3GMGA

Crystal structure of an uncharacterized conserved protein from mycobacterium tuberculosis
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
143
structure length
143
Chain Sequence
ARLAALSILVGAVGATGPGVMITIDDPGPGVAPEVMIDVINELRAAGAEAIQINDAHRSVRVGVDTWVVGVPGSLTVDTKVLSPPYSILAIGDPPTLAAAMNIPGGAQDGVKRVGGRMVVQQADRVDVTALRQPKQHQYAQPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uncharacterized protein Rv1825/MT1873
publication title Crystal structure of an uncharacterized conserved protein from Mycobacterium tuberculosis
rcsb
source organism Mycobacterium tuberculosis
molecule tags Structural genomics, unknown function
total genus 35
structure length 143
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05949 DUF881 Bacterial protein of unknown function (DUF881)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1880 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3gmgA00
3GMGA
chains in the Genus database with same CATH superfamily
4G1IA 2WVCA 1NJYA 4B9UA 4JI2J 2DR5A 7AT1B 1YKWA 4FYYB 1VQ6S 1XTZA 3SQOP 2NZ4A 1LNQA 1W2IA 3NOGA 2V2QA 3J7YI 2E1PA 4LF6F 2EFVA 4C8LA 5SUHA 1T7PA 2NXNA 4YP3A 4D3HA 2UUCJ 1RDRA 1GK8A 3BV8A 4BBYA 5DG9A 4FYXB 2GMLA 1SXLA 3H7HB 1ITPA 1DY3A 3ISNC 2RUGA 1S9FA 3W5YA 5HATA 2FIUA 5CYMB 3HFKA 3OFGA 3BBFA 2FUG9 3O6QA 4JI0F 1Y10A 1RYRA 2OPQA 4H54A 3K5PA 1FKPB 2V8GA 1N88A 5CABA 3DNCA 2OEJA 1Q7YT 2JLGA 2VQEF 3LGHA 3RR8A 2DRDA 3DRSA 4IUFA 4LF4J 2ZD1A 1ZA1B 8RUCA 1N5QA 4CYUB 1TL3A 3NP5A 5KFWA 3E51A 4BS2A 1SC1B 5D0HA 4OZ5A 3LWMA 1VQ9S 2R8KA 2X1GA 3FCHA 3LP1A 3UDLA 3EJMA 3FMBA 4FF2A 2HQGA 2Y1IA 1RT3B 1AZSB 2MPUA 4LF1A 4V19X 3AXMA 5ETQA 1MWQA 2I38A 4LT6A 4UW2A 4C4WA 2YKPA 4DFJA 2XS5A 2IRUA 3B54A 2GO8A 5IT0A 2HYIB 5CQGA 3UO0A 4FXVA 2RQKA 2BJ8A 2COLA 4J9OA 3B82A 2F8HA 1Z4UA 5T7LB 3NLCA 1O0PA 5KAKA 2Q6CA 2RRNA 4U9RA 2B8QA 4USTA 3M32B 1S6OA 4R5PA 3OJSA 1YZ7A 3CT9A 1SI9A 3PW7A 3OD2A 4NEYA 1CS4B 4HL9A 1G1XA 3FFIA 1HNWF 2ZWOA 1KVIA 1TKTB 3NBPA 4F0HA 4I56A 3LOUA 2O1PA 2V34A 3WX4A 3OXFA 4DHVA 3P6YC 3DRPA 5IT9Y 1S10A 3EXYA 3MWBA 5E3RA 4ZVTB 3SYZA 5A8KB 3I31A 2G0IA 2PA8D 2VQFF 3BH7B 3N5BA 3FK4A 1FX4A 2HVDA 2ZE2B 2IVMA 4A8XA 2J8SA 4DPTA 2V8DA 2VASA 2R2TA 2AEMA 2QL9B 2DY1A 3JAMY 1NKCA 2NUUG 1L3SA 3A8IA 1C0UA 1TUGB 3DM2A 3GJSB 2DBBA 1HI1A 1JLCB 3CWJA 2FGOA 1RBAA 1QAYA 4F3QA 1UJ4A 2ZDPA 1F3FA 2AX1A 1RABB 2AYMA 1HNIB 5KT2A 2B9WA 1QSYA 1SL0A 3DOMA 2FGCA 3W8GA 1TAQA 3C16B 4KKOB 3PM9A 3ZNJ1 5I3QA 5AXMA 2CNKB 2XCAA 2ZWPA 1R8BA 1U49A 1F60B 1Q4RA 3Q8RB 2H54B 4ZVSB 3UI3A 2GHPA 2NZCA 2V0NA 2YPZA 2OI2A 3TX0A 4PWDB 5DM7Q 1FKOB 1VYAA 3I4HX 4RNMA 2DH7A 3JS9A 4O3RA 1N36J 4KQZA 3X1LB 4JI6F 1KLNA 2I0XA 3UR3C 1T03A 4LF9F 4QIFA 4ZLJA 3PJWA 2CQBA 1YJRA 3MTKA 2E5LF 3WBZA 2F4VJ 4OHZA 5DDOC 1IKXA 4OMFG 4F25A 4OYXA 4Y3CA 1SB6A 4IH6A 1KC8T 2V4RA 1L3UA 3D1OA 4MK8A 4L3KA 2MHNA 2YY3A 2FB0A 2MEWA 4USVA 2FDNA 2CQ2A 4O3NA 4MKAA 4ZHRA 1X4EA 3TP2A 3TZYA 3G8SA 3QLHA 4YR2A 3CCVS 2OTLS 1EZZB 4OYZA 3MFHA 2WB1D 4ANDA 2BR0A 2QE5A 3CCMS 4ICLB 4L76A 4UOGA 3ZO7A 4Q45A 4UUXA 3FBFA 5KFRA 2A3JA 2WONA 2RHQB 3DRRB 4QOTA 3I5BA 3SFUA 2B6AA 4EFAC 5G0RA 2GHWA 2VA3A 2B9YA 3I0SA 1AUDA 2GAHC 3DDIA 2I5JA 3JXOA 4Y2IA 2MMYA 4NLOA 3AXKA 4YB1P 1AYEA 4D3GA 2WOMA 3EDRB 4N7TA 4CLLA 1JMTA 2M52A 5B0AA 1RI7A 2YNHB 5LSLA 1MMNA 2C2ZB 4DEZA 3RB6A 1HARA 1WKJA 2X3DA 1YLXA 5LXYA 1PAEX 2B0GA 1XMQF 4ZIVA 3RGIA 1ZOTA 4OI1A 4BCAA 1FRKA 3GIKA 4JI1F 1OS5A 3D0IE 3ET6B 4G1QB 1RK8A 3NXZA 3SIPB 3PTWA 2HWIA 3KKFA 3MTJA 4U8YA 3X3UA 2DD8S 2NPFA 2AX0A 2VONA 1QJHA 2DNRA 5KT6A 2DB1A 1FE0A 4RW4B 5HBMB 5IWAF 3JSBA 3R7SB 1VK8A 1HBUB 1XNQF 4K4TA 4EYHB 2DGQA 4NLUA 3PY8A 3PYFA 1G6BA 4RR5A 1NAQA 1S97A 2QA1A 2VG6B 3SCKE 2VHGA 1I51B 2E5HA 4ILMA 2R42A 2YNIB 4M8LA 1IKYB 3GIJA 2V94A 5F0UA 1RAFB 2ROGA 5ETRA 3EDQB 3BYRA 5C2GA 5CYMA 2CYYA 2RE1A 4RW6B 1HWIA 2F8EX 2XYPB 4CCHA 3K0JA 3OHAA 3DU5A 3I32A 1FKPA 5H9EK 2FJVA 2G1HA 4F04B 3BR8A 4DR1F 4PRFA 1T9VA 5E7OB 1UP1A 1FTRA 1UWBA 4QYZJ 3T3FA 2K2PA 3KG0A 1N5SA 2XO7A 4DR4F 3QGGA 4CYUA 2GJIA 2EPIA 4CH1A 4W98A 4UOFA 3ZFVA 4K4XA 2V50A 1ZYQA 3M05A 3O5TB 3M2RB 1S1XB 4FXDA 4ZLNA 1IQZA 5HLFB 2HS4A 5CD4A 3Q2TC 3V81B 1RT3A 1AZSA 3DLBA 1FRHA 2RDJA 2KG0A 4X4PA 1ZA2B 2JC0A 5GADU 3PVXA 4J9UE 4A8OA 2P2CB 2YBVA 4H4MB 3BGUA 2P8IA 2HBQB 4DLEA 1WI6A 1NNDA 5KG3A 3RRHA 1SJFA 3VCDA 5T7LA 1IWAA 3I5CA 2XGQA 3L7UA 4ZPCA 1BQXA 4OI6A 3M32A 2WBRA 3HXMA 2GCFA 2MYFA 3VAMA 3T1HF 2AYGA 3VALA 1CS4A 2B4PA 4EZ6A 2YQ3A 2QTWA 3Q22A 2GC8A 1HKAA 1LEOA 3ZXWA 2Y0SD 4A8KA 4P2MA 4DUZF 4MK9A 3I87A 1TKTA 3TUZC 2G13A 4LR9A 3T19A 2W8LA 1R7IA 4LF5F 1M5SA 4F4WA 2D74B 3JTPA 3GB0A 2M8HA 3ILJA 2DNMA 4J9RA 4GC7A 4UTGA 5A8KA 2JRSA 4HDGA 4NX9A 3TYTA 2QX0A 3TW0A 4DPOA 4IR9A 4NOHA 2J0SD 2ZH8A 4BLGA 2ZE2A 2J9DA 4NA2A 2FZGB 3KJQB 1V6HA 4CQ1A 4XAKA 3ZTPA 2QRRA 2VZ9A 4KAIA 1OQ3A 5FJ4A 5HROB 1JLCA 4N76A 4JOUA 2AWZA 3DYAB 3M6WA 1Y4ZB 3A8JA 4J37A 1KLMB 2Q66A 5F41A 3OL6A 1HNIA 4CLFA 4WP8A 4DQQA 4ATNA 3C16A 4KKOA 1VQLS 5CYJA 1YWXA 2KH9A 7FD1A 1AFIA 3PZPA 2MJNA 3BSOA 3QT6A 4OHXA 2VBWA 4XPEA 1XBWA 1N5YB 3F41A 2MKSA 4PWDA 2C3MA 4C98A 5LMNJ 4KIAA 3RAXA 1LQ9A 2DNQA 1FKOA 3SCLE 3BGRB 4DR3J 4MK7A 1RA6A 4JI8J 