO A;  3T37 A;  3AE6 A;  2Q0L A;  1B37 A;  3CPI G;  3KU9 A;  2GQF A;  3PVC A;  3W4J A;  2IID A;  5KVI A;  5KXJ A;  3G3E A;  3KD9 A;  5U63 A;  4H4W A;  4YTN A;  2B76 A;  4B65 A;  4Z43 A;  2X8H A;  5FS9 A;  1JU2 A;  3GD3 A;  2WES A;  3S61 A;  2DU8 A;  3DME A;  1IJH A;  1TRB A;  4NNJ A;  2XYO A;  4CY6 A;  1GET A;  5J7X A;  1BZL A;  1ELI A;  4EIQ A;  4GDP A;  3GDN A;  3I6D A;  5KRQ A;  3PO7 A;  4YSY A;  3QJ4 A;  3ALL A;  4X9N A;  5DBJ A;  5FMH A;  4BV6 A;  4CCR A;  2CFY A;  2XLT A;  4IVM B;  4TM1 A;  3HZL A;  2C67 A;  2JB2 A;  4P9S A;  4YJH A;  2XVE A;  1XAN A;  3M0O A;  4DGK A;  1YKJ A;  1FL2 A;  4NEW A;  3UTG A;  4BUR A;  1LQT A;  1BKW A;  4G6H A;  1OJT A;  4UP3 A;  4J56 A;  3ZNP A;  3DGH A;  2WU2 A;  1CC4 A;  3SY4 A;  2B7R A;  1DOE A;  2C75 A;  2YLS A;  3EPT A;  4GAP A;  2C64 A;  4YJG B;  3K7M X;  3P4R A;  1ZX9 A;  1KFY A;  5GRT A;  2YR6 A;  4J2W A;  2XVH A;  4OVI A;  2BS2 A;  4JN9 A;  3UKA A;  2E4A A;  1DJQ A;  3GYJ A;  1L0V A;  1ZOV A;  1VRQ B;  2BXR A;  2W0H A;  5BRT A;  2VVM A;  1QJD A;  4BJY A;  3EAO A;  3ZNN A;  5KNL A;  3DJG X;  3DK8 A;  3B6D A;  3T14 A;  1GEU A;  1CJC A;  2GEW A;  4H4X A;  3NIX A;  4WCT A;  1E1M A;  3W4K A;  1JEH A;  4H50 A;  5JCL A;  2NPX A;  5FS8 A;  3P1W A;  2BK5 A;  1NDA A;  1GOS A;  4LII A;  5KOX A;  2ZBW A;  3CNJ A;  3UOV A;  4U8J A;  4C77 A;  2BC1 A;  3AEG A;  2Q0K A;  5IQ4 A;  4UDP A;  3I3L A;  4HB9 A;  1K0J A;  1EL7 A;  1FEB A;  2C4C A;  2EQ9 A;  2FJD A;  1OJA A;  1S2Q A;  1DNC A;  3UKF A;  4YJG A;  1M64 A;  2C65 A;  3CMM A;  1D7Y A;  4I58 A;  4JNQ A;  4NTE A;  2BRY A;  4I59 A;  1H86 A;  2BRA A;  3NKS A;  4J57 A;  4JNA A;  1ONF A;  4EIP A;  3GRT A;  4RG4 A;  1H7W A;  2IVE A;  4H4T A;  3QSE A;  4IVO B;  1KDG A;  2GR1 A;  3AE7 A;  3SXI A;  1Q1W A;  4AP1 A;  1IUT A;  3CNP A;  1BWC A;  4IA6 A;  1MXT A;  5FS7 A;  1EL9 A;  1PXC A;  3F8R A;  3NTA A;  2CDU A;  2H88 A;  4X4J A;  1LVL A;  2R9Z A;  4XWR A;  2I0Z A;  2BK3 A;  2XVI A;  1NHP A;  3DJD A;  4C74 A;  1S2Y A;  3QFB A;  1F3P A;  4GRT