3GMGA

Crystal structure of an uncharacterized conserved protein from mycobacterium tuberculosis
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
143
structure length
143
Chain Sequence
ARLAALSILVGAVGATGPGVMITIDDPGPGVAPEVMIDVINELRAAGAEAIQINDAHRSVRVGVDTWVVGVPGSLTVDTKVLSPPYSILAIGDPPTLAAAMNIPGGAQDGVKRVGGRMVVQQADRVDVTALRQPKQHQYAQPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of an uncharacterized conserved protein from Mycobacterium tuberculosis
rcsb
source organism Mycobacterium tuberculosis
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein Rv1825/MT1873
total genus 35
structure length 143
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05949 DUF881 Bacterial protein of unknown function (DUF881)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1880 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3gmgA00
3GMGA
chains in the Genus database with same CATH superfamily
2VBZA 4KT0C 2RVJA 2XTJP 3CTRA 2AMCB 5IC6B 1NKEA 2EK1A 1VHFA 2Q43A 2H5IB 5IT0A 3CCVS 1W2BR 2NCKL 2FPHX 4IO1A 4CO4A 1HBUA 2HEKA 2WW4A 2CQ1A 1R6VA 3W5YA 2DEIA 1KWMA 2HRYA 3DMJB 4ECRA 5F8NA 1BLUA 5FDLB 5IFMA 1WJ9A 2VG5A 4C9DA 3CJ8A 4J9PA 2MQLA 3KTQA 3I0RA 4P72A 1N33F 3F56A 1SBRA 1TUWA 1VR6A 3FKBA 1EQMA 2YNGB 2GC8A 1X5PA 1ZM2A 2XG8A 3KDOA 4FDFA 3VAKA 3PZPA 3K0JA 1OMSA 1VGYA 3C66A 4ZLLA 3QRPA 4FXVA 3RG6A 2HQ3A 3OTOJ 3O6QA 3PFEA 1H7WA 4YDDB 4AYBD 1S6QA 2KB2A 4WPAA 3OTOF 5GAGI 1DTTA 3K8VA 3O44A 1WTBA 3UI3A 2OTLS 1T9YA 2JH3A 2WONA 4ELTA 2B5JB 4G1QB 1ITPA 3M2UA 4F25A 4RW8B 2PA8D 3LH2S 5KFHA 3I0RB 2CJBA 4NYPA 4DF4A 1N5VA 3ZTSA 1U48A 2ALYB 2V2QA 4LFBJ 2CZ4A 2I9SA 2HNZB 3K7RA 2WVFA 3NCPA 3MFHA 2DNYA 1B0VA 1I51B 2DB1A 2RRNA 4USVA 4DR4J 2OI2A 5D0RA 3K5PA 3CJKB 3C6TA 3QGPA 1XQIA 3AXMA 1C0TB 4G65A 4WFZA 3SZ2A 2A18A 3Q89A 4LT6A 1TVRB 1TKXB 3DRXA 4O3QA 1G3OA 2EKYA 1AT1B 1IBCB 2PO4A 3K2YA 3QGHA 4ZVRB 2ZH1A 3AJ1A 4URQU 4V1Ak 4Y2IA 4NX9A 4Y00A 4H4KA 4BLGA 3GONA 1EAYC 2HHUA 5ETRA 1XN9A 3CCLS 3HF5A 4CDIA 2HG4A 3QWPA 2DNZA 2EFGA 4H4OA 4ECYA 2VUGA 1R0CB 4CLZA 4Z37A 4MMOA 2XMUA 5LJ5Y 1F9FA 1KQGB 4JI3F 5DGAA 3EDRB 3VGSA 3OXGA 1TVRA 3K17A 2HIQA 2RF2A 2G2ZA 2VBXA 1YWXA 3DRPA 4OI2A 4TN2A 5B0CA 5B08A 2YX4A 4DR2F 1EX8A 1NK8A 2MHNA 2NSBA 2HLUA 3UO0A 5CZVA 2CZVC 1Q0NA 5KFRA 3R2DJ 1TELA 1LV5A 3FBFA 4E98A 2EW9A 1C1BA 4B9VA 3C16A 3HHDA 2FJXA 2YKMB 4G1PA 1YJUA 3W5XA 3EGNA 1S0MA 2J9DA 4ZPAA 2DJWA 3VALA 5CA5A 2UV8G 2RSQA 2HK3A 4CO0A 5FD1A 3VAMA 4DQIA 1VQ6S 5HVHA 4UF4A 2E44A 3RU0A 4DV7F 1R0BG 2UV8A 5HBMB 3M32A 3A1YG 3IGVA 1NMEB 1NK7A 5KFAA 4ER8A 3HPOA 1P6TA 2FD2A 2BMBA 1HD0A 3DHWC 1H7XA 2ZEJA 5A0YA 4X64J 2R7RA 2BM0A 3X1LB 5B0EA 5HN0A 4C6AA 1YDLA 1CJUA 5L8RC 3OVBA 2YBVA 1D9DA 2V94A 2ZBRA 4M8LA 3GMGA 3UVJA 4X4PA 3HT0A 2UUCJ 1AZSA 1JLBB 3DRSA 2ZHAA 3CUNA 4LRFA 4IKAA 2NUHA 3TZXA 5LMNJ 1V3ZA 1X4FA 2RU3A 4ED2A 2BW7A 4FF1A 1VIOA 2ZH6A 5HMZA 2W9BB 3RB0A 1QAIA 1NSQA 3KOAA 2GCFA 4DCJB 4R0JA 1P8GA 4QR2A 5ETKA 4ECVA 3KHHA 1NZ8A 2LA6A 4NI2A 4OL8A 4DEZA 1NK4A 2QT7A 5KFLA 3TP2A 1XBWA 2JWNA 2V68A 3EVMA 3JTPA 4FKYA 2RH3A 4KB7A 3A8EA 4LBPA 4IH7A 4KRWA 2XGPA 2ASJA 1X9WA 4KIAA 2KM8C 4J37A 3N5BA 1MW7A 2LVWA 4CH1A 3KLFA 2F1FA 1REVB 1BGXT 1WC0A 2DH8A 2MKHA 2PGCA 3AD8C 4NLDA 3UNYA 3R7NB 3BSCA 2QLFB 2DGSA 1JLEB 3E8OA 2BR0A 2MZ1A 5J2PA 4ZVFA 3AFGA 1VDHA 2YQ1A 4I2QB 4OX7A 3MPYA 5HSPA 3M9NB 3L95X 3U1NA 2GO8A 1JKHB 5KFZA 1KS2A 1GMVA 2RILA 2RHQB 3DYAA 5HLFA 3TA0A 1X5TA 1T95A 4QOTA 2ZHBA 4MKYA 3VVUA 3JTNA 2OPPA 3D4JA 1CBKA 4C98A 2VFVA 4KGXB 3J7YI 1BD6A 3Q2TC 1CJKB 4C8ZA 4C4WA 1FF2A 1WTFA 1RHUB 4CH7A 2RS2A 2FGCA 4YR3A 2D69A 2B51A 3V4IB 2DXDA 4IYQA 3VQTA 5DM6Q 2BVZA 3CJ5A 1FJEB 4YMEA 3GZ7A 3W60A 1QSSA 4V19J 3GTYX 1NXIA 4KJIA 1Q53A 1SKSA 1RAFB 4IDKA 4OV1A 3OV7A 2B56A 2QE5A 1S0OA 2RMLA 2VJUA 1TL7B 3R7SB 1PYOB 2R8KA 1S1TA 3HHLA 3M8WA 3LP1A 2BABA 2YNGA 4RUAA 3HVRA 1N5QA 4DV6J 3P6YC 3PHEA 1IBMF 2AJQA 2B8QA 2MLXA 2P9EA 4LF8F 1RHJB 2Y0BB 4P52A 1YJNS 2IRUA 3FFIB 3NGSA 2PMZD 4DXLA 2XC9A 4NCBA 2E1RA 2HGLA 1YBTA 4B3MF 2OSQA 2UP1A 1RACB 2MKIA 5HP1A 3MD3A 1M1KT 3CD0A 4OX9J 1XNQJ 2AJ1A 5J1EA 4DUYF 3TANA 1KDNA 2L9WA 2RD5C 2RE1A 3W66A 4CT8A 1RT5B 1GEHA 2OFGX 4EI2A 2FJAB 5CD4H 3ZZUA 4DSIA 1PYSB 2LU2A 2JC1A 2MZQA 3G6ES 1FKOB 3D9BA 5E7OB 3M2RA 3PX0A 3FZBA 1YK9A 2LCWA 3UCGA 4IRDA 2KXFA 2E7WA 3FNNA 3O1LA 1X4BA 2N82B 2R2TA 1J5OA 1URRA 3CCTA 3RRHA 4ITSA 2FHOB 3D0IE 3I6PA 4KKOB 1RT2B 4B3TF 2GAGC 4PG4A 5KG7A 1VRUA 1IUJA 2Y1RI 5L9XA 3A4TA 3BQ0A 3CC2S 4QPXA 4J9OA 4DFMA 2ZM6F 2HMIB 1Y3KA 3QT5A 4FBUA 1F2HA 5J2QA 1FFGB 1SC3B 4ZK7M 1UVIA 1FO1A 3IS9B 1KTQA 2WSEC 4HDGA 2J9DE 4QWBA 3RRKA 3HCXA 1C1CB 4DUYJ 5KFTA 1CJTB 4PXDA 1N6QB 1LXNA 5KFEA 4ELUA 3A3NB 4OX8A 2UUTA 5D3GA 5LSRA 3THVA 1SJRA 3BN4A 4OJ3A 3OPKA 2UVRA 2G0CA 2DGTA 2B4UA 2LU1A 3VAIA 1WC3A 1JLQB 5A8KB 4H4OB 1RWMB 4ES1A 3KLHB 2K8GA 4MKVA 1BWVA 3GE9A 2QLBB 4LRAA 3H98A 2N3LA 2CJAA 4PWWA 3HSJA 1T3OA 1TV6A 3AXKA 3UR3C 2KFZA 4LF1A 1S1XB 4ZVQB 3ZO7A 3OBIA 1TK0A 2ZUGA 4LSNA 2JDJA 2VASA 2YNFB 3GR0A 8RUCA 2CJXB 3KJNB 1RWOB 2I1RA 3EM1A 1Q8KA 4NLGA 5F3ZA 4MYUA 4RW4B 4WZMA 5A8KA 2ACYA 2OPSB 1S9EB 3I9ZA 4ILLA 1FWPA 4O44B 3HSDA 3T5LA 3WC2A 4HDHA 4C8MA 5KFMA 