3GMGA

Crystal structure of an uncharacterized conserved protein from mycobacterium tuberculosis
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
143
structure length
143
Chain Sequence
ARLAALSILVGAVGATGPGVMITIDDPGPGVAPEVMIDVINELRAAGAEAIQINDAHRSVRVGVDTWVVGVPGSLTVDTKVLSPPYSILAIGDPPTLAAAMNIPGGAQDGVKRVGGRMVVQQADRVDVTALRQPKQHQYAQPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uncharacterized protein Rv1825/MT1873
publication title Crystal structure of an uncharacterized conserved protein from Mycobacterium tuberculosis
rcsb
source organism Mycobacterium tuberculosis
molecule tags Structural genomics, unknown function
total genus 35
structure length 143
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05949 DUF881 Bacterial protein of unknown function (DUF881)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1880 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3gmgA00
3GMGA
chains in the Genus database with same CATH superfamily
4PXEA 4O44A 2UUBF 4BS2A 5DLFA 1WJ9A 1QVGR 4HH0A 1S1WB 2W4PA 5F3TA 3D7SB 4NLRA 5ETLA 4N5SA 4K4VA 2GO9A 3KUEA 4ECWA 3TZXA 3WX4A 1SB6A 4DR3J 4PRFA 2XY7A 2GVZB 4RW7A 2Z8QA 4RU9A 4HEA9 1NDCA 3FUYA 3M8YA 3BSCA 3HM9A 3N5BA 1I51B 2AHOB 4GKJJ 2E1AA 1S6QB 5KG5A 2V9KA 5KFEA 3NKYA 2EKNA 4LSNB 3A8JA 5AE3A 2H51B 2W8LA 1K9MT 2B43A 2PIIA 2QFIA 1TL7B 3GSDA 2CJ9A 2KFNA 2NXJA 3VF0B 1VBKA 1G4CA 2MMYA 1HNVA 3C15A 1R0CB 3EXYA 5U47A 1BMQB 2KXHA 5EWGA 4FVCA 3IAM9 2OUGA 3CIZA 1KTQA 2D7SA 3K2YA 2HYIB 2MLYA 2G1DA 4DDFA 5D8HB 2ZFHA 2J9CA 6FDRA 4TQSA 4R25A 2CQHA 3M9NB 1M1HA 4ZDNA 2HLUA 3ZNJ1 4OHYA 1P6TA 1TKXA 2VONA 4EGLA 1C0UA 2GIQA 3BH6B 3OTBA 1PYOB 2H4YB 1XBWA 2JJ4D 2R7OA 2CJYB 1A7GE 3ZTSA 5HBMA 3MD3A 1UWAA 5KFFA 4TY9A 3TUJC 4ID5B 4KSEB 3Q24A 1S99A 2ZC3A 1SC4B 2XMTA 3NP5A 5D0RA 2ZZMA 4O3SA 2POKA 3VQSA 5F41A 1DTTA 4B9TA 3W65A 1RWUA 2QSFA 4QR2A 3UNYA 4ID8A 3KHLA 2KG1A 3M6UA 4EI2A 4DV6J 2XY6A 3GR0A 2O01C 1JLFA 3ENVA 2FHKA 2HVZA 5CHCB 3NWGA 3PEHA 1KQSR 5KFYA 3ISZA 1R8HA 1JLBB 4F67A 4KGKA 4WBFA 2M5YA 4QR1A 5EWFA 1QAIA 3TUIC 4CLKA 2G4BA 4ED7A 2EI5A 4LR8A 3RB3A 3MEGB 5J2NB 3FBCA 2HGNA 1RB0A 5ETVA 3L9ZA 2M88A 1W25A 1U4BA 2HGMA 4QWBA 1N33F 2VKRA 2XY5A 3CD0A 3PYGA 3MFHA 2MJNA 4FS2A 5THWA 3QT5A 3MEDB 1WELA 4M5GA 3IBFB 3A13A 4KPCA 1EHWA 3DYAA 3TUZC 4WWSA 3X3UA 4DL0C 1WKKA 3IXQA 2GGPB 2CDRB 2Y1LB 2BABA 2C2EA 2ZOGA 4YHHF 5KT6A 4ZVGA 1RAIB 2AX1A 4MYUA 4KO0A 1RWKB 2HFUA 2QN6B 2RIJA 1QM9A 3PYFA 4NXMJ 1RWVB 1XNQF 3TJ8A 2VL1A 3LO3A 5CQGA 1QAXA 4RBVA 4JV5F 1QTNB 4RW4A 4ZHRB 2HHQA 1Q8IA 1OO0B 2A10A 4I68A 4O23A 4K59A 4ZN3A 1VQ6S 3NRBA 1YJWS 3JSMB 4PPDA 2XSJB 4YB7A 2HWHA 1MROB 3EZOA 1NPPA 1UJ4A 4DL3A 4TY8B 3VGSA 3CDAA 2V68A 4USVA 4QQBA 2RHSB 1A9NB 2UUCJ 2BKNA 1RYSA 1ZOTA 4WXOA 3RBXA 1S6OA 3G2XA 1RT7A 2N3OA 5FJ4A 4NLSA 1N6QB 3G8QA 3R1HA 2VFUA 3N6NA 1U1QA 3ONQA 1N4LA 3C16A 2DISA 2LECA 5DG8A 1Q5YA 1U0SA 1RHRB 2F8HA 4X65F 1CEZA 4X4SA 2E7WA 1I6JA 4M5MA 1RT6B 5A6PA 3NCRA 5A8RA 2JVRA 2IM0A 3TEHB 5CYQA 3FBBA 4DSEA 2Q6CA 3UD3P 3BO2A 2CPIA 4H4OB 4ZP9A 3KJQB 1PILA 1OY8A 3VTIA 1B4SA 1FRXA 1VJWA 3R8YA 1Q7LB 1FVQA 2M8DB 2MPUA 3R6LB 1N0UA 1VQ5S 3I32A 3PTWA 3H5YA 1X0PA 3EUNA 2D3ZA 1LWFB 3NBPA 3NGSA 3TWZA 4K5SA 3U7JA 1TL4A 4DU8A 5DDRC 2BW2A 7AT1B 1IBKF 1GMVA 3FGVA 2R8JA 1S0MA 2ADBA 3M8RA 3LGHA 2F8MA 2F63A 3E8OA 4ZITA 3P96A 1PBUA 2EFNA 1FJGJ 1YG0A 3QJLA 4CO3A 3CEDA 3CO9A 2HQGA 4FKYA 1VCTA 4ELUA 5GMKa 3UE2A 1SJFA 5E3RA 4FVMA 1KOOA 4G65A 1RK8A 3ZZOA 3TOQA 1RHUB 4FBTA 3C3LA 4MK8A 1Q53A 5LMNF 2VJUA 2HNZA 1VBXA 3KLHB 2GVZA 4B3MJ 4BDPA 4WTYA 3T5LA 2VKZG 2MDAA 1IWGA 1R8PA 1AYEA 1TKZA 1YBAA 2MQPA 3MHYA 3S6EA 1VRUA 4X64F 2FJXA 3Q8PB 2JEGA 1HW9A 4DHVA 2HHHF 3EDQB 2NUHA 2XMAA 2XMKA 5CXTA 1PBAA 2Y1RI 2YNIB 1N56A 2VA3A 2F5GA 2ACYA 3EGZA 2V2KA 3CDBA 2UXBJ 3GSIA 3KK3A 4LREA 3GYGA 4QWAA 3OVBA 1T03B 4KPYA 4J5OA 2X1FA 4PUOA 1O51A 3A4TA 4PXBA 2VDHA 2FJBB 1BWEA 4H4MB 1WG4A 3VHQA 3CSKA 4CRJA 1OYEA 1IR1A 1NK7A 2C3YA 4OI3A 1OSDA 1FDDA 4DV2F 3EVOA 2BOPA 1D8YA 3GB0A 2JZ5A 1JLEA 5L1KA 1Y0HA 2B6AB 4C6AA 3ULHA 3GP9A 4ZIVA 3O8WA 1E6VA 2OFHX 1UWBB 2DEJA 1QUPA 3NNHA 1XNRJ 4C8YA 1ZM9A 2DPJA 5IQQA 3MCOA 4WYWA 2V67A 1N32F 3R5BA 2IYGA 1QTMA 1ZTTA 2CXEA 4ANEA 4CCHA 1PIEA 2U1AA 3OW2R 1N48A 1FJEB 3OVSA 4A4JA 4KFBA 4J9OA 4J9SA 2HHXA 4CO5A 4U6PA 5K8PA 4J9PA 5FDLB 2KG0A 2MQOA 4DI6A 4ZIWA 3DRYA 3I31A 3DOLB 2A18A 3OL7A 1YJTA 4OI1A 1YJVA 3A8EA 2H4WB 1OY6A 1S9EA 1WSVA 2GA7A 3C6UA 4OX9F 1O5JA 3J7YI 1VRTB 4M94A 2W2OP 4F36A 3PW0A 1HQUA 2XGQA 5IQ6A 4EO8A 1H98A 