A;  4RSL A;  1COY A;  4YSH A;  1LV0 A;  4OPU A;  1F8R A;  3ZYX A;  3GD4 A;  4FK1 A;  4TLX A;  4H4Q A;  5KMS A;  3G5R A;  2R46 A;  4Z25 A;  3AE4 A;  1NHS A;  1ZY8 A;  2APG A;  4J33 A;  4U2S A;  4BK3 A;  2EQ7 A;  1PJ6 A;  2QA1 A;  2X8G A;  2OAM A;  2QAE A;  1C0K A;  2R45 A;  1GSN A;  2BS3 A;  4TLZ A;  3SFE A;  4TM0 A;  3AYJ A;  3SZW A;  4Y4L A;  1D4C A;  4D03 A;  1IUU A;  1NPX A;  3LOV A;  4HA6 A;  2GAG B;  1CJ4 A;  4YKG A;  4K7Z A;  3L1R A;  1F6M A;  2F5Z A;  1GAL A;  3SGL A;  4K5S A;  4D04 A;  4YSX A;  3SX6 A;  3AEE A;  4H2P A;  3DH9 A;  4EMW A;  1H7X A;  2OAL A;  3PS9 A;  2HQM A;  4H4P A;  4GCM A;  4ZN0 A;  1NG3 A;  1TDO A;  3FIM B;  3T2Z A;  2YAU A;  3C4N A;  4JY3 A;  2BC0 A;  2WBA A;  3ICS A;  1REO A;  3P4P A;  2V61 A;  3F8P A;  2V3A A;  1H84 A;  4YJF B;  1S3B A;  3L8K A;  3P4Q A;  2R4E A;  4JQ9 A;  3R9U A;  4G74 A;  3AE1 A;  2C76 A;  3H4K A;  3NN6 X;  3UKL A;  1BGN A;  2YLT A;  5BVA A;  1MO9 A;  5KOW A;  2YWL A;  2XFN A;  2AAQ A;  3VRD B;  1NHQ A;  2VRM A;  1RSG A;  3GDP A;  2BAC A;  1XHC A;  2YM1 A;  1TDE A;  4NTD A;  4G6G A;  3ICT A;  2B7S A;  2X50 A;  3H8I A;  4B67 A;  2B9W A;  4K22 A;  1CC2 A;  1DOD A;  1TDN A;  1GXF A;  2GR3 A;  1KF6 A;  1PJ7 A;  3BNM A;  4B63 A;  3K30 A;  3RP8 A;  5LV9 A;  1PDH A;  1EL5 A;  4K5R A;  1TYP A;  1GER A;  2V5Z A;  4AOX A;  2J3N A;  2R4J A;  3UTF A;  3AYL A;  4UDQ A;  2YLX A;  1C0P A;  2WET A;  2Y6R A;  1DOC A;  3AEF A;  3VQR A;  4YJF A;  2EQ6 A;  3WE0 A;  1L9C A;  5KMR A;  5C3J A;  1GT8 A;  4G73 A;  1H83 A;  2WHD A;  4H4R A;  1PXB A;  2C72 A;  2FJE A;  4CCQ A;  2YG3 A;  4OPT A;  2WDQ A;  3M13 A;  2E1M A;  1H81 A;  1D4D A;  1YQ4 A;  3AEB A;  3Q9T A;  1NEN A;  2XLU A;  2YVG A;  3IHM A;  1YQZ A;  4BK2 A;  3NNE A;  2V60 A;  2VVL G;  5JCK A;  4QFD A;  5JCN A;  3AEA A;  1DAO A;  4FX9 A;  3K7Q X;  1E1K A;  2PHH A;  3NH3 X;  2BAB A;  2XVJ A;  3P9U A;  1Y56 B;  3HYX A;  4H4Y A;  2XLR A;  5L46 A;  3C96 A;  3NN0 X;  3NLC A;  3UCL A;  4II3 A;  4EQR A;  3UKQ A;  1CJ2 A;  2C70 A;  4LU6 