3I55S 1WHXA 2PO4A 3MAHA 2ZEJA 2AP6A 5LMUJ 3NMRA 1GTEA 1TKDA 3KJVB 5DDPC 2GMJA 2NLWA 4AD6A 3HP6A 3MR6A 1S0NA 2BOAA 1HNXF 4P2SA 4C3LA 2NPIA 2JNJA 4LF8F 3MMAB 4C8YA 4P10A 4FVMA 1R89A 4EI2A 4ECRA 3CXCR 1KRPA 3KFWX 4CDIA 5KFOA 4GRSA 2KKHA 4USUA 3ZTQA 3TZWA 1APSA 3PW2A 3LALA 2XY6A 2OSQA 1RT5B 1FDDA 3PRDA 1R8PA 5B08A 4P7TA 3VAKA 4X4TA 3G86A 5BYSA 1JXVA 3GYGA 4ICLA 2CQIA 1HQ2A 3GPAA 2KG1A 1CQMA 1U6FA 3V6DB 2XI2A 3EE3A 3MPUB 2VH7A 4OYOA 2M4MA 3DRRA 3H20A 4UY85 2W9BB 1TFYA 1FWPA 4KJIA 2IMWP 3ISND 2LECA 1YJNS 2HZVA 1NO8A 2MQLA 1PJ7A 3HF5A 1EKRA 1YBTA 4XK8C 4Z37A 3E01B 2YNHA 3MEDB 2H65B 4WP3A 4WK1A 2CPIA 1CEZA 2KM8C 4CM2A 4FYVB 4YR0A 1F5AA 2VG5B 4DR5J 2FYXA 3ET6A 1TAUA 2CPDA 2IM2A 3TUJC 4B3SF 1U7LA 2X51A 5L8RC 4EGLA 2KFNA 4HACB 4LQ3A 2O67A 3HI9A 1YJWS 3PV8A 4RW4A 2DISA 2VOOA 2W9AA 2Z2LA 1CLFA 5HBMA 1VBKA 2MKHA 1WEXA 1HBUA 3DXBA 3NL0A 2UUBJ 3CD6S 1N56A 1RWVB 1HWJA 3EWGA 3EZ5A 2VG6A 2POKA 1NH8A 2I1RA 4FPIA 4URGA 2M70A 2YNIA 3CCTA 1NK8A 2I2YA 1RAJA 5HAOA 1IKYA 1OSCA 2VJVA 3RTVA 1FJCA 1IBKJ 3PJXA 4FS2A 1U0SA 3NAHA 1SKSA 3H2LA 3TR5A 2HVHA 4X66J 1ELOA 1WG4A 3IA0A 1V9OA 2R7XA 4JV5J 3CUNA 4RW6A 2DR9A 1U47A 2EG1A 4CRJA 5IV4A 2XG8A 4Z7CA 5D0EA 1NDKA 1RA7A 3HX9A 4U7UD 1EHWA 2JH3A 4C11B 1YDLA 3MM6B 1BWVA 4A8YA 4DSFA 2KZMA 2DHGA 3RR7A 2MQNA 2NCKL 2OPPB 4R8UB 3MR5A 1SVDA 1WACA 3OTOF 2EK6A 3EVWA 3MFIA 3HSGA 3M2RA 1S1XA 3GU0A 3NCQA 4OLOA 4NZ7A 5HLFA 4F36A 3K5OA 4LRAA 1KR4A 3V81A 4DR2F 4DU7A 1XR7A 3DRXA 4PG8A 4N47A 3VAFA 3QFHA 1O51A 4H4MA 1XC9A 5KFMA 5E2QA 2KFZA 2AF6A 1UFLA 1Q81T 4CLUA 4KBIA 1B4SA 2YWEA 3RB0A 3IG1B 1H6KX 4URSA 4USWA 3GV5B 3SSSA 4QR2A 2FHOB 3J7AN 1IVZA 4ECTA 1NH7A 2HKEA 1VS3A 4ETZA 2GVZB 1JX4A 1NHVA 2BQRA 3H5SA 1RP5A 2B9EA 2FJAB 2R9LA 4GKKF 4B9TA 2CZ9A 3SV3A 2ZBPA 4YOEA 2CNLB 4BHQA 4M63A 3CCLS 3GSDA 3HDSA 3NAIA 1FVSA 1YITS 3N6MA 4PPDA 4JYAJ 3ELHA 4KR0B 5CYQB 1L5UA 2BJ7A 4WK3A 1KQGB 4QYRA 1S4FA 1V5VA 4DV6F 3THVA 2H4WB 4X62F 4CLZA 2IC3B 2W8KA 2Z56B 4GMKA 4AL6A 1IKVB 4ERDA 5HVFA 4OIXA 2BRLA 2Z0GA 4CO1A 4M94A 2OD6A 3KLVA 3CVKA 4MH8A 4DS5A 1VISA 1RAHB 1RU1A 1SC6A 3QFWA 3IR6B 5HROA 2DH8A 5J2PB 1FA0A 1KOHA 4ED1A 1MSWD 1ZZNA 2JJ4D 3DYAA 3MMBB 1I94J 2IRXA 2FHKA 3DHWC 5E3PA 1KLMA 5EHHA 1VJQA 4DPXA 2GJFA 3B4MA 1T3OA 3D3CJ 1RT7B 2BW2A 3AFGA 1XWLA 2XGPA 1X4HA 1PJ5A 2W7OA 3OJUA 3PRVA 3BBBA 1VQ7S 1URRA 3PDNA 2DEIA 2PFDA 5L1LA 4GO5X 4J9LA 1N54B 1D9AA 3R6GB 1S6UA 2KHCA 2GV1A 1RWNB 1N5YA 2QIFA 2BJ9A 4DV3J 4LFAF 5I42B 1NSKL 4L3NA 3I9ZA 3N9UC 2ZHBA 3BGRA 3BH6B 2HLUA 1SKWA 4ZPBA 1XNRJ 3MM9B 4OZ2A 3E8OA 2EC0A 4O0NA 1NSPA 2PT0A 4OZ0A 2VFRA 2XM3A 4EBEA 4CH7A 3GILA 2MQOA 3KJVA 4YDXA 4CO2A 2PD1A 4CO0A 5KFZA 5IT4A 3H4DA 4JI3J 1T11A 3LGNA 3IRWP 3ZZYA 5GAGI 1Z2LA 1SH3A 5KG0A 2LDIA 2H5JB 5LT5A 2B43A 4Z2XA 4F7VA 2CUYA 1IBLJ 4YY3J 3MMAA 4DLGA 2YXLA 3T5HA 3VQTA 1FKAF 2YH1A 2ALYB 3DOLB 4U7UK 3IBCB 4B3TJ 4JV1A 3ITHB 3H90A 3H2VE 2ZH5A 3BSNA 3IN5A 4BC7A 2DGSA 1HLWA 1RT5A 4ZCLA 1NCLA 4KGKA 1T9UA 3UD3P 3CD0A 5HSPA 2R2RA 5AJ3F 4ECSA 3K8VA 1KBRA 4RPFA 4P75A 3UCGA 3M8YA 2EFNA 3V6DA 3BKTA 2WSCC 1JLGB 3K5MA 2QJ3A 5SZTA 3W9JA 2RAQA 1LWEB 2A10A 1QE1B 2CPHA 1VR6A 2W9BA 1RXOB 2JDJA 3M9MB 1KEKA 4KO0B 3SXLA 2Q79A 1XR5A 1M5PC 3A3PB 1K1QA 3R2CJ 2AW0A 1KDNA 2U2FA 3LA0A 3WIVA 2ZJRQ 1DQ9A 1HI8A 2XWYA 1SCJB 1ACMB 1ZPVA 3RG6A 4LF6J 3E01A 4DX8H 3M2VB 3MEDA 1TVRB 3ULHA 4ECZA 4WXWA 1RE1B 3LAKA 4OYAA 5DZ7A 1SKUB 2DNHA 3F44A 2MQPA 2V5HG 4DR7J 2DPJA 2E9RX 4PPZA 1S1VB 2VG5A 1FT8A 1U2CA 3M9NB 5EN1A 1HBNB 2GIFA 4DSIA 1TMMA 3HFZB 4HACA 2XB2D 1HMVB 1Z2ZA 3J7A1 2V4QA 1NJWA 2HS0A 2V69A 2MZTA 1IXKA 5AE2A 1H0HB 3UVJB 4TQSA 2NYHA 3K2YA 2WVBA 2R7VA 1UMJA 3ZZZA 2K1RB 3R1LA 2UVVA 3UDVA 1FRIA 1R8CA 3Q89A 4HTIA 3R1HA 3KDNA 3AB2B 3SFGA 1S5ZA 3GYNA 2M7SA 2FC8A 2DXEA 2QL7B 4IOBA 4PG5A 3FBEA 4WTOB 1RAAB 4LQ9A 3BQ2A 4E0DA 4HH1A 2LQJA 3T1AA 4NYZA 3QT8A 4CT9A 4A47A 2OKQA 4LRBA 2CZ4A 3NS7B 4EYIB 3TARA 1CC8A 3PCOB 2LVWA 4PCQA 4UY8T 1VCTA 4NCGB 4CP5A 1W7WA 1SPBP 1GX5A 1KONA 2OGUA 2J6TA 4C11A 3MM6A 1RT6B 4ID5B 2LA6A 3KLHB 2ROPA 4YB5A 4K4SA 2Y8WA 2PEBA 2CVIA 2Z30B 4ER8A 3M6XA 3QPIA 2DKOB 3HO1A 2AEJA 2OPPA 4R8UA 5KFBA 4NXMJ 4DOZA 4N41A 4RL1A 3PKYA 1T8EA 2Z2ZA 4XPCA 4ANCA 5C7PA 1UFWA 4I2QB 4WFYA 2OAUA 2GHVC 5FDLB 3PX6A 3MOZA 2HS3A 2P5VA 2YQ0A 4KB7A 2AQ4A 2F65A 4J9NA 2XMWA 2C22A 4IO9Q 4MYUA 1N0UA 5KT3A 2HVZA 3BB5A 1BHNA 1J2VA 2A1BA 1C0TB 2M8DB 1WKLA 1U2RA 4C9DA 2W1BA 2CKWA 4RBTA 3BQ1A 3ENAA 3IG1A 1NBEB 1KNZA 1H98A 4OV1A 4TXSA 5HJXA 3GLJA 4H4KC 3KK1A 2XC9A 2J5AA 2MQQA 2GVZA 4ECXA 5D4OA 2LCWA 5D78A 3S7RA 4LBIA 2MDAA 2MY7A 2RVJA 2VL1A 4LBPA 1CJVB 1VRQC 3UN5A 3PNIA 3G96A 1KP6A 2KDOA 1HYSB 1DTTB 2ZC3A 5CYQA 3EICA 1D09B 5KG1A 4CO5A 2PA3A 4TYAA 2C3UA 3LP2B 1WDTA 2AU0A 1G3OA 1B3TA 1N33F 2VFTA 2E9TA 2IC3A 2DEJA 2UUAF 4NXNF 2VBYA 5IQQA 5F9NA 1NPRA 3DLJA 1U8WA 1IKVA 2OTJS 5KT5A 3BSAA 2N3OA 4LVOP 1FTCA 4FKYA 3WC2A 5IS2A 1NSQA 2DCUB 3BO4A 3UQSA 3LWLA 3IRXB 2HFOA 4DQIA 4EO6A 4DF4A 3C6UB 4J9PA 5J2PA 2NS1B 4O4RA 3M6UA 1SJ3P 3P8BB 3MMBA 4RWXA 2LQBA 3JSYA 3OLBA 4NZ6A 3PIOQ 2RS2A 4WFXA 4WFBQ 1RT7A 1UVNA 1Y5LB 1G4CA 4DFKA 3Q86A 1FD8A 3ZTRA 4B08A 2HPUA 1F2GA 1IWGA 3GJTB 2E5GA 3Q8YA 3AA9A 4X64J 5IC4B 3M2UB 2BZ2A 3AB4B 