6AT1B 2J7KA 4FKXA 1HNVA 3GQCA 4ID5B 5J1PA 3C8YA 4A8YA 4K4UA 3PNIA 5M2PA 1U0SA 4KO0B 5A6WA 2DITA 1JK9B 5J2NA 1LEOA 3NGRA 3PO4A 1TKZB 3BR9A 2YKNB 5D0GA 2DGWA 1U47A 1N0UA 1UW4A 3CCQS 4B9SA 4I67A 3LO3A 5LMUJ 5C24B 2QV6A 3NWGA 2K7KA 1S10A 1FX2A 3N79A 3ITHA 4KAIA 5AE1A 1J27A 1X4GA 4LR9A 4DX5A 2RRAA 2G0IA 4DR6F 4WF9Q 3TVYA 4RNMA 2VFRA 3N5FA 4WP3A 4IH6A 2XS7A 3PYGA 5ETTA 1JJ2R 3QRQA 1G1XA 3CCUS 5C42A 1GQEA 3PYFA 3OR2B 4HTJA 4DZ6A 1Q16B 2H4WB 1KOHA 1XJWB 2XGQA 4DV7J 2CFXA 2E29A 2BKNA 4NI2B 1WF2A 2J5AA 4CH0S 4V19X 1OQ6A 5I42B 3KKFA 2JEIA 4ETXA 1OPIA 4YUDA 3HHKA 1QDUB 3C14B 1VFJA 2VBYA 4ID8A 3RB4A 1V9OA 1QTNB 2HSEB 4HACB 2V67A 1EB0A 3QO9A 4UOGA 1U2FA 2MLYA 2UU9J 2IY5B 3D1HA 1REVA 1T9UA 2ZJRQ 2AX1A 3T3FA 2ZJQQ 4IRCA 3BSAA 2DRBA 3SQGA 4QIVA 1XTZA 3MMBA 2MZTA 5J2PB 3U1LA 3L7OA 4Q43A 3G8TA 2F4VJ 2DXFA 3FMWA 4KHRA 2LA4A 3WC0A 4PRFA 1HNIA 1GX5A 2XM3A 4WJBA 1JKHA 1N5YB 4NLWA 3V6JA 4ZPVR 3IFEA 1WACA 5L46A 3HVTA 4ELVA 4ZP9A 1RT1A 1FRLA 1N5SA 4CLFA 5DG8A 4R8UB 1UETA 3GG0A 2DY9A 4EBDA 2BW2A 2RKIA 1S9GB 5H9FJ 1FRXA 2W9CA 5E33A 3BGUA 4TLQA 2KDOA 1CS4B 4Y34A 4JI1J 4YP3A 3V6KA 3DI6B 4DQPA 2BBEA 4RW6A 3R5CA 3OL6A 3H5XA 1WC4A 1J5EJ 1U1KA 4USMA 2GJFA 2RQKA 4DPWA 4XDCA 2ZZMA 2AX0A 2OPQB 2IYIA 4DV3F 2BQ3A 3PRDA 1QVGR 1E6VA 3LQVA 3PKMA 4FXDA 2XYPB 1YJRA 4WTYA 4YR2A 3R27A 4ZVTB 1Y00A 2VFSA 2VFUA 6FDRA 1R89A 1H73A 4ZA1A 2ATLA 3AJDA 4MIWA 2B9XA 3AAWB 1RQ0A 3AOCA 1FFWB 1WDTA 2HBZB 2OELA 2XYGB 1SKRA 1GK8A 5KOXA 3W62A 1IN0A 3R6GB 5HVFA 2EXUA 4U96A 1MMLA 2DNPA 2QLXA 1TFWA 1X4AA 3ENVA 3KLEA 3KK2B 3D0HE 1HI0P 2E7VA 2M7SA 3J81U 2EK6A 3SI8A 3LANA 3JSMA 2AU0A 1U0HA 5KFQA 1BMQB 3GCWP 2HPUA 2OPQA 3CCES 3WHIA 4PXEA 4N76A 3EGZA 4EUVA 1J5EF 1IM6A 1E6VB 5JVHQ 5CYJA 2ZD1B 1RTDA 1HA1A 3M1VB 4DUTA 3C6UA 4KPCA 4CIOA 2XO7A 3KJFB 3PRBA 2MEWA 2HHQA 1H0HB 4JP8A 1FKOA 1RISA 2BQRA 1XNRJ 3TOQA 2R8HA 2N7CA 1AUSL 1F6TA 2VFTA 3FCVA 5HMWA 4LFBF 2DIUA 4Y6IA 2MKCA 1XWLA 4IG3B 5BYQA 1RKIA 2M8HA 2ZC3A 4TVAB 3CXCR 3GYNA 1VRUB 1JLFA 3MURP 2YWWA 2D3OR 3UW1A 4K4WA 2HNDB 3P4UB 4OX9F 1ZAVA 5DO2A 3AT1B 2BEFA 1T8EA 4OJ1A 3GFHA 1PAEX 1K0VA 3FRYA 1UZHA 4C7QA 3BSNA 4EBEA 3G87A 2Y1IA 3TZYA 1SVDA 4JYAJ 2G9OA 4XTTA 3AHPA 1MMNA 1HWKA 1FA0A 3D68A 2AZ1A 3PDNA 2XZDB 4PXBA 1UVKA 2ZDOA 2G2YA 2K2PA 3R5AA 1IBLJ 4IH5A 3Q8VA 5K20B 1WELA 2W4PA 1RWNB 1JLGA 3D67A 1SKWA 4UW2A 2Y1LB 3G82B 1JMTA 3HKZD 4G1QA 4B9TA 4ZPDA 1DQ9A 1F3VA 4A8FA 5KFYA 2J6SA 4C8YA 2V50A 2QRRA 1U49A 3M2VA 3GJRB 3HX9A 4CO2A 1NSAA 1RLCL 3R5DA 3HXMA 3BYPA 3MCOA 2IIHA 2NYHA 3GFYA 2KN4A 2WB1D 4P73A 3ZNJ1 2FHMA 2HLTA 3ONQA 3I55S 3Q23A 3UCZP 1KSPA 4J90A 3NOCA 2EKNA 1HBUB 2GZOA 2C2OB 4JV0A 2Q6CA 2KRRA 2HWIA 1XR6A 4LQ9A 1RTIA 2IM3A 1HD1A 3DMJA 1ROFA 3GWCA 3R5JB 5FDLA 1X60A 4AUKA 1TL1A 2NUUG 3P3DA 2RQMA 3FSXA 3UNGC 2APOA 4LF7J 3KK3B 5IC4B 5BR8F 1QUVA 3KLGA 3KJVB 3MWBA 7FDRA 4A8KA 1RT6A 4N5SA 3BGFA 4ANEA 4M5JA 2PSZA 2YQ0A 2O66A 1OWXA 2YWHA 4GMKA 4CT9A 2CJQA 4ALZA 3LWLA 5J2NB 3KK1B 1OYDA 2IVMA 2D3O1 1W2IA 4UQGA 1VOMA 3MZIA 5AXLA 5C24A 3T9ZA 3BO4A 3LGHA 3J7Z5 4FPRA 1LWXA 4XPCA 7FD1A 4IO9Q 1RHQB 1VLYA 3OSNA 2DPJA 3B6BA 3EICA 4P10A 2IPOB 5LOQA 3KK3A 2PMWA 1K1QA 1M5KC 2ZKUA 2E1CA 3O2IA 5C42B 3BDEA 3KUHA 4F36A 4OI1A 3Q83A 3AQPA 3FMBA 4CO3A 1ZS6A 4URGA 3HZEA 3V5RA 3TZZA 1Y5IB 1LK7A 4LIWA 4YR0A 2MY8A 2Q79A 3FVYA 4J9UE 3RGIA 1C1BB 2WB4A 1X0PA 3BGLA 5A8RB 2AT1B 4DFJA 4NA2A 4IFYB 4L76A 3W5ZA 4ED8A 4ZCKA 1Q82T 4Q0BA 1RK8A 1BHNA 3PACA 3W64A 2B7BB 5CD4A 4OMFG 2I8EA 4UOCA 2YWKA 3RW7A 2R2UA 4TQRA 3BYRA 5D4NA 2GFFA 1MN9A 3RBXA 2BE9B 1B70B 4J9KA 4B17A 5IS2A 4D3HA 2MLZA 3MAAB 2HFSA 4DFPA 4WU2A 2W24A 4ATNA 5DQIA 2BX6A 4FS1A 1T02A 2IM2A 2I38A 3UDEA 4DR6J 1DQAA 2HZCA 2C2KB 2HVEA 1NO8A 3T6JA 2WSFC 5IQ6A 4F4XA 1FRMA 5E3RA 2DNMA 1ZPWX 2ZNYA 4CTAB 4IR9A 1WI6A 2XLIA 3KFWX 2PEHA 3UN5A 3SCLE 4ZLNA 1FK9A 1YKWA 4ZS6A 1KEKA 3DRSB 2HHHF 4IOBA 3FQKA 2B43A 2Y1JA 2G1HA 5JXSA 3EVWA 3S01A 1T05B 1NJIT 5FIIA 2ZC4A 5LJ3Y 2Z4PA 1JXEA 4UZBA 3IBCB 4USTA 1S72S 1RP5A 1JLAB 5ETOA 4ED7A 3QIPB 4WKYA 3JQJA 1U45A 2M70A 3EE3A 5IZHA 1RCXB 2ZE2B 3KXDA 3NNHA 4R25A 3IO1A 2ZOFA 2EFPA 1L5UA 2E9RX 2AYMA 3V6HA 1N34F 3C16B 3FJ2A 1WSVA 1EKRA 1V3SA 1UWAA 1IJEB 1UWBB 1FDAA 2C42A 3CDAA 2DIVA 1X4HA 5A6PA 4OZ2A 4A8OA 4A47A 3DDKA 2QSWA 2HBRB 5I4MA 2HAFA 4GKJJ 2M8DB 2X1AA 3KG4A 5DZ6A 1D9AA 2OEKA 2WCXA 4NZ6A 1VJWA 2X51A 2YWGA 5FJ4A 2NLWA 4USIA 1HNXF 1SJQA 3D1QA 3OXLA 3KJQB 2R7XA 4M5NA 2Z58B 1JB0C 4U95A 1JX4A 3MEDA 3P45B 3S8SA 2C2RA 2R2SA 4KGMA 4KE5A 3GV5B 2VQFJ 4FF4A 2A3JA 1ZZNA 1YJWS 3KYLA 3UD5A 3SCJE 3T1AA 3BH7B 4FBTA 1VCTA 1WG4A 2JJ4D 2V69A 2ZOMA 2G0JA 3JSBA 3PJ9A 4OZNA 4WE1A 1NLKL 1N52B 1Q79A 2JNJA 2O1PA 3ZTQA 2CPJA 4CO5A 5KAKA 3HM9A 2W7OA 4X62F 2W8LA 4DV2J 3PXGa 3NS5A 4YB5A 4ECUA 1IKYB 4LFCF 2Y0SD 3D7SB 1BWEA 4LF2A 4EWTA 4K0KJ 3HFZB 3DRRB 3MCMA 4AL5A 2W4DA 1OY8A 3JAMU 2UXDF 4IDKB 3DGPB 3IM9A 5DJBA 4EFAC 4QR1A 1TL7A 5B0BA 2AGPA 3BDPA 2JOQA 5KFWA 4F8RA 1YI2S 4O3RA 2XLKA 3CD6S 4K2XA 3WIUA 5CYQA 3DFEA 2K1RA 3H20A 1VQ4S 1Y3JA 4DR4F 1OQ3A 1FT8A 2OSRA 4RBUA 4ANCA 4ES2A 3TJ8A 4DSEA 3UR0A 2CVEA 4ZDNA 5KT5A 3LALA 3PG9A 4JI4J 4LREA 4QYZJ 3TW0A 2G2OA 1RBOB 5KFPA 2BOAA 4G1IA 5M2RA 1VQLS 2VG5B 