3Q8SB 1S9GA 2APOA 2K1RA 1WI6A 3OLBA 1IKVB 4EEYA 1M5KC 3MPVA 4OZ5A 1UFLA 2BVZA 4I2PB 4YHHJ 2UZAA 2BE9B 1QJHA 4RR5A 3HZEA 2XLIA 1HLWA 5KFBA 2IIHA 1HNWF 1XMBA 2AYBA 4W92B 1I94F 3FQLA 3JTPA 4P9SA 4OYWA 4NA2A 5BR8F 1PC5A 1VC0A 4JV5J 3DRRA 3US5A 2BOAA 2KI2A 3TX8A 4ZMMA 4Q2MA 3EVMA 4MFBB 3MEDA 4ERDA 4NCAA 2OMLA 2WRMA 4J90A 1FKAF 4EFAC 4C7QA 3VALA 4Q8FA 3PJXA 2VODA 2ZWPA 2DNNA 2UXDF 4BWJA 2D69A 3AAWB 2A3JA 5CYMA 2UXCJ 2V69A 1X4AA 3HHKA 1WACA 2ZBRA 5DRKA 1KDNA 4RZRA 2AJFE 2X1BA 5A2QY 2W7PA 2WW4A 5LXRA 2M8HA 2JHEA 3K5MA 3MAHA 2PEBA 2N82B 1RQ0A 3NS5A 2QRRA 4ZHRA 2LU1A 4C0HA 2IC3A 1Z1ZA 5KOWA 4WPAA 4WFYA 1X9MA 3N6LA 2ZITA 1FX2A 2L08A 2MQ8A 5LSLA 4TY8A 1ROFA 3K89A 3W2WB 3UCUP 4BLGA 5E3AA 2L9NA 3LA0A 3N4WA 1K0TA 3LP1B 4PWDA 4M1KA 3DI6B 2J0SD 1ULRA 2V63A 3AHPA 4DJBA 1RTZA 1TL3B 2K7JA 1N6QA 1LWEB 1SKSA 3IR5B 4ZLJA 1EQMA 3O2IA 1IM6A 4RNOA 3KMSA 4C8LA 3MM9A 1NH7A 1S9FA 1UCNA 3CMAS 5F0WA 3SZ2A 2UVUA 5HVGA 3MUVP 2FVCA 3HVAA 4KJIA 2GHPA 4DV3F 2AF6A 1IBKJ 5AJ3J 4HTIA 4O4RA 2DR6A 1RAGB 3OHAA 3KWMA 4B9UA 1J2VA 2N7YA 1U6ZA 3V6DB 3RB0A 1BWVA 2YKMA 2NCKL 3UR3C 1AXQA 1H2VZ 2DNGA 4OZNA 4EZ6A 5I4MA 2IBKA 5T14A 2FB0A 3P45B 2YKAA 3M05A 4K5RA 3VGVA 3KJVB 2L9DA 3MAAB 1HWLA 1RXOB 4C0OC 1RACB 4IG0A 1UEKA 4DX7A 3NS6A 1JJ2R 3DGPB 5ETKA 2UVVA 1VQPS 3PNIA 2Z57B 4JV0A 4YY3F 5KFVA 1RI7A 2CFXA 5L1JA 2DTJA 3KLFA 5LJ5Y 5J2MB 4KV8B 2CZVC 5D3GA 2GMHA 1U8SA 2W2QP 3KLHA 5KFQA 4KH0B 3W8PA 2DGOA 1T3NA 2AP6A 5B7WA 1RT5B 3PHEA 4DV2J 2W9BB 1RWPB 3I0SB 1AZSB 3GJSB 3BQ1A 2YKNB 1JJHA 1CJTB 1Q8KA 3DXBA 3LUYA 2B8QA 1UTAA 2B7BB 4ZVPB 4FKXA 4KYZA 1UVKA 1S1UA 2NXUA 2X51A 1L3KA 1Q95G 2CPJA 4JI1J 1HI0P 2VBWA 2HLTA 4MTPA 2R3VA 2W1BA 2OLWA 2KVQE 3QZ7A 4OHWA 1ZBTA 2FIUA 3BB5A 4MIBA 3FSYA 4WKRA 3JQJA 2JSXA 1W2IA 4KGMA 4RW9A 1IBMF 2VUGA 5B0BA 2XI2A 4B3RF 1VMBA 2I2YA 5KFOA 3L7OA 2RVJA 2CUYA 1Q4RA 3PIOQ 2BANA 2E29A 1Q0NA 2HNDB 3FBFA 1JNZB 3P5BP 4CM2A 4U8YA 2FUG9 1QE1A 3W61A 1IBCB 3HI9A 2LYVA 4QWDA 4LSLB 3MCNA 4USMA 2B4VA 2DIUA 2IJRA 4TVAB 5LMUJ 3M2VA 3S1TA 3FEYB 3HXMA 4EO6A 2XMUA 4LF6J 4DPYA 2WK4A 2IFXA 2YNGA 2XMJA 5CZXA 1Y9OA 4WP3A 1APSA 1S4FA 2OFGX 2W7AA 4FNIA 2Y8YA 5EX3A 1H38A 5A2QU 3AOBA 3W9IA 3OTCA 3V81A 4CH7A 3D6MB 3I5BA 4JI5F 1HR0F 4OYBA 4M8LA 1X60A 4QW9A 3WQPA 4KHRA 3I87A 2KFZA 2OPPA 5EN1A 4DS4A 3MM7B 1X9WA 1C1CB 3T1YJ 1TUWA 3I55S 1VQLS 3NEKA 2FTRA 4RW6B 1KC8T 4IDKB 2IVFB 1P9QC 2QJ3A 2IRYA 3UVJB 2DXEA 3OSNA 1H7WA 1UEVA 3PJ9A 3PY8A 4NEYA 1IN0A 5G0RB 1DQ9A 1VHIA 3CCJS 5EHHA 3TEGA 2IBOA 3HSGA 1S12A 1WI8A 2CVIA 1REVB 2GC8A 4P7VA 3M32A 4QW8A 1B0TA 1NEEA 1HMVA 2H9ZA 2RE1A 4UY85 3H0PA 3CE8A 1N54B 2VIHA 4OZ1A 2EC0A 3SXLA 3DLKA 4DR2J 1JLCA 1RU2A 2P9GA 2LDYA 3JSRA 5FD1A 4J9RA 1R31A 3LW5C 5H9FJ 4RKUC 2LP4A 3ZTRA 1NM2A 4UOGA 2GJIA 3VAHA 4KT0C 2XZDB 2M9KA 2CPZA 3AD9C 3QSIA 1PJ5A 4DR6J 2QL5B 4OYPA 1MN7A 4MK9A 1NK8A 1SIWB 4XTTA 5CAAA 1BUXA 1FRKA 4RW8B 1RTDB 4RL1A 4OYAA 5DZ7A 2ZBIA 3G4SS 4LRCA 2FDNA 2V94A 3CIMA 1HIYA 1TL5A 4QYZK 3R5DA 2MZRA 2FJVA 1JLQA 3DM2A 1U6FA 4AL7A 1RU1A 1GMWD 4YEAA 1VQMS 5HLFA 2ZJPQ 1U8WA 2DRDA 1UETA 4U8VA 4ZP6A 5F8NA 2D74B 1O6XA 3CJ8A 2RF2A 3SCIE 1F9FA 2J9DA 1FK9A 1CBKA 2CRLA 4ZVQB 4DR5J 3BGRB 1WG1A 4Y2AA 3MECA 4LR9A 1JLGB 1SL2A 2COLA 3OL6A 2ZH1A 1KEKA 5KFHA 3RTVA 4JI8F 5DDOC 1HBMA 4USHA 3UN2A 4MAKA 2BQRA 3BKFA 2YBVA 2D3O1 2HVHA 2IM3A 3R3TA 3DCAA 4USIA 3P6YC 5J1NA 4JI3J 2CWKA 4Z7CA 3IS9A 2HHUA 1T11A 1UVLA 4DL7A 1WG5A 4PQUB 5KFKA 2F3JA 4AL5A 4IFVB 1R0AB 4NLYA 4U95A 3POTA 1O0PA 4DSJA 3I0RA 2BUNA 2HVEA 2IAJB 4OL8A 4G3IA 3KXDA 3CULA 4ZPCA 3W1YC 2ZOFA 2XYPB 3MMAA 1NAQA 3OXLA 4DUYF 3JB9k 3KMQA 2AIRB 1KD1T 4HACB 1L3UA 1YDLA 3IM9A 3DDIA 1OS5A 3KNAA 3CT9A 2QGFB 5DG9A 2XS7A 3R7BB 2BZ2A 1RT3A 3DRXA 2MXYA 2IJFA 2HG4A 3SFGA 4CTAB 4DV1J 1NB2A 3EVWA 1H3DA 1WHYA 5HQ8A 3BDPA 4ZN1A 3K7RA 5HI7A 4KV8A 3OUYB 2VG5B 3BGFA 3QATA 3H8YA 2PMHA 3QIDA 3C8YA 4ZPDA 1VQ7S 2AW0A 1HBOA 3AQPA 2W9AA 1NSQA 5IS2A 1IBMJ 1IKXA 1KFSA 1U45A 2ZHAA 3Q2TC 4ZVUB 3FEZA 4B3RJ 5J2QB 5KOXA 3SDEA 3KLGA 2QFJA 1CJKA 1MMLA 1NJXA 2VPXB 2DHGA 2YPYA 3DLGB 1ZTWA 3MR2A 3NXZA 1DTQB 3I0SA 1N8RT 2ASYA 4FBUA 4F3QA 1LW0B 5IT0A 4O4GB 2EFPA 2HFSA 2GHVC 2KT5A 4NLUA 4XDDA 4ECVA 2W01A 2ZKUA 1S0OA 4ZVSB 2QLFB 3GZ7A 2BQ3A 2HQFA 5KFZA 3M1VB 4DPTA 3T1AA 3WZ0A 4DOZA 2M7SA 1DZ5A 3ET6A 4JV2A 2K7KA 3EE3A 2EFVA 2WOMB 5J1PA 1Q8BA 2RDDA 2FVQA 1RWMB 2YNHA 1U47A 4WFBQ 3B4DA 4QYRA 4K4XA 1U1KA 1FKPA 1RAHB 5HMXA 3C19A 5D0GA 2Y0SD 3MWBA 2NPIA 2GIFA 1WOOA 5F8GA 3MM6A 1DHMA 5DQHA 5J2PB 4UW2A 4O0NA 3KOAA 3W60A 2BBEA 4L75A 5IM0B 3PR4A 