3GMBA

Crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
369
structure length
369
Chain Sequence
TRRAEVAGGGFAGLTAAIALKQNGWDVRLHEKSSELRAFGAGIYLWHNGLRVLEGLGALDDVLQGSHTPPTYETWMHNKSVSKETFNGLPWRIMTRSHLHDALVNRARALGVDISVNSEAVAADPVGRLTLQTGEVLEADLIVGADGVGSKVRDSIGFKQDRWVSKDGLIRLIVPRMKKELGHGEWDNTIDMWNFWPRVQRILYSPCNENELYLGLMAPAADPRGSSVPIDLEVWVEMFPFLEPCLIEAAKLKTARYDKYETTKLDSWTRGKVALVGDAAHAMCPALAQGAGCAMVNAFSLSQDLEEGSSVEDALVAWETRIRPITDRCQALSGDYAANRSLSKGNMFTPAALEAARYDPLRRVYSWPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
publication title Structure of the PLP degradative enzyme 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase from Mesorhizobium loti MAFF303099 and its mechanistic implications.
pubmed doi rcsb
source organism Mesorhizobium loti
molecule tags Oxidoreductase
total genus 106
structure length 369
sequence length 369
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01494 FAD_binding_3 FAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.50 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase; Chain A, domain 2 3gmbA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3gmbA01
4J36A 1OJ9A 1PBEA 2XLPA 4UDPA 4CY6A 2R0GA 2EQ6A 2QA2A 2YLXA 3R9UA 2BC1A 4K2XA 2R0CA 2BXRA 2QAEA 1VRQB 2WESA 2WP6A 2WPFA 1ZDLA 4OPIA 3UKPA 1BKWA 2Q6UA 3QSSA 4H4VA 4A6NB 3BNMA 3NTAA 1OJTA 5KVHA 3CGBA 2IVDA 4REKA 2QA1A 1OJDA 3LZWA 2WP9A 4H4SA 3UCLA 5HY5A 5BRTA 3EAOA 4YKGA 2CFYA 3AE3A 1LTXR 1B5QA 2XVJA 5HXIA 3RNMA 3V3NA 2B7RA 1JRZA 2WQYA 4H4UA 3D1CA 2WPCA 3H8LA 4A65A 4D04A 4EQWA 4Z2UA 2GEWA 3DJDA 2JBVA 4PAAA 2YR6A 3DJJA 4RG3A 2RGOA 4RG4A 4Z2TA 2VQ7A 4FK1C 4O5QA 3PO7A 1NPXA 4I59A 4NZHA 4EM4A 4M52A 3L8KA 3DMEA 4NTDA 2YAUA 3DJEA 5M10A 1VQWA 2Z5YA 4USRA 1PS9A 4X9NA 1LJ1A 2CVJA 2WDQA 3UP4A 5KVIA 2BS4A 4JDRA 5GRTA 2RABA 4E0VA 3LOVA 3BNUA 2Z5XA 1GETA 3BHKA 3JSKA 4JN9A 2BACA 1LQUA 1DNCA 5CQFA 2TMDA 4H2NA 2A8XA 2YLWA 3KLJA 4FX9A 1K0JA 4J31A 2WP5A 4LIIA 3I3LA 4B63A 2XDOA 4YKFA 2YLZA 2V5ZA 1S2YA 3CNPA 1PXCA 2XFNA 4H4QA 5KOWA 2GVCA 3AE5A 1EL7A 3NRNA 4FDCB 1M6IA 2GB0A 2EQ7A 1PXBA 3IHGA 2C64A 5BULA 2IVEA 3NGCX 4AT0A 1L0VA 3FBSA 4B66A 2XFUA 4YXDA 1IUVA 3QJ4A 4OCGA 2GQFA 3CIRA 4U2SA 3C4NA 1TDKA 4BJZA 5BUKA 3AD9B 1PBBA 1AOGA 3UTHA 2VZ2A 2YM1A 1JRYA 1ZMDA 3RP6A 1TRBA 1K0LA 2XVHA 1GOSA 4Z43A 2ZZ0A 3AYLA 3LXDA 2OLOA 2WDVA 2WOIA 4K8DA 4B68A 2EQ9A 2B7SA 3UOXA 1F3PA 3ADAB 1CJ4A 1GNDA 1H6VA 3D8XA 3G5QA 2E4GA 4C77A 4Z2RA 1E1KA 3C96A 3Q6JA 4LA1A 2XLSA 3K7QX 4BK1A 1PBCA 1NHRA 5TR3A 3K7TA 2BK5A 4JY2A 3KD9A 4Y4MA 4B1BA 3SGLA 3ALLA 4J2WA 4Z44A 1CJCA 2RGHA 4C74A 4A6NA 1D7YA 3CGCA 4H4ZA 2CDUA 4H2QA 2VVMA 2YM2A 1NHSA 5KRQA 1RP0A 3P4QA 1D5TA 1GESA 2YR5A 1IJHA 1E7PA 1W4XA 3GWFA 3NN6X 3RP8A 2NVKX 3GYIA 1MXTA 1NHQA 1ONFA 1FCDA 1OJAA 2J3NA 2YG5A 3C4AA 2GH5A 3S61A 4A9WA 1CC6A 2YLTA 3OC4A 3UKLA 2V61A 2R45A 3T37A 4B64A 5C3JA 3UTFA 2AR8A 3UTEA 3AYIA 1V59A 4XWRA 2GRTA 5DBJA 3AE7A 2YG7A 4DSGA 3E1TA 1PBDA 3QSMA 1BGJA 2BK4A 3AEDA 2BYBA 4JNQA 2GAHB 2TPRA 1N4WA 4U8IA 2E5VA 5IPYA 1GRBA 4U8LA 1KFYA 4C3XA 1VG9A 1H86A 3QVPA 2DKHA 1TYTA 2X50A 1F8WA 4GR1A 4K7ZA 1JNRA 2BXSA 2JB1A 2JB3A 2GAGB 2JAEA 4J34A 4EQXA 1O5WA 3UOZA 1Y56A 4FK1A 2WETA 4H7UA 3IHMA 5EBKA 4C5OA 1E1MA 4USQA 4NTEA 4WCTA 2ARDA 3P4RA 4U2LA 3GYJA 4O5UA 2PYXA 2BA9A 1EL9A 3AECA 5KWFA 5IQ4A 5GSNA 3QFAA 4CRTA 2V3AA 3KU9A 5FS8A 2WDRA 1DODA 1MOKA 1N1PA 1TDNA 2FJDA 1F6MA 4Y4NA 2H89A 3VRDB 2ZZBA 2OA1A 1ZOYA 3AE9A 4DNAA 2X99A 2Y6RA 4AT2A 1E1NA 1OJCA 4RSLA 3VRBA 1GALA 5HHFA 4BK2A 1QLBA 1BF3A 4JQ9A 1PXAA 4J56A 1JNZA 4H50A 3NK0X 3SFDA 3CNSA 2R4EA 5KXJA 1F8SA 1X31B 5KOXA 1YKJA 2ZBWA 3PVCA 4H4XA 2AAQA 1GEUA 3EPTA 3ICRA 3NTDA 2O9ZA 2A89A 3NKSA 3DK9A 3P1WA 3EF6A 4B65A 4CNKA 3ATQA 4EQSA 3BHFA 3F8PA 2XFPA 4YSYA 2GQWA 1CC4A 1ZK7A 2WOVA 3AXBA 3IF9A 4BK3A 3NLCA 4B69A 1Y56B 3SFEA 1E1LA 2EQ8A 1CBOA 4CCQA 2C72A 2Q0KA 2C70A 4ZCCA 3G5SA 3VQRA 3FG2P 3EANA 2WU5A 2OAMA 1CHUA 4IV9A 2VRMA 5J60A 3AE8A 1DXLA 4EQRA 1PJ7A 5JCMA 1CJ2A 1PHHA 4A99A 4XWZA 2XCGA 3M12A 1H83A 5FMHA 1GTHA 4K5SA 4H2RA 3RP7A 1NHPA 4B67A 1GRAA 2YVFA 1PBFA 3M0OA 1KNPA 4TM1A 3F8RA 1H81A 3FMWA 5JCIA 2BABA 4A7AA 3P9UA 1LQTA 3OZ2A 1Q1WA 3LZXA 4OVIA 1B4VA 2BCGG 1BZLA 2W0HA 1O95A 1YQ3A 3FPZA 4EIPA 2H88A 5EB4A 2C73A 2GMHA 2C76A 1REOA 3AE2A 3H4KA 3G5RA 4H4RA 2AQJA 3DJGX 2WU2A 4TLXA 4K22A 1O94A 1ZY8A 1YQZA 1DOBA 1SEZA 3RHAA 2YG6A 4H4PA 4GDEA 4HB9A 2GMJA 4NEVA 3NK1X 2BK3A 4IA6A 4ICYA 3FIMB 4YWOA 1S2QA 1UKVG 2YWLA 4TM0A 3NYFA 3ISHA 4U8JA 2YLRA 1IUWA 4X4JA 5J7XA 2V3BA 2FJBA 3ZYXA 3DK8A 1GRHA 1M64A 3UKQA 3CPIG 4Z26A 4GF7A 4UDRA 1K0IA 2R46A 2YQUA 3QVRA 3UKKA 1CJ3A 5BVAA 2WEUA 1TDEA 2GR1A 4A79A 4DSHA 3ABVA 2GR2A 3GMCA 5U1OA 3QFBA 2WS3A 3NG7X 4OPLA 1FL2A 1DJQA 1DOEA 3ATRA 2APGA 3NN0X 4JNAA 2GF3A 3DK4A 2WOWA 2XLRA 3BI2A 1Q9IA 4H2PA 1L9EA 3NHOX 1S3BA 3CPJG 4AOSA 3AEFA 3M13A 4PABA 4NEWA 4C3YA 1KF6A 1KDGA 3CN8A 3QSEA 2F5ZA 4U8PA 1EBDA 1FECA 3V3OA 4AP1A 1JU2A 4DGKA 3UOYA 1LVLA 1N4VA 3ICSA 4IVMB 4LU6A 4GDPA 1FOHA 2CULA 2WHDA 1KSUA 3CNJA 3GSIA 5EOWA 4YSXA 4Z25A 2X8GA 3BI5A 4KPRA 3COXA 2GR0A 2UZZA 3CGDA 1L9CA 2JB2A 4U8OA 1IUUA 1LV0A 5FS6A 3AE6A 3ZDNA 4ECHA 4TLZA 4P9SA 1D4EA 1KSSA 3NNEA 2OLNA 4X9MA 1Y0PA 3UKHA 4CNJA 1NAAA 2B9YA 2C7GA 3GDNA 1E39A 2IIDA 1GTEA 2R4JA 3ICTA 1H7XA 1XPQA 4EMIA 3AEEA 5FS7A 1IUTA 3AYJA 1B8SA 3AWIA 4OPTA 1E6EA 1QO8A 2X8HA 3UTGA 2VVLG 4H4TA 1XHCA 2VVLA 2XYOA 3GRTA 3KKJA 3LB8A 1K4QA 1BGNA 3GRSA 4U8MA 2FJEA 2YVJA 1EL5A 4EMJA 1JOAA 4YSZA 2XLTA 4ZCDA 2BC0A 3UP5A 2WPEA 2HQMA 3DA1A 1YY5A 2B76A 1GSNA 3AEAA 5M0ZA 3NH3X 3S5WA 4OPUA 1TDOA 1GRGA 2R9ZA 1KNRA 3DH9A 1COYA 2C65A 1D7LA 2Q0LA 2VOUA 4U8NA 3CPHG 4BURA 4GRTA 3AE4A 1LPFA 1NEKA 5JCNA 1ZMCA 1GPEA 1GRFA 1FEBA 1H82A 1ZP0A 1VG0A 3LJPA 3URHA 4J33A 3GDPA 1IUXA 1NG4A 2C75A 3I6DA 1RSGA 2XLUA 5C2TA 3CNTA 3VR9A 1GT8A 1RYIA 2NPXA 2C3CA 2XVEA 1NG3A 4NTCA 4D03A 2FJAA 1XANA 4UP3A 3IWAA 1GXFA 2V60A 1NDAA 2VRLA 2PHHA 3GD4A 4TM4A 1Q1RA 2WBAA 5U25A 2QCUA 2OALA 2Q7VA 2Y6QA 3K30A 4OPDA 3UKFA 3NIXA 2C66A 