A;  1AN9 A;  1N4W A;  2H89 A;  1IUX A;  4CRT A;  4APN A;  1BF3 A;  3ZNO A;  4BK1 A;  4EQS A;  2AR8 A;  2JKC A;  1X31 B;  1F8W A;  3SZ0 A;  1GRB A;  4Z2T A;  3DK9 A;  3ISH A;  2ZZ0 A;  3RP7 A;  3UKH A;  2VQB A;  1GTE A;  3CGC A;  4IV9 A;  2TPR A;  4USQ A;  4B68 A;  3NYE A;  3SZF A;  4FDC B;  4EQX A;  3UP5 A;  2R0C A;  3UOZ A;  1L9E A;  4OPG A;  3CTY A;  4Z2R A;  4C5O A;  2XFP A;  3UTE A;  2E49 A;  3AE5 A;  2R0P A;  2GF3 A;  4U8L A;  2XFQ A;  1Q1R A;  5EOW A;  3KPF A;  3DK4 A;  2GMJ A;  4A99 A;  3FG2 P;  1Y56 A;  2EQ8 A;  2E82 A;  2C66 A;  5IPY A;  2JBV A;  2GVC A;  1NEK A;  1JRX A;  1CL0 A;  3AXB A;  2B9Y A;  3UTH A;  2CUL A;  4O5U A;  4AT0 A;  1GES A;  2BK4 A;  5U1O A;  3UOY A;  1FCD A;  3QFA A;  4O5Q A;  4AOS A;  3OZ2 A;  2GRT A;  2XFO A;  4YXD A;  2YR5 A;  1ZK7 A;  1PJ5 A;  3AEC A;  3QVR A;  4ZCC A;  4N9X A;  1D7L A;  3IHG A;  2QCU A;  1BGJ A;  1RP0 A;  3V3N A;  1GRT A;  4U8N A;  1IUW A;  1PBF A;  4JY2 A;  1OJD A;  3GMC A;  1NHR A;  2BCG G;  2E4G A;  2V3B A;  3NK2 X;  3AE9 A;  4MJW A;  4OPL A;  2JB1 A;  1M6I A;  3NT6 A;  4X9M A;  3AD9 B;  3UP4 A;  3M12 A;  1D5T A;  4NTC A;  3SZC A;  2WP9 A;  2C3D A;  5IQ1 A;  4FK1 C;  1TYT A;  1HYU A;  3C4A A;  2JAE A;  3DJE A;  2Z5Y A;  5C2T A;  4U2L A;  3G5S A;  4GAV A;  3BHF A;  3AED A;  4ZCD A;  4E0V A;  4OPI A;  4H2R A;  1SEZ A;  4A7A A;  1PBD A;  4Y4N A;  3QSS A;  1DOB A;  1LJ1 A;  1B5Q A;  1GV4 A;  3AE3 A;  3CNT A;  3NTD A;  4H2N A;  4OCG A;  5KWF A;  4GF7 A;  1VQW A;  3LJP A;  1LTX R;  2QA2 A;  1IUV A;  2RGH A;  3WGT A;  1YY5 A;  1GPE A;  2GQW A;  2C3C A;  2XDO A;  2YLW A;  3IWA A;  4ICY A;  1FEA A;  1JNZ A;  3ITJ A;  5M0Z A;  2WU5 A;  3KPK A;  4M52 A;  3BI5 A;  4YT0 A;  4EM3 A;  4NZH A;  3AYI A;  1K0L A;  3LXD A;  3V76 A;  1ZP0 A;  4CNK A;  1H6V A;  2YG5 A;  2A8X A;  2FJA A;  4J36 A;  2YG4 A;  4USR A;  3VRA A;  4XXG A;  4A6N A;  5KVH A;  3LZX A;  4B69 A;  1VE9 A;  1V59 A;  1OJ9 A;  2VQ7 A;  3JSK A;  4KPR A;  1AOG A;  3ABV A;  4K2X A;  1LQU A;  1O5W A;  1XDI A;  1ZMD