4G3IA 1SV5B 3MM9A 4CRJA 3VAGA 1HMVB 3KDNA 1CC7A 2KFYA 2ADCA 3DYAB 1Z2LA 5HLFB 3MMAA 2YNIA 5EUHA 2FZGB 1S1VB 2GQQA 2M88A 4MFBB 2EG2A 4HLBA 1I94J 1OO0B 1SJ4P 5C25B 2M3DA 4DR7F 3RR8A 1OPZA 2RHSB 2YKQA 1CJKA 2JFDA 2K1RB 2IA6A 1FRHA 3BQ1A 4PEOA 2CQ4A 2MQOA 1R8BA 2DNRA 3SMZA 2ZDPA 1BQXA 1O0PA 4J9VA 5IXUA 5L39A 1VC5A 1HI1A 4J5OA 3SFUA 1RTIB 1TMJA 2B4OA 3QT6A 2WVBA 1YQHA 3CJ4A 4OYWA 4RPFA 5T7LB 3M8YA 4MIBA 4ZCIA 2HFZA 3EZ5A 3J81j 4RL1A 4AXIA 2FY1A 4TY8B 1YITS 5KFIA 1QE1A 2HMIA 4DN0A 1GMUA 3M6XA 1ZM4A 3KLGB 3KJVA 3OSPA 3CDEA 5I3PA 5C2CA 1FDDA 1UTAA 3SV4A 4IQXA 3OUYB 3RW6A 1HPZB 3MM8A 1GXTA 1XR5A 5C5JA 1RKJA 5C25A 4K4TA 9ATCB 4AL7A 2MSTA 3JQKA 3FRZA 1R27B 1QLNA 3RBZA 4GC6A 2DYAA 2HNYB 1HQEA 3GR1A 5D3GB 1C4AA 3OLAA 4KHPJ 2VHGA 4WP8A 2OJ3A 1XIQA 1XNQF 2LEAA 4KGZB 2YWFA 4ZP6A 3CVKA 3LGNA 3WBZA 3IWXA 1FWLA 3KLIA 4JI2F 4WIIA 4DU7A 4ZLJA 3K5LA 5LSOA 5L1JA 1BQMB 1VK3A 2OH2A 3BM7A 4H4KC 1N5TA 3MAQA 4WU3A 3G6VA 3W2VB 3T1HJ 1S1UB 3QIDA 1I5OB 4OYAA 5DLGA 1EJ7L 2Z2MA 4O3OA 1TL3A 2W7AA 5K8PA 3M32B 4PG7A 4RU2A 1BQNB 2BYCA 4LSNB 4DPOA 1M5PC 4F2SA 5T14A 1U6ZA 3MEEB 3PFOA 4LF6F 2KFNA 5KFDA 1DARA 3NNAA 3SFGA 1F2GA 3ETOA 1NAQA 1WKKA 2CJ9A 2B9EA 3OFHA 5DDQC 4DCPB 3KG0A 4AXJA 2RJZA 3POTA 4OYPA 4W90B 2DT9A 1NZAA 4RJVA 3F41A 5HVGA 4ED6A 2VPZB 5HROA 2OIHA 4KC5A 5D8HB 1GXLA 5G0RB 4QW9A 3IRXB 3CCWA 4GRSA 5D4OA 5DGBA 2QMWA 4TNOA 3DRPB 2OTJS 3RYLA 1KVKA 1IKVA 4ZPCA 2F4VF 1SUQA 3A8IA 1FJCA 1O5JA 2XI3A 1CJTA 2GNKA 2KG1A 2WAQD 1KTVA 4P75A 2HZVA 5KFKA 4GKKJ 4EK2A 4NLYA 3M8RA 4PKDB 5CCLA 2UUAJ 2XNRA 1A0OB 2ADBA 5H9FK 4WCEQ 4LQ3A 1A6LA 1NDLA 3QJPA 3NOGA 2AKWB 2HFNA 2FLNA 4KR0B 1Q1KA 2WHOA 1N0VC 1RZMA 2NREA 2EG1A 3UD4P 3CC4S 2HFOA 3IRXA 2XQCA 4LF5F 5HK4A 1NU4A 3Q24A 1GH8A 2NR0A 1H2VZ 1LWCA 1JLAA 1IVZA 1IKVB 2MQMA 4DN9A 5C2GA 2UXCF 1F5BA 3M4XA 4EMDA 2F8EX 1EKSA 5KFUA 1VQMS 1VQ7S 3ZZPA 3MM5B 4EZ6A 3T6BA 5A0YB 2HVHA 4NL5A 3I0SB 4TQSA 1S4EA 1RWKB 5JVGQ 2NZ4A 1I3OB 1TTHB 3HHNB 3MXHP 4JI0J 1FXLA 2VODA 1NPKA 4Y0FA 3OTCA 3IA0A 2N4CA 1S6OA 1K73T 2B4VA 1WOOA 1FNXH 2GIFA 5F3TA 3W3SA 2G1DA 4YHHJ 2KO1A 3NGDA 2JFKA 3H42A 4QZVB 1HW9A 1MU2B 4ZCLA 1N5YA 3HFVA 3Q8UA 1TUVA 3B4MA 2EFQA 1S97A 1S7HA 2VPYB 3R5BA 5HL7Q 1RT1B 3VGVA 1E6YA 2E7XA 1L3SA 1D1UA 1S1TB 1SI9A 4LR8A 4OI6A 2VONA 1LFWA 1H72C 2D3ZA 1H2TZ 2C3PA 4PWDB 1IQZA 4LVOP 4F0KA 2FJBB 1YGYA 2ATCB 3PCOB 4C0OC 4EO6A 3ILJA 3QZ7A 1FJGJ 2E1MC 2Y3YA 3IP0A 5IV3A 2BJEA 2VB6A 4AQYF 1OY6A 3RB6A 1NJYA 2DNKA 4Q8FA 4ED5A 1MMDA 2ABYA 1TKTB 3GJTB 4ZHRA 3J7A1 1VQYA 3S7RA 3NL0A 1RUSA 2CQGA 1F1BB 2C1EB 2VJVA 4N8NA 4Q5VA 5BYRA 4DQQA 3G86A 2CQCA 3C14A 4YEAA 1RHRB 5B0GA 1UL3A 2IBOA 4P71A 2EFVA 3OJUA 4F2RA 2DGXA 3HZGA 5L9NA 2P5VA 3D3BJ 3GP9A 2HQFA 1JJ4A 1UA0A 2PEBA 1NUEA 3QFWA 2QN6B 2FB0A 3JSYA 4OQJA 3ILLA 5B7WA 2U2FA 5DDPC 4P2MA 5HJYA 2B4PA 4EZ9A 3JS9A 4YY3F 3EUNA 4DSKA 1T0TV 2H4YB 2HHXA 5K14A 1GMWA 1FFSB 3I5BA 4WK1A 1UZDA 1M5HA 4YDXA 2FVSA 3CULA 1TKTA 4NA1A 4A8SA 2PDAA 2DCLA 4M5IA 5BYSA 1RA7A 5KFFA 4PQUB 2GQ2A 3L7UA 4AD6A 5BJRA 4PABA 1Q7YT 5ETVA 1S7IA 3LW5C 1CULA 1U1LA 2V63A 3FEZA 1YBUA 4M63A 2Q1LA 3BQ2A 4NA3A 3OQ2A 3BZQA 3JQMA 4ED4A 1N6QA 5K8MA 1VQ5S 1S57A 2AEFA 2L41A 4OJGA 3ILOA 3M9MB 2KU7A 4DS5A 3FC9A 4HR2A 2NXEA 1IM4A 1YVFA 3HD1A 2ZKTA 4WWSA 3VGUA 2VG7B 1OY9A 3MD1A 2AHOB 4I68A 4RW9B 2ACMA 2AIRB 1B7YB 3Q8QB 1ZTTA 2XSJB 4ECWA 2VL1A 4PQUA 2CRLA 5KFNA 5DG7A 2CWKA 2LXUA 2CA9A 1PGZA 1Q95G 5U47A 2NXJA 1FHTA 4ZP8A 1SXLA 3RAXA 1Y5LB 3BH6B 3UCUP 3G6XA 4KV8B 1MWZA 4B08A 2YNFA 4NEZA 1ZH5A 3IR6B 3W61A 3CE8A 4WXWA 3GJSB 4HH0A 2VKZG 4I64A 1K0TA 1XERA 2QA4S 4UOHA 2LQ8A 2IAJB 3M8QA 4B9MA 3LA0A 4ZPWR 5GAEU 1JLGB 2JLEA 2HQGA 3G82A 3UQSA 3KK2A 1MNEA 1REGX 1RHMB 2QC3A 2IYGA 2B9WA 3IG1B 3MTKA 3SDEB 1VBYA 4IR1A 2ZBCA 1UA1A 1S1UA 2RRBA 3D3CJ 3VAFA 4GO5X 3OHAA 3HKWA 1H74A 1TL4A 4WFXA 3HJFA 3LP0A 4IG0B 1BQNA 1U26A 1C1CA 4S0MA 3T1HF 3W1YC 2J6UA 1FESA 2P9GA 4RNFA 3NMRA 2XMWA 1HKAA 3OFEA 5B0DA 2ZVIA 3KUGA 1R8CA 3NRBA 3OTEA 4U8VA 3R8YA 3TVKA 1HBNA 4K50A 2BE7D 2W25A 1JLQA 3MCSA 1YLXA 2CQIA 5LM7E 3FBBA 4NLQA 3ETMA 2DO4A 2P6TA 4X65J 4NRUA 1Q4RA 2XMAA 2CPXA 2GMHA 1Y11A 2DNQA 3PW5A 5E3QA 2YX7A 1RAAB 4LMZA 2HNZA 4WYWA 3NGUA 1PIEA 2DCUB 1WC1A 1HBMA 4ZPTR 2DGOA 5KFXA 1S99A 2WBMA 1FWKA 3C19A 3UDLA 4DL4A 1TFYA 3OD2A 3D5MA 1IJFB 3DXSX 4L75A 3CGIA 3FQLA 3CJKA 3M9OB 1HBNB 3NAIA 2E9TA 4JYAF 2DNGA 4GKKF 1O8BA 2GJIA 1HW8A 4DL5A 2EBEA 4C11B 2AYGA 2MQQA 2HKEA 2OD4A 4DI6A 4K4YA 4O0NA 1LW2A 4GC7A 4NLUA 5IT9Y 2MZJA 1KLNA 2C28A 2RAQA 4UT4A 1L3TA 1RWWB 4LRBA 3CIMA 3NBPB 1HNIB 1Y9OA 1ELOA 4PR6A 4QPTA 1N32F 1RLDA 4PQAA 3P8BB 3HD2A 2IJFA 4RW7B 1U1RA 3K8WA 2OLWA 4C3MA 1PBUA 4HH1A 4IFYA 3MPUB 3QAUA 2YH0A 4QWDA 2VZ9A 5C7PA 4QR0A 2J9CA 1SQFA 2O67A 3ULHA 5DG9A 1ZAXA 3U02A 3UN2A 3ZTPA 4DBQA 3TQ1A 3DOLA 1N36F 2AJ0A 4LF8J 2E66A 2D7SA 1AA1B 3JYTB 3I9V9 4RW6B 2W7PA 3GJQB 4ZJLA 2GAHC 4F4WA 4NXNF 1RYSA 4F26A 1SC1B 3NBPA 3GFXA 1G2EA 3QLHB 5BR8J 4FYXB 1VBZA 1DZ5A 1DY3A 4F3OA 2N3OA 5IWAJ 1EHWA 1QSYA 2IC3A 4KHMA 1RAIB 2CNOB 1P9QC 3QO9B 4ERDA 2BRKA 1CJVA 1KLMA 1QUPA 3IXQA 3VR1A 4D3GA 1RT7B 5DZ7A 3SSRA 1NCLA 4ECTA 4PAAA 4JI5J 2R7SA 1D09B 2P9CA 3DU5A 1H2UX 5EX0A 1BY9A 4KFBA 4ZVOB 2VICA 