3HHLB 3D1OA 5A76A 1HI1A 1ZAWA 2DIVA 2E9RX 2V4JB 1NJYA 1HWKA 3TNVA 2HIQA 2BXJA 2B4PA 2VQFF 2PI5A 4OFZA 1SJQA 5B09A 4GO7X 3VWSA 1RT4B 1X0FA 4IRCA 1TFWA 3BQ0A 3BF4A 4FYXB 4B08A 1LK7A 2GMLA 3CCSS 1RAEB 2UUAJ 3QIPB 2DHSA 4O3OA 3PDNA 1QSLA 5EWEA 3Q0AA 2ZDOA 4E98A 1TMMA 4I7FB 4QOTA 2VV5A 3BM7A 2F8EX 4WIIA 3ZZRA 1J5EJ 1DFDA 5IZHA 2C22A 3MMCA 4AYBD 4C8KA 1LWXA 4WZQA 4GVBB 5F8MA 1QSYA 3FMWA 1SQFA 3RAXA 4DSIA 3ILJA 4RW6A 1CC8A 4DQIA 4F04B 4OJGA 1JB0C 1M1GA 2YQ3A 2RKIB 1J5OB 3RZAA 1YWXA 1OY9A 4CYUA 4X2BA 4FXWA 4A8OA 2UV8G 4KIAA 3H98A 4F0KA 3BYPA 3TVZA 2CPDA 1RTJA 4IR9A 2HKEA 3C6TA 4C2MA 5BYSA 3S8SA 4NCGB 2JLGA 2FJEB 1RHQB 4WZMA 3ZZTA 3G82A 4OI0A 4WP8A 4AXIA 2ZWOA 4E8UA 1IBLF 5I42A 2MHEA 4IUFA 3MUMP 3QPIA 1MU2B 1T9TA 1S0NA 1YTYA 4J9VA 1OQ3A 3F73A 2ROGA 3M2UB 5M2RA 3PX6A 3KG4A 2HAIA 3M8ZA 1WC1A 4J9LA 1LEOA 4P2XA 4C0BA 3W62A 1NK6A 1NSKL 4OV1A 2NXEA 4YDDB 5D77A 2XNRA 2C2ZB 2J6SA 3KHHA 4FPIA 3BGLA 3NGTA 2DRAA 1DRZA 1KQGB 5KFJA 1Q81T 1NKEA 1TQLA 4FN5A 4B9NA 2QO3A 4NI2B 4K0KJ 1CPZA 1SJRA 1R8BA 1F0XA 2LQJA 2Y1IA 2KVIA 2LA6A 5SZTA 2KJVA 1SIZA 4DV4J 5KT4A 4PG8A 1NBEB 3BBFA 1Q16B 1BQMA 3EJMA 2AJQA 3O44A 3EICA 1UL3A 4JB8B 4ANDA 4DG1B 1CQNA 2YWEA 5KFXA 2VQEJ 1TK0A 3R97A 2MY7A 4ZVOB 3PW5A 4LT6A 1UEUA 4KQZA 2ZH8A 4HYKA 1URNA 4AT1B 4W98A 4I1TA 4LRBA 4NA3A 3GR1A 4NMXA 4HHUA 2BJ8A 1VQOS 1E6YA 3CPWR 2NUUG 1SC6A 4PKDB 3VV2B 3KG1A 4ALZA 1F3VA 5BXIA 2BW7A 4R5PB 3P5TL 3OFHA 3Q23A 4ILRA 1NRKA 3QLHB 2KU7A 2YNFA 2NR0A 1SKRA 1Z2LA 2DKOB 4A47A 2FZGB 2FLLA 1UZHA 3KLVA 5L8RC 2VZ9A 3CDUA 2Z0GA 4DQSA 4KHMA 4I6AA 1PO6A 4NCBA 4BC9A 1TFYA 3ZZUA 2HFVA 4EK2A 2HNYA 4FYWB 2OP5A 3QT7A 5KFNA 2QA2A 1FRMA 2HVDA 3A3OB 5C42B 4WFNQ 3FZBA 1JLAB 1Y10A 4UOCA 4IRKA 3P3DA 1FNOA 2G0CA 3CMES 1TV6A 2CQDA 2GQQA 3RW7A 1Y11A 3TVYA 1BQNA 2C2MB 1BD6A 1QAJA 1PCAA 5D4PA 3TZWA 3NY0A 4Y2CA 2B7CB 4NLVA 2F4VJ 1VGYA 1FF2A 4ICLB 4O3RA 5KFMA 4KTQA 3RB6A 1YITS 2WTFA 4ED4A 4RUHA 1RT2B 5C2CA 2AYEA 1T9XA 2C42A 1OWXA 3M9OB 2MSTA 4E2FB 3J7ZT 2J0XA 1M0SA 2IMOA 1WKLA 5DGAA 1YJNS 4P2FA 1L3SA 4LFCF 3L7PA 2HBYB 1FWKA 2GMJA 2W9CB 3BEGB 3TI0A 3M8SA 4DF8A 1RLCL 1MMDA 2UU9J 1K0VA 1HNXF 3GFYA 3A8IA 3CJKB 3QAUA 5AT1B 3I9V9 1WHWA 2YTCA 2OJ3A 2M3DA 2C2RA 4CDIA 4L76A 1DBDA 1GFWB 1N88A 3LF0A 3JAMY 4KBIA 4EBEA 2LQ9A 3SQGB 4LRDA 2DCLA 2PFDA 4R0EA 2GZOA 1KVIA 3HT0A 5K9FA 2DR8A 2J0QD 5KFRA 1LW2A 1Y00A 1IWAA 4M5JA 2ASDA 2FHOB 2CA9A 4ED0A 4F50A 1TL1B 2IYIA 1VC5A 5CD4A 4ZP7A 3J80U 3LP0B 3G6XA 1X4CA 3N5FA 4DCJB 5IM0A 1WC3A 1T9UA 3M8WA 4ER8A 3D0GE 4OZ2A 3MEEA 4FDFA 2NSCA 4FZVA 2LQ8A 2UUTA 3PFOA 4DFKA 1RT4A 5CCLA 1UZDA 4Q44A 1IKWA 2B9YA 2EW9A 3TAPA 4UQGA 1YLXA 3OL9A 1PSDA 4LFBJ 4DR7F 1RWNB 2HW3A 3HCXA 3CF5Q 3HHEA 1NK9A 3IG1B 4Z37A 2CNLB 3HJFA 2PD1A 4RUAA 3KDNA 4TKTA 2RRAA 2HK3A 1R43A 4WIQA 2CNOB 2VBZA 3HPOA 3JTOA 1VIOA 3FFIB 1GAOA 1HARA 2X1GA 4WFXA 3NLCA 2CG8A 4WU3A 1S6UA 4LUBA 3HFZB 3G8SA 4FXDA 5A8KB 2DCUB 3SSRA 3DMJA 4MYTA 3RR7A 3KTQA 1AFIA 4CH0S 1HFEL 1NJWA 1LXJA 4YR0A 1RADB 1GTHA 2AMCB 3M2RA 3JSBA 2EBGA 1HD0A 1LV5A 4PXCA 2MQNA 3H90A 1OQ6A 4DF4A 4WE1B 1PAEX 1BXNA 1C1BB 1HHQA 4IG3B 3LAMA 1XR7A 3QWPA 2LCWA 2BMBA 1RT1A 2ZZTA 3KLEA 3KG0A 2AWZA 4LF7J 2VJVA 5E3PA 1AROP 1FXDA 1MU2A 3N79A 2DHAA 4CM0A 3EX7B 2L41A 3MCMA 3GFHA 2DGUA 2I5JA 4DLGA 5C25B 4A8SA 1DJ0A 4Q0BA 3KJNB 5A0YA 1KHVA 2QL7B 1FEEA 1P8GA 1KWMA 3K17A 2GW8A 5MLCV 1RKIA 2KYZA 4G1QA 4MIWA 3VAIA 2AJ0A 4NYZA 4R8UA 4UT4A 4YN3B 4NYOA 2WBRA 3NMAA 1V5VA 3MUTP 5K14A 4QIEA 1MG7A 3KNGA 3W2VA 3B54A 3CCRS 1SJ3P 2ZD1B 2ZH4A 5I3PA 2VG6B 2HMIA 2H3EB 5IOLA 4MT1A 1R8CA 2BE7D 2A2DA 4PCQA 4JUZA 2CQ0A 2O67A 3BPDA 4KGZB 5E3QA 3AH6A 4P71A 4CO2A 2CDQA 3DLBA 4DZ6A 1IJEB 1WOPA 3E01B 3MOZA 3QGPA 1YRXA 5K8MA 2P9EA 4TQRA 1HQEA 2CADA 4DUTA 3LGMA 2R7XA 4DLEA 2ZJQQ 5ETRA 1HNZJ 1KLMA 1IUJA 2BE2B 2KTQA 1U1OA 1Y5LB 4QIGA 1SV5B 2LXUA 2ROPA 4DS5A 2X1AA 2SXLA 2KFYA 1YRUA 3AJ1A 3CCVS 3ZXWA 4DV0F 4JI4J 4LFAF 4F8RA 2XBPA 2MKJA 1WHXA 3T1HF 1VQYA 3PYEA 5GADI 1NKCA 2FPHX 3M8QA 5E3CA 4Y2KA 3HFVA 2P6SA 5E2QA 3BBCA 5GAGI 4K4UA 1U1LA 4DFMA 4DL4A 2A6MA 3WC0A 1VQNS 1D09B 3JAMU 1NKBA 2AV5A 2G13A 4RNNA 3DRPA 1BC6A 1WORA 3NMRA 3GG1A 2KRRA 2RUSA 3AODA 4XPEA 2J7KA 1CS4B 3IWXA 3K58A 5D15A 3HHNB 2VA2A 2YH1A 1N5YB 4RUBA 3IMQJ 1F3FA 1CJVB 2Y8WA 3HVTA 3K5LA 2PC6A 2B5JA 1CJUB 2AZ3A 5GVQA 1GT8A 1VLYA 5IT4A 4JI2J 2J8AA 5HP1A 3R7SB 2JRSA 2FY8A 3UW1A 3MM5B 4NLOA 4JYAF 4LF4F 1FE0A 4JI0J 2YKQA 3I82A 1HNXJ 2X3DA 1HBUB 4Y28C 4H4KA 3J7AN 3ILOA 2XI3A 2V2ZA 4O0IA 4N76A 2N7CA 2BACA 4DMZA 1VQ8S 1HNIB 4K2XA 5C24A 