A;  2BCP A;  4EQW A;  1E1N A;  3CGE A;  1RYI A;  3BHK A;  2XFU A;  3CPH G;  3AWI A;  1NAA A;  3GSI A;  5ER0 A;  4A9W A;  3ADA B;  2JB3 A;  2O9Z A;  4DSG A;  4YSZ A;  2XLS A;  1ZMC A;  4Z26 A;  1UKV G;  3NRN A;  2RGJ A;  4B64 A;  3CNS A;  2YG6 A;  3RED A;  2BXS A;  4II2 A;  4PAA A;  1O95 A;  3CIR A;  1K0I A;  5FS6 A;  1C0I A;  2OLN A;  1ZDL A;  1L9D A;  4DNA A;  3DA1 A;  4CNJ A;  2VRL A;  3AB1 A;  5JCI A;  3BI4 A;  3SM8 A;  3RP6 A;  2WPC A;  3LB8 A;  2GV8 A;  3EF6 A;  3HYW A;  2WOW A;  4U8P A;  4A65 A;  3K7T A;  4YKF A;  3DJJ A;  1IUS A;  2GR2 A;  2WP5 A;  4TM4 A;  4CBQ A;  3FPZ A;  3NGC X;  3CUK A;  3LAD A;  1KIF A;  3QVP A;  3D1C A;  1PBB A;  1Z6L A;  2YG7 A;  1PS9 A;  1F8S A;  4B66 A;  5TR3 A;  3CN8 A;  3IF9 A;  5HY5 A;  5KMP A;  1GRE A;  2FJB A;  4CY8 A;  3IC9 A;  2X3N A;  1JOA A;  1GRA A;  1FEC A; 
#chains in the Genus database with same CATH homology
 3KA7 A;  4ECH A;  4IA5 A;  2GB0 A;  3O0H A;  2ARD A;  2VVL A;  2YLR A;  3NG7 X;  5CKU A;  2YQU A;  4TM3 A;  3ALM A;  4PAB A;  3AD7 B;  1N4V A;  1E39 A;  3URH A;  2BS4 A;  2YR4 A;  1VG0 A;  3T2Y A;  3GYX A;  3GYI A;  2WOV A;  4H4S A;  4H7U A;  4A79 A;  1W4X A;  3II4 A;  1Q9I A;  2X8C A;  4U8I A;  3F8D A;  4LA1 A;  4OPD A;  1PBC A;  2UZZ A;  3COX A;  2VOU A;  2DKH A;  2ZZC A;  5EB5 A;  1JRY A;  5BUL A;  3Q6J A;  4U2T A;  1NG4 A;  1E1L A;  2E5V A;  4GUV A;  2ZZB A;  1FOH A;  3NYC A;  3FMW A;  4H2Q A;  3SFD A;  1GND A;  1YQ3 A;  1P2E A;  1GRG A;  4C3X A;  4ADW A;  1ZKQ A;  3EAN A;  3SQP A;  2ACZ A;  2V6O A;  3H8L A;  3KVE A;  4NEV A;  4EMJ A;  1B8S A;  3ATQ A;  4XWZ A;  3CPJ G;  5JCM A;  4AP3 A;  4YTP A;  3P4S A;  2BA9 A;  1CC6 A;  2GMH A;  2WDV A;  3E1T A;  4Z2U A;  2Q7V A;  4A5L A;  4Z44 A;  3GMB A;  1P2H A;  1QLB A;  4EM4 A;  4AT2 A;  3HYV A;  2A87 A;  1VDC A;  2A89 A;  3FBS A;  4Z24 A;  1VG9 A;  2TMD A;  2XLP A;  2C7G A;  4GDE A;  4WX1 A;  2CVJ A;  2GAH B;  2RAB A;  3NK0 X;  3NYF A;  2IVD A;  3GWD A;  3UKK A;  2DKI A;  3BI2 A;  2X99 A;  3QSM A;  3AE2 A;  2WOI