5HBMA 4IQMA 3CC7S 1U1OA 2LLZA 1N88A 2MKSA 4TU7A 2NXCA 5J1NA 4KQZA 3TZWA 4Z7CA 1QAYA 2OO4A 8AT1B 4U7CA 4O0IA 1HQUB 2N7YA 2IC3B 2ZJPQ 2ROGA 4WFBQ 5H9EJ 1U09A 2QYCA 1RTDB 2KTQA 1C4CA 1VRQC 2XWXA 2MMYA 2VG6B 4A8XA 1U1PA 3CJSA 1Q5YA 1WHXA 3N4WA 3AJ2A 4K59A 4DR5J 1WEYA 3B78A 4CNZA 4K5RA 1X4EA 1VBXA 2XB2D 3EYZA 2IM0A 4JUZA 4DX6A 3W9IA 2C2EA 1NB7A 1SIWB 2KT5A 4CLWA 3MCNA 5AXKA 3NMAA 5IQQA 2J7WA 1IWAA 2FTRA 3TWZA 4GVBA 2FLOA 2PN6A 1T9TA 2A0FB 3M8PA 3GIRA 1WNEA 1UP1A 3DOMA 4ZCMA 4JI4F 3TRGA 4HTIA 4MTPA 5CCMA 1SB6A 1U6FA 2DISA 1V5IB 4Y2CA 5FLXU 1KD1T 3CCRS 3FCWA 2HHHJ 1FKPB 2H54B 4ZN3A 4I2PA 1U2CA 1K44A 3J80U 3PW2A 1HR0F 1HYSB 4FVMA 1Q8BA 5AXMA 4BHQA 1T7PA 4OI4A 4OLPA 2H48B 3P5TL 2F3JA 4DPTA 4W92B 3CF5Q 1LQ9A 5SZTA 1U8WA 5IM0B 1OJ4A 1U0HB 1EQ0A 1D8ZA 2WRMA 3Q8RB 1YRTA 3FGVA 4QU6A 1RTJA 4AL6A 1X4CA 2XZTB 1NNDA 2ZD1A 3QGIA 2BACA 4QIFA 3C6UB 1KN6A 3LPEA 4JB8B 3TA1A 2DR7A 3MMJA 1LKZA 1FNMA 4OX6A 2LP4A 2CNNB 3V4IA 2FZKB 2FVRA 2HHTA 1N54B 1FKPA 2BJ3A 5GMKa 1VRTB 1Z1ZA 3OFFA 3TI0A 1MROA 1TU0B 1EETA 4HVZA 4M5MA 4YS2A 2LFVA 4DR3F 3CJ0A 1AFJA 3W2WA 3C15B 4DR7J 3HHEA 5T41A 5E41A 4R5PA 2W8KA 2FHJA 2B8PA 3ZTOA 3T19A 1HNXJ 2QTWA 3TR5A 2R7WA 1LW0A 3SDEA 2QA4G 1UW9A 1PKUA 2HNDA 4YQWA 4DV1F 1WEXA 1GXUA 1SL2A 1HWUA 1GT8A 1RTJB 4X65F 3IMQJ 4JI2J 2XS5A 4N41A 4BC9A 4DQSA 1JXVA 2FUG9 1UEKA 2H65B 3Q2SC 4OZ1A 3TAMB 2HS3A 1X4DA 4QBUA 3MR7A 5CYMA 4B3MJ 5F41A 4K4ZA 3HK2A 2GQCA 3D6TB 1SL0A 2UZAA 4X62J 2R7VA 2OFHX 4QIEA 2M5YA 4YY3J 3C6TB 1WC6A 5ETMA 5E0OA 3BKFA 4EEYA 4F67A 1YRUA 1C0TA 3MPWA 4LRDA 3W2WB 2VOOA 1QE1B 2DH9A 2OKQA 4LFAF 1L3VA 1LW0B 1RT5A 4LFAJ 3PYEA 4HHHA 1RTHA 3W8GA 4EU0A 4LR7A 4X4OA 4O3SA 4ILMA 1HPZA 1ICEB 1T9VA 1HLWA 3MM8B 4PYDA 4M5DA 4X84A 5CABA 3MM7B 4PYAA 2JC0A 1NHUA 1SL1A 5L1KA 5A76A 5A8RA 3PO5A 3MOJB 3HJVA 3HSGA 4K4XA 3LWMA 3OT9A 2LQJA 3E01A 4C8NA 1DTTB 1WF1A 1YJTA 3FZ2A 2BJ8A 1M5VC 4DQRA 4FYVB 1FE4A 3NG8A 1M1HA 2WONB 1ZAWA 1CQMA 1TL1B 5AE2A 1KP6A 2DKOB 3EPIA 1N48A 1HMVA 1KOOA 1D9FA 1U6BA 4DG1A 1PO6A 3MMAB 4ZP7A 2D41A 3AA9A 3DLEA 2FJDB 1R0AB 1I1GA 2DPIA 1S1VA 4MFBA 1RT6B 5D15A 1AROP 4R0EA 3TNVA 5L1LA 1KRPA 1NHKL 1WEZA 2LXFA 1UVLA 3O3LA 1T3NA 4USHA 2ALZA 2W2PP 4NXNJ 4IFVA 1YX2A 1HR0J 2DXEA 4B3RF 1B4SA 3D6FB 5HQ8A 4QWAA 1UVNA 4NPOA 3OL8A 1HNWJ 2KRBA 2AEMA 4UTGA 2CJKA 4XAKA 5T7LA 1EIYB 1BC6A 2CADA 2CWXA 2GVDB 3NS6A 4DPYA 3IM8A 2PA3A 3UE2A 1M90T 3DOLB 2HW3A 1TMMA 3CPWR 3EMTA 1R8PA 3GIMA 1HHQA 1MN7A 1S1XA 2D9OA 3DU6A 2IFXA 4USKA 3SIPB 4EBCA 2QZ8A 5A2QY 3QT8A 3TA2A 1RWPB 4DUZJ 1TP7A 2ROPA 4O3PA 2E5LJ 3QLHA 3GYGA 4IFVB 4ED0A 5CQGA 2CQPA 1PCAA 4OZJA 5HJXA 2I6WA 3ZZOA 2NPIA 2JHEA 2VQEF 1CLFA 3MFIA 3T1YF 1IKXA 3W7BA 4U6PA 3O5TB 4NZ0A 1URNA 5D0HA 4C3KA 5GAHU 4Y28C 3TJ9A 1KLMB 2XY6A 3H5UA 1H38A 1YZ7A 1RT4B 2GHWA 2J7UA 1VHIA 2BRLA 1AUDA 1V6HA 2L9NA 4X4NA 4ECSA 4JOUA 1SH3A 4E2FB 4ILRA 2KKHA 1FVQA 4UUWA 2IM1A 3N0VA 3PR5B 1YJ9S 6FD1A 2C2NA 3IAM9 4FYWB 5I3QA 4MYTA 3MEDB 3HVWA 3I0SA 4AQYJ 3EX7B 1SH0A 5F8LA 1ZETA 1VISA 1DJ0A 2QG9B 3IR5B 3TX0A 3TUIC 2AV5A 3X3UA 2MQPA 5DLFA 2L08A 1EZZB 1PJ7A 2COLA 2HQIA 3FEYB 4NASA 4P2XA 4QW8A 4WE1B 3TJAA 5LL6d 2F7VA 2E5HA 3VAHA 3NCRA 1R8HA 3R6LB 2CKWA 4I6AA 2EFOA 2HFUA 4PWUA 5EGYA 3M8SA 3MDFA 3DLLQ 1O51A 2HQDA 2MJNA 3Q8PB 2GX8A 3DRRA 4BBYA 3KNAA 4CLKA 1FRKA 2W01A 4B9UA 3OL9A 2U1AA 2YVSA 2F40A 3MUVP 2VPXB 2ZM6J 2LXIA 1U02A 4JV2A 3O8WA 5KG1A 4TU9A 2ZE2A 3N01A 3ZFVA 4JI6J 3CO9A 1HWJA 3I32A 3MGJA 4XK8C 4DV2F 1X0FA 1JWWA 1X5OA 2B9YA 1SJ3P 2YWEA 2NYIA 3IR7B 2XY5A 2M2BA 3GILA 1YBAA 2FQQB 2WSCC 1DURA 1UWBA 4F3MA 3TYTA 2IVFB 3VF0B 3NGKA 2XS2A 2KHDA 1XMBA 4DU8A 2H5EA 2I5JA 4N8OA 4NRTA 2W2NP 5ETQA 5L38A 3DOKB 2OD6A 2X1FA 1UCNA 1ZZFA 1A7GE 2V2VA 4DV0J 8ATCB 2W2OP 1UJ6A 1SQGA 2NSCA 3LP2A 4HT5A 3OLBA 3KHGA 2UUWA 4OZ5A 2LDYA 3IAS9 4C0HA 3HDSA 3HP6A 2RT3A 4CWBA 4K2JA 1RABB 4KBIA 3HVTB 3ET6B 1B7FA 4KH0B 1R31A 4TXSA 1QAXA 2YKOA 4DV1J 2P2CB 2CDRB 2V2KA 5GVQA 3CB4A 2CPHA 3MEGB 5B0FA 1M5OC 2VA2A 1J2VA 4ETZA 3BGRB 3MECA 2PC6A 3MUMP 3EJMA 4USWA 1FDNA 1C0UB 1SQEA 1DAXA 2XNQA 5M2UA 1EETB 1FD8A 4FVCA 4DUZF 4UY8T 3BN7A 4NLVA 3G71S 5HP1B 3GSDA 4A48A 4TYAA 3GCXP 1KC8T 5J1EB 1WUUA 4NWBA 4P2FA 2NZCA 3IRWP 4KGVB 4ED3A 1HWIA 1NSKL 3VTIA 1CG2A 5EN1A 2WTFA 5F9LA 1R6YA 5GADI 4RUHA 1CPZA 3CD7A 3QYYA 5J2MA 3QBCA 2MPUA 2DRDA 3H5SA 3MEGA 4I4BA 5AJ3F 3PYDA 1FTRA 5EWFA 4K4VA 2W9AA 4Q44A 4DR5F 1CEZA 1FRJA 1HQEB 1RAJA 5CH7B 2G13A 3RB3A 3PY8A 4I6YA 3H25A 3J7AN 3UDVA 2HHPA 5D0EA 3SSQA 1DRZA 2VQFF 4B3OB 5LMUF 4DV3J 2QLWA 3CJ2A 4CP5A 2H5JB 1RT3B 3PJXA 4L3KA 1RAHB 1SV5A 2B5JA 3MM9B 3R7BB 4RUCA 3GIIA 3ZC4A 2MYFA 1P1TA 2YX1A 5CHCB 4LRCA 1NKBA 4MT1A 1CVJA 2BJ7A 3M8ZA 1F0XA 3OTBA 2KXNB 2PI4A 1TL3B 1N33J 4HL9A 1VIXA 3OXFA 3IGNA 4KV8A 4ZJOA 5KFCA 2RDDA 3CJTA 5DQGA 2A10A 1UKUA 2C2MB 4DV0F 3MEEA 1IR2A 2D1CA 2OP5A 3SYZA 3DXBA 2X7IA 5IV4A 2JLGA 2Z8QA 1HNZJ 2IAJA 1B3TA 3H59A 3QPIA 1RADB 3AOBA 4LIRA 2K7JA 2O01C 2EC2A 2X1BA 3D54A 1UPPA 4M5LA 4FPIA 3H7HB 2C3OA 1LWFB 2Y8YA 3D0GE 1RT3A 3PM9A 3D28A 1NK0A 1AXQA 3TUPA 4DG1B 1CULB 4FNHA 3DLEB 1RAOA 1SC4B 1VYAA 2AJFE 2CAJA 1S79A 4ZVHA 3AOAA 5KG3A 4OZLA 4B3SJ 3ISND 1S0VA 1XMQJ 3GPAA 2FZCB 3HFKA 1N4LA 2NQPA 