5CH7B 2M70A 1R27B 1KS2A 4CP5A 4U7UK 3Q2SC 2YWHA 1U0HA 1G2EA 2BJ3A 1NHVA 3QZ8A 4Y3CA 1YGYA 4PG6A 1DQAA 5GADU 3CJSA 2WONA 5IWAJ 3E3XA 2OPQA 4HH1A 2XS2A 5A8WB 4I2QB 4YB1P 4DV7F 5T7LB 1FD2A 4NL5A 2EFQA 2QT7A 4P52A 3QYYA 2IVMA 1HWJA 2NQPA 4UZBA 1FNXH 1VHFA 4A8WA 4ZKAA 1SH0A 3WC2A 5IFMA 3BR8A 4OYMA 3CJ3A 4MKVA 1KQFB 3HLUA 3MAQA 1KVJA 4DWIA 3H25A 4WXWA 4DN9A 2RNEA 4A48A 1S1VB 2ZE2B 2YX1A 2AYMA 3CDEA 3UDEA 2AGPA 4EWTA 3JYTB 1WUUA 2Q3PA 2Z2MA 5JVGQ 2QX0A 2YH0A 4CLTA 1RA7A 3MGJA 1RTHB 4ZK7M 3K8WA 1SH3A 3CTRA 1VK8A 3QJJA 1QSSA 1S76D 1QVFR 2UVRA 4L72B 4CWBA 2XYHB 5C7PA 1HA1A 2EBEA 2CIMA 3RRKA 3G8TA 2HRTA 4U96A 3UQSA 1JWWA 4ZPVR 3D1HA 1VC6A 2QV6A 2QC3A 3SQOP 3ZZPA 2O5DA 1SL0A 1HPZA 2E9TA 2OD6A 1RJJA 4JV1A 1NSAA 4RUCA 2LU2A 4AQYF 3NNCA 3ISNC 1FI4A 3QGHA 2ZM6F 5CA5A 1T05B 2VFSA 3JQKA 5HMYA 3UPFA 2XLJA 1FTRA 4O3PA 1WEXA 2ROEA 4CO0A 4NWBA 1OMSA 2J9DE 2DXDA 4DZDA 1FVSA 2MTLA 3AD8C 4F3OA 2XHWA 3FFIA 5ETSA 2HBRB 4L74A 1RKJA 1FXRA 3ZC4A 4PEOA 4NOHA 1VQ9S 4DUZJ 4OJ1A 4NLGA 4LQ9A 3ZTPA 3WBZA 2XCAA 3TARA 1S59A 1EP4A 4DV5F 2HWTA 3EDRB 2RH3A 4X4NA 3M8PB 2I1RA 1FNMA 1ZPVA 2QYGA 3IRXA 3NG8A 4RNHA 1OPZA 3DHXA 1GH8A 3BQ2A 4BWMA 3K5PA 1SUQB 2C2KB 4X62F 1DLOB 3K8VA 3THTA 5HROB 5DM6Q 1CC7A 4USKA 2VU5A 3D67A 1B64A 1YJ7A 3QO9A 3OR1A 1HBNB 3CJTA 3G9CA 3H5XA 4CLWA 4N56A 4C9DA 3PHTA 3F56A 2DNHA 3GCXP 1IKYB 2BKOA 4KKOA 3HFKA 4GKKF 1B99A 4O3QA 2R2UA 3OFFA 1OJ4A 2EG1A 2GAHC 1XMOF 3UD4P 4NEZA 1NK0A 3MMBB 4M5IA 4DR4J 2VPZB 2LEAA 2XEXA 1SH2A 2NZCA 2MQMA 4NZ0A 3HO1A 2VC1A 3WIUA 2E5LJ 4ZVRB 1XMQJ 2CQ1A 5AE2A 3FSXA 2DGXA 3KHRA 2C28A 2KHDA 2LXFA 1X31C 3S7RA 4LFAJ 4XPCA 4B3OB 5FLXU 4I4BA 4DL6A 3QRPA 1OYDA 2J9EA 1AA1B 1VR6A 1GNKA 4NXNF 2KM8C 1U24A 4KHPJ 4TYAA 4Y34A 4H4KC 1PC4A 4LF2A 4OZ0A 4ECQA 3D6FB 1YRTA 4KRWA 1FESA 3IM8A 1BY9A 1PAUB 2HQCA 4XAKA 5KFIA 4LF8F 1NU4A 1KTVA 4IQMA 2YKOA 4MJKA 2KZMA 4C48A 2V0NA 1UAWA 2CAJA 2I0XA 4ETZA 4IO9Q 3NGUA 4JI6J 1WWHA 3KLIA 1EX8A 3PX0A 4L6V3 2P6TA 3AY0A 1M90T 4M5DB 3L4BC 4DR1F 1J27A 1R8AA 1YX2A 3QWUA 2VG7B 1FKOA 4P2MA 1Q5VA 1GX6A 2CQ3A 2JFKA 1GXUA 4Q45A 2EFGA 2OPRA 5DDQC 3D6TB 1FHTA 1P27B 2XGPA 1D3WA 1PYSB 2HHWA 3I4HX 2Q6BA 2MQLA 4I6YA 3P4UB 1HHSA 3J7A1 4YMEA 4OHXA 1HHTP 5HATA 1SPBP 1WSRA 1GEHA 1RUSA 2FC8A 2CJXB 3SV3A 3HHLD 2B51A 3AB2B 5AXMA 3N28A 4LRFA 5F9LA 2XM3A 2XULA 4U9RA 2PFFB 2MLZA 3AD7C 4Y2MA 2HS3A 2P8IA 2XHCA 1FFWB 2XMMA 1LNQA 1S10A 2W4DA 2MKCA 2RB7A 1NK4A 3C66A 1DAXA 3TZYA 3AOAA 1REGX 2E1CA 5JMNA 2C3PA 2LLZA 5KG2A 5KT5A 5EGYA 1CULA 2MZSA 5A6WA 2JEIA 1UVNA 1HYSB 2D9PA 2FZKB 3N6MA 1FXLA 2DK2A 2G9OA 3MM8A 4B3TF 3PKYA 1YKWA 2FVPA 1NZAA 3RUBL 1BHNA 4A8KA 2KRBA 2ZBPA 3QFHA 1JKHA 4R0JA 2R2RA 1U2RA 2UUBJ 1H73A 4LF5F 3B78A 5HMWA 1S1TB 1LQ9A 2XZTB 3TAQA 1C4AA 1I5OB 3FQKA 1LWCB 3ILLA 4EUVA 1M1KT 3HF5A 2N4DA 3M30A 2QEXS 4F2SA 2HFNA 1PYTA 4TU7A 1V9OA 2B0GA 5H1SV 2GFFA 3BSNA 3PW4A 4B9SA 3C14A 1ZAXA 2PN6A 2G2ZA 5DJBA 5I3UA 3IGVA 3A3NB 4RWXA 3FCVA 1EETA 2GNKA 2J6TA 4PQAA 3MMJA 2G0IA 3H42A 4LF9F 3GJRB 5HANA 2P5VA 3P8BB 1HWIA 3D4JA 4HVZA 4F2RA 3CJQA 2VFRA 5B0CA 4WKYA 1S1WA 3MPUB 3T9NA 4ES2A 4ZJQA 3GPAA 5D4OA 5KFCA 2BRKA 3ISND 1NK5A 1TUGB 4HDHA 2EWHA 1VBYA 4WU2A 4DQPA 3ITHB 2O3DA 2IRUA 3PO4A 3TANA 1CLFA 1S7HA 2JX2A 3DOMB 4O44B 1FE4A 2HS0A 3K57A 3R1LA 3DNCA 1SXLA 1GMWA 4DV5J 1WD6A 4F4KA 1I1GA 3V4IB 2ADCA 2DB1A 1N36F 1TK5A 2WZ1A 1S6QA 3CD6S 3VCDA 1RTIB 5CABA 3LWMA 4LSNA 3FMBA 4RW7B 1WHVA 2L9WA 1TL7A 5LM7E 1UP1A 2Z2YB 2MJUA 2AEMA 3QRRA 4Q5VA 2CJAA 5F8IA 4OIXA 4BHQA 3PACA 4RWWA 1T9VA 3OL8A 3CGIA 1F1BB 4FP9A 5E5NA 2KL8A 8AT1B 5K20B 3KUHA 4ZCKA 2CZ4A 4J9UE 3TA1A 3GYXB 3M8PA 4USUA 1SCJB 4DCOB 3Q8YA 5LXYA 1HNVB 3C15B 4AXJA 1F9EB 3HKWA 4DR3F 1ZA2B 4EYIB 1WTFA 3MOJB 4K4WA 1UVJA 1IQZA 9ATCB 1SUQA 4RLEA 1DLOA 4N41A 5HROA 3IC1A 2XMWA 3OTOF 3D54A 3VGUA 4URGA 4K4TA 1R7IA 4ID5A 4J9NA 2CJKA 1T9YA 4N47A 2D3UA 1Y5NB 2QMUB 4USTA 2JDJA 4CLFA 4CH1A 1B70B 2B8PA 3GG0A 2VASA 4P74A 5HBMB 1XN9A 2Q1LA 1N33J 3TA0A 2GQ2A 1JXEA 4NLTA 1X8DA 4P7TA 4TXSA 1IM4A 3BDEA 3TR5A 4LF8J 5GAEI 1UFKA 1DTTB 4DN0A 1JLBA 2IRXA 3QQCD 3OFGA 2RRBA 1CQMA 3DGVA 4OHVA 5GAHI 1H2UX 5KFGA 2PE8A 2ASJA 3MEGA 5J2NA 2HS4A 2H5IB 3CJRA 2DGVA 3MF5A 1G6BA 1JLFB 4IKAA 5L1IA 2OGUA 3TA2A 2KXFA 4Q43A 3F0NA 2V5HG 2C2OB 1XNQJ 4U67Q 1GTEA 3C2PA 3M6XA 3BREA 1SQGA 2V2VA 2J8SA 2R8GA 5KFLA 4ELTA 3RR8A 1K8AT 4HTJA 1N5QA 4ZCLA 3W5ZA 3DLHA 4X84A 2KT2A 3D28A 2DNKA 2KN4A 2GGPA 2FLOA 2ZHOA 3TRGA 1WKJA 3M7VA 1WC5A 1Q78A 3VVTA 2AX0A 1RYRA 2IDLA 1X4HA 4DV6F 2KXNB 2LVWA 4DL5A 3OT9A 3DYAB 5H9EJ 