A;  3GRS A;  3ICR A;  1PXA A;  2WPF A;  3T31 A;  5EB4 A;  4A6N B;  4H4V A;  2NVK X;  2YVF A;  4YTM A;  4U8O A;  2RGO A;  4Y4M A;  3T2K A;  1Y0P A;  3CGB A;  4GR1 A;  4H4Z A;  5EBK A;  5HXI A;  1ZOY A;  1MOK A;  3NHO X;  5CQF A;  1GRF A;  2VZ2 A;  5HHF A;  1KNP A;  1TDK A;  1E6E A;  5KMQ A;  3VRB A;  4G9K A;  4B1B A;  2BYB A;  1H82 A;  1QO8 A;  4H4U A;  1EL8 A;  2WQY A;  2GH5 A;  1JNR A;  3VR8 A;  1K4Q A;  2C73 A;  1CF3 A;  2WPE A;  3GWF A;  3CGD A;  1TDF A;  2Q6U A;  2WDR A;  1CBO A;  3DGZ A;  2R0G A;  4K8D A;  4OPC A;  4DSH A;  2WEU A;  3CND A;  3RNM A;  1OJC A;  2WP6 A;  1CHU A;  4J31 A;  5HYM A;  1JRZ A;  4JDR A;  2B9X A;  3UOX A;  5M10 A;  3ALJ A;  1D4E A;  4YWO A;  4NWZ A;  3RHA A;  2YM2 A;  1KNR A;  4C3Y A;  4REK A;  4BJZ A;  2XVF A;  5GSN A;  2GR0 A;  3NK1 X;  1PBE A;  1N4U A;  3T0K A;  1GTH A;  1PN0 A;  3KLJ A;  4EMI A;  5U25 A;  3D8X A;  1KSU A;  1GRH A;  2WS3 A;  3OC4 A;  1DXL A;  3VR9 A;  4U8K A;  4D03 A;  3UKP A;  4J34 A;  1N1P A;  1DJN A;  2PYX A;  2YLZ A;  3ZDN A;  5BUK A;  2JK6 A;  3G5Q A;  1O94 A;  2FBW A;  2Y6Q A;  2OA1 A;  4KX6 A;  3SYI A;  2YVJ A;  3ATR A;  4UDR A;  3LZW A;  1KSS A;  1LPF A;  3B3R A;  2Z5X A;  3AE8 A;  2XCG A;  1PHH A;  3S5W A;  3V3O A;  3BNU A;  3AD8 B;  1S3E A;  2AQJ A;  1B4V A;  1E7P A;  4RG3 A;  1CJ3 A;  4U8M A;  3KKJ A;  1EBD A;  1XPQ A;  5J60 A;  2OLO A;  3T37 A;  3AE6 A;  2Q0L A;  1B37 A;  3CPI G;  3KU9 A;  2GQF A;  3PVC A;  2IID A;  5KVI A;  5KXJ A;  4Z43 A;  3KD9 A;  5U63 A;  4H4W A;  4YTN A;  2B76 A;  4B65 A;  2X8H A;  5FS9 A;  1JU2 A;  3GD3 A;  2WES A;  3S61 A;  1IJH A;  1TRB A;  3DME A;  4NNJ A;  2XYO A;  4CY6 A;  1GET A;  5J7X A;  1BZL A;  4EIQ A;  1ELI A;  4GDP A;  3GDN A;  3I6D A;  5KRQ A;  3PO7 A;  4YSY A;  3QJ4 A;  3ALL A;  4X9N A;  5DBJ A;  5FMH A;  4BV6 A;  4CCR A;  2CFY A;  2XLT A;  4IVM B;  4TM1 A;  2C67 A;  3HZL A;  2JB2 A;  4P9S A;  2XVE A;  1XAN A;  3M0O A;  4DGK A;  1YKJ A;  1FL2 A;  4NEW A;  3UTG A;  4BUR A;  1LQT A;  1BKW A;  4G6H A;  1OJT A;  4UP3 