3V4IB 4J9QA 1PSDA 1RT1B 3QSYB 2YKNB 1W25A 2ZFHA 3CPWR 5I42A 1GEHA 4C3MA 1FJ7A 2ZC4A 2W2PP 3AOBA 1F3VA 4ED8A 1CJKB 1EKSA 4U96A 4ZPDA 1HNZF 1RWXB 1TKZB 2LKZA 3FRZA 2DHHA 3MM9A 4QCLA 2W25A 3C14B 2BABA 4KV8B 1U48A 1IJEB 1RQ0A 1RKIA 2IIHA 4TU9A 1LKZA 2C3OA 3THTA 5CZXA 4QWDA 1C4AA 3TUIC 3BO2A 5HO4A 2DY9A 1HPZB 2WW8A 4Y28C 2AGPA 3T9NA 1DLOB 3QNWB 3UNGC 2ABYA 4C0HA 2HQCA 5JJBA 1S77D 3W3SA 4UZCA 1UVMA 5IT9U 3CIZA 3NMAA 1VLOA 3DOLA 3QBCA 4F26A 2OEMA 3ITHA 2RHSB 2GX8A 4HHJA 4I1TA 3K7RA 2LU1A 1X0FA 1CJUB 1R43A 3MR2A 3J80Y 3CMES 1RAGB 2HNDB 1PAUB 5E0OA 3BZQA 2CDRB 4XIUA 3JAMU 4JI1J 1RTHB 2B9XA 1R6YA 1JLGA 3BGOP 2CG4A 1LWEA 1QE1A 4NZ0A 3BBCA 3PO5A 2NUHA 3R27A 4MIBA 4YB6A 5KFAA 3QRRA 4KO0A 3G9CA 3I96A 5M2UA 1JWWA 4IFVB 1WC4A 2YKAA 3HHLC 1PCAA 3ZZOA 5GMEA 3EYZA 3QZ7A 1NM2A 2YH0A 2ASYA 3KK2B 1TP7A 1RUSA 1S99A 1TVRA 4PKDB 2G2YA 3JYTB 3MCSA 3PFOA 1VHIA 3IR5B 5ETTA 1NUEA 3AOCA 1S1VA 4K4YA 4B3RF 1HBNA 2SXLA 3W1YC 3PRBA 5K9FA 1SV5B 1RHUB 4DX6A 1HMVA 2H1YA 3L4BC 3KMSA 1JXEA 3J81j 2F1FA 3T41A 2AYBA 3M8ZA 2HHPA 4QIWD 3GFXA 2AZ3A 3NS6A 3UVJA 4KHPJ 4JI4J 4RUCA 1W26A 4N56A 4OYBA 1U1RA 2K1RA 1RWUA 5K8NA 1FFWB 4DR4J 2HIQA 5KG2A 2HIYA 3CJ3A 5JUMA 3W64A 1V3SA 1BY9A 2M5YA 3TI0A 1D3WA 3Q8VA 3TJ8A 2VFVA 1K9MT 2IYGA 2FLNA 2MZJA 4KHMA 5MLCV 5BXIA 1A7GE 4IDKB 3IBFB 2NXUA 3OSPA 1OPZA 2MLZA 5J2QB 1BC6A 2IAJB 2CQ4A 4I7FB 1IBMF 4LREA 2J6SA 2CPJA 4NCGA 3CCUS 5IM0B 2CPFA 4FBUA 3HHNB 1RTDB 1C1BB 1RT6A 4ID5A 3KLHA 2ZZNA 3OBIA 4JI7F 1M5HA 4F4KA 2FVRA 1AXQA 3D6MB 2JEIA 1AROP 1CPZA 2IDLA 4NRTA 2DNPA 2CJYB 5LJ3Y 3OW2R 4I2QA 1NRKA 4TNOA 2IBOA 5FDLA 2CQ1A 2N7CA 4DUZJ 3SQGB 1SH2A 4YHHJ 3ONQA 4R25A 1C0TA 3W61A 1X4GA 4ZVEA 1FDBA 2MY8A 3R5GA 5L9NA 2MQMA 4Y2MA 3KTQA 3TZZA 5DG8A 1M5OC 2YNFB 1S1TB 2MZ1A 3I82A 2E66A 1Y3JA 3QGPA 4ZVUB 4DMZA 1F1BB 3DLGB 2DRBA 2J7WA 4QJVA 4IKAA 1FRJA 1B7YB 1CJVA 1QTNB 3CJSA 2ATLA 4WZMA 4WP9A 3RRKA 1HYSA 3UFCX 1DTTA 4JI2F 3ENVA 3OTEA 4DX7A 3RW7A 3LP2A 3CMAS 1WC3A 4X4OA 4ZPAA 2C3YA 9ATCB 2C2EA 4DXLA 4NL5A 1PGZA 2V8VA 1S0VA 2QL5B 2UUCF 1RHQB 5DLFA 4A8MP 1M5KC 3FSYA 4NE9C 5IOLA 4R0JA 3TVZA 2DNGA 3C6TB 4J9KA 2YWFA 3IRXA 4V1Ak 3Q8UA 3MM8B 3IXQA 3C6UA 1I3OB 1NPPA 4PAAA 1Q5YA 1B0VA 3NS5A 2DCLA 1ULRA 1QD1A 4K8RA 1CQNA 3B8HA 3OQ2A 3G6ES 2EKYA 3VTIA 1UPPA 2QT7A 2K3IA 5LSRA 2QMUB 1RCXB 4LF2A 2O3DA 3RUBL 3K8WA 3TJ9A 2CXEA 3M2UA 1BQNB 3MAAB 3V4IA 5F3ZA 1HWUA 1EARA 4O3QA 1RT1A 2YKNA 5IQ6A 4DCJB 3CW2C 2CRLA 2DHXA 5CZVA 5ETOA 2E44A 4DQSA 2N3LA 1CJKA 1TKZA 4DPYA 4DV2J 3LQVA 4LRDA 2PMWA 2RS8A 3NKYA 3TO8A 4Q7AA 3C14A 2DNLA 4J7CA 1B64A 2HNYB 4KV8A 3PIPQ 2CNNB 2HZAA 4ED3A 3QIPB 2PI5A 4EEYA 1ZAXA 2R8IA 2XS2A 1DBDA 2EFOA 2G2OA 1HPZA 1FVQA 4NA3A 4OJGA 1QVFR 2OIHA 2XZWA 4G65A 2X1AA 3ZZRA 1DLOA 1VBZA 3AJ1A 2WAQD 1X4BA 3K5NA 1WOPA 4O44B 3VZIA 2VICA 3FEZA 3WX8A 1X60A 4ANEA 5KG6A 1JJHA 2HHXA 1IM6A 3PYGA 2AJ4A 5BYRA 3VWSA 5KFGA 3G6XA 3HSJA 3B4DA 3NWRA 2CG8A 1UL3A 4I68A 2DHSA 2KFYA 2IA0A 3QT5A 1CJUA 2C2OB 1N4LA 5D6GA 2HNDA 2KT3A 3UDEA 1RTHA 2JL9A 4QWAA 3UWTA 2XZDB 2KRRA 4OYPA 2PGCA 2QSWA 3P96A 5LM7E 1OY9A 1SKRA 4O23A 4DL6A 2Y1RI 3A4TA 3HZGA 5E5NA 1PG5B 4IFVA 2R7WA 2EWHA 1YX2A 2RDIA 2JHEA 1J5EJ 1RWKB 1EQ0A 3F0NA 5A8WB 3IBWA 5HMXA 5B0CA 1S1WB 2ASLA 5AE1A 4EBDA 5ADZA 1JXLA 1QSSA 3PX4A 2VODA 3KK2A 4DSJA 1XN9A 1CBKA 3JYTA 1ZM2A 2OJ3A 1X9SA 3M7VA 1S72S 3VVTA 1LFWA 2HVEA 4K4ZA 3FZ2A 3QO9B 1ZBTA 1S9EB 2KHDA 2DR8A 1NDPA 1SV5A 4PXCA 5DG7A 2V8PA 4LMZA 3SMZA 4NWBA 2OLWA 3AQPA 1MROB 4RW9B 4WFAQ 3KHLA 2L9DA 2VF3A 1HBOB 5DLGA 1N36F 3NGRA 3HVTB 2ADCA 4MKYA 2RQCA 4M5HA 1YJUA 4NASA 1B7FA 1FNXH 2WZ1A 4X4RA 3D5MA 3PHEA 1FNOA 1QAIA 2F4VF 1Q8KA 3HT0A 5B0GA 2DGVA 3FEYB 1XMOF 5GMKa 1T02A 4IG0B 2HNZB 4OX9J 2B7BB 1FNMA 1SH0A 2QA4S 2UXDF 1RGVA 4IDKA 4DR2J 2Z57B 1KQSR 5J2QA 5L39A 2IAJA 4I7FA 2V2VA 4RW8B 2P6SA 4ILLA 5IM0A 3SZ2A 5KG7A 3OVBA 5ITHA 1RTDA 2DNZA 3BYPA 1C1BA 2PDAA 1WORA 3RBZA 2CJ9A 4Q0BB 3AH6A 5DO2A 2R7OA 3MUMP 3CDBA 3CO0P 1RWWB 4I0WA 3CE8A 4DUTA 4EZ9A 2YWKA 1X5PA 4Y00A 2BMBA 3W7BA 5KFKA 4WYLA 5BYQA 4U7CA 4ZVOB 5FLXY 1WSRA 5B09A 5K8PA 5LXRA 4BWJA 3HPOA 1RAOA 3CCRS 2JZ5A 4FBTA 1A9NB 3SQGA 4OLPA 2MLXA 1S76D 3SSQA 1FEHA 4P73A 2PI4A 2CVEA 1HW8A 2GIQA 2QSFA 1JLQB 3NOCA 2P9CA 3FMWA 1FFGB 3H5XA 1EX8A 1MMDA 1LV5A 3QJPA 4M5MA 4DZDA 2VPWB 2VA2A 2XNRA 3T1YJ 2YKQA 1UETA 2C28A 1JQGA 1X0PA 3DLGA 4PXBA 2UUWA 2PMZD 1VFJA 4K2JA 4QBUA 1WOOA 2DGOA 2RU9A 1BGXT 1JLAB 5EWEA 1JLBB 4QIEA 2G9OA 2BKPA 5MAOA 3O44A 3BDPA 3D1HA 4YR3A 1EQMA 3GZ7A 3ETOA 4C8ZA 4Q8EA 3FKBA 2GMHA 2FVSA 4X4UA 1FXRA 1NEEA 4KHRA 1ZM3A 1QTMA 1FCAA 4DUYF 1E6YB 3QATA 4DL5A 1QLNA 3H40A 2K7JA 1BMQB 3G87A 1X5SA 3C6TA 4NYPA 3P3DA 4K5RA 3TANA 3MM8A 4LFAJ 3W63A 4CLSA 2CPZA 2BVZA 1V5IB 3NGKA 2ACYA 2WRMA 1D8YA 1WC0A 3PFEA 1AT1B 3D1QA 4IOAQ 2YX1A 5ETLA 2GQCA 1VMBA 4ENOA 2MJUA 1VBYA 2CJBA 3M4XA 3BPSP 4DI6A 2RT3A 2QN6B 1BQNA 3MAAA 3QT7A 4EBCA 9RUBA 4WFNQ 3KLGB 1NJZA 3PHTA 1O8BA 4DN9A 2HHHJ 3NGDA 5HK4A 4USKA 1L3KA 3DXSX 3W5XA 1UPMB 4HLBA 2JSXA 1Y5IB 4QR0A 4FNHA 1GMUA 4WWSA 1VC0A 4USMA 1NU4A 3HMJG 1HHSA 5I3PA 5EWGA 4MIAA 2HNYA 1Q86T 3IWXA 1FWLA 4OI2A 1OO0B 3JTOA 1MLAA 3HHLD 4Q5VA 2XMTA 8ATCB 3C19A 2FHMA 4CIOA 4RBVA 1RHMB 3QIPA 4DV1J 