1NB7A 3T6BA 3IA0A 2H5EA 2LEBA 3TYTA 3FK4A 4DQRA 1JIHA 2YVSA 2WSFC 2I8EA 2QLBB 1S72S 5GAEU 2YPZA 3I4PA 5B0AA 4B3SF 1Q8LA 4KO0B 2DY9A 2ZUGA 1M5VC 4EMDA 1C2PA 5IC6B 4X65J 3JSMA 1X5OA 5GAHU 3NGRA 2XSJA 2CYYA 1Q1KA 1A0OB 4RNMA 1MROA 2HFZA 2GIRA 4AUKA 3TQEA 1S7IA 1R6VA 2AGQA 2NPFA 4RW4B 5DM7Q 4LF5J 2EFOA 4KY3A 2FVSA 5KFAA 1HD1A 3FVYA 1XC9A 3OV7A 2BRLA 3V4MA 3PZPA 2BM1A 4IQXA 8RUCA 1Q79A 2W2MP 2FJAB 4ES3A 2RD5C 3GIKA 1HL6A 4QIFA 5B0EA 3T6JA 2QG9B 2RQKA 2AU0A 5KT2A 4NXMF 2FGCA 1NXIA 4DEZA 3B8HA 3KDOA 3UR0A 1F6TA 4GRSA 2P9CA 3BN4A 2C3MA 1RT6A 1RT7B 2XSFA 2R7WA 2FLNA 2JC0A 5DQIA 4H4OA 3HSZA 3C16B 3EPGA 2VC0A 1RE1B 1B7YB 4OZ3A 1FD8A 3R2CJ 2K3KA 2WHOA 2V9WA 1LWCA 1MW7A 2E5HA 1T9WA 1NH8A 3HZGA 1B0PA 5D0HA 4K4YA 2ZC4A 5A8RB 4FPRA 5LMNJ 5CYQB 1LWFA 4I56A 1SBRA 1ICEB 2YX4A 4FS1A 2DR7A 2QA1A 2UUCF 1YVFA 2RJZA 5ADZA 2VOOA 2ZH6A 4UUXA 3DXSX 3MR3A 4X64J 2LDIA 3VAGA 4K8RA 3EZ5A 5L9NA 2OSRA 2RQCA 3O3LA 5HK4A 3BGUA 2HHHJ 4I6WA 4HL9A 2EK6A 3GONA 1GQEA 4G1IA 1X4FA 3Q83A 4Y65A 3AOCA 3NBPB 5AXLA 2B4OA 1V5IB 3BV8A 3PYDA 2I6WA 1N5TA 2XO7A 3KJFB 5HSPA 1NSPA 2HURA 1R6YA 1ITPA 5F8HA 3AXKA 2OEJA 3DOMA 1V3RA 5B0FA 2BYCA 1KONA 3R9LA 1D0EA 2VFVA 3ZZZA 3DDNA 4ED5A 1RBOB 3JQMA 3V4IA 1UJ5A 3HDSA 4X4TA 2C3UA 1RTIA 1AUSL 4NE9C 1TAQA 2RDIA 3B4MA 4ED3A 2HNZB 3ELHA 2YNIA 3FDSA 4V1Ak 3NAHA 5IC4B 4HI1A 1TKZB 4ZCMA 1N32J 3CB4A 5IV4A 2XWYA 1VRUB 1D1UA 2QIFA 1EKRA 2AJ2A 1T03A 4H54A 3OTOJ 3RBDA 4HT7A 3PXGa 2WW8A 4NPOA 1UPPA 1K73T 4KGXB 4H4MA 1FJGF 1KBRA 4X66F 4CLLA 2QLWA 4GC6A 4A8YA 4DL2A 4LBPA 2DVIA 3KK3B 3RRGA 2MYFA 3MD1A 3BO3A 2MZQA 2AZ1A 2W24A 2PA3A 2B6AA 3W7BA 2M2BA 4PUOB 3LANA 4OX9J 1Q82T 1UWBA 2HZAA 3GTYX 4B3MF 4M5LA 1Y7PA 1RCOB 1VS3A 1QUVA 3D68A 4O3NA 2B3TB 4CT9A 2R4FA 1HW8A 2UUWA 2LA4A 1JLEB 3GQCA 5IT9U 3W5YA 4K4ZA 1E6VB 4RNFA 1ZPWX 3QGIA 3FRZA 3MTJA 4E0DA 2HBQB 5FDLA 1U26A 2UXBF 8ATCB 1HNWJ 2O1PA 3GV8B 1GXLA 3DOLA 4U7UD 2CQ4A 2BA9A 1I94J 2BJ7A 5HVFA 4QU7A 1F5CA 2RQMA 2XQCA 2MB0B 1L3VA 3FCWA 4AL6A 2G2YA 1S0VA 5BR8J 1VRTA 4P6QA 4KFBB 4C3LA 2H48B 2RHQB 2PEHA 4PPZA 4ZPBA 5HL7Q 3PX4A 4KC5A 1D9FA 1IKVA 3WDOA 2WVBA 1S9EB 4Z2XA 3MURP 4K7QA 3C6UB 4I2PA 2UXDJ 1T02A 1XNRF 3RW6A 4UOFA 1HQUB 4USWA 3F41A 2MKKA 4FF3A 1S9GB 4UTGA 2ZDPA 1U1PA 4A8QA 2K1RB 2EPIA 1FDAA 3LALA 4ECTA 2QMWA 1TR0A 4ILMA 4Y0FA 2R2SA 2C2NA 1N34F 4EBDA 2DO0A 4B3SJ 1T7PA 4MFBA 3DLEB 2GJFA 3R5GA 2F40A 5HQMA 2MKYA 3UN5A 2GX8A 1MSWD 1S6PB 1SI9A 3EWGA 3HVWA 2ZBQA 3E2EA 2F65A 5EX0A 3DRRB 2YXLA 3GIMA 3GFZA 2LFVA 3NGDA 1KP6A 2DNLA 2LMIA 1ZAVA 4KE5A 1H2TZ 5KTQA 2QL9B 2GCFA 2NSBA 3OTDA 1F9HA 3H7HB 4TNOA 5CYMB 1FJCA 2KHCA 4C97A 4DSLA 4ECUA 2HQDA 4DV3J 1N52B 2B9XA 2DYAA 2KT3A 4LIWA 2HPUA 3KK2B 3DU6A 4C4WA 3TW0A 1TKTB 3W2WA 4X4VA 4RBUA 4OMFG 4EBCA 4WJBA 1RISA 1ZYQA 4TLRA 5KT3A 1WDDA 2XTJP 3BN7A 1VJQA 4ECXA 2FHJD 3LP1A 2IC3B 1S97A 5GMDA 3DI6A 1U1MA 3IBWA 3ETOA 3PRBA 1RAOA 1TMJA 1TL3A 4TN2A 1K47A 1LWEA 2DO4A 1ZM2A 1IR2A 1H6KX 1FO1A 2CQBA 2UXCF 3L95X 1N5VA 4USJC 2HQ3A 3DFEA 4WFZA 4PWDB 1OSCA 1JXLA 5KFUA 2OD4A 1WC6A 4F02A 3V6DA 4UY8T 1N5SA 4ES1A 3J81Y 4KR0B 4YY3J 2OSQA 5LOQA 2V6AA 2IMWP 2K3IA 3MM9B 2WAQD 3PEJA 3MR7A 4NRTA 4PWWA 3T3FA 2C2DA 4OI6A 4OHZA 2BX6A 2OO4A 3KJVA 1RHKB 4TU9A 2HVIA 3MAAA 4C3MA 2F9DA 4QWCA 4AFFA 2YKMB 3PO5A 1U2CA 1F2HA 2OTLS 3PW7A 3DGPA 1YK9A 2R7TA 3EYZA 3DLLQ 4YR2A 3BPSP 3UFCX 2DHHA 4PABA 3G71S 4URSA 4IOBA 4A46A 3IP0A 3R6GB 3UN3A 4GMKA 5SUHA 3LP2B 1U09A 3D0IE 4RO0A 5F9NA 3N01A 4IG0B 4NLDA 4ZJOA 4ZLPA 5J2MA 3FJ2A 2VBYA 1ZZNA 2AD9A 5I3QA 5AJ3F 1U25A 2BEFA 2CPFA 2EG2A 3EXCX 2PO4A 2V8HA 1HKAA 2A1BA 3RYLA 2HZVA 3THPA 1JQGA 3CCMS 4C8ZA 2Z30B 3U1LA 4X66J 4OYZA 1NO8A 3T19A 3KLFB 4OI2A 2IA0A 4KH1B 3CUNA 2FJWA 3NOGA 1RT5A 4LBIA 4YS2A 2ZVSA 4OI4A 3RG6A 4HHHA 2W9BA 5D3GB 4CO4A 2CQGA 3R5JB 3TVKA 1AZSA 4F3MA 1C0TB 4GVLA 3AJ2A 2VOPA 2YKNA 1W26A 3M4XA 1CJTA 2YWGA 3W66A 7FD1A 4LQ3A 3PRVA 4ECRA 2UVWA 2FD2A 3UDCA 1VYAA 1X4EA 4MKYA 5D4LA 4ZPTR 3VAMA 5MAOA 3TO8A 3A12A 1D9AA 3ILIA 3PCOB 3UO0A 1U1NA 1VQ4S 1Y5IB 1LKZA 4WK1A 2ZVIA 4C11B 1YIJS 1F2GA 5LL6d 3D6HB 4RJVA 4UQTA 1W2BR 2KZZA 3O6QA 4ZPAA 2LXIA 1S1UB 2OEMA 2HNDA 2V8PA 5ETQA 4CIOA 2KYXA 3OJUA 1R0BG 3SCKE 4TLQA 4JI5J 2WVDA 1RAFB 4RW9B 4LSLA 1HR0J 2DNMA 2DXFA 2ASLA 3D3BJ 1ZS6A 2XS5A 3IFEA 2ATCB 2CJQA 4MH8A 2Z2ZA 2VPWB 2JOQA 2BANB 4C8NA 2GV1A 3DHWC 2RILA 1DY3A 3KK1B 1QE1B 3U27A 4J9MA 2AKWB 1XWLA 4FF1A 3I5CA 1TVRB 4JI1F 3Q89A 2E1MC 1YZ6A 1TKDA 4V19X 3D66A 3ZO7A 3CO0P 3M2VB 4J9KA 2M0GB 1YHQS 3GMGA 4DFJA 3S01A 2CQ2A 2YNGB 2ZUAA 2XYGB 1B0VA 5B0DA 