5FS9A 3DGZA 4WX1A 4A5LA 3NYEA 3SQPA 2BCPA 3WE0A 4CY8A 1JRXA 1FEAA 3L1RA 1EL8A 2GR3A 3K7MX 3LADA 1B37A 3CNDA 1XDIA 2DKIA 2XFOA 4H4WA 4ADWA 1IUSA 3Q9TA 1CC2A 4CBQA 1MO9A 2YG3A 4EM3A 1BWCA 4BJYA 5CKUA 1N4UA 2X3NA 3BI4A 2RGJA 1L9DA 1PJ5A 3AEGA 3KA7A 4K5RA 3V76A 1PN0A 4MJWA 3AE1A 1ELIA 2I0ZA 3NK2X 5IQ1A 3F8DA 4GCMA 1TDFA 4YTNA 1GERA 4OPCA 1Z6LA 1P2EA 3CTYA 4EIQA 2XFQA 3VR8A 2JK6A 2V6OA 3AEBA 4BV6A 3KVEA 1VDCA 1YQ4A 2ZZCA 3PS9A 4AP3A 1GV4A 3UKAA 1H7WA 5HYMA 5L46A 4EMWA 1NENA 3UOVA 4APNA 4U8KA 3REDA 3VRAA 1F8RA 2JKCA 4U2TA 5EB5A 5ER0A 2FBWA 1CL0A 4TM3A 3II4A 3NT6A 3CGEA 4AOXA 1D4DA 1DJNA 4YT0A 3AD7B 4Y4LA 2XVFA 2A87A 3ALMA 3ALJA 4YSHA 3AD8B 3GWDA 1PDHA 4J57A 2YLSA 1CF3A 1HYUA 2B9XA 5LV9A 3HZLA 1QJDA 4YTMA 4H4YA 3B6DA 4KX6A 4Z24A 1S3EA 1DOCA 3GMBA 3P4PA 4OPGA 1PJ6A 4IA5A 2R0PA 2E1MA 4N9XA 1JEHA 3IC9A 4HA6A 2YR4A 2B9WA 4I58A 3B3RA 2XVIA 3DGHA 3P4SA 2C67A 2VQBA 3AB1A 4CCRA 1ZKQA 4UDQA 2GV8A 3SM8A 1TYPA 5JCKA 3GD3A 2X8CA 1ZOVA 1ZX9A 1GRTA 4XXGA 1H84A 3KPFA 1D4CA 3NYCA 2BS2A 4GUVA 1GREA 2YVGA 3O0HA 3H8IA 2ACZA 5JCLA 2BS3A 3ITJA 4ZN0A 4IVOB 2YG4A 2C3DA 5U63A 4YTPA 1P2HA 4JY3A
chains in the Genus database with same CATH superfamily
4J36A 1OJ9A 1PBEA 2XLPA 4UDPA 4CY6A 2R0GA 2EQ6A 2QA2A 2YLXA 3R9UA 2BC1A 4K2XA 2R0CA 2BXRA 2QAEA 1VRQB 2WESA 2WP6A 2WPFA 1ZDLA 4OPIA 3UKPA 1BKWA 2Q6UA 3QSSA 4H4VA 4A6NB 3BNMA 2BRYA 3NTAA 1OJTA 5KVHA 3CGBA 2IVDA 4REKA 2QA1A 1OJDA 3LZWA 4G74A 2WP9A 4H4SA 4G6HA 3UCLA 5HY5A 5BRTA 3ZNPA 3EAOA 4YKGA 2CFYA 3AE3A 1LTXR 1B5QA 2XVJA 5HXIA 3RNMA 3V3NA 2B7RA 1JRZA 2WQYA 4H4UA 5U63A 3D1CA 2WPCA 3H8LA 4A65A 4D04A 4GAVA 4EQWA 2GEWA 4Z2UA 3DJDA 4G6GA 3SXIA 4PAAA 2JBVA 2YR6A 3DJJA 4RG3A 2RGOA 4RG4A 4Z2TA 2VQ7A 4FK1C 4O5QA 3PO7A 1NPXA 4I59A 4NZHA 4EM4A 4M52A 3L8KA 3DMEA 4NTDA 2YAUA 3DJEA 5M10A 1VQWA 4GAPA 2Z5YA 4USRA 3CUKA 1PS9A 4X9NA 1LJ1A 2CVJA 2WDQA 3UP4A 5KVIA 2BS4A 4JDRA 5GRTA 2RABA 4E0VA 3LOVA 3BNUA 2Z5XA 1GETA 3BHKA 3JSKA 4JN9A 3SY4A 2BACA 1LQUA 1DNCA 5CQFA 1VE9A 2TMDA 4H2NA 2A8XA 2YLWA 3KLJA 4FX9A 1K0JA 4J31A 2WP5A 1DAOA 3I3LA 4LIIA 4B63A 2XDOA 4YKFA 2YLZA 2V5ZA 1S2YA 3CNPA 1PXCA 2XFNA 4H4QA 3SZFA 2GVCA 5KOWA 3AE5A 1EL7A 3NRNA 4FDCB 2GB0A 1M6IA 2EQ7A 1PXBA 3IHGA 2C64A 3ZNQA 5BULA 2IVEA 3NGCX 4AT0A 1L0VA 3FBSA 4B66A 2XFUA 4YXDA 1IUVA 3QJ4A 4OCGA 4YJGB 2GQFA 3CIRA 4U2SA 3C4NA 4YJDA 4BJZA 1TDKA 2BRAA 5BUKA 3AD9B 1PBBA 1AOGA 3UTHA 2VZ2A 2YM1A 1JRYA 1ZMDA 3RP6A 1TRBA 1K0LA 2XVHA 1GOSA 4Z43A 2ZZ0A 3AYLA 3LXDA 2OLOA 2WDVA 2WOIA 4K8DA 4B68A 2EQ9A 2B7SA 3UOXA 1F3PA 3ADAB 1CJ4A 1GNDA 1H6VA 3D8XA 3T2KA 3G5QA 4YJFA 2E4GA 5KMQA 4C77A 4Z2RA 1E1KA 3C96A 3Q6JA 4LA1A 2XLSA 4BK1A 3K7QX 1PBCA 1NHRA 3WGTA 3K7TA 5TR3A 2BK5A 4JY2A 3KD9A 4Y4MA 4B1BA 3SGLA 3ALLA 4J2WA 4Z44A 1DDOA 1CJCA 2RGHA 4C74A 4A6NA 1D7YA 3CGCA 4H4ZA 2CDUA 4H2QA 2VVMA 2YM2A 1NHSA 3SZCA 5KRQA 5KMSA 1RP0A 3P4QA 1D5TA 1GESA 2YR5A 1IJHA 1E7PA 1W4XA 3GWFA 3RP8A 3NN6X 2NVKX 3GYIA 1MXTA 1NHQA 1ONFA 3SZWA 1FCDA 1OJAA 2J3NA 2YG5A 3C4AA 2GH5A 3S61A 4A9WA 1CC6A 2YLTA 3OC4A 3UKLA 2V61A 2R45A 3T37A 4B64A 5C3JA 3UTFA 2AR8A 3UTEA 3AYIA 1V59A 4XWRA 2GRTA 5DBJA 3AE7A 2YG7A 4DSGA 2E49A 3E1TA 4II3A 1PBDA 3QSMA 4NWZA 1BGJA 2BK4A 3W4IA 3AEDA 2BYBA 4JNQA 2GAHB 3W4KA 1N4WA 2TPRA 4U8IA 2E5VA 5IPYA 1GRBA 4U8LA 4QFDA 1KFYA 4C3XA 1VG9A 1H86A 3QVPA 2DKHA 1TYTA 2X50A 1F8WA 2E4AA 4GR1A 4K7ZA 1JNRA 2BXSA 2JB1A 2JB3A 2GAGB 2JAEA 4J34A 4EQXA 1C0PA 3ZNOA 1O5WA 3UOZA 4II2A 1Y56A 4FK1A 2WETA 4H7UA 3IHMA 5EBKA 4C5OA 1E1MA 4USQA 4NTEA 4WCTA 2ARDA 3P4RA 3SYIA 4U2LA 3GYJA 4O5UA 2PYXA 2BA9A 1EL9A 3AECA 5KWFA 5IQ4A 5GSNA 3QFAA 4CRTA 2V3AA 3KU9A 5FS8A 2WDRA 1DODA 1MOKA 1N1PA 1TDNA 2FJDA 1F6MA 4Y4NA 2H89A 3VRDB 3SZ0A 2ZZBA 2OA1A 1ZOYA 3AE9A 3HYWA 4DNAA 4YJGA 2X99A 2Y6RA 4AT2A 4BK2A 1E1NA 4RSLA 1OJCA 1GALA 5HHFA 3VRBA 1QLBA 1BF3A 4JQ9A 1PXAA 4J56A 1JNZA 4H50A 3NK0X 3SFDA 3CNSA 2R4EA 5KXJA 1F8SA 1X31B 5KOXA 1YKJA 3PVCA 2ZBWA 4H4XA 2AAQA 1GEUA 3EPTA 3ICRA 3NTDA 2O9ZA 2A89A 3NKSA 3DK9A 3P1WA 3EF6A 4B65A 4CNKA 3ATQA 4EQSA 3BHFA 3F8PA 2XFPA 4YSYA 2GQWA 3T14A 1CC4A 1ZK7A 3AXBA 3IF9A 4BK3A 2WOVA 3NLCA 4B69A 1Y56B 3SFEA 1E1LA 2EQ8A 1CBOA 4CCQA 2C72A 2Q0KA 2C70A 4ZCCA 3VQRA 3G5SA 3FG2P 3EANA 2WU5A 2OAMA 1CHUA 4IV9A 3HYVA 2VRMA 5J60A 3AE8A 1DXLA 4EQRA 1PJ7A 5JCMA 1CJ2A 1PHHA 4A99A 4XWZA 2XCGA 3M12A 1H83A 5FMHA 1GTHA 4K5SA 3ZNNA 4H2RA 3RP7A 1NHPA 2E48A 4B67A 1GRAA 2YVFA 1PBFA 3M0OA 1KNPA 4TM1A 3F8RA 1H81A 3FMWA 5JCIA 2BABA 4A7AA 3P9UA 3OZ2A 1LQTA 3T2ZA 1Q1WA 3LZXA 4OVIA 1B4VA 2BCGG 1BZLA 2W0HA 1O95A 1YQ3A 3FPZA 4EIPA 2H88A 5EB4A 2C73A 2GMHA 2C76A 1REOA 3AE2A 3H4KA 3G5RA 4H4RA 2AQJA 3DJGX 2WU2A 4TLXA 4K22A 1O94A 1ZY8A 1YQZA 1DOBA 1SEZA 3RHAA 2YG6A 4H4PA 4GDEA 4HB9A 2GMJA 4NEVA 3NK1X 4IA6A 2BK3A 4ICYA 3FIMB 4YWOA 1S2QA 1UKVG 2YWLA 4TM0A 3NYFA 3ISHA 4U8JA 2YLRA 1IUWA 4X4JA 1C0KA 2V3BA 5J7XA 2FJBA 3ZYXA 3DK8A 1GRHA 1M64A 3UKQA 3CPIG 4Z26A 3T0KA 4GF7A 4UDRA 1K0IA 2R46A 2YQUA 3QVRA 3UKKA 1CJ3A 4YJHB 5BVAA 2WEUA 3HYXA 1TDEA 2GR1A 4A79A 4DSHA 3ABVA 2GR2A 3GMCA 5U1OA 3QFBA 2WS3A 3NG7X 4OPLA 1FL2A 1DJQA 1DOEA 3ATRA 2APGA 3NN0X 4JNAA 5KMRA 2GF3A 3DK4A 2WOWA 2XLRA 3BI2A 1Q9IA 4H2PA 1L9EA 3NHOX 2DU8A 1S3BA 3CPJG 4AOSA 3AEFA 3M13A 4QFCA 4PABA 4NEWA 4C3YA 1KF6A 1KDGA 3CN8A 3QSEA 2F5ZA 4U8PA 1EBDA 1FECA 4G9KA 3V3OA 4AP1A 1JU2A 4DGKA 3UOYA 1EVIA 1LVLA 1N4VA 3ICSA 4IVMB 4LU6A 4GDPA 1FOHA 3GSIA 2CULA 1KSUA 2WHDA 3CNJA 5EOWA 4YSXA 1C0LA 2X8GA 4Z25A 3BI5A 4KPRA 3COXA 2UZZA 2GR0A 3CGDA 1L9CA 2JB2A 4U8OA 1IUUA 1C0IA 1LV0A 3AE6A 5FS6A 3ZDNA 4ECHA 4TLZA 4P9SA 1KSSA 4X9MA 1D4EA 2OLNA 3NNEA 1Y0PA 3UKHA 4CNJA 1NAAA 2B9YA 2C4CA 2C7GA 3GDNA 1E39A 5KMPA 2IIDA 1GTEA 2R4JA 3ICTA 1H7XA 1XPQA 4EMIA 3AEEA 5FS7A 1IUTA 2E82A 3AYJA 1B8SA 4OPTA 3UTGA 1E6EA 1QO8A 2X8HA 2VVLG 4H4TA 1XHCA 2VVLA 2XYOA 3GRTA 3KKJA 3LB8A 1K4QA 1BGNA 3GRSA 4U8MA 2FJEA 2YVJA 1EL5A 4EMJA 1JOAA 3T31A 2XLTA 4YSZA 4ZCDA 2BC0A 3UP5A 2WPEA 2HQMA 3DA1A 1YY5A 2B76A 1GSNA 3AEAA 5M0ZA 3NH3X 3S5WA 4OPUA 1TDOA 1AN9A 1GRGA 2R9ZA 1KNRA 3DH9A 1COYA 