4QW9A 3LH2S 1YI2S 2JFDA 5B0FA 3HHDA 3Q2SC 3IP0A 3PACA 3KNGA 4C48A 2DO4A 1KVKA 4CTAB 2HFUA 4L6V3 3P5BP 3TQEA 5B0EA 4O44A 4QU7A 3CCZA 1EB0A 2I6WA 3BSCA 2Z8QA 4A8FA 1U8SA 4IH7A 3CD5A 3HHLB 2IM1A 2RKIB 4B3MJ 1FXLA 1T0TV 2B56A 1X4DA 1OMSA 4KE5A 5D4PA 3LGMA 5KFQA 3KJFB 2NR0A 3U1NA 5H9FJ 4WE1B 3ZZ0A 2XMMA 4ILRA 4NI2B 3KWMA 5LJ5Y 1NK7A 2E7VA 5KFJA 2CFXA 2GFFA 1TUWA 1Q7LB 2RQ4A 3PR5B 4PYAA 5HANA 3FBCA 2XHCA 2HGMA 4GVLA 3G6YA 3CSKA 2BUNA 5A8WA 3BREA 1S1WA 3VGVA 3RBXA 2Y1JA 3HT3A 2GS8A 1TK8A 3A3NB 2D41A 3FQKA 2Z4PA 1B0PA 2OP5A 3CB4A 2OMLA 2L48A 1D9FA 1LW2B 1TK5A 2O5DA 4OZJA 2RNEA 2FHJD 2W4DA 1RAEB 2XTJP 3QO9A 1S9EA 3D6HB 1B70B 4DCOB 2LLZA 5CCLA 5A8RB 2RB7A 2QMXA 3TX8A 2OHDA 4IH5A 2KO1A 5LMNF 2F9JA 1MROA 4RW9A 4DR3F 3GP9A 4Y2CA 2YVSA 1HBOA 3HVTA 4Q2LA 4B9LA 1H74A 3IC1A 3KNAA 3VHQA 4DV4F 3B78A 2G0CA 4LFBF 2ZBRA 5LMUF 1GFWB 4MKBA 1S59A 2V6AA 3DC2A 3LAMA 1N32F 1NHUA 1F5BA 4L72B 1U26A 3CJ8A 1MW7A 5L1IA 1D1UA 4F2RA 4IG0A 2HNZA 5KFYA 2X7IA 3AD9C 1DURA 2HEKA 2ZOMA 4B9NA 2QYCA 1FD2A 3GONA 3EPGA 5HVHA 5C2CA 2MKCA 3N6NA 3HFVA 3SCIE 2ERRA 4RW8A 3AAWB 4WKYA 4IYQA 4G3IA 2JFKA 2F3JA 2MB0B 4XTTA 3H8YA 2YWHA 2FLLA 2R3VA 4C0OC 3GIIA 4Q0BA 3JSMB 3S6EA 2HQIA 2BE2B 2E9ZA 4WPAA 2GGPB 1FJGF 1RLDA 3D0GE 5DGBA 3OXGA 3EZUA 4YN3B 2WK4A 3WDOA 5K20B 3FUYA 2QMWA 2UUTA 3H98A 3TRGA 3UCZP 2BA9A 2EXUA 4U95A 2MZRA 2NXCA 2XNQA 4DG1B 4Q44A 2CPEA 2QGFB 2R7QA 5D4LA 3V6HA 1I5OB 2CZVC 1H7WA 1JLQA 2XSFA 2WVEA 4E2FB 1WOSA 2G1DA 2HHSA 4AT1B 4X2BA 4L73A 4LF7J 2XLJA 1KQFB 4DR5F 1C4CA 2JWNA 5F9LA 2DR7A 2FC9A 1HI0P 2BJDA 3T5KA 1RHKB 2ROEA 1Q79A 1JLAA 1RISA 3FNNA 3M8RA 1JLBA 5H1SV 5D3GB 3DN9A 4A4JA 4RKUC 5E3AA 1WHVA 5F3TA 2UUBF 3N6LA 5BR8J 1R27B 3QIDA 3TAPA 2G2ZA 1YRXA 2YNGB 1ZTWA 4UT4A 4KTQA 3IR7B 2GJ2A 3CMQA 1T95A 4M5IA 1EP4B 3H59A 5JVGQ 3DHXA 3OVAA 3PYEA 2YKMB 2VD3A 1HW9A 1BXNA 3OTCA 1IBKF 1E6YA 3CF5Q 2RF2B 1G7CB 2QLBB 4O3PA 4X66F 3CC7S 4NLWA 1WELA 2B3TB 4JV5F 4IO1A 3K58A 2AT1B 4X4QA 2I8EA 1UVIA 1URNA 4KRWA 3E3XA 4PG4A 4PZVA 4ZK7M 4JUZA 2CIMA 2DIVA 1HNZJ 2D9PA 1RT2B 1IJFB 4HT5A 1X5TA 3GJQB 4AYBD 2JEJA 1OSDA 3ZC4A 3CCSS 4HKQA 1NXIA 2MGZB 1IQTA 2DVIA 3FJ2A 2MSSA 3RZAA 1IBCB 1G2EA 1UEVA 1TL7B 5U47A 1T3NA 5DM6Q 3BKUA 5C25B 3GG0A 1W2BR 2ILZA 2ZVSA 2R7UA 3MHYA 2UXCJ 2LQ9A 3GV7B 4B17A 3NNAA 4KT0C 4I69A 2NSCA 3P45B 3N5FA 3H5YA 3CJ4A 3RAQA 4ELTA 4USIA 4J9VA 3K59A 3IM9A 2DIUA 1FESA 2ZOGA 3M8PB 4X4NA 3V2UC 3BM7A 3SCJE 4ECWA 3H25A 5J2MB 2BJEA 4YS2A 5D8HB 4CTAA 4DQPA 2PN6A 2QLWA 5D4NA 4HI2A 1KS2A 2NXJA 4ECVA 2W9CB 2BX6A 4JYAF 4P9SA 1J27A 4IRKA 1C1CB 1Q0NA 4RNOA 4DR6J 4QWCA 2HBZB 3TAQA 4P7VA 4TY8B 1DHMA 3DLEB 1SIWB 2DNOA 3LPYA 3HHLA 2RKIA 2V68A 1ZETA 1R3NA 4DFPA 2XWXA 1R8AA 2JEGA 1UWAA 1VQOS 2ALZA 2JC1A 4X84A 4B3RJ 4WE1A 1NB7A 4NI2A 2EG2A 4PXDA 2XQCA 2CJQA 5GADI 2W2QP 5JXSA 4F2SA 3BJYA 1UZDA 3W60A 2AMCB 3GMGA 4MFBB 3D7SB 3W2WB 3J7YU 2HWHA 2F9DA 3GR1A 5B7WA 1UJ5A 3IWLA 3AD8C 4IRCA 2CWKA 4K4VA 3OXLA 1UTAA 4P2XA 1YK9A 2HFNA 3EPIA 2LYVA 3R6LB 1P9YA 4B02A 1EAYC 1F0XA 3FCVA 1LW2A 2CADA 2IM3A 1FRMA 3DU6A 1IR2A 4F02A 1Q5VA 3FRYA 4QYZK 1OYDA 3J81U 1UJ6A 2PMHA 4B9VA 2BJ1A 5A8RA 4CH0S 4DV3F 3W62A 3EMTA 2W4CA 3OHBA 1YG0A 2BQUA 4O3OA 3NGUA 4ZHRB 3UW1A 1CJTB 1S0MA 3PO4A 5G4DA 4IR1A 2QEXS 3CJKB 5FIIA 2MQ8A 4RU2A 1ICEB 2DGUA 4QPXA 4OX6A 5IFMA 4FDFA 2N7YA 4DSLA 2J7UA 2FHJA 3JTNA 3W2VB 2BM1A 2GW8A 2F4FA 2BBEA 3R9LA 1VDHA 1P27B 5E3QA 2Q43A 4FS1A 5K8MA 2KVQE 2AYEA 2EC2A 1DAXA 3C46A 1K44A 1I1GA 4YY3F 2OH2A 2H3EB 4DJBA 2XHWA 3W9HA 4DL0C 1S6QB 4K50A 1RHRB 2DK2A 1R6VA 2KJVA 1FDAA 2NYIA 4TU7A 4DV7F 1N34F 2PIIA 4OX7A 4G1QA 2N4DA 3MCNA 2HSEB 2UZAA 1VQSA 3N0VA 3THPA 4F4XA 4DV0J 3JSMA 2Y1LB 2Z58B 1UEUA 4A8QA 2BE2A 1S57A 2HLTA 1Y0HA 2GGPA 2ZKUA 2XI3A 1SC3B 2FJBB 4RZRA 3VZHA 1GAOA 2B7CB 3HKWA 3DOKB 1ZTTA 3O3LA 3QWUA 3L3CA 2CQ0A 1IR1A 2VB6A 3F56A 4ECQA 3KUGA 3KJNB 1R0AB 1Y00A 4HYKA 3T6JA 5B0DA 3KXDA 5L46A 2JX2A 1NK0A 4QZVB 1D0EA 1RTJB 2ZHOA 2FLPA 4J5OA 4DG1A 2WVDA 3KLFB 4PR6A 4ED6A 1BQMB 1S12A 3ISZA 1PC5A 3D28A 5K8OA 4MMOA 4A46A 2WW4A 5A2QY 3VQSA 3GE9A 4WJBA 4DR7F 2XY7A 5KFUA 1JIHA 4JV0A 1JNRB 4ALZA 4RJVA 4USHA 2ASDA 4N8NA 3AD7C 4RWWA 1U1OA 1U25A 1DRZA 2IVFB 2JEFA 1T9YA 3LANA 1H3DA 2DNNA 4KPYA 1FRXA 2ZZTA 5D3GA 1SJ4P 3CGIA 3MEKA 1TFWA 1HQUB 3G2XA 2YNGA 1RT4B 3QQCD 1UWBB 3GV8B 3OFFA 2UU9F 2A18A 2R4FA 5DETA 4ES2A 1HNVB 8AT1B 3BN4A 1EP4A 4KFBB 4KSEB 2YKMA 1GTHA 5KFFA 2AGOA 1FWKA 2OPRB 2ZDOA 2RF2A 3VGSA 1R8HA 4DL7A 2CQDA 3WZ0A 3I56S 2EFQA 3BQ0A 1TMJA 5KFSA 1WD6A 4ZJLA 5J1PA 1HD0A 1S0OA 3MXHP 2M3DA 3VV2B 1H38A 5C42B 2DPIA 5KFTA 3US5A 1HR0J 2AKWB 4YUDA 1DARA 1U1LA 1RT2A 2V8HA 2DO0A 1QAXA 2H5EA 3I0RB 3W8PA 2ZVIA 5DDQC 4IQXA 4S0MA 2BKOA 2VOPA 2VPZB 1RU2A 1D9DA 4B9MA 4UUWA 2MGZA 2Q6BA 2BRKA 4NXMF 4ZJQA 2ZH7A 2VC1A 3MPYA 1CVJA 3T5LA 1XEZA 4PXEA 1TL7A 2MHEA 2DYAA 2XMVA 4DSEA 3UD4P 3DKDA 1TK0A 2FVCA 5C25A 4ES3A 4C8KA 2J9DE 2Q3PA 2VG7B 1RACB 2PE8A 4M5GA 4NLRA 4OFZA 2R7RA 2YX4A 4HH0A 4DV5F 1GT8A 2PFFB 2HBYB 1OIAA 2LXFA 2BYCA 2V9KA 2W4PA 3M8PA 2Y0BB 1Y11A 4RLEA 1IR0A 4RU9A 1AW0A 1N52B 5J2MA 1TR0A 2GVDB 4ZVFA 3MCMA 5EDWA 3MI7X 4QQBA 3CCES 3HSDA 2FZKB 3Q83A 5DQHA 5L9XA 1X7VA 3ILOA 5K14B 3RBEA 2W9CA 1WF0A 