4USJC 3A8KA 3OR1B 1ZTWA 3DKDA 4X4SA 3MR2A 2ZWOA 2RUSA 1XMOJ 3NXZA 1HHTP 2JEJA 3DRYA 4L3NA 2VOPA 1HL6A 1BUXA 2IJRA 1S9EA 4U7UK 1NJWA 4KKOA 4WP9A 1VJQA 2RS8A 2AD9A 1NM2A 2GVDA 4DPUA 2OPRA 4Q2MA 2QMUB 3PV8A 1FX4A 2BQUA 4W4MA 1I94F 4DWIA 1HNVB 2RF2B 3BS9A 1X9SA 3U27A 3CCMS 3Q86A 4FP9A 4RLEA 3V6DB 1GTEA 1B0TA 3I4PA 3QZ8A 1TKZA 4PCQA 2MHEA 3H0PA 3OR1A 4DCOB 4DLEA 2DVIA 3H5YA 2ZVSA 3AB2B 5A2QU 3M8QB 4JBCA 1MWQA 2D9PA 4PG5A 1VQ8S 2CPIA 4C0BA 4ENOA 3BPSP 2H9ZA 2GW8A 4UZCA 1KQSR 1UEUA 3PR4A 3KLHA 1K8AT 2YKPA 3NAHA 2B0GA 4ZOSA 3A12A 2JEGA 3T1YJ 2AP6A 5LT5A 4QWCA 3AB4B 3C2PA 1FE0A 3TARA 2XMTA 2ZZTA 1YJVA 3OTDA 1TV6B 2XYHB 3US5A 1Q8IA 1RCOB 2CQHA 3FSYA 4MJKA 5KT2A 4DR2J 2DK2A 3BREA 4OYXA 1MG7A 2QMXA 1V5VA 3THTA 4Q45A 2GIQA 5GADU 3GG1A 4RNNA 1NJZA 3ENWA 4FXWA 3SSSA 1F9HA 2DHSA 3JTOA 2VPWB 3PEHA 2OUGA 3SCKE 3RBEA 1AB8A 4EYHB 1F5AA 3OUYA 4OYOA 4O44A 2YPYA 1P27B 2E5IA 4NLXA 2EVZA 3WX4A 4DSJA 2V2ZA 2EC0A 2EBGA 3GV7B 1G4CA 1T9WA 2FGOA 1DTQA 4RBVA 1S0NA 3DLHA 1MLAA 3D66A 1LWCB 1RWXB 2JRSA 1KKHA 4Y2KA 2XY7A 3FUYA 2BDPA 4Y2AA 2XULA 4FNIA 4NLPA 1TKDA 2WVCA 4GO7X 4B9NA 2UXBF 1AFIA 3G8QA 3MM5A 4WIQA 4JI5F 2SXLA 3PX4A 4UOFA 4DX7A 4RBTA 1X31C 1FNOA 4X4RA 1VI7A 1FDBA 1PC4A 1S6PB 4HHUA 2CQ0A 2XMVA 5HANA 5KG0A 1FXDA 4H4MA 1KFDA 1QM9A 2QA1A 4NCGA 4WBFA 2A6MA 5B09A 4ZIWA 1WF0A 3QSYB 4JI7J 3G6YA 2EFNA 3UN3A 2AYBA 5K14B 1IWGA 2MJUA 4YOEA 5KFVA 3OR2A 1PC5A 1NBEB 3J80Y 1AW0A 3U1MA 1PJ5A 4MAKA 5D77A 2ILZA 3W63A 2WK4A 5DM7Q 2ZNZA 1YTYA 1HARA 2JVRA 1HIYA 3BGOP 5BXIA 2FVQA 4LJMA 3ZZRA 1NDKA 5H9EK 4XDDA 4HACA 1ZPVA 2F8MA 1H3DA 4JV5J 4JI1F 3CWJA 1FEHA 4WYLA 3RAMA 1VMBA 3H40A 4K7QA 1N8RT 3OW2R 3SQGB 1HWLA 3R97A 1HHSA 2F65A 2Z2ZA 3P96A 3S1TA 1Z2ZA 2UXCJ 3T5KA 1Y5NB 3H8YA 2BOPA 3KLEB 3CMAS 4C48A 3QJJA 4DR1F 2EPIA 3OVAA 1S59A 4P2SA 5E3AA 2HRUA 3M8PB 1YRXA 4FZVA 2DNNA 5GMDA 3D2WA 3DOMB 3MI7X 2UUBJ 1RWUA 1JNRB 4Q8EA 1DLOB 2DBBA 3EZOA 5F8GA 3LP1B 1NK5A 4CLYA 2A2DA 4ZVGA 3WQPA 1CJVB 4PUOA 2N4DA 2IVYA 2GVZB 3TAQA 1CS4A 3PVXA 3C3LA 2R4FA 4NYZA 1PBAA 3F0NA 3I5AA 1Q78A 1G7CB 3PTWA 4DOZA 4F4AA 1TAUA 4Z7YA 4I69A 2V34A 3BBFA 2NXUA 4B3OA 3NWRA 4BCAA 4IG3A 2MDAA 1QVFR 2FYXA 1NB2A 2QL7B 3CJRA 2JLFA 2FHJD 3PW7A 2CVIA 3NKYA 2DR9A 3RRGA 3CT9A 2LQBA 2AJ2A 4DL2A 5ETSA 1HQUA 4RR5A 5RUBA 2ZWPA 3DCAA 5KT7A 3HLUA 3PW0A 4DR1J 1VQKS 4X4QA 3CCSS 4CNYA 3M6UA 2E5JA 2VG6A 2LKZA 4RX6A 5K5MA 2XLJA 1FJGF 2Z2LA 2F63A 1T11A 5DETA 4OYBA 4PUOB 4K0KF 4KHPF 4CYUB 3AH6A 2V8VA 5ETNA 1QY7A 2GHPA 4G6VB 2LMIA 4NXMJ 2I0XA 4C8LA 1JLCB 2L9DA 2ILYA 1JNZB 1LWFA 4YN3B 2KYXA 3EXCX 3HT3A 3G4SS 2UVWA 2MB0B 5HMXA 4C8KA 3M2VB 2R7TA 5GAEI 3KLVA 2V4JB 2UXBJ 1RE1B 3HHLD 2QYGA 1WDDA 1TL5A 4F4YA 2FC9A 2P8IA 1YIJS 4B9LA 3C46A 3IS9A 2M4MA 2QL9B 5MLCV 4USUA 2VDIA 3CJ3A 1NJXA 4RNHA 3TAMA 3P49B 1XC9A 2OHDA 4CYUA 1Q7LB 2BJDA 3LAMA 3L3CA 3R5GA 4DV5J 1HNZF 4JI7F 2WW8A 4OJHA 5F0WA 2CQBA 3ZZTA 5ADZA 5LXRA 3F73A 4BWMA 1RB0A 3J81Y 2QLJB 2X3GA 1JIHA 1XNRF 1GNKA 1PJ6A 2CQ3A 4OYZA 2CQ2A 4WXOA 4C11A 3RAQA 2MTLA 2DNLA 3VV2B 1VLOA 3VHQA 4KPYA 2HBYB 4F4KA 2KXHA 2YNIB 1KNZA 3IG1A 1NPRA 4H54A 1EP4A 4I7FB 2FVPA 1HBOB 2BM1A 3H2VE 1TUGB 1NHVA 2V8HA 3EVOA 3AODA 2KHCA 3L9ZA 1UFKA 1Y0HA 2F5GA 3KWMA 2CUYA 3LP0B 4IG0A 2B3TB 3GB0A 4NZ7A 5DDRC 4DSLA 2KT2A 1V3RA 2QO3A 4DJBA 4ZIVA 2J9EA 4DV4J 4JV5F 2HIYA 1WKLA 3G9CA 2B6AB 2HWTA 3D1OA 3FBCA 3ILIA 4QIWD 4YB1P 2OEMA 5KG6A 4P9SA 2ZBPA 3GIJA 2OPSA 2I2YA 2UUBF 3C15A 2L3MA 5F8MA 1Y4ZB 1ACMB 4A4JA 4CO1A 3Q0AA 3R1HA 3ZZZA 1ZOTA 4N56A 1WORA 2POKA 4WFAQ 3A3OB 1EP4B 2C3YA 2GA7A 1KR4A 3MOZA 1F5CA 2VC0A 3K5NA 3BO3A 1U1MA 3M6VA 4IOAQ 3QSIA 1PG5B 2CG4A 2QSFA 3M7VA 2IMWP 3I31A 3E2EA 1FTCA 3NEKA 2ZH8A 3FK4A 1Y10A 4X2BA 2CPZA 1QTMA 3ISNC 2IRXA 5KT4A 4J9LA 2DY1A 5THWA 1S6QB 3CNQP 3EGWB 4RWWA 2B6AA 3U7JA 4Q0BB 2AF6A 3NCQA 1Y7PA 4ZPBA 2V0NA 1FJ7A 4N47A 2DH7A 7AT1B 1G6BA 4PG6A 5EWEA 4FF2A 1S1WA 2UU9F 3MUTP 1S49A 4TLRA 4Z2XA 1LW2B 2RDJA 2UXDJ 1MSWD 1NPPA 1C2PA 3VWSA 1R43A 1S77D 4NE9C 4QU7A 5E3PA 1YHQS 3EDQB 2C3MA 4HYKA 3I5CA 3FDSA 3BJYA 5G4DA 3QJLA 2CQDA 3DDNA 2XCAA 3KK1A 1IR1A 3T41A 2BKPA 2VKRA 2YKMA 1ZBTA 3R9LA 1KHWA 3POTB 1U1QA 4FYDA 1FK9B 2BANA 5EWGA 2H3EB 4ECXA 1UEVA 2LQ9A 1RT4A 2VH7A 1KFSA 2IRYA 4FF3A 1TKXA 2GGPA 1GAOA 1U2RA 3BPDA 3JYTA 2HK2A 3AD7C 3T9NA 2V8DA 3SQOP 3TQEA 4C2MA 2IA0A 3D6HB 4P7VA 2QFJA 2FLLA 1KQFB 4L74A 4XIUA 5JJBA 4M94A 2VBWA 1WKJA 3LGMA 1UVMA 2C2ZB 3JB9k 1KONA 2ZFHA 3QAEA 2YH1A 5JUMA 1T03A 2XHWA 3DDIA 1SCJB 3ZZYA 4HEA9 3G96A 1VC6A 2R2RA 1F9EB 2LEBA 2HHWA 3IC1A 4GKJF 2OMLA 1Q81T 2FY8A 2H1YA 3QATA 1RT7A 1RGVA 3CMES 1PSDA 2BUNA 1PYTA 3DLKA 1ZYQA 4F50A 2GGPB 4KFBB 3DI6A 4DL0C 2V4QA 1KBRA 4KYZA 3MAHA 3K58A 1IBKJ 4NOHA 2BE2B 2JEFA 1WG5A 3PJWA 1ULRA 2XZWA 5DDOC 5D4LA 4XO0A 3TVZA 3MM6A 4A8WA 2AGQA 4DL7A 4FN5A 2W4CA 2FJEB 2NPFA 4CTAA 3CCZA 5B0AA 4U7UD 4FYYB 5F9NA 5E5NA 1SPBP 3EXYA 2EI5A 2MXYA 3BKTA 3GV8B 3MPVA 5IOLA 4RZRA 4DR3J 2DR6A 1JLEA 1B99A 2GVZA 2PMHA 5AJ3J 1AYEA 4B3RJ 3CDUA 2JL9A 3AA8A 3DLKB 2Z56B 4KY3A 5KT6A 1TK5A 4NMXA 2Z30B 2GV1A 1RAEB 1YG0A 3H2LA 3MF5A 4I2QA 2BE2A 3ELHA 4CZCA 3QIPA 3SCIE 2BJ1A 3DGPA 4MKAA 4DX8H 5IWAF 2KI2A 1JXLA 4IOCQ 4GVBB 4NEYA 1E6YB 2HHSA 2KZZA 