2C65A 1D7LA 2Q0LA 2VOUA 4U8NA 3CPHG 4BURA 4GRTA 3AE4A 1LPFA 1NEKA 5JCNA 1ZMCA 1GPEA 1GRFA 1FEBA 1H82A 1VG0A 1ZP0A 3LJPA 3URHA 4J33A 3GDPA 1IUXA 1NG4A 2C75A 3I6DA 1RSGA 2XLUA 5C2TA 3CNTA 3VR9A 1GT8A 1RYIA 2NPXA 2C3CA 2XVEA 1NG3A 4NTCA 4D03A 2FJAA 1XANA 4UP3A 3IWAA 1GXFA 2V60A 1NDAA 2VRLA 2PHHA 3GD4A 4TM4A 1Q1RA 2WBAA 5U25A 2QCUA 2OALA 2Q7VA 2Y6QA 3K30A 4OPDA 3UKFA 3NIXA 2C66A 5FS9A 4YJHA 3DGZA 4WX1A 3NYEA 4A5LA 3SQPA 2BCPA 3WE0A 3T2YA 4CY8A 1JRXA 4NNJA 1FEAA 3L1RA 1EL8A 2GR3A 3K7MX 3KPKA 3LADA 1B37A 3CNDA 3W4JA 1XDIA 2DKIA 2XFOA 4H4WA 4ADWA 1IUSA 3Q9TA 1CC2A 4CBQA 1MO9A 2YG3A 4EM3A 1BWCA 4BJYA 5CKUA 1N4UA 2X3NA 3BI4A 2RGJA 1L9DA 1PJ5A 3AEGA 3KA7A 4K5RA 3V76A 1PN0A 4MJWA 3AE1A 1ELIA 2I0ZA 3NK2X 5IQ1A 3F8DA 4GCMA 1TDFA 4YTNA 1GERA 4OPCA 1Z6LA 1P2EA 3CTYA 4EIQA 2XFQA 3VR8A 3GYXA 2JK6A 2V6OA 3AEBA 4BV6A 3KVEA 1VDCA 1YQ4A 3PS9A 2ZZCA 4AP3A 1GV4A 3UKAA 1H7WA 5HYMA 5L46A 4EMWA 1NENA 3UOVA 3SX6A 4U8KA 4APNA 3REDA 3VRAA 1F8RA 2JKCA 4U2TA 5EB5A 5ER0A 2FBWA 1CL0A 4TM3A 3CMMA 3II4A 3NT6A 3CGEA 4AOXA 1D4DA 1DJNA 4YT0A 3AD7B 4Y4LA 2XVFA 2A87A 3ALMA 3ALJA 4YSHA 1KIFA 3AD8B 3GWDA 1PDHA 4J57A 2YLSA 1CF3A 1HYUA 2B9XA 5LV9A 4G73A 3HZLA 1QJDA 4YTMA 4H4YA 3B6DA 4KX6A 4Z24A 1P2HA 1DOCA 3GMBA 1S3EA 3P4PA 4OPGA 1PJ6A 4IA5A 2R0PA 2E1MA 4N9XA 5KNLA 1JEHA 3IC9A 4HA6A 2YR4A 2B9WA 4I58A 3B3RA 2XVIA 3DGHA 3P4SA 2C67A 2VQBA 3AB1A 4YTPA 4CCRA 1ZKQA 4UDQA 2GV8A 3SM8A 1TYPA 5JCKA 3GD3A 2X8CA 1ZOVA 1ZX9A 1GRTA 4XXGA 1H84A 3KPFA 1D4CA 3NYCA 2BS2A 4GUVA 1GREA 2YVGA 3O0HA 3H8IA 2ACZA 5JCLA 2BS3A 3ITJA 4ZN0A 4IVOB 2YG4A 2C3DA 3G3EA 4YJFB 3AWIA 4JY3A
chains in the Genus database with same CATH topology
4J36A 1OJ9A 1PBEA 2XLPA 4UDPA 4CY6A 2R0GA 2EQ6A 2QA2A 2YLXA 3R9UA 2BC1A 4K2XA 2R0CA 2BXRA 2QAEA 1VRQB 2WESA 2WP6A 2WPFA 1ZDLA 4OPIA 3UKPA 1BKWA 2Q6UA 3QSSA 4H4VA 4A6NB 3BNMA 2BRYA 3NTAA 1OJTA 5KVHA 3CGBA 2IVDA 4REKA 2QA1A 1OJDA 3LZWA 4G74A 2WP9A 4H4SA 4G6HA 3UCLA 5HY5A 5BRTA 3EAOA 4YKGA 2CFYA 3AE3A 1LTXR 1B5QA 2XVJA 5HXIA 3RNMA 3V3NA 2B7RA 1JRZA 2WQYA 4H4UA 3D1CA 2WPCA 3H8LA 4A65A 4D04A 4GAVA 4EQWA 2GEWA 4Z2UA 3DJDA 4G6GA 3SXIA 2JBVA 4PAAA 2YR6A 3DJJA 4RG3A 2RGOA 4RG4A 4Z2TA 2VQ7A 4FK1C 4O5QA 3PO7A 1NPXA 4I59A 4NZHA 4EM4A 4M52A 3L8KA 3DMEA 4NTDA 2YAUA 3DJEA 5M10A 1VQWA 4GAPA 2Z5YA 4USRA 1PS9A 4X9NA 1LJ1A 2CVJA 2WDQA 3UP4A 5KVIA 2BS4A 4JDRA 5GRTA 2RABA 4E0VA 3LOVA 3BNUA 2Z5XA 1GETA 3BHKA 3JSKA 4JN9A 3SY4A 2BACA 1LQUA 1DNCA 5CQFA 2TMDA 4H2NA 2A8XA 2YLWA 3KLJA 4FX9A 1K0JA 4J31A 2WP5A 4LIIA 3I3LA 4B63A 2XDOA 4YKFA 2YLZA 2V5ZA 1S2YA 3CNPA 1PXCA 2XFNA 4H4QA 3SZFA 2GVCA 5KOWA 3AE5A 1EL7A 3NRNA 4FDCB 1M6IA 2GB0A 2EQ7A 1PXBA 3IHGA 2C64A 5BULA 2IVEA 3NGCX 4AT0A 1L0VA 3FBSA 4B66A 2XFUA 4YXDA 1IUVA 3QJ4A 4OCGA 2GQFA 3CIRA 4U2SA 3C4NA 4BJZA 1TDKA 2BRAA 5BUKA 3AD9B 1PBBA 1AOGA 3UTHA 2VZ2A 2YM1A 1JRYA 1ZMDA 3RP6A 1TRBA 1K0LA 2XVHA 1GOSA 4Z43A 2ZZ0A 3AYLA 3LXDA 2OLOA 2WDVA 2WOIA 4K8DA 4B68A 2EQ9A 2B7SA 3UOXA 1F3PA 3ADAB 1CJ4A 1GNDA 1H6VA 3D8XA 3T2KA 3G5QA 2E4GA 5KMQA 4C77A 4Z2RA 1E1KA 3C96A 3Q6JA 4LA1A 2XLSA 4BK1A 3K7QX 1PBCA 1NHRA 5TR3A 3K7TA 2BK5A 4JY2A 3KD9A 4Y4MA 4B1BA 3SGLA 3ALLA 4J2WA 4Z44A 1CJCA 2RGHA 4C74A 4A6NA 1D7YA 3CGCA 4H4ZA 2CDUA 4H2QA 2VVMA 2YM2A 1NHSA 3SZCA 5KRQA 5KMSA 1RP0A 3P4QA 1D5TA 1GESA 2YR5A 1IJHA 1E7PA 1W4XA 3GWFA 3RP8A 3NN6X 2NVKX 3GYIA 1MXTA 1NHQA 1ONFA 3SZWA 1FCDA 1OJAA 2J3NA 2YG5A 3C4AA 2GH5A 3S61A 4A9WA 1CC6A 2YLTA 3OC4A 3UKLA 2V61A 2R45A 3T37A 4B64A 5C3JA 3UTFA 2AR8A 3UTEA 3AYIA 1V59A 4XWRA 2GRTA 5DBJA 3AE7A 2YG7A 4DSGA 3E1TA 4II3A 1PBDA 3QSMA 4NWZA 1BGJA 2BK4A 3AEDA 2BYBA 4JNQA 2GAHB 2TPRA 1N4WA 4U8IA 2E5VA 5IPYA 1GRBA 4U8LA 1KFYA 4C3XA 1VG9A 1H86A 3QVPA 2DKHA 1TYTA 2X50A 1F8WA 4GR1A 4K7ZA 1JNRA 2BXSA 2JB1A 2JB3A 2GAGB 2JAEA 4J34A 4EQXA 1O5WA 3UOZA 4II2A 1Y56A 4FK1A 2WETA 4H7UA 3IHMA 5EBKA 4C5OA 1E1MA 4USQA 4NTEA 4WCTA 2ARDA 3P4RA 3SYIA 4U2LA 3GYJA 4O5UA 2PYXA 2BA9A 1EL9A 3AECA 5KWFA 5IQ4A 5GSNA 3QFAA 4CRTA 2V3AA 3KU9A 5FS8A 2WDRA 1DODA 1MOKA 1N1PA 1TDNA 2FJDA 1F6MA 4Y4NA 2H89A 3VRDB 3SZ0A 2ZZBA 2OA1A 1ZOYA 3AE9A 3HYWA 4DNAA 2X99A 2Y6RA 4AT2A 4BK2A 1E1NA 1OJCA 4RSLA 1GALA 5HHFA 3VRBA 1QLBA 1BF3A 4JQ9A 1PXAA 4J56A 1JNZA 4H50A 3NK0X 3SFDA 3CNSA 2R4EA 5KXJA 1F8SA 1X31B 5KOXA 1YKJA 2ZBWA 3PVCA 4H4XA 2AAQA 1GEUA 3EPTA 3ICRA 3NTDA 2O9ZA 2A89A 3NKSA 3DK9A 3P1WA 3EF6A 4B65A 4CNKA 3ATQA 4EQSA 3BHFA 3F8PA 2XFPA 4YSYA 2GQWA 3T14A 1CC4A 1ZK7A 4BK3A 2WOVA 3AXBA 3IF9A 3NLCA 4B69A 1Y56B 3SFEA 1E1LA 2EQ8A 1CBOA 4CCQA 2C72A 2Q0KA 2C70A 4ZCCA 3G5SA 3VQRA 3FG2P 3EANA 2WU5A 2OAMA 1CHUA 4IV9A 3HYVA 2VRMA 5J60A 3AE8A 1DXLA 4EQRA 1PJ7A 5JCMA 1CJ2A 1PHHA 4A99A 4XWZA 2XCGA 3M12A 1H83A 5FMHA 1GTHA 4K5SA 4H2RA 3RP7A 1NHPA 4B67A 1GRAA 2YVFA 1PBFA 3M0OA 1KNPA 4TM1A 3F8RA 1H81A 3FMWA 5JCIA 2BABA 4A7AA 3P9UA 1LQTA 3OZ2A 3T2ZA 1Q1WA 3LZXA 4OVIA 1B4VA 2BCGG 1BZLA 2W0HA 1O95A 1YQ3A 3FPZA 4EIPA 2H88A 5EB4A 2C73A 2GMHA 2C76A 1REOA 3AE2A 3H4KA 3G5RA 4H4RA 2AQJA 3DJGX 2WU2A 4TLXA 4K22A 1O94A 1ZY8A 1YQZA 1DOBA 1SEZA 3RHAA 2YG6A 4H4PA 4GDEA 4HB9A 2GMJA 4NEVA 3NK1X 4IA6A 2BK3A 4ICYA 3FIMB 4YWOA 1S2QA 1UKVG 2YWLA 4TM0A 3NYFA 3ISHA 4U8JA 2YLRA 1IUWA 4X4JA 5J7XA 2V3BA 2FJBA 3ZYXA 3DK8A 1GRHA 1M64A 3UKQA 3CPIG 4Z26A 3T0KA 4GF7A 4UDRA 1K0IA 2R46A 2YQUA 3QVRA 3UKKA 1CJ3A 5BVAA 2WEUA 3HYXA 1TDEA 2GR1A 4A79A 4DSHA 3ABVA 2GR2A 3GMCA 5U1OA 3QFBA 2WS3A 3NG7X 4OPLA 1FL2A 1DJQA 1DOEA 3ATRA 2APGA 3NN0X 4JNAA 5KMRA 2GF3A 3DK4A 2WOWA 2XLRA 3BI2A 1Q9IA 4H2PA 1L9EA 3NHOX 1S3BA 3CPJG 4AOSA 3AEFA 3M13A 4PABA 4NEWA 4C3YA 1KF6A 1KDGA 3CN8A 3QSEA 2F5ZA 4U8PA 1EBDA 1FECA 4G9KA 3V3OA 4AP1A 1JU2A 4DGKA 3UOYA 1LVLA 1N4VA 3ICSA 4IVMB 4LU6A 4GDPA 1FOHA 2CULA 2WHDA 1KSUA 3CNJA 3GSIA 5EOWA 4YSXA 4Z25A 2X8GA 3BI5A 4KPRA 3COXA 2GR0A 2UZZA 3CGDA 1L9CA 2JB2A 4U8OA 1IUUA 1LV0A 5FS6A 3AE6A 3ZDNA 4ECHA 4TLZA 4P9SA 1D4EA 1KSSA 3NNEA 2OLNA 4X9MA 1Y0PA 3UKHA 4CNJA 1NAAA 2B9YA 2C4CA 2C7GA 3GDNA 1E39A 5KMPA 2IIDA 1GTEA 2R4JA 3ICTA 1H7XA 1XPQA 4EMIA 3AEEA 5FS7A 1IUTA 3AYJA 