1TTHB 3MDFA 2VFSA 3UR0A 1C1CA 4MYTA 2P9EA 1YBUA 2G4BA 2W01A 3K17A 4TY8A 3U1LA 3DLEA 5H9EJ 2XMUA 3IM8A 2MLYA 4ZN3A 3WC0A 4QU6A 3A12A 4CT8A 1AA1B 4FYDA 3DLHA 3R7NB 4ECUA 4F67A 5KFDA 5C5JA 1NMEB 4C0BA 2FLOA 4CLTA 2FPHX 2FD2A 3GCXP 4P74A 4MFBA 4GKJJ 3W2WA 2OSRA 2IRYA 4YQWA 4H4OB 3MD1A 4ED4A 2ZUGA 1L3TA 4OL8A 1RBOB 1VBXA 3QZ8A 2ZH1A 2IPOB 2UXBF 3W66A 2OMOA 4DPUA 4AFFA 1IN0A 1KSPA 3T5JA 1VGYA 3HHKA 1H2VZ 4X64F 1XMOJ 4JI5F 2P9GA 2X1FA 3GCWP 3VAJA 2BQ3A 2YWWA 2UXDJ 1V3RA 3NCPA 5ETNA 5CCMA 2E1AA 2ATCB 3K89A 2YPYA 3EGNA 4NYOA 1MMLA 1ZM4A 1CJTA 2E1MC 2NXEA 4ZPTR 3CJKA 1HHQA 2QLFB 3BPDA 1DQAA 4NCBA 3H0PA 5E33A 3RB4A 3HD1A 1YQHA 4OJ3A 2XMKA 4RBUA 2UVWA 2RIJA 3A3OB 1SQEA 3G4SS 1WHWA 3TWZA 4JP8A 4TY9A 4KGVB 3HK2A 3W2VA 1KTQA 2MKJA 1RYSA 1M1HA 4FF1A 1RAIB 4OZ1A 4CZCA 2W24A 1LWCB 1HQEB 1F2HA 5AE3A 2NQPA 3R3TA 2B51A 4OX8A 3CJQA 2ZZMA 1S6QA 1Q1KA 4HT7A 2XBPA 5HQ8A 4KYZA 2RD5C 2E7XA 3D4JA 1WC1A 3DGPB 3S01A 4HHHA 3D54A 4Y34A 2AJ1A 3CO9A 2VU5A 2XO6A 3E2EA 2EBEA 1PIEA 4L75A 1XERA 5D15A 3EXCX 4JI0J 1XJWB 2DXDA 2YX7A 4NEZA 1JNZB 1WUUA 3DOKA 2VQEJ 3WQPA 1CSJA 3RAMA 1WTFA 2CQPA 2XS7A 1PBAA 3TEHB 2UVUA 2VKRA 4NLYA 2QA2A 2CPXA 4I64A 1R0AA 2PC6A 1J5OB 4IFYB 1RTJA 5F8IA 4LBHA 3PW5A 3KLFA 1TUVA 2L3MA 1BQMA 1TL1B 5CH7B 4J9MA 3W9IA 1FK9B 1P6TA 3UPFA 4OYWA 4DL3A 4ZP8A 1VQKS 2KT2A 1VHFA 4EU0A 2HRTA 4DUYJ 2UVRA 4LSNB 2CNOB 4WCEQ 2OELA 3GIRA 2VC0A 4X4SA 2QC3A 3GFYA 1SC4B 3DMJB 4LRFA 3IAM9 4NMLA 4TQRA 4AQYF 4KGMA 3AQOA 3AA8A 2ZM6F 4PEOA 1Q78A 1HQUA 4KHPF 4JI4F 3P5TL 3NG8A 3GQCA 1RT4A 4DF8A 4NLTA 3LTOA 4CM0A 3D9BA 3O1LA 2M9KA 4ZPWR 3CJ2A 2EBGA 1HNVA 4W92B 1PYOB 4M5JA 4KFBA 2IA6A 1HNWJ 4IQMA 3U27A 4N8OA 2AIRB 2OPRA 4DX5A 5EUHA 3I6PA 4LFCF 2RILA 1KKHA 2C1EB 5KOWA 1UW4A 3FGVA 1P1TA 1RJJA 5C42A 2YTCA 1H7XA 3C3LA 1N0VC 1DQ8A 2KU7A 2VQFJ 1VI7A 2IMOA 3OV7A 3I0RA 2LEAA 1T05B 3MM5B 4NCAA 1RTZA 2A6OA 2KYZA 2JVRA 3V5RA 4N77A 3OL9A 5F8HA 2QFJA 5FLXU 1U6BA 4R0EA 1U1NA 3ILIA 3MUTP 2DRAA 2C2RA 5C24B 3QSIA 4HR2A 4M5KA 1Z1ZA 2V67A 3LP0B 3BR9A 3SV4A 2IY5B 4WTYA 4CO3A 1O5JA 1CULB 1AFJA 4ZOSA 4YHHF 4HDHA 3VGTA 1YBAA 4DFMA 1FF2A 2VG7A 3DDNA 4TVAB 1HFEL 1IM4A 4HHUA 1KFSA 2QV6A 1HWLA 4U6PA 3DLKB 5EWFA 4NLPA 4ED7A 5DJBA 1I6JA 3OTBA 2QZ8A 3MEEB 4FKXA 3LPEA 1NDCA 3AODA 1UZHA 1T9WA 2GVDA 3AT1B 3NNCA 3N28A 4WFZA 2D7SA 3OT9A 5DS7A 4C8MA 4JI6J 4KC5A 4LF9J 1KN6A 3D6FB 2V2ZA 2VUGA 5K14A 1SJ1A 2QG9B 2E5LJ 4F0KA 3CULA 3UCUP 2HGLA 3MF5A 3A8KA 3QGIA 5A6WA 3TUPA 3CDUA 4WU2A 2ZNZA 3KLEB 4UQTA 1HL6A 4F4ZA 3BGLA 3NGSA 3CNQP 1U6ZA 3FCWA 5KOXA 3U02A 1Y7PA 3MECB 1DJ0A 3UE2A 5JMNA 3MAQA 4TKTA 3WIUA 5K5MA 4WYWA 5M2PA 3PW0A 3MGJA 1MG7A 4FVCA 2V2KA 2KTQA 3CJTA 1UEKA 1JLFB 4G1PA 4H4OA 3NEKA 1U0HB 2N4CA 1BE4A 4NLGA 3P4UB 2LMIA 3BDEA 1N5TA 1LXNA 4DV4J 1HA1A 4EUVA 2Q1LA 4LFBJ 2A0FB 1N32J 3G8TA 2AD9A 2ZJPQ 1PO6A 2C2NA 3EGZA 1RWOB 2HWTA 4ZVGA 6AT1B 3QYYA 2XYGB 2XULA 1RKJA 3IFEA 4KGZB 3MD3A 4EK2A 5AT1B 4MT1A 1NPKA 4K7QA 1JB0C 4M5LA 5CAAA 2Y9HA 4YMEA 1XMQJ 4DV2F 1UVLA 4PWUA 5GAEU 3M30B 1D8ZA 2KM8B 2EKNA 4M5NA 4UOCA 3ZNUA 3FQLA 1U1MA 1SL1A 5F8GA 1ZAWA 1FJGJ 1KTVA 4QWEA 1RLCL 2J6UA 2OPSB 5IWAJ 2CQGA 1XNQJ 1VQ5S 4F3MA 2ILYA 3CJ0A 3POTB 1LWCA 1HQEA 4UZBA 3M2VA 2APOA 3RB3A 4OYIA 5HQMA 1KHVA 1OYEA 3U1MA 3DGPA 3P49B 4AL7A 1RWMB 1SIZA 3MR7A 5GMDA 4FF3A 4ID8A 3EX7B 2G0JA 2FJEB 5KFVA 4O0IA 2WCXA 4RUBA 4KH1B 3UDCA 2RRBA 2ZH6A 2HMIB 3FEXB 1TZ0A 2FJWA 5KG5A 3OL8A 4DR1J 4B9SA 5J1EB 2J76E 3K57A 4WIQA 1R0BG 4OHVA 4F0MA 1J5OA 2NREA 3R2DJ 2AZ1A 3KMQA 4IFYA 3JQMA 1J5EF 3EGVA 1RBLA 2R8JA 2RH3A 4DBQA 3HVRA 2DJWA 4JV2A 1TL1A 5KFNA 4PUOB 4LR7A 3KDOA 5L38A 2HQ3A 1FK9A 2CPYA 4PWWA 1BUXA 5AXNA 5J1NA 2OFGX 4A8WA 1R31A 5HVGA 3PXGa 2EK1A 2D3O1 3IS9B 3R5JB 4LSNA 3KUHA 4K0KF 3OVSA 1RZMA 1TV6B 3JSRA 1X9MA 5CHCB 3DMJA 2DGWA 2QA4G 3SSRA 2CJKA 1S9GB 3BS9A 3T1HJ 2XSJB 1ZAVA 1PYSB 1PJ6A 3PR4A 2F7VA 4HI1A 1DTQB 4A48A 2DNKA 5A76A 1P8GA 1MWYA 4C8NA 5GAEI 3IO1A 5DDRC 3H2UB 3ZZTA 3IGNA 1F6TA 4CLPA 4B3OB 2ASJA 1KHWA 3GR0A 1VK3A 5F8LA 4GVBB 1K1SA 4OX9F 1U09A 1FRLA 1VIXA 2XEXA 5KT4A 4LF5J 2ZOFA 1OWXA 5A6PA 5EGYA 2R2UA 1KWMA 3NGTA 2ACMA 2CWXA 1F9EB 4X65F 5THWA 3MMCB 4DPWA 4NA1A 3OUYB 1Q82T 5ETSA 2M2BA 1X4AA 2XLKA 2J0XA 4OHWA 5ETVA 1T05A 3MM5A 1LWXA 4NLVA 2Y3YA 4DN0A 3D2WA 1S48A 5GAGU 4KGXB 3UN2A 3U7JA 3KK1B 3A13A 3RJMB 3ZTSA 5C24A 1F5CA 4FN5A 4ZVHA 5B0BA 4CI0B 3LP0A 3DI6B 3DFEA 1RTIB 3J7Z5 2D1CA 3MEGB 2Z2YB 2OUGA 1GMWD 4ECYA 1CULA 3R7BB 2ZBCA 4X4VA 3R5DA 1WI8A 5GAHU 3OFEA 3JB9k 2HHUA 1WNEA 3MM7B 1WTBA 2FVPA 1QDUB 3ENQA 3VAIA 3RBDA 2D3OR 1KVJA 4ZMMA 3DLKA 4XO0A 5BJRA 1GMVA 4E8UA 4M95A 1LOUA 2AEFA 2L08A 2XMJA 3N01A 3MEEA 3T1YF 2LFVA 4OJHA 1GXTA 3L7PA 3AJ2A 2PSZA 4WBFA 5J2NB 4QIVA 3OPKA 3WHIA 3V6JA 4ZITA 4LF4F 1NHKL 2J0QD 2HQDA 2LQ5A 4I2PB 2WHOA 2W2NP 2GAGC 2F40A 4RW7B 3EM1A 4LR8A 4LSZB 3PW4A 5LOQA 3NY0A 5L1KA 3DLLQ 1UAWA 2V4JB 1HNXJ 4ITSA 5A0YB 1GXLA 2QFIA 2HQFA 4K4WA 3KLEA 1VQMS 1YRUA 2DTJA 4LF8J 1IKWB 4LRCA 3MR3A 3SEOA 2MKYA 3PEHA 3IWNC 2OFHX 3JQJA 4QR1A 3MECA 1WG1A 3IGVA 2ZH9A 3D6TB 4MTPA 3SI8A 3AY0A 4RNHA 3NCRA 3Q23A 4RNNA 3K5LA 1VQYA 1TELA 1JLFA 3EGWB 1LFPA 1WKKA 1TKXB 1U0HA 5IXUA 3M9OB 2HRYA 3JQKA 4ZKAA 5F0WA 3HJFA 1DFDA 3Q8PB 