4U67Q 2CZ9A 3IN5A 2HS4A 5ITHA 2KT3A 4LVNP 3UVJB 3W8PA 2M9KA 5CYQB 4OI0A 4NCAA 4MK9A 1AZSB 4FS2A 2NS1B 2ZBIA 5CYMB 3BGRA 3MECB 4M1KA 3VGTA 4ECZA 1PILA 1D0EA 2GMJA 4ZKAA 4EGLA 1S9FA 3IWNC 2HZAA 4Y3CA 5AE3A 2UUCF 1A9NB 2LECA 4ZHRB 4ZN1A 1UFLA 1WHVA 2IBKA 2KJWA 5D78A 4OLOA 1IKWB 4J9RA 3UD3P 1JLFB 4ANDA 1D3WA 5AXNA 2FJVA 3V2UC 3BF4A 4J9NA 1RTHB 2R8GA 2K06A 2HQCA 4OYMA 4HHJA 1HQ2A 2AJ4A 4M5DB 2WBRA 5J2MB 2Q6BA 2ROEA 2CPDA 3IBWA 5L1IA 4F4ZA 3OFGA 4LSZB 4I6WA 3S6EA 1APSA 2Q66A 1W25A 2HWHA 1LOUA 2OEJA 3E01B 3HI9A 1FVSA 1VRTA 1U25A 3K89A 3LOUA 3M30A 4CI0B 2UVUA 4O4RA 2QJ3A 4X4TA 1XMOF 4Q2LA 4LF6J 1UVJA 2G4BA 3DHXA 2OMOA 3WX8A 1KVJA 3IWLA 4R5PB 1BXNA 1TQLA 4ECQA 5LSLA 4YFUA 2ZOGA 2RNEA 5D6GA 1VQPS 1X5SA 4LF7F 2VC1A 2V4RA 2M0GB 2Z2YB 1ZM9A 2DHXA 2PIIA 4LSLA 3PHTA 4O23A 3WDOA 4O3NA 4F04B 1FRIA 5DRKA 1CC8A 3MR3A 3KHLA 4KTQA 3QFHA 2ZITA 1RJJA 2R9LA 1JJCB 2J0WA 1R3NA 2JX2A 1RSCA 3CDWA 3RTVA 3FBEA 3M30B 2RQCA 2VG7A 4RUBA 1J5OB 2HHVA 2CIMA 1NDPA 2HGNA 2V5HG 2Z57B 2QFIA 2EWHA 3FSIA 2M52A 4TYBA 3V4MA 1DQ8A 1RU2A 2W2QP 2ASYA 2R7QA 1UAWA 3BKUA 3QGGA 2DO0A 4K8RA 4L73A 2R42A 3K5MA 2ZH3A 3W2VA 2AEJA 2MKYA 3CMQA 4RW8A 5J2QB 2QIFA 5FLXY 4N77A 2HVZA 3M05A 3T5JA 3RR7A 3DN9A 4K4SA 2PFFB 3W65A 3UWTA 3I96A 2QGFB 4LSLB 1R0AA 4YHHF 3BEGB 1VBKA 2HS0A 4PXCA 4F0MA 1LK5A 4CLSA 5LMNF 3KNGA 2LQ5A 4J9SA 4LF5J 1SIZA 2MKKA 3KMQA 3NY0A 1XK8A 5KFJA 5GMEA 3DLJA 2Q3PA 1IKXB 2HAIA 2J8SA 3SXLA 5DS7A 4DL3A 2R8JA 1T9XA 4P7TA 4XPEA 2EEYA 4I1TA 2MKJA 4U8YA 1U7LA 1FKAF 4HI1A 1FI4A 3AQOA 5HROB 1P1LA 3DLGB 3VZIA 5F8IA 2CXEA 2KJVA 2HGMA 1UFWA 3NS7B 4TY8A 5G0RA 3D6MB 5HI7A 1KQKA 5K8NA 2A6OA 1OYEA 3RJMB 3MMCA 4ZVEA 4KH1B 1IR0A 2WOMB 2A1BA 1UJ4A 4OI3A 1SUQB 4DFKA 1S76D 3WIVA 2ZUAA 3BSOA 1O6XA 1L3UA 3BBBA 5HQMA 4L72B 2ZH2A 1QJHA 4LFCJ 2R7UA 1U24A 2HNYA 3CEDA 4K5SA 5ETPA 1UJ5A 2ZBQA 4LF9J 2DNOA 1ZA2B 5HATA 2P6SA 2FC8A 2MQNA 3AY0A 3DM2A 5KG4A 4DZDA 4RU9A 2D74B 1JLBA 2YY3A 4DMZA 3J7YU 3K57A 4DV6F 4OHWA 4JV1A 3ENAA 1ZA1B 2CPEA 2GHVC 3DLGA 2KM8B 1KHVA 1W26A 1VS3A 2IJNA 2QL5B 2DGUA 2IMOA 3PKYA 1TR0A 2W9BA 3MMCB 4N7TA 3QT7A 1RBAA 1S5ZA 2WOMA 2X3DA 2YKAA 4C97A 4PPZA 2VU5A 5KG2A 1B0PA 2J6TA 4JI8J 1OSCA 4DPXA 4M95A 2R8IA 2YTCA 2YNHB 2Z0GA 1XEZA 1YSJA 3MEKA 2F8HA 3VCDA 4DV4F 2X1GA 1GFWB 3TO8A 3W9JA 1NRKA 3ITHB 4NLSA 2DNHA 3MR5A 3KLFB 3DM2B 3ZZ0A 2OAUA 2BA9A 3J7ZT 2VQEJ 2NXNA 1FERA 1H6KX 1RWVB 2AYEA 4GVLA 3T5HA 3Q8YA 1RU1A 2WVDA 1SC6A 1WOSA 3M6WA 3MR6A 2HVIA 2L48A 4NMLA 1X8DA 2HURA 2K3KA 5AT1B 2MQ8A 4CQ1A 2XMMA 1RBLA 4W98A 1Q5VA 1JQGA 2RB7A 2V8PA 1HFEL 3I82A 2YNHA 5KT3A 1IBKF 1PAUB 3NP5A 4M5HA 2OPPB 5SUHA 1GTHA 1HI8A 1N36J 3UPFA 2ZH7A 1IBLF 4RW4A 4PWDA 1CJUB 2ZH5A 4Y2MA 2DTJA 1F60B 1X9MA 3NGTA 3EPGA 4ZVUB 3DLBA 3JAMY 1N34J 2DR8A 2E5LF 4UY85 2VV5A 3MMBB 4P6QA 2W2MP 4ZVSB 4J7CA 1FXRA 1C0UA 2C3UA 4B02A 1L3KA 4MK8A 3PIPQ 1DHMA 4ID5A 4L6V3 3B54A 1M1GA 5K9FA 2JVOA 2ZH9A 2XO6A 5KTQA 3W9HA 2C2DA 3K59A 5F8HA 4NLOA 3DGVA 2YKNA 3OHBA 1LNQA 3SBMA 5F0UA 2Y9HA 2CG8A 2DGQA 5I3UB 4CCHA 1S9GA 5KFSA 1LXJA 5IT4A 1VQ9S 2V9WA 5D4PA 5MAOA 5A8WB 2XSFA 4A46A 5CZXA 1LWEB 5KFBA 2J8AA 2MZSA 1YZ6A 2I5JB 2LYVA 3KG1A 4X64F 4WFNQ 3ADAC 3DOKA 1IKYA 2BKOA 4PPDA 4C8OA 4B3SF 1DTQB 5H1SV 2UUAF 3LP2B 3GSIA 1WC5A 2IHR1 2QA2A 4UQTA 3OVSA 3BBCA 1RDRA 2BZ2A 2V9KA 1OS5A 3CJQA 1S6UA 3ET6A 2KZMA 3L7PA 4TY9A 4HI2A 3PW4A 1IXKA 3KUEA 4RKUC 4CLTA 2R3VA 1MWYA 1VQSA 4O4GB 1Z4UA 3GFZA 2KG0A 4C3LA 4DSFA 1R8AA 4H4MB 4MK7A 4NCGB 1WOPA 1VQOS 4HKQA 2AZ3A 2MY7A 4NLRA 4CM2A 2RU9A 3OL7A 1LWEA 2ZHOA 3TUJC 5KOWA 3NNCA 4NYOA 3QMQA 1NH8A 2RUGA 2XSJA 1WHYA 4EO8A 3I4HX 3JSMB 5KFOA 2RQ4A 3IBFB 4M5KA 2J0QD 2PI5A 4QQBA 3P5BP 3M1VA 3HHLB 1U1NA 4TU8A 4MH8A 2HBQB 3PRVA 3VVTA 1KVIA 3RBDA 2KVQE 4LF4F 3HMJG 2DHAA 4OHZA 1NK6A 1HYSA 1SH2A 2CPFA 4LBIA 3GYXB 3LF0A 4URSA 3FFIA 4CLUA 4Q7AA 3R2CJ 4DLGA 2GO9A 1XR7A 3TAPA 4Y65A 2DEJA 1WG1A 4OHXA 3WZ0A 4PG8A 4TKTA 1QSLA 5HQLA 5IM0A 4OHVA 4WK3A 3R3TA 2OPRB 3VQSA 5JMNA 2KYZA 1CQNA 2XWYA 1S12A 4PZVA 3VZHA 1NEEA 3CDBA 2GIRA 3CSKA 1NKCA 5K8OA 1EARA 4HT7A 1UPMB 1Q86T 2DRAA 3V6DA 1M0SA 2C22A 2RIJA 3CCJS 3JSRA 2FHKA 2PE8A 1SKUB 1FCAA 2KVIA 3M2RB 1DFDA 1WHWA 3A3PB 2HYIB 1M5SA 4BC7A 2XI2A 5EDWA 2AGOA 4OYIA 4YB7A 4LUBA 4OZ3A 3FCHA 3ZTRA 4LF9F 4AT1B 4WZQA 1RT2A 1D8YA 5CXTA 3KLIB 4A8MP 2ASLA 2PFDA 1BQMA 3N28A 4KGKA 3V81B 3PIOQ 2KL8A 3CW2C 1VC0A 1HBOA 4F7VA 4X4VA 2HFVA 1UMJA 2ERRA 2E9ZA 1IQTA 3HSZA 2FDNA 4P74A 4B3TJ 4RNOA 4QYRA 1NH7A 3NLCA 1WI8A 2HVDA 2ASDA 2F9DA 4IRKA 4OHYA 4I0WA 1RAGB 4J91A 5GAGU 1RA6A 4J9QA 1WWHA 2FLPA 4NXMF 2JZ5A 2MSSA 1LFPA 2DHHA 2E1PA 1K1SA 5LXYA 4QCLA 3M2UB 3DC2A 1QAJA 5HAOA 3TEGA 3V81A 1N32J 4AFFA 2FVCA 3QNWB 3PX6A 2UVVA 2WZ1A 2CJYB 1T94A 2YXLA 5E2QA 3AD9C 1X7VA 3MM7A 1VK8A 4X66J 2WVEA 3CIZA 3DNCA 3SEOA 3BR8A 5I42A 4NLTA 1NSPA 1QD1A 3MTJA 4BS2A 4IUFA 1HNWF 1R7IA 2K3IA 3N6NA 2LEPA 4DV5F 1B64A 3H90A 3HVAA 3TUZC 2FJWA 2CNKB 3HHLC 3RZAA 4ZJQA 3FEXB 1P9YA 2V8GA 2DHGA 3GIKA 4U9RA 2BJ9A 4OFZA 2YPZA 2V6AA 1S1WB 4QYZK 1XMQF 4WKRA 4ES3A 1H98A 2XCPA 2F9JA 1OIAA 3F44A 4UUXA 1FEEA 2DR5A 4OV6A 2XMJA 2CDQA 4MIAA 2GJ2A 3TX8A 4WTOB 3HO1A 2MZRA 4ZLPA 3N6LA 4DDFA 3PEJA 4KO0A 5HO4A 4MKBA 1HBMB 