1JX4A 2DGTA 4L3KA 2HK2A 4RPFA 1N34J 2UP1A 2ZKTA 4ZS6A 1QD1A 2HEKA 4DU7A 1YI2S 3MM7A 1C1CA 1X5TA 3GU0A 4OX6A 3V81B 5M2PA 4DCPB 3THVA 3JTNA 5KFSA 2ALZA 2EVZA 2AEJA 3AFGA 2HBZB 4IDKA 4MMOA 2VF3A 5BJRA 3CCZA 3ZNUA 5D0EA 3IN5A 1CSJA 1UMJA 3UVJA 2BKPA 5LMUF 2G1HA 3FNNA 2OPPB 2NYHA 3CMQA 3CC7S 3QJPA 2CPYA 4QCLA 4DX5A 4LF6F 5G0RA 3B6BA 2H65B 4X4QA 1NDLA 2AQ4A 1C4CA 1VQSA 2RMLA 1N0VC 4OJ3A 2V4QA 1REVA 2DY1A 5ETNA 1P1LA 5HJYA 3DLEA 1D9DA 3BSAA 3J80Y 1KRPA 1SC3B 3A3PB 3W5XA 5B08A 1FT8A 1S6PA 1PG5B 3CVKA 3O5TB 4OX7A 3J81U 4RU2A 3H2UB 3OXFA 1FRJA 4FF4A 2WSCC 3SV4A 4X4UA 4NASA 2K8GA 2HFOA 3M32B 4DSKA 3ENQA 3D5MA 2GVDB 1ZM4A 2DR9A 1HMVB 4PG4A 3HSDA 4JOUA 4YQWA 3T1YF 3OXGA 3DLKB 1WDTA 3BGOP 3CCWA 2IM2A 1JLCB 4CT8A 4QZVB 3G87A 3ADAC 2EEYA 3HMJG 3WIVA 3Q8VA 1W7WA 2HQIA 5ITHA 4RW8A 1RTDA 3BH7B 1S57A 5KFWA 4L3NA 4IRDA 4JI8J 3HHDA 3KYLA 3I6PA 5KFTA 4EU0A 2DH9A 2DNZA 3J7YU 2VHGA 1R89A 2MLXA 3KK2A 2HHTA 1ELOA 3H4BA 4IOCQ 1TKTA 3OLAA 2PDAA 1RAAB 4JI7F 1NHUA 2J7UA 2OHDA 2RUGA 3RRHA 2RAQA 1SKWA 1S49A 1RZMA 1NHKL 1ZZFA 1RHJB 2QTWA 3E51A 4FYYB 3TX0A 2WVEA 2LQ5A 4QR0A 2W4CA 2R8KA 3LAKA 4Q2LA 3HULA 4XDCA 4YFUA 4DR2F 2ACMA 4HDGA 2YWKA 1JLQB 3DM2B 3A8KA 4N77A 3BGRA 5DQGA 5HLFB 1AB8A 1JLGA 3OBIA 3CW2C 3U1NA 3MPWA 2VB6A 3R5CA 5FIIA 4DUYJ 3I9ZA 2RF2B 2R7RA 4AE5A 1HQ2A 2YQ1A 4DR6F 1FK9B 1UJ6A 4CLSA 5JVHQ 3MECB 4PQUA 1DQ8A 1CG2A 1HBMB 4M95A 4W90B 3PM9A 4P73A 2DRBA 4IFVA 1XR5A 1R0AA 1TU0B 1BE4A 3PKMA 5KT7A 2IAJA 2DD8S 4MKAA 3IS9B 1G3OA 4F4AA 2Z2LA 1NDKA 1XQIA 4Q8EA 2R7VA 3ENAA 3IRWP 2ERRA 4HACA 1KR4A 3MEKA 1UA0A 2DEIA 3POTB 2WB1D 2BQUA 3CJ5A 4DR5F 3I0RB 4PYDA 3LP2A 4CTAA 3EGWB 2R9LA 1UVIA 4PG5A 2DH8A 5LSRA 1OIAA 3MMAB 2W2NP 3OUYA 1K44A 1H7XA 3H5UA 2VG5A 6AT1B 2YWFA 3W64A 4J37A 4JI3F 4M63A 3SEOA 3I56S 1RT3B 1KOHA 4UOHA 1T0TV 1RWWB 3CD5A 1RLDA 3ZFVA 4UUWA 2ZH5A 5J2QA 1RABB 2RT3A 3GFXA 5L1LA 2MGZB 1ZM3A 3DLGA 2W8KA 1ZETA 4G6VB 3P49B 4P10A 1DTQA 3GIJA 5K8NA 4M5HA 1C0TA 1TELA 2EC2A 1LW0A 2D41A 1HBOB 4O4GA 3PIPQ 1SJ4P 1IKXB 3X1LB 1VRQC 3V2UC 4J91A 3H20A 2CPXA 3SDEB 3KLGB 1CJKB 4WTOB 4ZJLA 3K5NA 3M1VA 1U7LA 2OTJS 2I9SA 2ZH3A 1FTCA 4C11A 2VQFJ 4V19J 4UZCA 2ALYB 4DPOA 3MCSA 2W7OA 4DV1F 1SQEA 2WOMA 3CCLS 3WHIA 1ACMB 2F9JA 2B9EA 3LQVA 2QA4S 4UF4A 2BJDA 4K2JA 2E5JA 4ELVA 2W2PP 2IVYA 3VZHA 4NZ6A 3ET6B 1RSCA 2VDIA 5L38A 5J2PA 1X7VA 2DH7A 2JWNA 3V6JA 1VLOA 3HHLA 1TK8A 2HWIA 2YNHB 3BZQA 2CQIA 2BJEA 2V4JA 3UD5A 1FKPB 1GK8A 2DNQA 3NS7B 4NRUA 4RBTA 3KK1A 2CKWA 4I69A 2F4FA 1XTZA 1QY7A 3SCJE 4IOAQ 3MM6B 3WX8A 4IFYB 3C46A 1TVRA 4P75A 2JEJA 2ZEJA 3IGNA 1MMNA 3N9UC 1JNRB 3QIPA 1V6HA 1XR6A 3RBZA 3W63A 4ATNA 5J1EB 2JVOA 4ECYA 4I7FA 2MSSA 3B82A 3GIRA 1IVZA 3GV7B 5HAOA 4ED2A 4WK3A 1XJWB 4F4YA 3FC9A 3QRQA 2KJWA 1IBLJ 1X4GA 2KB2A 1D8ZA 4GVBA 1RWOB 2NLWA 5D78A 2FHMA 1OPIA 2J5AA 3CJ2A 4XK8C 2NZ4A 3LH2S 4K50A 2RKIA 3FBEA 1NJZA 1J5OA 3CD7A 3MMCB 5DLGA 2E1RA 1L3TA 1KN6A 5BYQA 2IJNA 4IO1A 2OI2A 2R7UA 3OHBA 3I96A 3PVXA 2DGQA 4I67A 4B17A 2HGLA 2K2PA 3CJ4A 4Y6IA 2KO1A 4NCGA 2A6OA 4LRAA 4NYPA 3UDLA 5KG3A 2JLEA 5KFDA 4CYUB 2QMXA 3ZTOA 2UUAF 3CC2S 4ED1A 2D9OA 1Y4ZB 1RTJB 3M2UA 2JL9A 3ZZ0A 4DQQA 3C6TB 4JI7J 2KDOA 1J5EF 4QIWD 3CNQP 3HD1A 5DDPC 2KH9A 1KNZA 3G82B 2EK1A 3BSOA 4QPTA 2MHNA 5I42B 2GVDA 4OX8A 3JS9A 5CYJA 4I0WA 5ETOA 4X4OA 1QAYA 4DFPA 4D3GA 3NCPA 2ZNZA 3GCWP 2WBMA 2OKQA 4NI2A 1FDBA 2GQCA 2E5GA 5L39A 3V6KA 3W3SA 5KG0A 2VICA 1BLUA 1L5UA 3O1LA 4HLBA 2R8HA 4CLZA 1CVJA 2HHPA 4OJHA 3BYRA 3SMZA 4HR2A 1WC0A 4KAIA 4DG1A 7FDRA 2MZ1A 1M5OC 3PW2A 1R3NA 2MY8A 5KG7A 1B3TA 1GX5A 3QFWA 2E1PA 3TAMB 1SC1B 1HI8A 2XCPA 4BBYA 2JNJA 1XEZA 2DNRA 1BQMB 1QLNA 2XMVA 5E0OA 1JJCB 2R2TA 4CLUA 3BS9A 5DO2A 6FD1A 4PAAA 3R5AA 3DOKB 3VQTA 3KKFA 4R5PA 3UCGA 2VH7A 2Y0BB 4PXDA 4MK7A 4ZPWR 2BDPA 1GMUA 1MWQA 4F0MA 1VDHA 2V50A 2EXUA 4K0KF 1I3OB 2OMOA 2CNKB 3QLHA 1JK9B 1PKUA 1G1XA 3W9JA 3GE9A 1E6YB 1ZA1B 1X4BA 3G96A 1LXNA 2XO6A 2JH3A 4DV4F 3T9ZA 4ZA1A 4IYQA 3VAKA 3U02A 1FWPA 3LPYA 1EAYC 1S79A 1S4EA 3QGGA 3AT1B 2ZJRQ 2VQEF 2YNFB 2ZZNA 2VBXA 2QA4G 4WCEQ 3MPYA 2V8VA 1M5HA 3H2VE 5C42A 1JLAA 2KKHA 4LFCJ 1WEYA 2QLXA 4PZVA 2MZTA 4L73A 2E44A 5FLXY 3QT6A 3T5KA 3PFEA 3MTKA 3HHLC 4DPUA 1YJRA 2HNYB 4NLQA 1SL1A 2IPOB 2RSQA 4ICLA 2CPHA 3BO4A 4IH5A 2NS1B 1RT2A 4N8OA 1TV6B 2D3OR 3VAFA 2BJ1A 3OVAA 2FQQB 5CD4H 5F8JA 1BQNB 2RS8A 3SCLE 1LFPA 1AW0A 3L09A 2MGZA 4CO1A 4M5KA 2JC1A 4GO5X 2PMWA 2Q43A 2NXNA 5HVHA 3G6ES 5CCMA 3FKBA 2IY5B 2W9CA 2ZH9A 2ILZA 3EZUA 3CWJA 1M5SA 5K8OA 1B7FA 3TZZA 1M5PC 1H74A 3HD2A 3JXOA 4NLXA 4YP3A 