2EW9A 4WKRA 3GYXB 2EFGA 3DGVA 4GO7X 1JJ2R 1FHTA 1Q8BA 1PKUA 2VV5A 3QRPA 5HJYA 3B6BA 4ED0A 2GQQA 1P9QC 1GXUA 2CDQA 3BKFA 4NPOA 3ZTOA 5DGAA 2QLJB 4P72A 1S4EA 3D67A 3CDWA 3RYLA 2QLXA 4OZ3A 2C2MB 2Z2MA 2FJXA 2HBRB 3BN7A 4ZP6A 4WU3A 3EUNA 2HHHF 2BANB 2FJDB 3KK3B 1HWKA 2B5JB 4CNYA 1T9TA 2FTRA 2DNYA 2OD4A 3F73A 2C2DA 1GNKA 4DZ6A 1K47A 4ZCKA 4DV7J 1N34J 2VPYB 5GAHI 3M30A 2CQCA 3BF4A 4B3SJ 1WG5A 2L41A 4U67Q 4WZQA 3UNYA 3KG1A 2WSEC 3I4PA 4U8VA 2K06A 1FXDA 3FBBA 3VR1A 3PX0A 4DV1F 4ZPVR 2JLEA 3LUYA 2WBMA 1PYTA 2OPSA 3NNHA 3KLIB 1U45A 1NZAA 3MPWA 4TLRA 1ZM9A 3POTA 3FSXA 5IV3A 5DQIA 3ADAC 5ETKA 4K5SA 4PG7A 3OTDA 4ZP9A 3TA0A 4Y6IA 5DRKA 5RUBA 4F50A 1BD6A 2MKKA 4RUAA 4B3MF 1JJ4A 1OPIA 1QY7A 3A8EA 1A0OB 2F5GA 3S8SA 1UCNA 2CJXB 3L09A 3DCAA 1WJ9A 3OL7A 2YWGA 1Q8IA 1YJTA 4C8OA 2HMIA 5EX0A 2BXJA 4LJMA 1LXJA 4TU8A 2DH9A 4RNFA 5J1EA 1C2PA 1RSCA 1R0CB 3M8QB 4I6AA 1LW0B 4MKVA 3N4WA 5CXTA 4ZJOA 1KD1T 2IM0A 1X8DA 4NRUA 1RB0A 3OTOJ 2YKOA 2UU9J 4PUOA 3I9V9 3R5CA 4M1KA 2DITA 4ZN1A 4I6YA 2HRUA 1P1LA 3CDAA 1Y3KA 2BDPA 4OYMA 2E1CA 2I9SA 4EWTA 3IS9A 4QIGA 2AJ0A 3ZZUA 3KHRA 1VIOA 1S1UB 3TZXA 2KYXA 3VVUA 1TV6A 2P6TA 3TQ1A 2R7TA 1NK9A 2CA9A 2CQ3A 4IG3B 7FDRA 4CLYA 5CA5A 1REGX 2BV3A 2J9EA 2K8GA 2MTLA 1S9GA 1VLYA 1HBMB 4ZVPB 2XSJA 4ZCMA 2BW7A 1GH8A 2BE7D 1QM9A 3QAEA 1DTQA 1WC5A 3TVKA 2D3UA 4UOHA 2JVOA 4GKKJ 2ZH2A 4F8RA 1UW9A 2F8MA 2RUSA 2V63A 4B3OA 5KFLA 3TA1A 2R2SA 3QGHA 3FDSA 3SBMA 2IFXA 4GVBA 1X4FA 3S1TA 2HHVA 1B99A 4C2MA 2OEKA 4P6QA 4DV6J 4C7QA 4X62J 3R97A 4O3SA 1WC6A 5ETPA 4ZA1A 3MUVP 1BLUA 3D0HE 3MMCA 1X5OA 2FY8A 3MCOA 2HZCA 2X1BA 2KRBA 3OUYA 3MPDA 2X3GA 3CC4S 3M6VA 2YNFA 1S1TA 1OQ6A 1KFDA 4USJC 4DV5J 6FD1A 3AHPA 1GX6A 1WWHA 5EX3A 4XDDA 3G82B 1U24A 4QWBA 1YIJS 2D9OA 3VAHA 1WSVA 3VAGA 2RRAA 3CCWA 1YZ6A 2DGXA 2LXUA 3DI6A 1RTIA 2QYGA 5D0RA 2ZBQA 2ZUAA 3MEGA 1B0TA 5HP1B 1SUQB 2HFZA 2AV5A 1YTYA 4DQRA 4FYWB 3O2IA 3CC2S 1NSAA 2M0GB 1TU0B 1FERA 3TJAA 3G8QA 3HZEA 2LDYA 1X4CA 3MM7A 1JK9B 2L9NA 5A2QU 1UFKA 3EZOA 2KXFA 2J8AA 3KUEA 1NKEA 1TQLA 4FP9A 3CTRA 3OR1B 2K3KA 1T9XA 2EVZA 4EO8A 1VQPS 4P2FA 1FJEB 4LF7F 1UKUA 2B4OA 4O4GB 4PQUB 5J2NA 2ZJQQ 1O6XA 1GMWA 2H51B 3KYLA 5DQGA 3SDEB 1SJRA 3PKMA 1LK7A 2RU3A 4ED2A 4DL4A 2AJ2A 4ZP7A 4OV6A 2C3PA 4I2PA 4RW7A 5BR8F 4DWIA 1HHTP 1U4BA 2V4JA 1XQIA 3HLUA 5A0YA 2UXBJ 4WF9Q 3TNVA 3R8YA 1H2UX 1OJ4A 1IKWA 3EVMA 4DCPB 3NWGA 2HW3A 4JI5J 4P52A 4LVNP 5AXLA 4L74A 5T14A 2DHAA 1S7IA 5KFEA 1U02A 1OY6A 3HJVA 4ETXA 1K8AT 4TLQA 4Q43A 2ZHAA 2RDDA 5HMYA 2HGNA 2W7PA 1K0VA 1XK8A 3J81Y 1FX2A 5AJ3J 2W2OP 3J7ZT 1HIYA 1TKXA 1VC6A 1N8RT 4OJ1A 2LQ8A 2E1RA 3M1VB 4W90B 4C6AA 2DGTA 2FQQB 1FDNA 3KG4A 4GC6A 3V6KA 1MU2B 4ELVA 1KQKA 3OFHA 1VQ8S 5KG4A 5IZHA 1VOMA 1NDLA 3TAMB 3RRGA 3QMQA 5HN0A 4YEAA 3RW6A 2HHTA 1RHJB 1X9WA 1IUJA 1E6VB 1YRTA 3I5AA 4MIWA 2BANA 2ZH3A 4DU8A 1M90T 3KK3A 4Q2MA 4ZS6A 2B5JA 3GJRB 2VPXB 1JKHB 2FVQA 3O8WA 5E3CA 4Y2KA 2UXCF 4OI4A 2VKZG 2HK3A 3Q0AA 2ZKTA 3CCJS 2HFVA 4K59A 4CLWA 4ZIWA 3HKZD 3GSIA 3BEGB 1FFSB 6FDRA 1RADB 2DR6A 2AJFE 2W7AA 2WSFC 1FEEA 1Q95G 2A2CA 2BEFA 1YGYA 2O01C 2KJWA 3KLIA 2H4YB 4FNIA 5I3UB 2W2MP 4ZVQB 3CJRA 4M5DB 1QVGR 1S6PB 2WB4A 1PBUA 2E5JA 5JVHQ 1YJ9S 4AE5A 4DR6F 3L9ZA 2BOPA 1EETB 1T94A 1VRTB 1VRUB 3OSNA 1X31C 3GG1A 2IJNA 2H9ZA 5KTQA 1REVB 4AXIA 4J9SA 1NK6A 1EIYB 3UN3A 3EVOA 3MMJA 1A6LA 1MWZA 2KXHA 3HM9A 4CNZA 3H5UA 3L7OA 2DXFA 1L3VA 4V19J 4FXWA 2VBZA 1JLEB 2U1AA 2ZNYA 3W65A 3G6VA 2AJQA 3C2PA 2PEHA 1K0TA 1N6QB 2GA7A 4UQGA 4JI8F 5F8MA 5F8NA 4OI3A 4I6WA 3M8QA 2HVIA 2B4UA 1ZS6A 1LW0A 2XLIA 2WTFA 2IVYA 1VC5A 4AQYJ 4C3KA 2ZM6J 4ZDNA 2AHOB 2D69A 4YDDB 2NSBA 3BO3A 1VQNS 3C15B 2ZITA 5KFPA 3OR2B 3H4BA 3HVWA 2GIRA 3CIMA 5HMWA 2E7WA 3LW5C 2DT9A 4Z7YA 3D68A 4OQJA 2C2KB 1F9HA 5T41A 4W4MA 2IYIA 1N5VA 2LEPA 2EFPA 2VBXA 2BJ3A 1AUSL 2MKIA 1S7HA 2MZSA 5CD4H 2HFSA 4LFCJ 2XYHB 3GIMA 3MPVA 1S1UA 3ZZPA 4LSLB 5AXKA 4TN2A 3NRBA 4IG3A 3KHHA 5D77A 2KT5A 4F4YA 4WIIA 2JOQA 1RCOB 5KFXA 1Q8LA 3IMQJ 1HBMA 1JJCB 4F3OA 4Q8FA 3V4MA 1NJIT 3H42A 2H5IB 1SQGA 3TEGA 4H4KA 4F4AA 3QRQA 4JB8B 1LWFB 2IJRA 2H48B 2KI2A 1M1GA 2CQHA 2FY1A 4I4BA 1QAJA 4IRDA 3TVYA 1NB2A 1MN9A 2K7KA 4N5SA 4RX6A 1H72C 4ZCIA 1N33J 2GO9A 2UUAJ 4NXNJ 2M88A 4P71A 3IAS9 2LXIA 4ED5A 2AGQA 5IC6B 4RO0A 4HEA9 2KB2A 3HCXA 2HHWA 1SBRA 2KZZA 1FE4A 1WEZA 4DV0F 1DZ5A 1GQEA 1U1QA 3G82A 1YSJA 4LIWA 4Y2AA 4E98A 1QUPA 3GFHA 3CDEA 2OPQB 5LL6d 4TYBA 4NLQA 3CCQS 3CEDA 1YHQS 2OO4A 1HD1A 5M2RA 3PJ9A 3KOAA 2IBKA 2GNKA 1WF2A 5HP1A 1SUQA 3DRSB 4K4UA 2IJFA 1QSLA 2ZBIA 2ZD1B 3ICLA 3C8YA 1MN7A 5H9FK 5GVQA 2XZTB 1OY8A 1TL3B 1PILA 4AUKA 1UA0A 5FD1A 1Q16B 4FPRA 2A6MA 5DZ6A 2MXYA 1XIQA 4JBCA 4OZNA 4C97A 2VIHA 5D0GA 3LP1B 2RJZA 4DSKA 1PC4A 3OR1A 1YJVA 3BGFA 3QAUA 4FZVA 5KFCA 2ZH4A 2J9CA 4DS4A 3KHGA 3PEJA 3HSZA 2HHQA 2KXNB 3CJ5A 1RWPB 2IDEA 5KT7A 4O4GA 2BE9B 4PQUA 1LK5A 4UF4A 4K2XA 2WVFA 1UVKA 1V3ZA 4YFUA 3SDEA 3DDKA 1WF1A 3Q8QB 3HULA 3GWCA 3QJJA 2MSTA 4ES1A 1UA1A 1FO1A 5F8JA 2VJUA 4R5PB 5ETMA 1F9FA 5KFIA 1SJQA 4KPCA 4OI0A 3Q24A 3ETMA 2XMAA 4PYDA 3FZBA 3LF0A 3OLAA 3QJLA 3KLGA 3FFIB 1XMBA 1CG2A 2BKNA 4Y65A 1Q53A 3NBPB 3FVYA 1VJWA 3HHEA 1WDDA 3FC9A 1EJ7L 3W5ZA 3DRPB 4KY3A 2FZCB 1NK4A 4IOCQ 