2PT0A 3BO2A 1RTZA 3L4BC 3LAKA 3ZXWA 4EYIB 4E0DA 2Y8WA 2O5DA 4KSEB 1YJ7A 4LF4J 3BB5A 3GU0A 4JI3J 2QX0A 5GAHI 4QWEA 3I87A 2BV3A 4F02A 1JJHA 2CNLB 3H4BA 1S48A 4AE5A 3I56S 4DF8A 2F4FA 4BWJA 4QIGA 3H2UB 2VA3A 2VF3A 4CLLA 4ZITA 3MAAA 1K9MT 3LTOA 2H51B 3BV8A 3RUBL 2MGZA 4ICLB 3OJSA 3TEHB 4ED1A 1WSRA 2YQ3A 2OGUA 1MU2A 4J9MA 3UFCX 3EWGA 3B4DA 1K47A 1BE4A 1Q8LA 4RW7A 4X4UA 3A13A 1DLOA 2VIHA 1FD2A 2O3DA 3ENQA 3JXOA 1TK8A 5I3UA 4WFYA 5EX3A 4JI0F 1S6PA 5HMYA 4A8QA 1W7WA 2J0SD 5IT9U 2LDIA 1T05A 2D3UA 2RDIA 5A8WA 2J0XA 2AW0A 2J76E 3CO0P 3N9UC 4YB6A 1NK9A 1OSDA 4CLPA 3CD5A 4OIXA 4ICLA 2MGZB 1N56A 2E1AA 5F8JA 3KMSA 3EZUA 3ICLA 1S4FA 2E5GA 3Q22A 3R1LA 2CYYA 4DL6A 2FIUA 3QQCD 1RYRA 3LPYA 1WD6A 2XEXA 1U8SA 5KFGA 1NDCA 4R8UA 4DS4A 1RXOB 1SJ1A 3EGVA 4F0HA 4M5GA 3LUYA 4O4GA 2BANB 4QJVA 4RO0A 1IBMJ 4F3QA 2RKIB 3Q8SB 3ISZA 2W9CB 2GMLA 1GMWD 3QWUA 1I6JA 2XHCA 1DBDA 5E3CA 3ZNUA 4I2PB 4E8UA 2JSXA 4I56A 3UDCA 1JLCA 2ZZNA 5CAAA 3KHRA 2R7OA 3MPDA 2DD8S 2B7CB 1ZM3A 1F3FA 2PD1A 2VDHA 3E3XA 4DHVA 1RHKB 2IDLA 9RUBA 3G8SA 3N6MA 3SV3A 3THPA 2AQ4A 2AWZA 4X66F 3QRRA 2W1BA 2IDEA 1TZ0A 5DQHA 1RI7A 2XBPA 2A2CA 2V4JA 2GS8A 3GLJA 4ZVPB 1T03B 3HULA 3H4DA 3G2XA 1TAQA 2XMKA 2CPYA 1VQNS 3MHYA 4OZ0A 2ZH4A 2QEXS 2VD3A 1GX6A 5EHHA 1SJFA 3A8JA 4RWXA 3VAJA 3L09A 1CSJA 5ETLA 4CM0A 1MROB 4ZMMA 1U4BA 4LBHA 3E51A 4RW9A 2BXJA 3B82A 4JI8F 4JI6F 1IKWA 3K5OA 3MM6B 2HRTA 5KG5A 2KH9A 3B8HA 2DGVA 4I7FA 4BDPA
chains in the Genus database with same CATH topology
2VBZA 4KT0C 2RVJA 3CTRA 1NKEA 2EK1A 1VHFA 2Q43A 5IT0A 3CCVS 1W2BR 2FPHX 4IO1A 4CO4A 1HBUA 2CQ1A 2HRYA 3DMJB 4ECRA 5F8NA 1BLUA 5FDLB 5IFMA 2VG5A 4C9DA 4J9PA 2MQLA 3KTQA 3I0RA 1N33F 3F56A 1SBRA 3VAKA 2YNGB 2GC8A 1X5PA 1ZM2A 2XG8A 3PZPA 3K0JA 1VGYA 3C66A 4FXVA 2HQ3A 3O6QA 3PFEA 1H7WA 4YDDB 4AYBD 1S6QA 2KB2A 3OTOF 5GAGI 1DTTA 3K8VA 3O44A 3UI3A 2OTLS 2JH3A 2WONA 4ELTA 2B5JB 4G1QB 3M2UA 4F25A 4RW8B 2PA8D 3LH2S 5KFHA 3I0RB 2CJBA 4NYPA 4DF4A 1N5VA 1U48A 2CZ4A 2I9SA 2HNZB 3K7RA 3NCPA 3MFHA 2DNYA 1B0VA 2DB1A 2RRNA 3K5PA 3CJKB 3C6TA 3QGPA 1C0TB 4WFZA 3SZ2A 2A18A 4LT6A 1TVRB 1TKXB 3DRXA 4O3QA 1G3OA 2EKYA 2PO4A 3K2YA 2ZH1A 3QGHA 3AJ1A 4URQU 4Y2IA 4NX9A 4Y00A 4H4KA 2HHUA 1XN9A 3CCLS 3HF5A 2HG4A 3QWPA 2DNZA 2EFGA 4H4OA 4ECYA 2VUGA 4Z37A 4MMOA 2XMUA 5LJ5Y 1F9FA 1KQGB 4JI3F 5DGAA 3OXGA 1TVRA 1N36F 2HIQA 2RF2A 2VBXA 3DRPA 1YWXA 4TN2A 4OI2A 5B0CA 5B08A 4DR2F 2YX4A 1NK8A 2MHNA 2NSBA 2HLUA 5CZVA 2CZVC 5KFRA 1LV5A 4E98A 2EW9A 1C1BA 3HHDA 2FJXA 2YKMB 4G1PA 1YJUA 3EGNA 1S0MA 2J9DA 4ZPAA 2DJWA 3VALA 5CA5A 2UV8G 2RSQA 4CO0A 3VAMA 5FD1A 4DQIA 1VQ6S 2E44A 3RU0A 4DV7F 2UV8A 5HBMB 3M32A 3A1YG 3IGVA 1NK7A 5KFAA 3HPOA 1P6TA 2FD2A 5A0YA 1HD0A 3DHWC 1H7XA 3X1LB 2R7RA 2BM0A 5B0EA 5HN0A 3OVBA 5L8RC 1D9DA 2V94A 4M8LA 4X4PA 3GMGA 1JLBB 3DRSA 2ZHAA 3CUNA 4IKAA 2NUHA 4FF1A 1V3ZA 1X4FA 2RU3A 4ED2A 1VIOA 2ZH6A 5HMZA 2W9BB 3RB0A 1QAIA 3KOAA 2GCFA 4R0JA 1P8GA 4QR2A 4ECVA 4OL8A 3KHHA 2LA6A 4DEZA 1NK4A 2QT7A 5KFLA 3TP2A 1XBWA 2JWNA 3JTPA 2RH3A 4KB7A 3A8EA 4IH7A 4KRWA 2XGPA 2ASJA 1X9WA 4KIAA 2KM8C 4J37A 3N5BA 1MW7A 2LVWA 4CH1A 3KLFA 2F1FA 1REVB 1BGXT 2DH8A 2MKHA 2PGCA 4NLDA 3BSCA 2DGSA 1JLEB 3E8OA 2BR0A 2MZ1A 5J2PA 4ZVFA 4I2QB 4OX7A 3MPYA 3M9NB 3L95X 3U1NA 2GO8A 1JKHB 5KFZA 1KS2A 2RILA 3DYAA 5HLFA 3TA0A 1X5TA 1T95A 4QOTA 2ZHBA 4MKYA 3JTNA 2OPPA 4C98A 3J7YI 2VFVA 1BD6A 3Q2TC 4C8ZA 4C4WA 1FF2A 1WTFA 4CH7A 2RS2A 2FGCA 4YR3A 2B51A 3V4IB 4IYQA 3VQTA 5DM6Q 3CJ5A 2BVZA 1FJEB 4YMEA 3GZ7A 1QSSA 4V19J 4KJIA 1Q53A 1SKSA 4IDKA 3OV7A 4OV1A 2B56A 2QE5A 1S0OA 2RMLA 2R8KA 1S1TA 3HHLA 3LP1A 2BABA 2YNGA 4RUAA 3HVRA 1N5QA 3P6YC 3PHEA 1IBMF 2AJQA 2P9EA 4LF8F 1YJNS 2IRUA 3FFIB 2PMZD 2XC9A 2E1RA 2HGLA 4B3MF 2OSQA 2UP1A 2MKIA 5HP1A 3MD3A 1M1KT 3CD0A 2AJ1A 5J1EA 4DUYF 3TANA 2L9WA 2RD5C 2RE1A 4CT8A 1RT5B 2OFGX 2FJAB 5CD4H 3ZZUA 4DSIA 2LU2A 2JC1A 2MZQA 1FKOB 5E7OB 3M2RA 3FZBA 3UCGA 2LCWA 4IRDA 2KXFA 2E7WA 3FNNA 3O1LA 1X4BA 2N82B 2R2TA 1J5OA 1URRA 3CCTA 3RRHA 4ITSA 2FHOB 3D0IE 3I6PA 4KKOB 1RT2B 4B3TF 4PG4A 5KG7A 1VRUA 1IUJA 2Y1RI 5L9XA 3BQ0A 4J9OA 3CC2S 4QPXA 4FBUA 4DFMA 2ZM6F 2HMIB 1Y3KA 5J2QA 4ZK7M 1UVIA 1FO1A 3IS9B 1KTQA 2WSEC 4HDGA 2J9DE 4QWBA 3RRKA 1C1CB 5KFTA 4PXDA 1N6QB 1LXNA 5KFEA 4ELUA 4OX8A 2UUTA 5D3GA 5LSRA 3THVA 1SJRA 3BN4A 4OJ3A 3OPKA 2G0CA 2DGTA 2B4UA 2LU1A 3VAIA 1JLQB 5A8KB 4H4OB 4ES1A 3KLHB 2K8GA 3GE9A 3H98A 2N3LA 2CJAA 1T3OA 1TV6A 3UR3C 2KFZA 1TK0A 1S1XB 3OBIA 2ZUGA 4LSNA 2JDJA 2VASA 2YNFB 3GR0A 2I1RA 4NLGA 5F3ZA 4MYUA 4RW4B 4WZMA 5A8KA 2ACYA 2OPSB 1S9EB 3I9ZA 4ILLA 4O44B 3T5LA 3WC2A 4HDHA 4C8MA 5KFMA 2J7KA 3GQCA 1HNVA 4A8YA 4ID5B 5J1PA 3C8YA 4K4UA 3PNIA 5M2PA 4KO0B 5A6WA 2DITA 1JK9B 5J2NA 3PO4A 1TKZB 3BR9A 2YKNB 1U47A 2DGWA 4B9SA 1N0UA 1UW4A 3CCQS 4I67A 3LO3A 5C24B 2QV6A 3NWGA 2K7KA 1S10A 2RRAA 3N79A 3ITHA 4KAIA 5AE1A 4WF9Q 1X4GA 3TVYA 4RNMA 2VFRA 3N5FA 2XS7A 4IH6A 1JJ2R 1G1XA 3CCUS 5C42A 1GQEA 3OR2B 4HTJA 1Q16B 1KOHA 2XGQA 2CFXA 2E29A 4CH0S 1WF2A 2J5AA 4V19X 1OQ6A 5I42B 3KKFA 2JEIA 4ETXA 1OPIA 4YUDA 3HHKA 1VFJA 2VBYA 4ID8A 3RB4A 1V9OA 3QO9A 1U2FA 3D1HA 1REVA 2ZJRQ 3T3FA 2AX1A 2ZJQQ 4IRCA 3BSAA 2DRBA 3SQGA 4QIVA 1XTZA 3MMBA 2MZTA 5J2PB 3U1LA 3L7OA 