A;  4J56 A;  3DGH A;  2WU2 A;  1CC4 A;  3SY4 A;  2B7R A;  1DOE A;  2C75 A;  2YLS A;  3EPT A;  4GAP A;  2C64 A;  3K7M X;  3P4R A;  1ZX9 A;  1KFY A;  5GRT A;  2YR6 A;  4J2W A;  2XVH A;  4OVI A;  2BS2 A;  4JN9 A;  3UKA A;  1DJQ A;  3GYJ A;  1L0V A;  1ZOV A;  1VRQ B;  2BXR A;  2W0H A;  5BRT A;  2VVM A;  1QJD A;  4BJY A;  3EAO A;  5KNL A;  3DJG X;  3DK8 A;  3B6D A;  3T14 A;  1GEU A;  1CJC A;  2GEW A;  4H4X A;  3NIX A;  1E1M A;  4WCT A;  1JEH A;  4H50 A;  5JCL A;  2NPX A;  5FS8 A;  3P1W A;  2BK5 A;  1NDA A;  1GOS A;  4LII A;  5KOX A;  2ZBW A;  3CNJ A;  3UOV A;  4U8J A;  4C77 A;  2BC1 A;  3AEG A;  2Q0K A;  5IQ4 A;  4UDP A;  3I3L A;  4HB9 A;  1FEB A;  1EL7 A;  1K0J A;  2C4C A;  2EQ9 A;  2FJD A;  1OJA A;  1S2Q A;  1DNC A;  3UKF A;  3CMM A;  1M64 A;  2C65 A;  1D7Y A;  4I58 A;  4JNQ A;  4NTE A;  2BRY A;  4I59 A;  1H86 A;  2BRA A;  3NKS A;  4J57 A;  4JNA A;  1ONF A;  4EIP A;  3GRT A;  4RG4 A;  1H7W A;  2IVE A;  4H4T A;  3QSE A;  4IVO B;  1KDG A;  2GR1 A;  3AE7 A;  3SXI A;  1Q1W A;  4AP1 A;  1IUT A;  3CNP A;  1BWC A;  4IA6 A;  1MXT A;  5FS7 A;  1EL9 A;  1PXC A;  3F8R A;  3NTA A;  2CDU A;  2H88 A;  4X4J A;  1LVL A;  2R9Z A;  4XWR A;  2I0Z A;  2BK3 A;  2XVI A;  1NHP A;  3DJD A;  4C74 A;  1S2Y A;  3QFB A;  1F3P A;  4GRT A;  1COY A;  1LV0 A;  4RSL A;  3ZYX A;  4OPU A;  1F8R A;  4YSH A;  3GD4 A;  4FK1 A;  4TLX A;  4H4Q A;  5KMS A;  3G5R A;  2R46 A;  4Z25 A;  3AE4 A;  1NHS A;  1ZY8 A;  2APG A;  4J33 A;  4U2S A;  4BK3 A;  2EQ7 A;  1PJ6 A;  2QA1 A;  2X8G A;  2OAM A;  2QAE A;  2R45 A;  1GSN A;  2BS3 A;  4TLZ A;  3SFE A;  4TM0 A;  3AYJ A;  3SZW A;  4Y4L A;  1D4C A;  1IUU A;  1NPX A;  3LOV A;  4HA6 A;  2GAG B;  1CJ4 A;  4YKG A;  4K7Z A;  3L1R A;  1F6M A;  2F5Z A;  1GAL A;  3SGL A;  4K5S A;  4D04 A;  4YSX A;  3SX6 A;  3AEE A;  4H2P A;  3DH9 A;  4EMW A;  1H7X A;  2OAL A;  2HQM A;  3PS9 A;  4H4P A;  4GCM A;  4ZN0 A;  1NG3 A;  1TDO A;  3FIM B;  3T2Z A;  2YAU A;  4JY3 A;  2WBA A;  2BC0 A;  3C4N A;  3ICS A;  1REO A;  3P4P A;  2V61 A;  3F8P