4MJKA 4ZLLA 3MURP 1NKBA 2UV8G 1HR0F 4XDCA 1UVJA 2C42A 3HD2A 3MZIA 1ROFA 4LUBA 1TL4A 3M1VA 4NLXA 2BM0A 4AL5A 1M5VC 4PG6A 1C0UB 3DM2B 2XY5A 1H73A 4YB7A 4CO4A 4NLDA 1MU2A 2J7KA 2N82B 2KL8A 3CD7A 1SL2A 2LP4A 2KN4A 3TAMA 2L9WA 1WEYA 4NLSA 3T9ZA 1MNEA 1U2FA 1NZ8A 2A2DA 2E29A 2VFUA 3A1YG 2UV8A 1E6VA 2HURA 3DOMB 2V9WA 3GFZA 1KOOA 1NLKL 1JKHA 3ILLA 2R8HA 2HK2A 4KH0B 2GQ2A 2R8GA 2LU2A 2RQMA 4J90A 4PABA 2JLFA 3VGUA 5HQLA 4ELUA 3HVAA 3ENWA 2UP1A 3RU0A 2CJAA 3R5AA 5HL7Q 2LA4A 1TL5A 5KFHA 1XR6A 3QWPA 3R5BA 3G71S 2R7SA 2LEBA 2HAFA 3C66A 2O66A 1I94F 1S49A 2QO3A 4HVZA 1AB8A 3D66A 4NMXA 2B4VA 1T03B 5I3UA 2BACA 3PG9A 4M5DA 3FSIA 3Q8SB 3D3BJ 1S6PA 2HAIA 4CWBA 1NJXA 2D3ZA 5HI7A 5LSOA 4OHYA 2IHR1 2RMLA 3MOJB 1IKXB 4EMDA 2B8PA 1SQFA 1EETA 2EI5A 3N79A 4LIRA 1VRUA 1VRTA 3DRYA 5L1JA 3AOAA 1REVA 1ZZFA 1QUVA 5E41A 1JLEA 1S79A 1YJ7A 1NK5A 1IBMJ 5HMZA 1U1PA 4BDPA 4ZVRB 4K0KJ 1BWEA 3QLHB 2MZQA 1M0SA 1N6QA 4HTJA 1XNRF 2XCPA 3VF0B 2CAJA 3UD5A 2J0WA 2E5IA 4Y0FA 3TA2A 4JI7J 4PQAA 4GKJF 4A8SA 2HG4A 3TOQA 2F63A 1Y5NB 4DL2A 2Y8YA 3C15A 4AXJA 3AJDA 1K73T 3OR2A 4JI3F 2YQ1A 2WONB 2ADBA 1Y9OA 4MAKA 2B6AB 1IBLF 3M8WA 5G0RB 4QW8A 3I0SB 2VDIA 4RUHA 2I5JB 1N48A 3PYDA 4I67A 3L95X 4BWMA 4B3TF 2KVIA 2VDHA 4J91A 4WXOA 3M8SA 2WOMB 4LSLA 3J80U 1H2TZ 5I4MA 4X65J 1CC7A 2GZOA 1ZPWX 4G6VB 4CLKA 1VQ4S 1M1KT 4URQU 4ZLPA 1FI4A 1YVFA 4QPTA 1ZH5A 1LWFA 1WHYA 3GTYX 3T6BA 1U1KA 4FF4A 4DDFA 4OZLA 3LO3A 4BC9A 2RSQA 2EEYA
chains in the Genus database with same CATH topology
4LQ9A 3BQ2A 4G1IA 3IS9B 1NJYA 4E0DA 2QMWA 4HH1A 4B9UA 4LSNA 2LQJA 3T1AA 2DR5A 4K0KF 3OVSA 4NYZA 2UUTA 3H98A 4CT9A 4A47A 1VQ6S 1XTZA 2OKQA 3TRGA 2CZ4A 1TV6B 3UCZP 3JSRA 2BA9A 4EYIB 1X9MA 3TARA 5CHCB 1CC8A 2NZ4A 2LVWA 1W2IA 3DMJA 4PCQA 4UY8T 2DGWA 4NCGB 3J7YI 1GX5A 1KONA 2J6TA 4C11A 3MM6A 1RT6B 4ID5B 2MZRA 2LA6A 4LF6F 2QA4G 2EFVA 2ROPA 2XNQA 3KLHB 4C8LA 3SSRA 5SUHA 1S9GB 4YB5A 4DG1B 4Q44A 2CJKA 1T7PA 2CPEA 3BS9A 4YP3A 4K4SA 4D3HA 1RDRA 2CVIA 2R7QA 2XSJB 1ZAVA 5D4LA 3V6HA 3M6XA 2CZVC 3QPIA 4BBYA 1H7WA 5DG9A 1JLQA 2XSFA 3HO1A 3PR4A 2F7VA 4HI1A 1DTQB 4A48A 2OPPA 2GMLA 4R8UA 5KFBA 2DNKA 1SXLA 4DOZA 3ISNC 2G1DA 1P8GA 2RUGA 1S9FA 2HHSA 4X2BA 4N41A 1MWYA 2FIUA 4C8NA 5GAEI 3IO1A 5CYMB 5DDRC 3PKYA 3HFKA 1T8EA 3H2UB 3ZZTA 4XPCA 3IGNA 2XLJA 1KQFB 4DR5F 3OFGA 2FUG9 4B3OB 3O6QA 2ASJA 1UFWA 4I2QB 4WFYA 1C4CA 2OAUA 1KHWA 2JWNA 4JI0F 2GHVC 3GR0A 5FDLB 5F9LA 1RYRA 2DR7A 1VK3A 3PX6A 3MOZA 2OPQA 5F8LA 2FC9A 4H54A 2BJDA 3T5KA 1HI0P 2HS3A 2P5VA 1FKPB 3K5PA 1K1SA 4OX9F 4KB7A 2AQ4A 4J9NA 2V8GA 1U09A 2XMWA 1FRLA 1N88A 1VIXA 2C22A 4IO9Q 4MYUA 2XEXA 1N0UA 2ROEA 3DNCA 1Q79A 5KT4A 1JLAA 5KT3A 2HVZA 1RISA 2ZOFA 3FNNA 2JLGA 1OWXA 3M8RA 1Q7YT 3BB5A 5A6PA 1JLBA 5EGYA 2R2UA 5H1SV 2VQEF 5D3GB 3DN9A 3RR8A 4A4JA 1J2VA 3DRSA 4RKUC 2A1BA 4X65F 4IUFA 1C0TB 5E3AA 1WHVA 5THWA 2M8DB 1U2RA 4C9DA 2ZD1A 2CKWA 4RBTA 5F3TA 2UUBF 3N6LA 3MMCB 3WDOA 3BQ1A 1R27B 3IG1A 3QIDA 3TAPA 1KNZA 1YRXA 4NA1A 2YNGB 1H98A 1N5QA 1ZTWA 3OUYB 1TL3A 3NP5A 4OV1A 1Q82T 4TXSA 4KTQA 3IR7B 5KFWA 2M2BA 2GJ2A 3E51A 4BS2A 1X4AA 2XLKA 2J0XA 4OHWA 4OZ5A 1T95A 3LWMA 1VQ9S 1T05A 3MM5A 4H4KC 3KK1A 2R8KA 2X1GA 4NLVA 3FCHA 2XC9A 1EP4B 2J5AA 4DN0A 2MQQA 3LP1A 3H59A 3D2WA 3DHXA 3OVAA 5JVGQ 2YKMB 3UDLA 1S48A 2VD3A 1HW9A 5GAGU 3FMBA 3OTCA 4ECXA 1IBKF 4FF2A 1E6YA 5D4OA 3CF5Q 3U7JA 2RF2B 1G7CB 3KK1B 2Y1IA 1RT3B 2LCWA 5D78A 3S7RA 5C24A 4O3PA 1F5CA 4X66F 3CC7S 2MPUA 2MDAA 2MY7A 4NLWA 1WELA 4FN5A 4V19X 4ZVHA 5B0BA 2RVJA 2VL1A 2B3TB 4CI0B 2I38A 4LT6A 4JV5F 4IO1A 3LP0A 3DI6B 3DFEA 3PNIA 4UW2A 3G96A 1RTIB 3J7Z5 3K58A 4C4WA 1HYSB 2KDOA 2D1CA 1DTTB 2YKPA 3MEGB 4X4QA 4DFJA 2XS5A 2IRUA 2I8EA 2ZC3A 1UVIA 2GO8A 5IT0A 1URNA 4KRWA 5CYQA 5CQGA 3E3XA 4PG4A 5KG1A 4ECYA 4CO5A 2HYIB 2PA3A 4TYAA 2ZBCA 4ZK7M 2C3UA 4JUZA 2CIMA 4X4VA 2DIVA 3R5DA 3LP2B 4FXVA 1WI8A 5GAHU 2RQKA 3OFEA 3JB9k 2HHUA 2D9PA 2COLA 4J9OA 1RT2B 3B82A 2F8HA 1IJFB 2AU0A 1Z4UA 4HT5A 1G3OA 5T7LB 1N33F 3NLCA 1O0PA 2VFTA 2Q6CA 2RRNA 5KAKA 2E9TA 1WNEA 2IC3A 1X5TA 3MM7B 1WTBA 2FVPA 4U9RA 2UUAF 4NXNF 4AYBD 3M32B 1S6OA 3ENQA 2JEJA 2VBYA 4R5PA 3OJSA 1OSDA 3VAIA 3RBDA 2D3OR 3CT9A 5IQQA 1SI9A 1KVJA 4ZMMA 3PW7A 5F9NA 3ZC4A 3CCSS 4HKQA 3DLJA 3DLKA 1IKVA 4XO0A 2OTJS 5BJRA 5KT5A 3BSAA 2MGZB 1IQTA 4HL9A 2DVIA 2N3OA 3FJ2A 2MSSA 4LVOP 4E8UA 4M95A 1LOUA 3RZAA 1FTCA 1G1XA 3WC2A 2L08A 2XMJA 3N01A 5IS2A 3MEEA 3FFIA 3T1YF 1HNWF 4OJHA 1GXTA 2DCUB 3BO4A 3UQSA 1G2EA 1UEVA 3L7PA 3LWLA 3AJ2A 3IRXB 1KVIA 2PSZA 5U47A 1T3NA 1TKTB 3NBPA 2HFOA 4DQIA 4I56A 4EO6A 5DM6Q 5J2NB 4DF4A 3LOUA 2O1PA 4QIVA 3OPKA 3V6JA 3C6UB 4J9PA 5J2PA 2NS1B 4O4RA 3M6UA 4LF4F 2J0QD 5C25B 1SJ3P 3GG0A 3WX4A 3OXFA 4DHVA 3MMBA 4RWXA 3P6YC 2LQ5A 2LQBA 4I2PB 3JSYA 2WHOA 3DRPA 1W2BR 2ILZA 5IT9Y 3OLBA 2ZVSA 2R7UA 3MHYA 2F40A 4NZ6A 1S10A 3EXYA 3MWBA 2LQ9A 4RW7B 3PIOQ 3GV7B 2RS2A 5E3RA 3PW4A 4B17A 3SYZA 5A8KB 3NNAA 4WFXA 5L1KA 4WFBQ 1RT7A 3I31A 4KT0C 4I69A 1UVNA 2NSCA 1Y5LB 3N5FA 3H5YA 4DFKA 3DLLQ 2PA8D 1FD8A 1UAWA 2VQFF 3CJ4A 2V4JB 4B08A 3RAQA 4ELTA 4USIA 3N5BA 2HPUA 4ITSA 1F2GA 5A0YB 1GXLA 2E5GA 3K59A 2DIUA 2ZE2B 2IVMA 4A8XA 3AA9A 4K4WA 3KLEA 1FESA 2ZOGA 1VQMS 3M8PB 2V8DA 2VASA 2R2TA 4X4NA 