4Q43A 3G8TA 3FMWA 4KHRA 2LA4A 3WC0A 4PRFA 1HNIA 1GX5A 4WJBA 1JKHA 1N5YB 4NLWA 3V6JA 4ZPVR 3IFEA 1WACA 4ELVA 3HVTA 4ZP9A 1RT1A 1FRLA 1N5SA 5DG8A 4R8UB 1UETA 3GG0A 4EBDA 2BW2A 2RKIA 1S9GB 5H9FJ 1FRXA 2W9CA 5E33A 3BGUA 4TLQA 2KDOA 4Y34A 4YP3A 3V6KA 3DI6B 4DQPA 2BBEA 4RW6A 3R5CA 3OL6A 3H5XA 1U1KA 2RQKA 4XDCA 2ZZMA 2AX0A 2OPQB 2IYIA 4DV3F 2BQ3A 3PRDA 1QVGR 1E6VA 3LQVA 3PKMA 4FXDA 1YJRA 4WTYA 4YR2A 3R27A 1Y00A 2VFSA 2VFUA 6FDRA 1R89A 4ZA1A 2ATLA 4MIWA 2B9XA 3AAWB 1RQ0A 1SKRA 5KOXA 1IN0A 1MMLA 2DNPA 2QLXA 1TFWA 1X4AA 3ENVA 3KLEA 3KK2B 3D0HE 1HI0P 2M7SA 2EK6A 3SI8A 3LANA 3JSMA 2AU0A 5KFQA 2HPUA 2OPQA 3CCES 4N76A 4PXEA 3EGZA 4EUVA 1J5EF 1E6VB 5JVHQ 5CYJA 2ZD1B 1RTDA 1HA1A 3M1VB 3C6UA 4CIOA 2XO7A 3PRBA 2HHQA 1H0HB 1FKOA 1RISA 2BQRA 3TOQA 2R8HA 2N7CA 2VFTA 5HMWA 4LFBF 2DIUA 4Y6IA 2MKCA 1XWLA 4IG3B 5BYQA 1RKIA 2M8HA 2ZC3A 3CXCR 3GYNA 1VRUB 1JLFA 3MURP 2D3OR 3UW1A 4K4WA 2HNDB 4OX9F 1ZAVA 5DO2A 1T8EA 4OJ1A 3GFHA 1K0VA 3FRYA 4C7QA 3BSNA 4EBEA 2Y1IA 2G9OA 3AHPA 1MMNA 1HWKA 1FA0A 4PXBA 3PDNA 1UVKA 2ZDOA 3R5AA 2K2PA 4IH5A 1WELA 2W4PA 1JLGA 1SKWA 4UW2A 4B9TA 1JMTA 3HKZD 4G1QA 4A8FA 4ZPDA 1DQ9A 5KFYA 2J6SA 4C8YA 2QRRA 1U49A 3M2VA 4CO2A 3HX9A 3R5DA 3HXMA 3GFYA 3I55S 2KN4A 2WB1D 2FHMA 2HLTA 3ONQA 3Q23A 3UCZP 1KSPA 1HBUB 4JV0A 2Q6CA 2KRRA 2HWIA 1XR6A 4LQ9A 1RTIA 2IM3A 1HD1A 3DMJA 1ROFA 3GWCA 5FDLA 4AUKA 1TL1A 2NUUG 3P3DA 2RQMA 3FSXA 3UNGC 2APOA 3KK3B 5BR8F 3KLGA 1QUVA 3KJVB 3MWBA 7FDRA 4A8KA 1RT6A 4N5SA 3BGFA 2PSZA 2O66A 1OWXA 2YWHA 4GMKA 4CT9A 2CJQA 4ALZA 3LWLA 5J2NB 3KK1B 2IVMA 1W2IA 4UQGA 1VOMA 3MZIA 5AXLA 5C24A 3T9ZA 3BO4A 3J7Z5 4FPRA 4XPCA 7FD1A 4IO9Q 1VLYA 3OSNA 2DPJA 3KK3A 1K1QA 1M5KC 2ZKUA 2E1CA 3O2IA 5C42B 3BDEA 4OI1A 3AQPA 3FMBA 4CO3A 4URGA 3HZEA 3V5RA 1Y5IB 1LK7A 4LIWA 4YR0A 2MY8A 2Q79A 3FVYA 5A8RB 1C1BB 2WB4A 1X0PA 3BGLA 4DFJA 4NA2A 4IFYB 4ED8A 4ZCKA 1Q82T 4Q0BA 1RK8A 3PACA 2B7BB 4OMFG 2I8EA 4UOCA 2YWKA 3RW7A 2R2UA 4TQRA 5D4NA 2GFFA 4J9KA 4B17A 5IS2A 4D3HA 4DFPA 4WU2A 2W24A 4ATNA 5DQIA 4FS1A 1T02A 2IM2A 2I38A 1DQAA 2HZCA 1NO8A 3T6JA 2WSFC 5IQ6A 4F4XA 1FRMA 5E3RA 2DNMA 1ZPWX 2ZNYA 4CTAB 4IR9A 1WI6A 2XLIA 3KFWX 2PEHA 3SCLE 1FK9A 1KEKA 4ZS6A 3DRSB 2HHHF 4IOBA 3FQKA 2B43A 2Y1JA 5JXSA 3S01A 1T05B 1NJIT 5FIIA 2ZC4A 5LJ3Y 2Z4PA 1JXEA 1S72S 1RP5A 1JLAB 4ED7A 3QIPB 4WKYA 1U45A 2M70A 5IZHA 3NNHA 2ZE2B 4R25A 3IO1A 2ZOFA 2EFPA 1L5UA 2E9RX 2AYMA 3V6HA 1N34F 3FJ2A 1V3SA 1IJEB 1UWBB 1FDAA 2C42A 3CDAA 2DIVA 1X4HA 5A6PA 4A8OA 4A47A 3DDKA 2QSWA 5I4MA 2M8DB 2X1AA 3KG4A 1D9AA 2WCXA 4NZ6A 1VJWA 2X51A 2YWGA 5FJ4A 2NLWA 4USIA 1HNXF 1SJQA 3D1QA 3OXLA 2R7XA 1JB0C 1JX4A 3MEDA 3S8SA 2C2RA 2R2SA 4KGMA 4KE5A 3GV5B 4FF4A 2A3JA 1ZZNA 1YJWS 3KYLA 3SCJE 3T1AA 4FBTA 1WG4A 2JJ4D 3JSBA 2ZOMA 4OZNA 4WE1A 1N52B 1Q79A 2O1PA 5KAKA 4CO5A 2CPJA 2W7OA 2W8LA 3HM9A 4X62F 3PXGa 3NS5A 4YB5A 4ECUA 1IKYB 4LFCF 2Y0SD 1BWEA 4EWTA 4AL5A 3DRRB 2W4DA 2UXDF 4IDKB 5DJBA 4EFAC 4QR1A 5B0BA 2AGPA 3BDPA 2JOQA 5KFWA 4F8RA 1YI2S 4O3RA 2XLKA 3CD6S 4K2XA 5CYQA 3DFEA 2K1RA 3H20A 1VQ4S 1Y3JA 4DR4F 1OQ3A 1FT8A 2OSRA 4RBUA 4ES2A 4DSEA 3UR0A 2CVEA 4ZDNA 5KT5A 3LALA 4QYZJ 3TW0A 5KFPA 4G1IA 5M2RA 1VQLS 2VG5B 4G3IA 1SV5B 3MM9A 2ADCA 3VAGA 1HMVB 2KFYA 1CC7A 3DYAB 1Z2LA 5HLFB 3MMAA 2YNIA 5EUHA 1S1VB 2GQQA 2M88A 4MFBB 2EG2A 4HLBA 1OO0B 1SJ4P 5C25B 2M3DA 4DR7F 1OPZA 2YKQA 2JFDA 2K1RB 2IA6A 1FRHA 3BQ1A 2CQ4A 2MQOA 1R8BA 2DNRA 3SMZA 2ZDPA 1BQXA 1O0PA 5IXUA 5L39A 1VC5A 1HI1A 4J5OA 3SFUA 1RTIB 2B4OA 3CJ4A 1YQHA 5T7LB 4ZCIA 4MIBA 2HFZA 3EZ5A 2FY1A 4AXIA 4TY8B 1YITS 5KFIA 1QE1A 2HMIA 4DN0A 3M6XA 3OSPA 1ZM4A 3KLGB 3KJVA 3CDEA 5I3PA 1FDDA 3SV4A 4IQXA 3RW6A 1HPZB 3MM8A 1GXTA 1XR5A 5C5JA 1RKJA 5C25A 4K4TA 4AL7A 2MSTA 3FRZA 1R27B 1QLNA 4GC6A 2HNYB 5D3GB 1HQEA 3GR1A 1C4AA 3OLAA 2OJ3A 1XNQF 2LEAA 2YWFA 4ZP6A 3CVKA 3LGNA 3WBZA 3IWXA 4JI2F 3KLIA 1VC0A 4WIIA 3K5LA 5L1JA 5LSOA 1BQMB 1VK3A 2OH2A 3BM7A 4H4KC 1N5TA 3MAQA 4WU3A 3G6VA 3W2VB 1S1UB 3QIDA 5DLGA 2Z2MA 4O3OA 1TL3A 2W7AA 5K8PA 3M32B 4PG7A 4RU2A 1BQNB 2BYCA 4LSNB 4DPOA 1M5PC 4F2SA 5T14A 1U6ZA 3MEEB 3PFOA 4LF6F 2KFNA 5KFDA 1DARA 3NNAA 3SFGA 1F2GA 3ETOA 1NAQA 2CJ9A 3OFHA 5DDQC 3KG0A 4AXJA 2RJZA 3POTA 4W90B 2DT9A 1NZAA 2OIHA 3F41A 4ED6A 2VPZB 5HROA 4KC5A 5D8HB 1GXLA 5G0RB 4QW9A 3IRXB 3CCWA 5D4OA 5DGBA 2QMWA 4TNOA 3DRPB 2OTJS 3RYLA 4ZPCA 1IKVA 2F4VF 1SUQA 1FJCA 1O5JA 2XI3A 2KG1A 2GNKA 2WAQD 1KTVA 5KFKA 4NLYA 3M8RA 4PKDB 5CCLA 2XNRA 2ADBA 4WCEQ 4LQ3A 1A6LA 3QJPA 2HFNA 2FLNA 4KR0B 1Q1KA 2WHOA 1N0VC 2NREA 2EG1A 3UD4P 3CC4S 2HFOA 3IRXA 4LF5F 1NU4A 3Q24A 1GH8A 2NR0A 1LWCA 1H2VZ 1JLAA 1IKVB 2MQMA 4DN9A 2UXCF 1F5BA 3M4XA 1VQMS 2F8EX 5KFUA 1VQ7S 3ZZPA 3MM5B 4EZ6A 3T6BA 5A0YB 2HVHA 4NL5A 3I0SB 4TQSA 5JVGQ 2NZ4A 3HHNB 3MXHP 1FXLA 2VODA 4Y0FA 3OTCA 3IA0A 2N4CA 1S6OA 1K73T 2B4VA 1FNXH 5F3TA 3W3SA 2G1DA 2KO1A 3NGDA 2JFKA 4QZVB 1HW9A 1MU2B 4ZCLA 1N5YA 1TUVA 3B4MA 2EFQA 1S97A 1S7HA 2VPYB 3R5BA 5HL7Q 1RT1B 1L3SA 1E6YA 2E7XA 1D1UA 1S1TB 1SI9A 4OI6A 2VONA 1LFWA 2D3ZA 2C3PA 1H2TZ 4PWDB 1IQZA 4LVOP 2FJBB 1YGYA 4C0OC 4EO6A 3QZ7A 2E1MC 2BJEA 2VB6A 4AQYF 4Q8FA 3RB6A 4ED5A 2DNKA 1MMDA 2ABYA 1TKTB 4ZHRA 3J7A1 1VQYA 3S7RA 3NL0A 2CQGA 4N8NA 4Q5VA 5BYRA 4DQQA