1B8SA 3AWIA 4OPTA 1E6EA 1QO8A 2X8HA 3UTGA 2VVLG 4H4TA 1XHCA 2VVLA 2XYOA 3GRTA 3KKJA 3LB8A 1K4QA 1BGNA 3GRSA 4U8MA 2FJEA 2YVJA 1EL5A 4EMJA 1JOAA 3T31A 2XLTA 4YSZA 4ZCDA 2BC0A 3UP5A 2WPEA 2HQMA 3DA1A 1YY5A 2B76A 1GSNA 3AEAA 5M0ZA 3NH3X 3S5WA 4OPUA 1TDOA 1GRGA 2R9ZA 1KNRA 3DH9A 1COYA 2C65A 1D7LA 2Q0LA 2VOUA 4U8NA 3CPHG 4BURA 4GRTA 3AE4A 1LPFA 1NEKA 5JCNA 1ZMCA 1GPEA 1GRFA 1FEBA 1H82A 1ZP0A 1VG0A 3LJPA 3URHA 4J33A 3GDPA 1IUXA 1NG4A 2C75A 3I6DA 1RSGA 2XLUA 5C2TA 3CNTA 3VR9A 1GT8A 1RYIA 2NPXA 2C3CA 2XVEA 1NG3A 4NTCA 4D03A 2FJAA 1XANA 4UP3A 3IWAA 1GXFA 2V60A 1NDAA 2VRLA 2PHHA 3GD4A 4TM4A 1Q1RA 2WBAA 5U25A 2QCUA 2OALA 2Q7VA 2Y6QA 3K30A 4OPDA 3UKFA 3NIXA 2C66A 5FS9A 3DGZA 4WX1A 4A5LA 3NYEA 3SQPA 2BCPA 3WE0A 3T2YA 4CY8A 1JRXA 4NNJA 1FEAA 3L1RA 1EL8A 2GR3A 3K7MX 3KPKA 3LADA 1B37A 3CNDA 1XDIA 2DKIA 2XFOA 4H4WA 4ADWA 1IUSA 3Q9TA 1CC2A 4CBQA 1MO9A 2YG3A 4EM3A 1BWCA 4BJYA 5CKUA 1N4UA 2X3NA 3BI4A 2RGJA 1L9DA 1PJ5A 3AEGA 3KA7A 4K5RA 3V76A 1PN0A 4MJWA 3AE1A 1ELIA 2I0ZA 3NK2X 5IQ1A 3F8DA 4GCMA 1TDFA 4YTNA 1GERA 4OPCA 1Z6LA 1P2EA 3CTYA 4EIQA 2XFQA 3VR8A 3GYXA 2JK6A 2V6OA 3AEBA 4BV6A 3KVEA 1VDCA 1YQ4A 2ZZCA 3PS9A 4AP3A 1GV4A 3UKAA 1H7WA 5HYMA 5L46A 4EMWA 1NENA 3UOVA 3SX6A 4U8KA 4APNA 3REDA 3VRAA 1F8RA 2JKCA 4U2TA 5EB5A 5ER0A 2FBWA 1CL0A 4TM3A 3CMMA 3II4A 3NT6A 3CGEA 4AOXA 1D4DA 1DJNA 4YT0A 3AD7B 4Y4LA 2XVFA 2A87A 3ALMA 3ALJA 4YSHA 3AD8B 3GWDA 1PDHA 4J57A 2YLSA 1CF3A 1HYUA 2B9XA 5LV9A 4G73A 3HZLA 1QJDA 4YTMA 4H4YA 3B6DA 4KX6A 4Z24A 1S3EA 1DOCA 3GMBA 3P4PA 4OPGA 1PJ6A 4IA5A 2R0PA 2E1MA 4N9XA 5KNLA 1JEHA 3IC9A 4HA6A 2YR4A 2B9WA 4I58A 3B3RA 2XVIA 3DGHA 3P4SA 2C67A 2VQBA 3AB1A 4CCRA 1ZKQA 4UDQA 2GV8A 3SM8A 1TYPA 5JCKA 3GD3A 2X8CA 1ZOVA 1ZX9A 1GRTA 4XXGA 1H84A 3KPFA 1D4CA 3NYCA 2BS2A 4GUVA 1GREA 2YVGA 3O0HA 3H8IA 2ACZA 5JCLA 2BS3A 3ITJA 4ZN0A 4IVOB 2YG4A 2C3DA 5U63A 4YTPA 1P2HA 4JY3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J36 A;  1OJ9 A;  1PBE A;  2XLP A;  4UDP A;  4CY6 A;  2R0G A;  2EQ6 A;  2QA2 A;  2YLX A;  3R9U A;  2BC1 A;  4K2X A;  2R0C A;  2BXR A;  2QAE A;  1VRQ B;  2WES A;  2WP6 A;  2WPF A;  1ZDL A;  4OPI A;  3UKP A;  1BKW A;  2Q6U A;  3QSS A;  4H4V A;  4A6N B;  3BNM A;  3NTA A;  1OJT A;  5KVH A;  3CGB A;  2IVD A;  4REK A;  2QA1 A;  1OJD A;  3LZW A;  2WP9 A;  4H4S A;  3UCL A;  5HY5 A;  5BRT A;  3EAO A;  4YKG A;  2CFY A;  3AE3 A;  1LTX R;  1B5Q A;  2XVJ A;  5HXI A;  3RNM A;  3V3N A;  2B7R A;  1JRZ A;  2WQY A;  4H4U A;  3D1C A;  2WPC A;  3H8L A;  4A65 A;  4D04 A;  4EQW A;  4Z2U A;  2GEW A;  3DJD A;  2JBV A;  4PAA A;  2YR6 A;  3DJJ A;  4RG3 A;  2RGO A;  4RG4 A;  4Z2T A;  2VQ7 A;  4FK1 C;  4O5Q A;  3PO7 A;  1NPX A;  4I59 A;  4NZH A;  4EM4 A;  4M52 A;  3L8K A;  3DME A;  4NTD A;  2YAU A;  3DJE A;  5M10 A;  1VQW A;  2Z5Y A;  4USR A;  1PS9 A;  4X9N A;  1LJ1 A;  2CVJ A;  2WDQ A;  3UP4 A;  5KVI A;  2BS4 A;  4JDR A;  5GRT A;  2RAB A;  4E0V A;  3LOV A;  3BNU A;  2Z5X A;  1GET A;  3BHK A;  3JSK A;  4JN9 A;  2BAC A;  1LQU A;  1DNC A;  5CQF A;  2TMD A;  4H2N A;  2A8X A;  2YLW A;  3KLJ A;  4FX9 A;  1K0J A;  4J31 A;  2WP5 A;  4LII A;  3I3L A;  4B63 A;  2XDO A;  4YKF A;  2YLZ A;  2V5Z A;  1S2Y A;  3CNP A;  1PXC A;  2XFN A;  4H4Q A;  5KOW A;  2GVC A;  3AE5 A;  1EL7 A;  3NRN A;  4FDC B;  1M6I A;  2GB0 A;  2EQ7 A;  1PXB A;  3IHG A;  2C64 A;  5BUL A;  2IVE A;  3NGC X;  4AT0 A;  1L0V A;  3FBS A;  4B66 A;  2XFU A;  4YXD A;  1IUV A;  3QJ4 A;  4OCG A;  2GQF A;  3CIR A;  4U2S A;  3C4N A;  1TDK A;  4BJZ A;  5BUK A;  3AD9 B;  1PBB A;  1AOG A;  3UTH A;  2VZ2 A;  2YM1 A;  1JRY A;  1ZMD A;  3RP6 A;  1TRB A;  1K0L A;  2XVH A;  1GOS A;  4Z43 A;  2ZZ0 A;  3AYL A;  3LXD A;  2OLO A;  2WDV A;  2WOI A;  4K8D A;  4B68 A;  2EQ9 A;  2B7S A;  3UOX A;  1F3P A;  3ADA B;  1CJ4 A;  1GND A;  1H6V A;  3D8X A;  3G5Q A;  2E4G A;  4C77 A;  4Z2R A;  1E1K A;  3C96 A;  3Q6J A;  4LA1 A;  2XLS A;  3K7Q X;  4BK1 A;  1PBC A;  1NHR A;  5TR3 A;  3K7T A;  2BK5 A;  4JY2 A;  3KD9 A;  4Y4M A;  4B1B A;  3SGL A;  3ALL A;  4J2W A;  4Z44 A;  1CJC A;  2RGH A;  4C74 A;  4A6N A;  1D7Y A;  3CGC A;  4H4Z A;  2CDU A;  4H2Q A;  2VVM A;  2YM2 A;  1NHS A;  5KRQ A;  1RP0 A;  3P4Q A;  1D5T A;  1GES A;  2YR5 A;  1IJH A;  1E7P A;  1W4X A;  3GWF A;  3NN6 X;  3RP8 A;  2NVK X;  3GYI A;  1MXT A;  1NHQ A;  1ONF A;  1FCD A;  1OJA A;  2J3N A;  2YG5 A;  3C4A A;  2GH5 A;  3S61 A;  4A9W A;  1CC6 A;  2YLT A;  3OC4 A;  3UKL A;  2V61 A;  2R45 A;  3T37 A;  4B64 A;  5C3J A;  3UTF A;  2AR8 A;  3UTE A;  3AYI A;  1V59 A;  4XWR A;  2GRT A;  5DBJ A;  3AE7 A;  2YG7 A;  4DSG A;  3E1T A;  1PBD A;  3QSM A;  1BGJ A;  2BK4 A;  3AED A;  2BYB A;  4JNQ A;  2GAH B;  2TPR A;  1N4W A;  4U8I A;  2E5V A;  5IPY A;  1GRB A;  4U8L A;  1KFY A;  4C3X A;  1VG9 A;  1H86 A;  3QVP A;  2DKH A;  1TYT A;  2X50 A;  1F8W A;  4GR1 A;  4K7Z A;  1JNR A;  2BXS A;  2JB1 A;  2JB3 A;  2GAG B;  2JAE A;  4J34 A;  4EQX A;  1O5W A;  3UOZ A;  1Y56 A;  4FK1 A;  2WET A;  4H7U A;  3IHM A;  5EBK A;  4C5O A;  1E1M A;  4USQ A;  4NTE A;  4WCT A;  2ARD A;  3P4R A;  4U2L A;  3GYJ A;  4O5U A;  2PYX A;  2BA9 A;  1EL9 A;  3AEC A;  5KWF A;  5IQ4 A;  5GSN A;  3QFA A;  4CRT A;  2V3A A;  3KU9 A;  5FS8 A;  2WDR A;  1DOD A;  1MOK A;  1N1P A;  1TDN A;  2FJD A;  1F6M A;  4Y4N A;  2H89 A;  3VRD B;  2ZZB A;  2OA1 A;  1ZOY A;  3AE9 A;  4DNA A;  2X99 A;  2Y6R A;  4AT2 A;  1E1N A;  1OJC A;  4RSL A;  3VRB A;  1GAL A;  5HHF A;  4BK2 A;  1QLB A;  1BF3 A;  4JQ9 A;  1PXA A;  4J56 A;  1JNZ A;  4H50 A;  3NK0 X;  3SFD A;  3CNS A;  2R4E A;  5KXJ A;  1F8S A;  1X31 B;  5KOX A;  1YKJ A;  2ZBW A;  3PVC A;  4H4X A;  2AAQ A;  1GEU A;  3EPT A;  3ICR A;  3NTD A;  2O9Z A;  2A89 A;  3NKS A;  3DK9 A;  3P1W A;  3EF6 A;  4B65 A;  4CNK A;  3ATQ A;  4EQS A;  3BHF A;  3F8P A;  2XFP A;  4YSY A;  2GQW A;  1CC4 A;  1ZK7 A;  2WOV A;  3AXB A;  3IF9 A;  4BK3 A;  3NLC A;  4B69 A;  1Y56 B;  3SFE A;  1E1L A;  2EQ8 A;  1CBO A;  4CCQ A;  2C72 A;  2Q0K A;  2C70 A;  4ZCC A;  