1YRUA 3M2UB 3V2UC 3BM7A 2DTJA 1IKWB 3SCJE 2BZ2A 3AB4B 3JAMY 4ECWA 3V4IB 3H25A 4J9QA 1NKCA 2NUUG 1PSDA 1L3SA 1C0UA 5J2MB 1RT1B 3DM2A 3MR3A 3SEOA 2DBBA 3PEHA 2YKNB 2BJEA 1W25A 2ZFHA 3CPWR 3IWNC 5D8HB 1HI1A 1JLCB 3CWJA 2OFHX 4CTAA 4DQPA 2PN6A 4QR1A 5I42A 2FGOA 3MECA 4C3MA 1WG1A 2QLWA 1QAYA 1FJ7A 2ZC4A 3IGVA 4F3QA 1UJ4A 5D4NA 4HI2A 2ZH9A 1KS2A 2ZDPA 4ECVA 4ED8A 4MTPA 2W9CB 4ZPDA 2AX1A 1HNZF 4JYAF 3SI8A 3AY0A 1TKZB 4RNHA 2LKZA 2AYMA 3FRZA 4IRKA 3NCRA 1C1CB 3Q23A 1HNIB 4RNOA 3MM9A 4QCLA 5KT2A 2W25A 4QWCA 3TAQA 2B9WA 1QSYA 1SL0A 3DOMA 4RNNA 3K5LA 2BABA 2FGCA 1VQYA 4KV8B 1TAQA 1JLFA 4P7VA 1U48A 3EGWB 1LFPA 1IJEB 1TKXB 4TY8B 1DHMA 4KKOB 3DLEB 3PM9A 1RQ0A 1SIWB 2DNOA 3LPYA 5IXUA 1RKIA 3M9OB 5I3QA 2HRYA 3HHLA 4ZKAA 5F0WA 2RKIA 5AXMA 3HJFA 4TU9A 1DFDA 1ZETA 3Q8PB 1LKZA 2C3OA 1R3NA 2EW9A 4DFPA 2XWXA 4WKRA 3GYXB 2XCAA 1R8AA 3THTA 2EFGA 5CZXA 4GO7X 1R8BA 1JJ2R 2JEGA 4QWDA 1U49A 1F60B 1Q4RA 1C4AA 3TUIC 3Q8RB 1Q8BA 1FHTA 1VQOS 3BO2A 2VV5A 2ALZA 5HO4A 3UI3A 2GHPA 1HPZB 2V0NA 2JC1A 4X84A 4ED0A 4WE1A 2GQQA 2WW8A 1P9QC 4Y28C 1NB7A 1GXUA 2AGPA 2CDQA 2EG2A 3T9NA 1DLOB 4NPOA 4PWDB 5DGAA 3UNGC 2ABYA 4PXDA 4C0HA 5DM7Q 2CJQA 5GADI 1FKOB 5JJBA 3CDWA 3I4HX 4RNMA 1S77D 5JXSA 3RYLA 4F2SA 3W3SA 2QLXA 2Z2MA 3BJYA 1UVMA 2FJXA 2DH7A 3CIZA 4O3RA 3NMAA 3GMGA 4MFBB 3DOLA 3BN7A 4ZP6A 3W2WB 4WU3A 4KQZA 3J7YU 3EUNA 4F26A 2HHHF 3X1LB 2BANB 4JI6F 1KLNA 2HWHA 2F9DA 2I0XA 3UR3C 3ITHA 3GR1A 2FJDB 1T03A 3KK3B 4LF9F 4QIFA 1HWKA 5B7WA 2B5JB 1UJ5A 4CNYA 2FTRA 3IWLA 2DNYA 2OD4A 3PJWA 2CQBA 2GX8A 3F73A 4IRCA 4HHJA 1YJRA 2C2DA 1GNKA 3OXLA 4I1TA 4K4VA 3MTKA 3K7RA 2E5LF 2HFNA 2LU1A 3WBZA 3EPIA 4OHZA 4ZCKA 5DDOC 1IKXA 2VPYB 2LYVA 4OMFG 5GAHI 3M30A 4F25A 1X0FA 2CQCA 3BF4A 4Y3CA 1R43A 3MR2A 1WG5A 3J80Y 3CMES 2L41A 4U67Q 2HNDB 5E0OA 1SB6A 3BZQA 4WZQA 4IH6A 1KC8T 4B02A 3KG1A 2WSEC 4XIUA 2V4RA 1L3UA 1RTHB 3D1OA 1F0XA 3I4PA 2B9XA 1LW2A 1FXDA 4MK8A 2IM3A 1FRMA 3VR1A 1R6YA 3PX0A 1JLGA 2MHNA 2YY3A 3DU6A 4DV1F 4ZPVR 2JLEA 3LUYA 2CG4A 1LWEA 4F02A 1QE1A 2FB0A 4NZ0A 3FRYA 2WBMA 3PO5A 2NUHA 2OPSA 3R27A 4MIBA 3NNHA 2FDNA 1UJ6A 4YB6A 2CQ2A 2PMHA 4MKAA 4O3NA 4ZHRA 4B9VA 5KFAA 3KLIB 1X4EA 4KO0A 3G9CA 3I96A 3TP2A 5M2UA 5A8RA 1JWWA 4IFVB 1U45A 1NZAA 4CH0S 4DV3F 3G8SA 3MPWA 4TLRA 1ZM9A 2W4CA 3QLHA 3OHBA 1YG0A 3POTA 4O3OA 4YR2A 2BQUA 4ZHRB 3CCVS 3FSXA 3UW1A 2YKAA 2OTLS 3HHLC 1S0MA 3PO4A 5G4DA 5DQIA 4IR1A 3ZZOA 4K5SA 4PG7A 2QEXS 3OTDA 3CJKB 3EYZA 5FIIA 4RU2A 3QZ7A 3MFHA 4ZP9A 3TA0A 2WB1D 2DGUA 4Y6IA 2YH0A 4QPXA 2QE5A 4OX6A 2BR0A 2ASYA 5DRKA 3KK2B 1TP7A 3CCMS 4F50A 4ICLB 1BD6A 1S99A 1TVRA 2MKKA 4PKDB 5IFMA 4UUXA 4Q45A 2N7YA 4DSLA 3JYTB 3MCSA 2J7UA 4RUAA 3PFOA 5KFRA 4B3MF 1JJ4A 1OPIA 3IR5B 2A3JA 1S1VA 2WONA 1QY7A 4K4YA 2FHJA 3A8EA 3DRRB 3JTNA 4QOTA 4B3RF 3I5BA 3W2VB 1HBNA 2SXLA 2BM1A 3S8SA 3SFUA 3L09A 2B6AA 3DCAA 4EFAC 2GW8A 3OL7A 2BBEA 3PRBA 5K9FA 1P27B 2YWGA 1Q8IA 1YJTA 2Q43A 5E3QA 5K8MA 4FS1A 1SV5B 5G0RA 4C8OA 2GHWA 2HMIA 2VA3A 2B9YA 1HMVA 2AYEA 5EX0A 3I0SA 3KMSA 2BXJA 1AUDA 1JXEA 4LJMA 1DAXA 3C46A 2F1FA 1LXJA 2AYBA 1I1GA 4YY3F 2I5JA 4TU8A 2DH9A 4Y2IA 2HHPA 2MMYA 4QIWD 3GFXA 4RNFA 2OH2A 4DJBA 2XHWA 4NLOA 5J1EA 1C2PA 3NS6A 4YB1P 4D3GA 4DL0C 2WOMA 1S6QB 4K50A 3M8QB 4I6AA 2DK2A 1LW0B 4RUCA 1JMTA 2KJVA 3N4WA 2M52A 5B0AA 5CXTA 1FDAA 1RI7A 2YNHB 5LSLA 4N56A 1MMNA 2NYIA 1KD1T 4TU7A 4DEZA 3RB6A 1HARA 1RWUA 2IM0A 2K1RA 5K8NA 4DV7F 1U1RA 1N34F 1X8DA 5LXYA 2PIIA 4OX7A 4G1QA 2B0GA 2N4DA 4NRUA 2HIQA 1XMQF 2UZAA 1VQSA 5KG2A 3N0VA 2YKOA 3THPA 1ZOTA 4F4XA 3JSMA 3CJ3A 4OI1A 5JUMA 4BCAA 1FRKA 3GIKA 1V3SA 4JI1F 1BY9A 1OS5A 2M5YA 1UEUA 3TI0A 4A8QA 1D3WA 3D0IE 4PUOA 3I9V9 2BE2A 4G1QB 3R5CA 2HLTA 1Y0HA 1RK8A 2GGPA 2ZKUA 2VFVA 4M1KA 2XI3A 1K9MT 2FJBB 2DITA 2HWIA 4RZRA 3VZHA 1GAOA 3KKFA 3MTJA 2IYGA 4I6YA 2B7CB 2FLNA 2MZJA 4KHMA 2HRUA 3X3UA 3HKWA 2DD8S 3DOKB 1P1LA 3CDAA 1Y3KA 5MLCV 2BDPA 1ZTTA 2E1CA 1A7GE 2I9SA 2AX0A 2NPFA 3O3LA 4IDKB 3QWUA 4EWTA 3L3CA 3IS9A 2VONA 2CQ0A 2NXUA 1QJHA 2DNRA 2VB6A 4QIGA 2AJ0A 3ZZUA 5KT6A 1VIOA 3KHRA 2DB1A 1FE0A 4RW4B 3OSPA 1OPZA 5HBMB 5IWAF 3F56A 5J2QB 3JSBA 1VK8A 4ECQA 1HBUB 1XNQF 1S1UB 4K4TA 2IAJB 1BC6A 2KYXA 1R0AB 1Y00A 2CQ4A 4EYHB 1TV6A 4I7FB 2P6TA 4HYKA 1IBMF 2DGQA 3TQ1A 4NLUA 2J6SA 2CPJA 2R7TA 3T6JA 1NK9A 3PY8A 5B0DA 2CQ3A 4NCGA 3CCUS 5IM0B 4IG3B 7FDRA 2CPFA 1G6BA 2JX2A 4FBUA 3HHNB 1RTDB 1NK0A 4QZVB 5CA5A 1NAQA 1C1BB 1RT6A 2QA1A 1RTJB 2VG6B 2ZHOA 4ID5A 3SCKE 1S97A 1D0EA 2FLPA 2BV3A 4J5OA 3KLHA 3OBIA 2ZZNA 2J9EA 2K8GA 4DG1A 1S9GA 2E5HA 4ILMA 1VLYA 1HBMB 2YNIB 3KLFB 4JI7F 1M5HA 4M8LA 4PR6A 4F4KA 2FVRA 4ED6A 2XSJA 1BQMB 4ZCMA 1IKYB 1GH8A 1AXQA 3GIJA 3ISZA 2JEIA 1PC5A 1AROP 2V94A 1QM9A 3D28A 3QAEA 5K8OA 1DTQA 4MMOA 3TVKA 1CPZA 4A46A 2D3UA 2JVOA 2ZH2A 5F0UA 4F8RA 5A2QY 4NRTA 3VQSA 3GE9A 4WJBA 2F8MA 2ROGA 5CYMA 4DR7F 2DNPA 2XY7A 2CYYA 5KFUA 1JIHA 5LJ3Y 3OW2R 2RE1A 4RW6B 4B3OA 4JV0A 5KFLA 4I2QA 1NRKA 1HWIA 3TA1A 2R2SA 1JNRB 2F8EX 4TNOA 4ALZA 2IBOA 3QGHA 4USHA 3FDSA 2CQ1A 5FDLA 2N7CA 3OHAA 2ASDA 2IFXA 3DU5A 4N8NA 4CCHA 3K0JA 4RWWA 1U1OA 1U25A 3I32A 1X4FA 1FKPA 1DRZA 2IVFB 3S1TA 2JEFA 2HHVA 3LANA 1H3DA 2FJVA 2DNNA 3SQGB 1SH2A 4KPYA 1FRXA 4C2MA 3ONQA 4R25A 4P6QA 4C7QA