A;  2V3A A;  1H84 A;  3L8K A;  1S3B A;  3P4Q A;  2R4E A;  4JQ9 A;  3R9U A;  4G74 A;  3AE1 A;  2C76 A;  3H4K A;  3NN6 X;  3UKL A;  1BGN A;  2YLT A;  5BVA A;  1MO9 A;  5KOW A;  2YWL A;  2XFN A;  2AAQ A;  3VRD B;  1NHQ A;  2VRM A;  1RSG A;  3GDP A;  2BAC A;  1XHC A;  2YM1 A;  1TDE A;  4NTD A;  4G6G A;  3ICT A;  2B7S A;  2X50 A;  3H8I A;  4B67 A;  2B9W A;  4K22 A;  1CC2 A;  1DOD A;  1TDN A;  1GXF A;  2GR3 A;  1KF6 A;  1PJ7 A;  3BNM A;  4B63 A;  3K30 A;  3RP8 A;  5LV9 A;  1PDH A;  1EL5 A;  4K5R A;  1TYP A;  1GER A;  2V5Z A;  4AOX A;  2J3N A;  2R4J A;  3UTF A;  3AYL A;  4UDQ A;  2YLX A;  3WE0 A;  2WET A;  2Y6R A;  1DOC A;  3AEF A;  3VQR A;  2EQ6 A;  1L9C A;  5KMR A;  5C3J A;  1GT8 A;  4G73 A;  1H83 A;  2WHD A;  4H4R A;  1PXB A;  2C72 A;  2FJE A;  4CCQ A;  2YG3 A;  4OPT A;  2WDQ A;  3M13 A;  2E1M A;  1H81 A;  1D4D A;  1YQ4 A;  3AEB A;  3Q9T A;  1NEN A;  2XLU A;  2YVG A;  3IHM A;  1YQZ A;  4BK2 A;  3NNE A;  2V60 A;  2VVL G;  5JCK A;  5JCN A;  3AEA A;  4FX9 A;  3K7Q X;  1E1K A;  2PHH A;  3NH3 X;  2BAB A;  2XVJ A;  3P9U A;  1Y56 B;  3HYX A;  4H4Y A;  2XLR A;  3NLC A;  3C96 A;  3NN0 X;  3UCL A;  4EQR A;  4II3 A;  5L46 A;  3UKQ A;  1CJ2 A;  2C70 A;  4LU6 A;  1N4W A;  2H89 A;  1IUX A;  4CRT A;  4APN A;  1BF3 A;  4EQS A;  4BK1 A;  2AR8 A;  2JKC A;  1X31 B;  1F8W A;  3SZ0 A;  1GRB A;  4Z2T A;  3DK9 A;  3ISH A;  2ZZ0 A;  3RP7 A;  3UKH A;  2VQB A;  1GTE A;  3CGC A;  4IV9 A;  2TPR A;  4USQ A;  4B68 A;  3NYE A;  3SZF A;  4FDC B;  4EQX A;  3UP5 A;  2R0C A;  3UOZ A;  1L9E A;  4OPG A;  3CTY A;  4Z2R A;  4C5O A;  2XFP A;  3UTE A;  3AE5 A;  2R0P A;  2GF3 A;  4U8L A;  2XFQ A;  1Q1R A;  5EOW A;  3KPF A;  3DK4 A;  2GMJ A;  4A99 A;  3FG2 P;  1Y56 A;  2EQ8 A;  2C66 A;  5IPY A;  2JBV A;  2GVC A;  1NEK A;  2B9Y A;  1JRX A;  1CL0 A;  3AXB A;  3UTH A;  2CUL A;  4O5U A;  4AT0 A;  1GES A;  2BK4 A;  5U1O A;  3UOY A;  1FCD A;  3QFA A;  4O5Q A;  4AOS A;  3OZ2 A;  2GRT A;  2XFO A;  4YXD A;  2YR5 A;  1ZK7 A;  1PJ5 A;  3AEC A;  3QVR A;  4ZCC A;  4N9X