3G5S A;  3VQR A;  3FG2 P;  3EAN A;  2WU5 A;  2OAM A;  1CHU A;  4IV9 A;  2VRM A;  5J60 A;  3AE8 A;  1DXL A;  4EQR A;  1PJ7 A;  5JCM A;  1CJ2 A;  1PHH A;  4A99 A;  4XWZ A;  2XCG A;  3M12 A;  1H83 A;  5FMH A;  1GTH A;  4K5S A;  4H2R A;  3RP7 A;  1NHP A;  4B67 A;  1GRA A;  2YVF A;  1PBF A;  3M0O A;  1KNP A;  4TM1 A;  3F8R A;  1H81 A;  3FMW A;  5JCI A;  2BAB A;  4A7A A;  3P9U A;  1LQT A;  3OZ2 A;  1Q1W A;  3LZX A;  4OVI A;  1B4V A;  2BCG G;  1BZL A;  2W0H A;  1O95 A;  1YQ3 A;  3FPZ A;  4EIP A;  2H88 A;  5EB4 A;  2C73 A;  2GMH A;  2C76 A;  1REO A;  3AE2 A;  3H4K A;  3G5R A;  4H4R A;  2AQJ A;  3DJG X;  2WU2 A;  4TLX A;  4K22 A;  1O94 A;  1ZY8 A;  1YQZ A;  1DOB A;  1SEZ A;  3RHA A;  2YG6 A;  4H4P A;  4GDE A;  4HB9 A;  2GMJ A;  4NEV A;  3NK1 X;  2BK3 A;  4IA6 A;  4ICY A;  3FIM B;  4YWO A;  1S2Q A;  1UKV G;  2YWL A;  4TM0 A;  3NYF A;  3ISH A;  4U8J A;  2YLR A;  1IUW A;  4X4J A;  5J7X A;  2V3B A;  2FJB A;  3ZYX A;  3DK8 A;  1GRH A;  1M64 A;  3UKQ A;  3CPI G;  4Z26 A;  4GF7 A;  4UDR A;  1K0I A;  2R46 A;  2YQU A;  3QVR A;  3UKK A;  1CJ3 A;  5BVA A;  2WEU A;  1TDE A;  2GR1 A;  4A79 A;  4DSH A;  3ABV A;  2GR2 A;  3GMC A;  5U1O A;  3QFB A;  2WS3 A;  3NG7 X;  4OPL A;  1FL2 A;  1DJQ A;  1DOE A;  3ATR A;  2APG A;  3NN0 X;  4JNA A;  2GF3 A;  3DK4 A;  2WOW A;  2XLR A;  3BI2 A;  1Q9I A;  4H2P A;  1L9E A;  3NHO X;  1S3B A;  3CPJ G;  4AOS A;  3AEF A;  3M13 A;  4PAB A;  4NEW A;  4C3Y A;  1KF6 A;  1KDG A;  3CN8 A;  3QSE A;  2F5Z A;  4U8P A;  1EBD A;  1FEC A;  3V3O A;  4AP1 A;  1JU2 A;  4DGK A;  3UOY A;  1LVL A;  1N4V A;  3ICS A;  4IVM B;  4LU6 A;  4GDP A;  1FOH A;  2CUL A;  2WHD A;  1KSU A;  3CNJ A;  3GSI A;  5EOW A;  4YSX A;  4Z25 A;  2X8G A;  3BI5 A;  4KPR A;  3COX A;  2GR0 A;  2UZZ A;  3CGD A;  1L9C A;  2JB2 A;  4U8O A;  1IUU A;  1LV0 A;  5FS6 A;  3AE6 A;  3ZDN A;  4ECH A;  4TLZ A;  4P9S A;  1D4E A;  1KSS A;  3NNE A;  2OLN A;  4X9M A;  1Y0P A;  3UKH A;  4CNJ A;  1NAA A;  2B9Y A;  2C7G A;  3GDN A;  1E39 A;  2IID A;  1GTE A;  2R4J A;  3ICT A;  1H7X A;  1XPQ A;  4EMI A;  3AEE A;  5FS7 A;  1IUT A;  3AYJ A;  1B8S A;  3AWI A;  4OPT A;  1E6E A;  1QO8 A;  2X8H A;  3UTG A;  2VVL G;  4H4T A;  1XHC A;  2VVL A;  2XYO A;  3GRT A;  3KKJ A;  3LB8 A;  1K4Q A;  1BGN A;  3GRS A;  4U8M A;  2FJE A;  2YVJ A;  1EL5 A;  4EMJ A;  1JOA A;  4YSZ A;  2XLT A;  4ZCD A;  2BC0 A;  3UP5 A;  2WPE A;  2HQM A;  3DA1 A;  1YY5 A;  2B76 A;  1GSN A;  3AEA A;  5M0Z A;  3NH3 X;  3S5W A;  4OPU A;  1TDO A;  1GRG A;  2R9Z A;  1KNR A;  3DH9 A;  1COY A;  2C65 A;  1D7L A;  2Q0L A;  2VOU A;  4U8N A;  3CPH G;  4BUR A;  4GRT A;  3AE4 A;  1LPF A;  1NEK A;  5JCN A;  1ZMC A;  1GPE A;  1GRF A;  1FEB A;  1H82 A;  1ZP0 A;  1VG0 A;  3LJP A;  3URH A;  4J33 A;  3GDP A;  1IUX A;  1NG4 A;  2C75 A;  3I6D A;  1RSG A;  2XLU A;  5C2T A;  3CNT A;  3VR9 A;  1GT8 A;  1RYI A;  2NPX A;  2C3C A;  2XVE A;  1NG3 A;  4NTC A;  4D03 A;  2FJA A;  1XAN A;  4UP3 A;  3IWA A;  1GXF A;  2V60 A;  1NDA A;  2VRL A;  2PHH A;  3GD4 A;  4TM4 A;  1Q1R A;  2WBA A;  5U25 A;  2QCU A;  2OAL A;  2Q7V A;  2Y6Q A;  3K30 A;  4OPD A;  3UKF A;  3NIX A;  2C66 A;  5FS9 A;  3DGZ A;  4WX1 A;  4A5L A;  3NYE A;  3SQP A;  2BCP A;  3WE0 A;  4CY8 A;  1JRX A;  1FEA A;  3L1R A;  1EL8 A;  2GR3 A;  3K7M X;  3LAD A;  1B37 A;  3CND A;  1XDI A;  2DKI A;  2XFO A;  4H4W A;  4ADW A;  1IUS A;  3Q9T A;  1CC2 A;  4CBQ A;  1MO9 A;  2YG3 A;  4EM3 A;  1BWC A;  4BJY A;  5CKU A;  1N4U A;  2X3N A;  3BI4 A;  2RGJ A;  1L9D A;  1PJ5 A;  3AEG A;  3KA7 A;  4K5R A;  3V76 A;  1PN0 A;  4MJW A;  3AE1 A;  1ELI A;  2I0Z A;  3NK2 X;  5IQ1 A;  3F8D A;  4GCM A;  1TDF A;  4YTN A;  1GER A;  4OPC A;  1Z6L A;  1P2E A;  3CTY A;  4EIQ A;  2XFQ A;  3VR8 A;  2JK6 A;  2V6O A;  3AEB A;  4BV6 A;  3KVE A;  1VDC A;  1YQ4 A;  2ZZC A;  3PS9 A;  4AP3 A;  1GV4 A;  3UKA A;  1H7W A;  5HYM A;  5L46 A;  4EMW A;  1NEN A;  3UOV A;  4APN A;  4U8K A;  3RED A;  3VRA A;  1F8R A;  2JKC A;  4U2T A;  5EB5 A;  5ER0 A;  2FBW A;  1CL0 A;  4TM3 A;  3II4 A;  3NT6 A;  3CGE A;  4AOX A;  1D4D A;  1DJN A;  4YT0 A;  3AD7 B;  4Y4L A;  2XVF A;  2A87 A;  3ALM A;  3ALJ A;  4YSH A;  3AD8 B;  3GWD A;  1PDH A;  4J57 A;  2YLS A;  1CF3 A;  1HYU A;  2B9X A;  5LV9 A;  3HZL A;  1QJD A;  4YTM A;  4H4Y A;  3B6D A;  4KX6 A;  4Z24 A;  1S3E A;  1DOC A;  3GMB A;  3P4P A;  4OPG A;  1PJ6 A;  4IA5 A;  2R0P A;  2E1M A;  4N9X A;  1JEH A;  3IC9 A;  4HA6 A;  2YR4 A;  2B9W A;  4I58 A;  3B3R A;  2XVI A;  3DGH A;  3P4S A;  2C67 A;  2VQB A;  3AB1 A;  4CCR A;  1ZKQ A;  4UDQ A;  2GV8 A;  3SM8 A;  1TYP A;  5JCK A;  3GD3 A;  2X8C A;  1ZOV A;  1ZX9 A;  1GRT A;  4XXG A;  1H84 A;  3KPF A;  1D4C A;  3NYC A;  2BS2 A;  4GUV A;  1GRE A;  2YVG A;  3O0H A;  3H8I A;  2ACZ A;  5JCL A;  2BS3 A;  3ITJ A;  4ZN0 A;  4IVO B;  2YG4 A;  2C3D A;  5U63 A;  4YTP A;  1P2H A;  4JY3 A; 
#chains in the Genus database with same CATH topology
 4J36 A;  1OJ9 A;  1PBE A;  2XLP A;  4UDP A;  4CY6 A;  2R0G A;  2EQ6 A;  2QA2 A;  2YLX A;  3R9U A;  2BC1 A;  4K2X A;  2R0C A;  2BXR A;  2QAE A;  1VRQ B;  2WES A;  2WP6 A;  2WPF A;  1ZDL A;  4OPI A;  3UKP A;  1BKW A;  2Q6U A;  3QSS A;  4H4V A;  4A6N B;  3BNM A;  2BRY A;  3NTA A;  1OJT A;  5KVH A;  3CGB A;  2IVD A;  4REK A;  2QA1 A;  1OJD A;  3LZW A;  4G74 A;  2WP9 A;  4H4S A;  4G6H A;  3UCL A;  5HY5 A;  5BRT A;  3ZNP A;  3EAO A;  4YKG A;  2CFY A;  3AE3 A;  1LTX R;  1B5Q A;  2XVJ A;  5HXI A;  3RNM A;  3V3N A;  2B7R A;  1JRZ A;  2WQY A;  4H4U A;  5U63 A;  3D1C A;  2WPC A;  3H8L A;  4A65 A;  4D04 A;  4GAV A;  4EQW A;  2GEW A;  4Z2U A;  3DJD A;  4G6G A;  3SXI A;  4PAA A;  2JBV A;  2YR6 A;  3DJJ A;  4RG3 A;  2RGO A;  4RG4 A;  4Z2T A;  2VQ7 A;  4FK1 C;  4O5Q A;  3PO7 A;  1NPX A;  4I59 A;  4NZH A;  4EM4 A;  4M52 A;  3L8K A;  3DME A;  4NTD A;  2YAU A;  3DJE A;  5M10 A;  1VQW A;  4GAP A;  2Z5Y A;  4USR A;  3CUK A;  1PS9 A;  4X9N A;  1LJ1 A;  2CVJ A;  2WDQ A;  3UP4 A;  5KVI A;  2BS4 A;  4JDR A;  