5BYRA 1XK8A 4C98A 4P72A 5KG6A 3ETMA 4ZP8A 2GJ2A 3CJKA 4ECZA 3D1QA 2VFTA 2Y3YA 3BR9A 3Q86A 3HKZD 3U1MA 4ITSA 1YZ7A 3MDFA 1IQTA 1FFGB 1EIYB 3SQGA 2OEKA 4NX9A 1NPRA 4QPXA 2DITA 2H1YA 3K59A 4DR7J 4A8MP 2FVRA 2F4VF 1JJ4A 4N8NA 1TAUA 1TL1A 3L3CA 2FLPA 4OYOA 2IM1A 1RA6A 4RX6A 3LP0A 5F8LA 1URRA 1X4DA 3EGNA 2I38A 4HHJA 1NCLA 2OH2A 1LW2B 4YDXA 2F1FA 4I64A 3IR6B 3D3CJ 1UW9A 3CXCR 3H40A 1PJ7A 1VISA 2YKPA 3TUPA 4IFYA 1Y3JA 3OPKA 2UU9F 4EYHB 3QAEA 5HMZA 5HJXA 2ABYA 3HP6A 3IG1A 1LK5A 5J1EA 3MEEB 3Q8QB 2JFDA 4FYVB 4DX6A 4QWEA 1BGXT 3IWNC 4IR1A 1TTHB 3BKUA 1IKWB 4GC7A 4X4PA 2FZCB 1FWLA 5H9EK 2X7IA 2RS2A 5M2UA 5A8KA 4WYLA 4LSZB 3DU5A 1KVKA 3GWCA 3LGNA 4N7TA 2E5IA 3OR2B 4WE1A 1YQHA 4LR7A 4B9VA 4TU8A 1WF2A 2J7WA 1VQKS 3RU0A 4X4RA 4CLYA 2MKHA 1C1BA 2FYXA 4IG3A 3CC4S 2VPYB 3OTEA 2G2OA 3DMJB 5D6GA 4FXVA 3AA9A 3QNWB 5HQLA 3M2RB 4LF1A 2LKZA 2RDJA 3AJDA 4LFBF 1K1QA 1IXKA 1MNEA 4HKQA 3SSSA 1VI7A 4IH6A 2E9ZA 3R2DJ 3GILA 3CJ0A 5F0UA 5C25A 3QMQA 3D0HE 1RAJA 3AQOA 3NOCA 2BJ9A 4ZVEA 3VGTA 4ETXA 3BBBA 4J7CA 1RT1B 2DT9A 3KLEB 5E41A 3FSIA 2Z58B 2AJ1A 2M4MA 1UFWA 1YJ9S 2I5JB 1UA1A 3PJWA 3K5OA 3CCQS 1IJFB 4NLPA 3T5HA 4Q0BB 2ZOMA 2QZ8A 5A0YB 2Y1JA 3GJTB 4NLWA 4ED6A 2XG8A 1RWXB 1GXTA 4G1QB 3DRSB 2ZD1A 3M9MB 2F7VA 5LSOA 4LVNP 4DV0J 2VG6A 4CQ1A 3ZTQA 2CNNB 4R8UB 4TYBA 3T1HJ 4DXLA 3DC2A 4C8MA 3HK2A 4WP9A 4AD6A 2XNQA 5K14B 3TAMA 3EPIA 3CDWA 3W2VB 4LF7F 3E01A 4DSFA 2FJDB 3JSYA 2DNYA 1YJUA 1JMTA 5HN0A 2WVCA 2HMIB 1EB0A 2LQBA 2BE2A 1VBZA 3MPDA 1MWZA 2C3OA 5KFPA 1SV5A 1EZZB 3CCUS 4HT5A 3OQ2A 3VZIA 4F26A 1KQKA 4QJVA 2GS8A 1FJ7A 3NAIA 2CJBA 2V2QA 5KG1A 3DOKA 1JXVA 2Z4PA 2R7QA 2YQ0A 3UCZP 1S1XB 2R8IA 2WSEC 1HQEB 2MKIA 3V6HA 1RBAA 2ZNYA 1KLMB 4C3KA 2QLJB 5C2GA 3J7Z5 4F4XA 3R27A 3UWTA 5DGBA 1SKUB 2WVFA 3Q8UA 2A2CA 4ZOSA 4YOEA 5E33A 4JYAJ 4LF4J 1TUVA 1VOMA 3AB4B 2E7XA 3A1YG 2CG4A 3RJMB 2PI4A 1U48A 3VVUA 4Y00A 2Z56B 3FCHA 1P1TA 2RQ4A 4MKBA 3M8QB 3QSYB 1CS4A 1T94A 4G1PA 2DNPA 1N5YA 1KLNA 1CJVA 2OPSB 1CJUA 2YX7A 1HNZF 3RGIA 5GMEA 2E66A 2IHR1 2DPIA 4DV7J 3DRPB 3RAMA 3PV8A 1Z2ZA 1KSPA 3I5AA 3F44A 3VAJA 3MM5A 5L9XA 4U7CA 2DBBA 3IBCB 1NJIT 3SSQA 4JI4F 1HBUA 1HWUA 3HVTB 4NMLA 2B5JB 2Q79A 1WOSA 3ICLA 5EUHA 5T41A 4OZJA 1HNIA 3NWRA 5HP1B 2OAUA 3ENWA 4YR3A 1NUEA 3R7NB 4FYDA 3MR6A 4F4ZA 2QYCA 2KM8B 1AFJA 3D2WA 3MXHP 4EZ9A 3NL0A 2M52A 5A8WA 4I2QA 5T7LA 1LFWA 1RP5A 2CZ9A 2ILYA 5C24B 2YY3A 1FRHA 2YWWA 4ZCIA 3H59A 2PGCA 2MQQA 2HIYA 1U0HB 5EDWA 4ZLNA 2XZWA 4DPXA 4LVOP 2HZCA 4ENOA 4OV6A 2FGOA 1S1VA 2ZE2A 2U2FA 2WONB 5KG4A 2OPQB 2BM0A 4S0MA 2ZH2A 2J76E 2DNOA 1FA0A 4JI2F 3L7UA 3JYTA 4OZLA 2DR5A 1IR0A 3AA8A 1NZ8A 2LEPA 3GYNA 1RTHA 4ECSA 4AQYJ 1MWYA 3FZ2A 4JI0F 2ATLA 2ZM6J 2V34A 4QYZJ 1FX4A 2HSEB 4ZVHA 5CZVA 4ZVFA 4BCAA 1X5PA 3IWLA 5L46A 2WCXA 1LOUA 4ANCA 1TZ0A 2HAFA 3IAS9 3UI3A 1BQXA 5IWAF 1WTBA 2QE5A 2XB2D 4Z7YA 5F3ZA 3FRYA 3PRDA 1X9SA 1VFJA 3GLJA 5LT5A 3BJYA 2CQPA 2L3MA 3W8GA 1FDNA 2OELA 2BV3A 1KHWA 4KGVB 2FHJA 1T05A 3LWLA 3D9BA 3H4DA 3RB4A 1YBTA 4CNYA 3KUGA 3TJ9A 4JBCA 1HPZB 5H9FK 4OLOA 2IA6A 4X62J 4W4MA 4ILLA 2L48A 1F5AA 3DKDA 2H54B 4CLPA 3QT8A 5JXSA 3BKTA 3MI7X 4IH7A 5KAKA 4QU6A 2CQCA 5AXKA 3G6VA 4M5NA 4GKKJ 1H72C 2DJWA 4WF9Q 1K1SA 2ZHBA 2A0FB 3OR2A 3PR5B 3TJAA 1XMOJ 5G4DA 3K0JA 3H5SA 1FEHA 5ETPA 2XLKA 2D1CA 4B02A 2W25A 5DZ6A 4F4WA 3MZIA 1NMEB 3EMTA 2PMZD 4XO0A 5B0GA 4KB7A 3NCQA 1EP4B 2IDEA 4FNHA 1UW4A 2AGOA 2CWXA 1FCAA 1FERA 2K06A 4GKJF 1XERA 1HBNA 2OIHA 5K5MA 1TKXB 2BR0A 3IRXB 2RRNA 2UV8A 1IKYA 2V8GA 4NA1A 1C0UB 5RUBA 4QBUA 3EM1A 3KHGA 1FRLA 1NPKA 1U49A 2RU9A 2NXCA 3VR1A 4NXNJ 2JLFA 1EJ7L 3SYZA 4ZVTB 3J81j 1F5BA 1U2FA 3G6YA 2B9WA 3MMBA 1SJ1A 1RDRA 3SBMA 3LPEA 3QO9B 4DUZF 3OR1B 3V5RA 3IO1A 1XIQA 4NZ7A 4CI0B 1T3OA 4WFAQ 2VD3A 1Q7YT 2E7VA 2CVEA 3Q8RB 4KKOB 2AEFA 3W9HA 2N3LA 3CCTA 2GHWA 2FC9A 5ETMA 2ZBCA 2G0JA 2HRYA 4MIAA 2AJ4A 1RHMB 2PT0A 3SIPB 3DRSA 4K4SA 1Y3KA 4DR1J 2MZJA 2EKYA 2JEFA 4B3OA 2B4UA 1F60B 4YB6A 5AE1A 3MFIA 1WEZA 1A6LA 3OJSA 1EARA 1DURA 4LMZA 1YSJA 4A8FA 1ZH5A 2DGWA 1V3SA 3HSJA 2XC9A 3QBCA 3N0VA 4CNZA 5E7OB 2R42A 3EGVA 4B9LA 4FF2A 3HX9A 4P2SA 2GAGC 2RU3A 3HJVA 4DX8H 3HVRA 3TQ1A 4LIRA 4PWUA 1T95A 1G7CB 1UPMB 4BC7A 4DR4F 4LJMA 4F0HA 4M5DA 1S1XA 3UDVA 2VG7A 3T5JA 5IV3A 1AT1B 1X5SA 4YB5A 2QSWA 5IT9Y 2E5LF 4LBHA 2GO8A 1XMQF 4B9MA 4Q7AA 1O8BA 3DN9A 3UNGC 4PR6A 2DGSA 3KLIB 5HO4A 3NGKA 2O66A 1DARA 4PG7A 3DDKA 2V8DA 1FKOB 4J9QA 3NNAA 4PYAA 4A8XA 5IXUA 5LJ3Y 1KKHA 2AT1B 3G86A 1KFDA 4B3TJ 3H2LA 2OPRB 4QIVA 1MN9A 2ZH7A 4KHPF 2P2CB 1WF1A 3IR7B 2PA8D 3GV5B 