A;  1D7L A;  3IHG A;  2QCU A;  1BGJ A;  1RP0 A;  3V3N A;  1GRT A;  4U8N A;  4JY2 A;  1IUW A;  1PBF A;  1OJD A;  3GMC A;  1NHR A;  2BCG G;  2E4G A;  2V3B A;  3NK2 X;  3AE9 A;  4MJW A;  4OPL A;  2JB1 A;  1M6I A;  3NT6 A;  4X9M A;  3AD9 B;  3UP4 A;  1D5T A;  3M12 A;  4NTC A;  3SZC A;  2WP9 A;  2C3D A;  5IQ1 A;  4FK1 C;  1TYT A;  1HYU A;  3C4A A;  2JAE A;  3DJE A;  2Z5Y A;  5C2T A;  4U2L A;  3G5S A;  4GAV A;  3BHF A;  3AED A;  4ZCD A;  4E0V A;  4OPI A;  4H2R A;  1SEZ A;  4A7A A;  1PBD A;  4Y4N A;  3QSS A;  1DOB A;  1LJ1 A;  1B5Q A;  1GV4 A;  3AE3 A;  3CNT A;  3NTD A;  4H2N A;  4OCG A;  5KWF A;  4GF7 A;  1VQW A;  3LJP A;  1LTX R;  2QA2 A;  1IUV A;  1YY5 A;  2GQW A;  2RGH A;  1GPE A;  2XDO A;  2C3C A;  2YLW A;  3IWA A;  4ICY A;  1FEA A;  1JNZ A;  3ITJ A;  5M0Z A;  2WU5 A;  3KPK A;  4M52 A;  3BI5 A;  4YT0 A;  4EM3 A;  4NZH A;  3AYI A;  1K0L A;  3LXD A;  3V76 A;  1ZP0 A;  4CNK A;  1H6V A;  2YG5 A;  2A8X A;  2FJA A;  4J36 A;  2YG4 A;  4USR A;  3VRA A;  4XXG A;  4A6N A;  5KVH A;  3LZX A;  4B69 A;  1V59 A;  2VQ7 A;  1OJ9 A;  3JSK A;  1AOG A;  4KPR A;  3ABV A;  4K2X A;  1LQU A;  1O5W A;  1XDI A;  1ZMD A;  2BCP A;  4EQW A;  1E1N A;  3CGE A;  1RYI A;  2XFU A;  3BHK A;  3CPH G;  3AWI A;  1NAA A;  3GSI A;  5ER0 A;  4A9W A;  3ADA B;  2JB3 A;  2O9Z A;  4DSG A;  4YSZ A;  2XLS A;  1ZMC A;  4Z26 A;  1UKV G;  3NRN A;  2RGJ A;  4B64 A;  3CNS A;  2YG6 A;  3RED A;  2BXS A;  4II2 A;  4PAA A;  1O95 A;  3CIR A;  1K0I A;  5FS6 A;  2OLN A;  1ZDL A;  1L9D A;  4DNA A;  3DA1 A;  4CNJ A;  2VRL A;  3AB1 A;  5JCI A;  3BI4 A;  3SM8 A;  3RP6 A;  2WPC A;  3LB8 A;  2GV8 A;  3EF6 A;  3HYW A;  2WOW A;  4U8P A;  4A65 A;  3K7T A;  4YKF A;  3DJJ A;  1IUS A;  2GR2 A;  2WP5 A;  4TM4 A;  4CBQ A;  3FPZ A;  3NGC X;  3LAD A;  3QVP A;  3D1C A;  1PBB A;  1Z6L A;  2YG7 A;  1PS9 A;  1F8S A;  4B66 A;  5TR3 A;  3CN8 A;  3IF9 A;  5HY5 A;  5KMP A;  1GRE A;  2FJB A;  4CY8 A;  3IC9 A;  2X3N A;  1JOA A;  1GRA A;  1FEC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...