5GRT A;  2RAB A;  4E0V A;  3LOV A;  3BNU A;  2Z5X A;  1GET A;  3BHK A;  3JSK A;  4JN9 A;  3SY4 A;  2BAC A;  1LQU A;  1DNC A;  5CQF A;  1VE9 A;  2TMD A;  4H2N A;  2A8X A;  2YLW A;  3KLJ A;  4FX9 A;  1K0J A;  4J31 A;  2WP5 A;  1DAO A;  3I3L A;  4LII A;  4B63 A;  2XDO A;  4YKF A;  2YLZ A;  2V5Z A;  1S2Y A;  3CNP A;  1PXC A;  2XFN A;  4H4Q A;  3SZF A;  2GVC A;  5KOW A;  3AE5 A;  1EL7 A;  3NRN A;  4FDC B;  2GB0 A;  1M6I A;  2EQ7 A;  1PXB A;  3IHG A;  2C64 A;  3ZNQ A;  5BUL A;  2IVE A;  3NGC X;  4AT0 A;  1L0V A;  3FBS A;  4B66 A;  2XFU A;  4YXD A;  1IUV A;  3QJ4 A;  4OCG A;  4YJG B;  2GQF A;  3CIR A;  4U2S A;  3C4N A;  4YJD A;  4BJZ A;  1TDK A;  2BRA A;  5BUK A;  3AD9 B;  1PBB A;  1AOG A;  3UTH A;  2VZ2 A;  2YM1 A;  1JRY A;  1ZMD A;  3RP6 A;  1TRB A;  1K0L A;  2XVH A;  1GOS A;  4Z43 A;  2ZZ0 A;  3AYL A;  3LXD A;  2OLO A;  2WDV A;  2WOI A;  4K8D A;  4B68 A;  2EQ9 A;  2B7S A;  3UOX A;  1F3P A;  3ADA B;  1CJ4 A;  1GND A;  1H6V A;  3D8X A;  3T2K A;  3G5Q A;  4YJF A;  2E4G A;  5KMQ A;  4C77 A;  4Z2R A;  1E1K A;  3C96 A;  3Q6J A;  4LA1 A;  2XLS A;  4BK1 A;  3K7Q X;  1PBC A;  1NHR A;  3WGT A;  3K7T A;  5TR3 A;  2BK5 A;  4JY2 A;  3KD9 A;  4Y4M A;  4B1B A;  3SGL A;  3ALL A;  4J2W A;  4Z44 A;  1DDO A;  1CJC A;  2RGH A;  4C74 A;  4A6N A;  1D7Y A;  3CGC A;  4H4Z A;  2CDU A;  4H2Q A;  2VVM A;  2YM2 A;  1NHS A;  3SZC A;  5KRQ A;  5KMS A;  1RP0 A;  3P4Q A;  1D5T A;  1GES A;  2YR5 A;  1IJH A;  1E7P A;  1W4X A;  3GWF A;  3RP8 A;  3NN6 X;  2NVK X;  3GYI A;  1MXT A;  1NHQ A;  1ONF A;  3SZW A;  1FCD A;  1OJA A;  2J3N A;  2YG5 A;  3C4A A;  2GH5 A;  3S61 A;  4A9W A;  1CC6 A;  2YLT A;  3OC4 A;  3UKL A;  2V61 A;  2R45 A;  3T37 A;  4B64 A;  5C3J A;  3UTF A;  2AR8 A;  3UTE A;  3AYI A;  1V59 A;  4XWR A;  2GRT A;  5DBJ A;  3AE7 A;  2YG7 A;  4DSG A;  2E49 A;  3E1T A;  4II3 A;  1PBD A;  3QSM A;  4NWZ A;  1BGJ A;  2BK4 A;  3W4I A;  3AED A;  2BYB A;  4JNQ A;  2GAH B;  3W4K A;  1N4W A;  2TPR A;  4U8I A;  2E5V A;  5IPY A;  1GRB A;  4U8L A;  4QFD A;  1KFY A;  4C3X A;  1VG9 A;  1H86 A;  3QVP A;  2DKH A;  1TYT A;  2X50 A;  1F8W A;  2E4A A;  4GR1 A;  4K7Z A;  1JNR A;  2BXS A;  2JB1 A;  2JB3 A;  2GAG B;  2JAE A;  4J34 A;  4EQX A;  1C0P A;  3ZNO A;  1O5W A;  3UOZ A;  4II2 A;  1Y56 A;  4FK1 A;  2WET A;  4H7U A;  3IHM A;  5EBK A;  4C5O A;  1E1M A;  4USQ A;  4NTE A;  4WCT A;  2ARD A;  3P4R A;  3SYI A;  4U2L A;  3GYJ A;  4O5U A;  2PYX A;  2BA9 A;  1EL9 A;  3AEC A;  5KWF A;  5IQ4 A;  5GSN A;  3QFA A;  4CRT A;  2V3A A;  3KU9 A;  5FS8 A;  2WDR A;  1DOD A;  1MOK A;  1N1P A;  1TDN A;  2FJD A;  1F6M A;  4Y4N A;  2H89 A;  3VRD B;  3SZ0 A;  2ZZB A;  2OA1 A;  1ZOY A;  3AE9 A;  3HYW A;  4DNA A;  4YJG A;  2X99 A;  2Y6R A;  4AT2 A;  4BK2 A;  1E1N A;  4RSL A;  1OJC A;  1GAL A;  5HHF A;  3VRB A;  1QLB A;  1BF3 A;  4JQ9 A;  1PXA A;  4J56 A;  1JNZ A;  4H50 A;  3NK0 X;  3SFD A;  3CNS A;  2R4E A;  5KXJ A;  1F8S A;  1X31 B;  5KOX A;  1YKJ A;  3PVC A;  2ZBW A;  4H4X A;  2AAQ A;  1GEU A;  3EPT A;  3ICR A;  3NTD A;  2O9Z A;  2A89 A;  3NKS A;  3DK9 A;  3P1W A;  3EF6 A;  4B65 A;  4CNK A;  3ATQ A;  4EQS A;  3BHF A;  3F8P A;  2XFP A;  4YSY A;  2GQW A;  3T14 A;  1CC4 A;  1ZK7 A;  3AXB A;  3IF9 A;  4BK3 A;  2WOV A;  3NLC A;  4B69 A;  1Y56 B;  3SFE A;  1E1L A;  2EQ8 A;  1CBO A;  4CCQ A;  2C72 A;  2Q0K A;  2C70 A;  4ZCC A;  3VQR A;  3G5S A;  3FG2 P;  3EAN A;  2WU5 A;  2OAM A;  1CHU A;  4IV9 A;  3HYV A;  2VRM A;  5J60 A;  3AE8 A;  1DXL A;  4EQR A;  1PJ7 A;  5JCM A;  1CJ2 A;  1PHH A;  4A99 A;  4XWZ A;  2XCG A;  3M12 A;  1H83 A;  5FMH A;  1GTH A;  4K5S A;  3ZNN A;  4H2R A;  3RP7 A;  1NHP A;  2E48 A;  4B67 A;  1GRA A;  2YVF A;  1PBF A;  3M0O A;  1KNP A;  4TM1 A;  3F8R A;  1H81 A;  3FMW A;  5JCI A;  2BAB A;  4A7A A;  3P9U A;  3OZ2 A;  1LQT A;  3T2Z A;  1Q1W A;  3LZX A;  4OVI A;  1B4V A;  2BCG G;  1BZL A;  2W0H A;  1O95 A;  1YQ3 A;  3FPZ A;  4EIP A;  2H88 A;  5EB4 A;  2C73 A;  2GMH A;  2C76 A;  1REO A;  3AE2 A;  3H4K A;  3G5R A;  4H4R A;  2AQJ A;  3DJG X;  2WU2 A;  4TLX A;  4K22 A;  1O94 A;  1ZY8 A;  1YQZ A;  1DOB A;  1SEZ A;  3RHA A;  2YG6 A;  4H4P A;  4GDE A;  4HB9 A;  2GMJ A;  4NEV A;  3NK1 X;  4IA6 A;  2BK3 A;  4ICY A;  3FIM B;  4YWO A;  1S2Q A;  1UKV G;  2YWL A;  4TM0 A;  3NYF A;  3ISH A;  4U8J A;  2YLR A;  1IUW A;  4X4J A;  1C0K A;  2V3B A;  5J7X A;  2FJB A;  3ZYX A;  3DK8 A;  1GRH A;  1M64 A;  3UKQ A;  3CPI G;  4Z26 A;  3T0K A;  4GF7 A;  4UDR A;  1K0I A;  2R46 A;  2YQU A;  3QVR A;  3UKK A;  1CJ3 A;  4YJH B;  5BVA A;  2WEU A;  3HYX A;  1TDE A;  2GR1 A;  4A79 A;  4DSH A;  3ABV A;  2GR2 A;  3GMC A;  5U1O A;  3QFB A;  2WS3 A;  3NG7 X;  4OPL A;  1FL2 A;  1DJQ A;  1DOE A;  3ATR A;  2APG A;  3NN0 X;  4JNA A;  5KMR A;  2GF3 A;  3DK4 A;  2WOW A;  2XLR A;  3BI2 A;  1Q9I A;  4H2P A;  1L9E A;  3NHO X;  2DU8 A;  1S3B A;  3CPJ G;  4AOS A;  3AEF A;  3M13 A;  4QFC A;  4PAB A;  4NEW A;  4C3Y A;  1KF6 A;  1KDG A;  3CN8 A;  3QSE A;  2F5Z A;  4U8P A;  1EBD A;  1FEC A;  4G9K A;  3V3O A;  4AP1 A;  1JU2 A;  4DGK A;  3UOY A;  1EVI A;  1LVL A;  1N4V A;  3ICS A;  4IVM B;  4LU6 A;  4GDP A;  1FOH A;  3GSI A;  2CUL A;  1KSU A;  2WHD A;  3CNJ A;  5EOW A;  4YSX A;  1C0L A;  2X8G A;  4Z25 A;  3BI5 A;  4KPR A;  3COX A;  2UZZ A;  2GR0 A;  3CGD A;  1L9C A;  2JB2 A;  4U8O A;  1IUU A;  1C0I A;  1LV0 A;  3AE6 A;  5FS6 A;  3ZDN A;  4ECH A;  4TLZ A;  4P9S A;  1KSS A;  4X9M A;  1D4E A;  2OLN A;  3NNE A;  1Y0P A;  3UKH A;  4CNJ A;  1NAA A;  2B9Y A;  2C4C A;  2C7G A;  3GDN A;  1E39 A;  5KMP A;  2IID A;  1GTE A;  2R4J A;  3ICT A;  1H7X A;  1XPQ A;  4EMI A;  3AEE A;  5FS7 A;  1IUT A;  2E82 A;  3AYJ A;  1B8S A;  4OPT A;  3UTG A;  1E6E A;  1QO8 A;  2X8H A;  2VVL G;  4H4T A;  1XHC A;  2VVL A;  2XYO A;  3GRT A;  3KKJ A;  3LB8 A;  1K4Q A;  1BGN A;  3GRS A;  4U8M A;  2FJE A;  2YVJ A;  1EL5 A;  4EMJ A;  1JOA A;  3T31 A;  2XLT A;  4YSZ A;  4ZCD A;  2BC0 A;  3UP5 A;  2WPE A;  2HQM A;  3DA1 A;  1YY5 A;  2B76 A;  1GSN A;  3AEA A;  5M0Z A;  3NH3 X;  3S5W A;  4OPU A;  1TDO A;  1AN9 A;  1GRG A;  2R9Z A;  1KNR A;  3DH9 A;  1COY A;  2C65 A;  1D7L A;  2Q0L A;  2VOU A;  4U8N A;  3CPH G;  4BUR A;  4GRT A;  3AE4 A;  1LPF A;  1NEK A;  5JCN A;  1ZMC A;  1GPE A;  1GRF A;  1FEB A;  1H82 A;  1VG0 A;  1ZP0 A;  3LJP A;  3URH A;  4J33 A;  3GDP A;  1IUX A;  1NG4 A;  2C75 A;  3I6D A;  1RSG A;  2XLU A;  5C2T A;  3CNT A;  3VR9 A;  1GT8 A;  1RYI A;  2NPX A;  2C3C A;  2XVE A;  1NG3 A;  4NTC A;  4D03 A;  2FJA A;  1XAN A;  4UP3 A;  3IWA A;  1GXF A;  2V60 A;  1NDA A;  2VRL A;  2PHH A;  3GD4 A;  4TM4 A;  1Q1R A;  2WBA A;  5U25 A;  2QCU A;  2OAL A;  2Q7V A;  2Y6Q A;  3K30 A;  4OPD A;  3UKF A;  3NIX A;  2C66 A;  5FS9 A;  4YJH A;  3DGZ A;  4WX1 A;  3NYE A;  4A5L A;  3SQP A;  2BCP A;  3WE0 A;  3T2Y A;  4CY8 A;  1JRX A;  4NNJ A;  1FEA A;  3L1R A;  1EL8 A;  2GR3 A;  3K7M X;  3KPK A;  3LAD A;  1B37 A;  3CND A;  3W4J A;  1XDI A;  2DKI A;  2XFO A;  4H4W A;  4ADW A;  1IUS A;  3Q9T A;  1CC2 A;  4CBQ A;  1MO9 A;  2YG3 A;  4EM3 A;  1BWC A;  4BJY A;  5CKU A;  1N4U A;  2X3N A;  3BI4 A;  2RGJ A;  1L9D A;  1PJ5 A;  3AEG A;  3KA7 A;  4K5R A;  3V76 A;  1PN0 A;  4MJW A;  3AE1 A;  1ELI A;  2I0Z A;  3NK2 X;  5IQ1 A;  3F8D A;  4GCM A;  1TDF A;  4YTN A;  1GER A;  4OPC A;  1Z6L A;  1P2E A;  3CTY A;  4EIQ A;  2XFQ A;  3VR8 A;  3GYX A;  2JK6 A;  2V6O A;  3AEB A;  4BV6 A;  3KVE A;  1VDC A;  1YQ4 A;  3PS9 A;  2ZZC A;  4AP3 A;  1GV4 A;  3UKA A;  1H7W A;  5HYM A;  5L46 A;  4EMW A;  1NEN A;  3UOV A;  3SX6 A;  4U8K A;  4APN A;  3RED A;  3VRA A;  1F8R A;  2JKC A;  4U2T A;  5EB5 A;  5ER0 A;  2FBW A;  1CL0 A;  4TM3 A;  3CMM A;  3II4 A;  3NT6 A;  3CGE A;  4AOX A;  1D4D A;  1DJN A;  4YT0 A;  3AD7 B;  4Y4L A;  2XVF A;  2A87 A;  3ALM A;  3ALJ A;  4YSH A;  1KIF A;  3AD8 B;  3GWD A;  1PDH A;  4J57 A;  2YLS A;  1CF3 A;  1HYU A;  2B9X A;  5LV9 A;  4G73 A;  3HZL A;  1QJD A;  4YTM A;  4H4Y A;  3B6D A;  4KX6 A;  4Z24 A;  1P2H A;  1DOC A;  3GMB A;  1S3E A;  3P4P A;  4OPG A;  1PJ6 A;  4IA5 A;  2R0P A;  2E1M A;  4N9X A;  5KNL A;  1JEH A;  3IC9 A;  4HA6 A;  2YR4 A;  2B9W A;  4I58 A;  3B3R A;  2XVI A;  3DGH A;  3P4S A;  2C67 A;  2VQB A;  3AB1 A;  4YTP A;  4CCR A;  1ZKQ A;  4UDQ A;  2GV8 A;  3SM8 A;  1TYP A;  5JCK A;  3GD3 A;  2X8C A;  1ZOV A;  1ZX9 A;  1GRT A;  4XXG A;  1H84 A;  3KPF A;  1D4C A;  3NYC A;  2BS2 A;  4GUV A;  1GRE A;  2YVG A;  3O0H A;  3H8I A;  2ACZ A;  5JCL A;  2BS3 A;  3ITJ A;  4ZN0 A;  4IVO B;  2YG4 A;  2C3D A;  3G3E A;  4YJF B;  3AWI A;  4JY3 A; 
#chains in the Genus database with same CATH homology
 4J36 A;  1OJ9 A;  1PBE A;  2XLP A;  4UDP A;  4CY6 A;  2R0G A;  2EQ6 A;  2QA2 A;  2YLX A;  3R9U A;  2BC1 A;  4K2X A;  2R0C A;  2BXR A;  2QAE A;  1VRQ B;  2WES A;  2WP6 A;  2WPF A;  1ZDL A;  4OPI A;  3UKP A;  1BKW A;  2Q6U A;  3QSS A;  4H4V A;  4A6N B;  3BNM A;  2BRY A;  3NTA A;  1OJT A;  5KVH A;  3CGB A;  2IVD A;  4REK A;  2QA1 A;  1OJD A;  3LZW A;  4G74 A;  2WP9 A;  4H4S A;  4G6H A;  3UCL A;  5HY5 A;  5BRT A;  3EAO A;  4YKG A;  2CFY A;  3AE3 A;  1LTX R;  1B5Q A;  2XVJ A;  5HXI A;  3RNM A;  3V3N A;  2B7R A;  1JRZ A;  2WQY A;  4H4U A;  3D1C A;  2WPC A;  3H8L A;  4A65 A;  4D04 A;  4GAV A;  4EQW A;  2GEW A;  4Z2U A;  3DJD A;  4G6G A;  3SXI A;  2JBV A;  4PAA A;  2YR6 A;  3DJJ A;  4RG3 A;  2RGO A;  4RG4 A;  4Z2T A;  2VQ7 A;  4FK1 C;  4O5Q A;  3PO7 A;  1NPX A;  4I59 A;  4NZH A;  4EM4 A;  4M52 A;  3L8K A;  3DME A;  4NTD A;  2YAU A;  3DJE A;  5M10 A;  1VQW A;  4GAP A;  2Z5Y A;  4USR A;  1PS9 A;  4X9N A;  1LJ1 A;  2CVJ A;  2WDQ A;  3UP4 A;  5KVI A;  2BS4 A;  4JDR A;  5GRT A;  2RAB A;  4E0V A;  3LOV A;  3BNU A;  2Z5X A;  1GET A;  3BHK A;  3JSK A;  4JN9 A;  3SY4 A;  2BAC A;  1LQU A;  1DNC A;  5CQF A;  2TMD A;  4H2N A;  2A8X A;  2YLW A;  3KLJ A;  4FX9 A;  1K0J A;  4J31 A;  2WP5 A;  4LII A;  3I3L A;  4B63 A;  2XDO A;  4YKF A;  2YLZ A;  2V5Z A;  1S2Y A;  3CNP A;  1PXC A;  2XFN A;  4H4Q A;  3SZF A;  2GVC A;  5KOW A;  3AE5 A;  1EL7 A;  3NRN A;  4FDC B;  1M6I A;  2GB0 A;  2EQ7 A;  1PXB A;  3IHG A;  2C64 A;  5BUL A;  2IVE A;  3NGC X;  4AT0 A;  1L0V A;  3FBS A;  4B66 A;  2XFU A;  4YXD A;  1IUV A;  3QJ4 A;  4OCG A;  2GQF A;  3CIR A;  4U2S A;  3C4N A;  4BJZ A;  1TDK A;  2BRA A;  5BUK A;  3AD9 B;  1PBB A;  1AOG A;  3UTH A;  2VZ2 A;  2YM1 A;  1JRY A;  1ZMD A;  3RP6 A;  1TRB A;  1K0L A;  2XVH A;  1GOS A;  4Z43 A;  2ZZ0 A;  3AYL A;  3LXD A;  2OLO A;  2WDV A;  2WOI A;  4K8D A;  4B68 A;  2EQ9 A;  2B7S A;  3UOX A;  1F3P A;  3ADA B;  1CJ4 A;  1GND A;  1H6V A;  3D8X A;  3T2K A;  3G5Q A;  2E4G A;  5KMQ A;  4C77 A;  4Z2R A;  1E1K A;  3C96 A;  3Q6J A;  4LA1 A;  2XLS A;  4BK1 A;  3K7Q X;  1PBC A;  1NHR A;  5TR3 A;  3K7T A;  2BK5 A;  4JY2 A;  3KD9 A;  4Y4M A;  4B1B A;  3SGL A;  3ALL A;  4J2W A;  4Z44 A;  1CJC A;  2RGH A;  4C74 A;  4A6N A;  1D7Y A;  3CGC A;  4H4Z A;  2CDU A;  4H2Q A;  2VVM A;  2YM2 A;  1NHS A;  3SZC A;  5KRQ A;  5KMS A;  1RP0 A;  3P4Q A;  1D5T A;  1GES A;  2YR5 A;  1IJH A;  1E7P A;  1W4X A;  3GWF A;  3RP8 A;  3NN6 X;  2NVK X;  3GYI A;  1MXT A;  1NHQ A;  1ONF A;  3SZW A;  1FCD A;  1OJA A;  2J3N A;  2YG5 A;  3C4A A;  2GH5 A;  3S61 A;  4A9W A;  1CC6 A;  2YLT A;  3OC4 A;  3UKL A;  2V61 A;  2R45 A;  3T37 A;  4B64 A;  5C3J A;  3UTF A;  2AR8 A;  3UTE A;  3AYI A;  1V59 A;  4XWR A;  2GRT A;  5DBJ A;  3AE7 A;  2YG7 A;  4DSG A;  3E1T A;  4II3 A;  1PBD A;  3QSM A;  4NWZ A;  1BGJ A;  2BK4 A;  3AED A;  2BYB A;  4JNQ A;  2GAH B;  2TPR A;  1N4W A;  4U8I A;  2E5V A;  5IPY A;  1GRB A;  4U8L A;  1KFY A;  4C3X A;  1VG9 A;  1H86 A;  3QVP A;  2DKH A;  1TYT A;  2X50 A;  1F8W A;  4GR1 A;  4K7Z A;  1JNR A;  2BXS A;  2JB1 A;  2JB3 A;  2GAG B;  2JAE A;  4J34 A;  4EQX A;  1O5W A;  3UOZ A;  4II2 A;  1Y56 A;  4FK1 A;  2WET A;  4H7U A;  3IHM A;  5EBK A;  4C5O A;  1E1M A;  4USQ A;  4NTE A;  4WCT A;  2ARD A;  3P4R A;  3SYI A;  4U2L A;  3GYJ A;  4O5U A;  2PYX A;  2BA9 A;  1EL9 A;  3AEC A;  5KWF A;  5IQ4 A;  5GSN A;  3QFA A;  4CRT A;  2V3A A;  3KU9 A;  5FS8 A;  2WDR A;  1DOD A;  1MOK A;  1N1P A;  1TDN A;  2FJD A;  1F6M A;  4Y4N A;  2H89 A;  3VRD B;  3SZ0 A;  2ZZB A;  2OA1 A;  1ZOY A;  3AE9 A;  3HYW A;  4DNA A;  2X99 A;  2Y6R A;  4AT2 A;  4BK2 A;  1E1N A;  1OJC A;  4RSL A;  1GAL A;  5HHF A;  3VRB A;  1QLB A;  1BF3 A;  4JQ9 A;  1PXA A;  4J56 A;  1JNZ A;  4H50 A;  3NK0 X;  3SFD A;  3CNS A;  2R4E A;  5KXJ A;  1F8S A;  1X31 B;  5KOX A;  1YKJ A;  2ZBW A;  3PVC A;  4H4X A;  2AAQ A;  1GEU A;  3EPT A;  3ICR A;  3NTD A;  2O9Z A;  2A89 A;  3NKS A;  3DK9 A;  3P1W A;  3EF6 A;  4B65 A;  4CNK A;  3ATQ A;  4EQS A;  3BHF A;  3F8P A;  2XFP A;  4YSY A;  2GQW A;  3T14 A;  1CC4 A;  1ZK7 A;  4BK3 A;  2WOV A;  3AXB A;  3IF9 A;  3NLC A;  4B69 A;  1Y56 B;  3SFE A;  1E1L A;  2EQ8 A;  1CBO A;  4CCQ A;  2C72 A;  2Q0K A;  2C70 A;  4ZCC A;  3G5S A;  3VQR A;  3FG2 P;  3EAN A;  2WU5 A;  2OAM A;  1CHU A;  4IV9 A;  3HYV A;  2VRM A;  5J60 A;  3AE8 A;  1DXL A;  4EQR A;  1PJ7 A;  5JCM A;  1CJ2 A;  1PHH A;  4A99 A;  4XWZ A;  2XCG A;  3M12 A;  1H83 A;  5FMH A;  1GTH A;  4K5S A;  4H2R A;  3RP7 A;  1NHP A;  4B67 A;  1GRA A;  2YVF A;  1PBF A;  3M0O A;  1KNP A;  4TM1 A;  3F8R A;  1H81 A;  3FMW A;  5JCI A;  2BAB A;  4A7A A;  3P9U A;  1LQT A;  3OZ2 A;  3T2Z A;  1Q1W A;  3LZX A;  4OVI A;  1B4V A;  2BCG G;  1BZL A;  2W0H A;  1O95 A;  1YQ3 A;  3FPZ A;  4EIP A;  2H88 A;  5EB4 A;  2C73 A;  2GMH A;  2C76 A;  1REO A;  3AE2 A;  3H4K A;  3G5R A;  4H4R A;  2AQJ A;  3DJG X;  2WU2 A;  4TLX A;  4K22 A;  1O94 A;  1ZY8 A;  1YQZ A;  1DOB A;  1SEZ A;  3RHA A;  2YG6 A;  4H4P A;  4GDE A;  4HB9 A;  2GMJ A;  4NEV A;  3NK1 X;  4IA6 A;  2BK3 A;  4ICY A;  3FIM B;  4YWO A;  1S2Q A;  1UKV G;  2YWL A;  4TM0 A;  3NYF A;  3ISH A;  4U8J A;  2YLR A;  1IUW A;  4X4J A;  5J7X A;  2V3B A;  2FJB A;  3ZYX A;  3DK8 A;  1GRH A;  1M64 A;  3UKQ A;  3CPI G;  4Z26 A;  3T0K A;  4GF7 A;  4UDR A;  1K0I A;  2R46 A;  2YQU A;  3QVR A;  3UKK A;  1CJ3 A;  5BVA A;  2WEU A;  3HYX A;  1TDE A;  2GR1 A;  4A79 A;  4DSH A;  3ABV A;  2GR2 A;  3GMC A;  5U1O A;  3QFB A;  2WS3 A;  3NG7 X;  4OPL A;  1FL2 A;  1DJQ A;  1DOE A;  3ATR A;  2APG A;  3NN0 X;  4JNA A;  5KMR A;  2GF3 A;  3DK4 A;  2WOW A;  2XLR A;  3BI2 A;  1Q9I A;  4H2P A;  1L9E A;  3NHO X;  1S3B A;  3CPJ G;  4AOS A;  3AEF A;  3M13 A;  4PAB A;  4NEW A;  4C3Y A;  1KF6 A;  1KDG A;  3CN8 A;  3QSE A;  2F5Z A;  4U8P A;  1EBD A;  1FEC A;  4G9K A;  3V3O A;  4AP1 A;  1JU2 A;  4DGK A;  3UOY A;  1LVL A;  1N4V A;  3ICS A;  4IVM B;  4LU6 A;  4GDP A;  1FOH A;  2CUL A;  2WHD A;  1KSU A;  3CNJ A;  3GSI A;  5EOW A;  4YSX A;  4Z25 A;  2X8G A;  3BI5 A;  4KPR A;  3COX A;  2GR0 A;  2UZZ A;  3CGD A;  1L9C A;  2JB2 A;  4U8O A;  1IUU A;  1LV0 A;  5FS6 A;  3AE6 A;  3ZDN A;  4ECH A;  4TLZ A;  4P9S A;  1D4E A;  1KSS A;  3NNE A;  2OLN A;  4X9M A;  1Y0P A;  3UKH A;  4CNJ A;  1NAA A;  2B9Y A;  2C4C A;  2C7G A;  3GDN A;  1E39 A;  5KMP A;  2IID A;  1GTE A;  2R4J A;  3ICT A;  1H7X A;  1XPQ A;  4EMI A;  3AEE A;  5FS7 A;  1IUT A;  3AYJ A;  1B8S A;  3AWI A;  4OPT A;  1E6E A;  1QO8 A;  2X8H A;  3UTG A;  2VVL G;  4H4T A;  1XHC A;  2VVL A;  2XYO A;  3GRT A;  3KKJ A;  3LB8 A;  1K4Q A;  1BGN A;  3GRS A;  4U8M A;  2FJE A;  2YVJ A;  1EL5 A;  4EMJ A;  1JOA A;  3T31 A;  2XLT A;  4YSZ A;  4ZCD A;  2BC0 A;  3UP5 A;  2WPE A;  2HQM A;  3DA1 A;  1YY5 A;  2B76 A;  1GSN A;  3AEA A;  5M0Z A;  3NH3 X;  3S5W A;  4OPU A;  1TDO A;  1GRG A;  2R9Z A;  1KNR A;  3DH9 A;  1COY A;  2C65 A;  1D7L A;  2Q0L A;  2VOU A;  4U8N A;  3CPH G;  4BUR A;  4GRT A;  3AE4 A;  1LPF A;  1NEK A;  5JCN A;  1ZMC A;  1GPE A;  1GRF A;  1FEB A;  1H82 A;  1ZP0 A;  1VG0 A;  3LJP A;  3URH A;  4J33 A;  3GDP A;  1IUX A;  1NG4 A;  2C75 A;  3I6D A;  1RSG A;  2XLU A;  5C2T A;  3CNT A;  3VR9 A;  1GT8 A;  1RYI A;  2NPX A;  2C3C A;  2XVE A;  1NG3 A;  4NTC A;  4D03 A;  2FJA A;  1XAN A;  4UP3 A;  3IWA A;  1GXF A;  2V60 A;  1NDA A;  2VRL A;  2PHH A;  3GD4 A;  4TM4 A;  1Q1R A;  2WBA A;  5U25 A;  2QCU A;  2OAL A;  2Q7V A;  2Y6Q A;  3K30 A;  4OPD A;  3UKF A;  3NIX A;  2C66 A;  5FS9 A;  3DGZ A;  4WX1 A;  4A5L A;  3NYE A;  3SQP A;  2BCP A;  3WE0 A;  3T2Y A;  4CY8 A;  1JRX A;  4NNJ A;  1FEA A;  3L1R A;  1EL8 A;  2GR3 A;  3K7M X;  3KPK A;  3LAD A;  1B37 A;  3CND A;  1XDI A;  2DKI A;  2XFO A;  4H4W A;  4ADW A;  1IUS A;  3Q9T A;  1CC2 A;  4CBQ A;  1MO9 A;  2YG3 A;  4EM3 A;  1BWC A;  4BJY A;  5CKU A;  1N4U A;  2X3N A;  3BI4 A;  2RGJ A;  1L9D A;  1PJ5 A;  3AEG A;  3KA7 A;  4K5R A;  3V76 A;  1PN0 A;  4MJW A;  3AE1 A;  1ELI A;  2I0Z A;  3NK2 X;  5IQ1 A;  3F8D A;  4GCM A;  1TDF A;  4YTN A;  1GER A;  4OPC A;  1Z6L A;  1P2E A;  3CTY A;  4EIQ A;  2XFQ A;  3VR8 A;  3GYX A;  2JK6 A;  2V6O A;  3AEB A;  4BV6 A;  3KVE A;  1VDC A;  1YQ4 A;  2ZZC A;  3PS9 A;  4AP3 A;  1GV4 A;  3UKA A;  1H7W A;  5HYM A;  5L46 A;  4EMW A;  1NEN A;  3UOV A;  3SX6 A;  4U8K A;  4APN A;  3RED A;  3VRA A;  1F8R A;  2JKC A;  4U2T A;  5EB5 A;  5ER0 A;  2FBW A;  1CL0 A;  4TM3 A;  3CMM A;  3II4 A;  3NT6 A;  3CGE A;  4AOX A;  1D4D A;  1DJN A;  4YT0 A;  3AD7 B;  4Y4L A;  2XVF A;  2A87 A;  3ALM A;  3ALJ A;  4YSH A;  3AD8 B;  3GWD A;  1PDH A;  4J57 A;  2YLS A;  1CF3 A;  1HYU A;  2B9X A;  5LV9 A;  4G73 A;  3HZL A;  1QJD A;  4YTM A;  4H4Y A;  3B6D A;  4KX6 A;  4Z24 A;  1S3E A;  1DOC A;  3GMB A;  3P4P A;  4OPG A;  1PJ6 A;  4IA5 A;  2R0P A;  2E1M A;  4N9X A;  5KNL A;  1JEH A;  3IC9 A;  4HA6 A;  2YR4 A;  2B9W A;  4I58 A;  3B3R A;  2XVI A;  3DGH A;  3P4S A;  2C67 A;  2VQB A;  3AB1 A;  4CCR A;  1ZKQ A;  4UDQ A;  2GV8 A;  3SM8 A;  1TYP A;  5JCK A;  3GD3 A;  2X8C A;  1ZOV A;  1ZX9 A;  1GRT A;  4XXG A;  1H84 A;  3KPF A;  1D4C A;  3NYC A;  2BS2 A;  4GUV A;  1GRE A;  2YVG A;  3O0H A;  3H8I A;  2ACZ A;  5JCL A;  2BS3 A;  3ITJ A;  4ZN0 A;  4IVO B;  2YG4 A;  2C3D A;  5U63 A;  4YTP A;  1P2H A;  4JY3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...