2OPSA 4Y2IA 2J6UA 2MKSA 5DG7A 3M6WA 4ZLLA 4DPWA 1WF0A 3SI8A 2B56A 1Z4UA 1EKSA 2MEWA 3TP2A 1H0HB 3MR5A 4JI6F 3LTOA 2R7SA 3ZZYA 2NYIA 1HYSA 4XIUA 4F25A 1VK3A 2Y9HA 1EQ0A 3OSPA 2J0WA 3OD2A 4OYIA 3AXMA 3CCES 3LOUA 3GJQB 1NNDA 3RBEA 3SFUA 1RBLA 4ED8A 4HI2A 1WNEA 3FEXB 1PJ6A 1CULB 1NDPA 1P9YA 2AYGA 1S5ZA 1U6BA 4LF9J 1RCXB 2C1EB 2V4RA 1PGZA 4C8OA 1U02A 4OQJA 4CZCA 2H5JB 3Q22A 3MM8B 2XWXA 5ETTA 5DETA 1S1TA 4OLPA 1Q86T 1MLAA 4URQU 1QDUB 2N4CA 1TP7A 4YUDA 1JKHB 1UVMA 1SVDA 5DS7A 4DBQA 1V3ZA 3T41A 2HHVA 2HHSA 1YBUA 1FFSB 5GAGU 2PSZA 3GIIA 4D3HA 3M6VA 2Q66A 1S48A 5D4NA 2FY1A 2NREA 1WC4A 1N36J 1UKUA 1FRIA 2CPEA 3PG9A 3M30B 1RGVA 4F7VA 1VIXA 3C14B 2WB4A 1T8EA 4JP8A 5C5JA 4OYXA 3RAQA 1S77D 2HRUA 5I3UB 5JJBA 3HT3A 1NLKL 3OFEA 1EETB 3KFWX 2X3GA 2DHXA 1U1RA 3ITHA 9RUBA 5JUMA 5AXNA 3DLJA 1AUDA
chains in the Genus database with same CATH topology
4XDDA 2I9SA 4PXEA 2ZH3A 1FTCA 1NK5A 4O44A 2OTJS 4HDHA 4ECVA 2EWHA 1VBYA 2UUBF 4C11A 4BS2A 2ZKUA 4WU2A 5DLFA 4DQPA 3ITHB 4V19J 1QVGR 4HH0A 2O3DA 2IRUA 1S1WB 1S0OA 2W4PA 3PO4A 3GZ7A 5F3TA 3MCSA 4DPOA 2W7OA 4NLRA 3TANA 1CLFA 2BQ3A 1S7HA 4DV1F 1SQEA 2JX2A 3M1VB 5KFZA 3T1AA 2WOMA 3WZ0A 4N5SA 4O44B 3CCLS 1FE4A 2HS0A 3K57A 4K4VA 4DOZA 3R1LA 3DNCA 1SXLA 2M7SA 1DZ5A 2F9JA 2GO9A 4JV2A 4ECWA 1WD6A 2K7KA 3WX4A 3LQVA 1SB6A 2QA4S 4F4KA 1I1GA 2EFVA 2BJDA 4PRFA 2WOMB 5J1PA 3V4IB 2XY7A 2ADCA 2E5JA 2DB1A 4ELVA 4RW7A 1Q8BA 2Z8QA 1TK5A 1N36F 4RU9A 2IVYA 3VZHA 4HEA9 4NZ6A 1S6QA 2FVQA 3CD6S 3VCDA 1RTIB 2YNHA 5L38A 1U47A 5J2PA 3LWMA 4WFBQ 3B4DA 4QYRA 1X7VA 2DH7A 2JWNA 4LSNA 4K4XA 1U1KA 1FKPA 3BSCA 3FMBA 5HMXA 3HM9A 3V6JA 4RW7B 2Y0SD 3N5BA 3HHLA 2NPIA 3MWBA 1TK8A 5F8GA 1WHVA 2L9WA 2E1AA 2HWIA 1S6QB 5KG5A 3MM6A 1DHMA 2V9KA 5DQHA 2YNHB 3BZQA 1UP1A 2CQIA 3NKYA 5KFEA 2BJEA 2MJUA 2V4JA 5J2PB 4UW2A 3KOAA 4Q5VA 2CJAA 4LSNB 5F8IA 1FKPB 4OIXA 2BBEA 2DNQA 5AE3A 5IM0B 2W8LA 4NRUA 4RBTA 4BHQA 3KK1A 3PR4A 3HHLB 3PACA 2CKWA 1K9MT 3D1OA 4I69A 2B43A 1XTZA 1HI1A 1QY7A 1ZAWA 2PIIA 4RWWA 2DIVA 3SCJE 4IOAQ 3MM6B 2E9RX 4IFYB 3GSDA 3C46A 2V4JB 2CJ9A 3OL8A 1NJYA 2KFNA 1HWKA 3TNVA 2HIQA 1TVRA 3CGIA 2BXJA 2JEJA 2B4PA 2VQFF 2PI5A 4OFZA 3VF0B 1SJQA 4FP9A 3IGNA 5E5NA 5B09A 2MMYA 1HNVA 1MMNA 4GO7X 3N9UC 3VWSA 3EXYA 5U47A 4ZCKA 2CZ4A 3TA1A 1JNRB 1RT4B 2KXHA 3GYXB 3M8PA 3QIPA 5EWGA 1V6HA 1XR6A 1X0FA 4ATNA 5J1EB 2JVOA 4IRCA 4FVCA 3IAM9 4ECYA 1TFWA 3BQ0A 3BF4A 5LXYA 4I7FA 3CIZA 2MSSA 1HNVB 1KTQA 4B08A 2D7SA 3K2YA 1LK7A 2GMLA 3B82A 2HYIB 2G1DA 4AXJA 3HKWA 4DDFA 5D8HB 3CCSS 2ZFHA 2J9CA 6FDRA 4DR3F 3GV7B 3QIPB 4TQSA 4R25A 2CQHA 2DHSA 4O3OA 4WK3A 4EYIB 4ED2A 3M9NB 3PDNA 4ZDNA 1WTFA 1QSLA 4F4YA 5EWEA 4K4WA 3MOJB 2KJWA 3Q0AA 1X4GA 2ZDOA 4E98A 2HLUA 2KB2A 4I7FB 1UVJA 1D8ZA 4QOTA 2VV5A 1IQZA 3BM7A 4OHYA 2F8EX 1P6TA 4WIIA 3ZZRA 1TKXA 1SUQA 4RLEA 1DFDA 5IZHA 2C22A 1DLOA 2VONA 2NLWA 4EGLA 4N41A 3MMCA 5D78A 4AYBD 5HROA 4C8KA 4WZQA 1C0UA 2FHMA 1OPIA 3IC1A 2XMWA 2GIQA 3OTOF 3D54A 2J5AA 3OTBA 3CJ2A 4XK8C 2NZ4A 5F8MA 1QSYA 3FMWA 4URGA 4K4TA 1R7IA 1XBWA 3LH2S 4K50A 2JJ4D 2RKIA 1NJZA 4ID5A 1J5OA 2R7OA 4J9NA 2CJKA 1A7GE 3CD7A 3MMCB 5DLGA 4N47A 3RAXA 2D3UA 4DSIA 5HBMA 1Y5NB 2E1RA 1L3TA 3MD3A 4RW6A 1CC8A 1KN6A 2JDJA 4DQIA 4OJGA 5BYQA 1JB0C 4CH1A 2IJNA 4IO1A 5KFFA 2R7UA 2YQ3A 3OHBA 4TY9A 2RKIB 3TUJC 4ID5B 1J5OB 3I96A 3GG0A 3RZAA 3PVXA 2DGQA 1YWXA 4KSEB 4I67A 3Q24A 4B17A 2HGLA 1S99A 2VASA 5HBMB 1XN9A 2Q1LA 2ZC3A 2K2PA 3CJ4A 3TA0A 4Y6IA 2GQ2A 2XMTA 3NP5A 2KO1A 1JXEA 4FXWA 2ZZMA 4A8OA 4O3SA 4NCGA 2POKA 2UV8G 4NLTA 1X8DA 4KIAA 3VQSA 3H98A 5F41A 4P7TA 4TXSA 4NYPA 3TVZA 1DTTA 2CPDA 1RTJA 4B9TA 4IR9A 1IM4A 1RWUA 2QSFA 4QR2A 3BDEA 3TR5A 3UDLA 5KG3A 4ID8A 2JLEA 5KFDA 3C6TA 2QMXA 4C2MA 3KHLA 2UUAF 5BYSA 3S8SA 3CC2S 4ED1A 4NCGB 2JLGA 2KG1A 2FJEB 2D9OA 3M6UA 5GAEI 4WZMA 1Y4ZB 3ZZTA 4OI0A 1DTTB 4DN0A 1JLBA 1RTJB 4AXIA 4E8UA 2IRXA 3M2UA 2XY6A 1IBLF 5I42A 3GR0A 2JL9A 2O01C 3ZZ0A 4DQQA 2MHEA 3C6TB 4IUFA 3OFGA 2KDOA 1JLFA 1J5EF 3ENVA 4QIWD 2RRBA 3MUMP 3QPIA 2FHKA 1MU2B 2HVZA 1CQMA 4OHVA 5CHCB 5DDPC 1S0NA 2KH9A 1KNZA 3NWGA 1H2UX 3PEHA 5KFGA 5GAHI 5KFYA 1YTYA 1KQSR 2EK1A 1OQ3A 3ISZA 2PE8A 3F73A 1R8HA 3BSOA 1JLBB 4F67A 2ASJA 4KGKA 4QPTA 2MHNA 3MEGA 2ROGA 5J2NA 2M5YA 3M2UB 5M2RA 2HS4A 5I42B 3PX6A 3KG4A 2DGVA 4OX8A 3MF5A 5CYJA 4QR1A 2HAIA 5EWFA 4I0WA 4J9LA 1QAIA 1G6BA 1JLFB 4X4OA 4IKAA 3TUIC 5L1IA 4C0BA 1QAYA 3TA2A 4OV1A 2KXFA 4Q43A 1NK6A 4DFPA 2G4BA 4D3GA 4YDDB 4ED7A 2V5HG 2EI5A 4U67Q 3NCPA 1GTEA 2ZNZA 5D77A 2XNRA 3RB3A 2WBMA 3MEGB 2OKQA 5J2NB 2J6SA 3KHHA 2HGNA 1FDBA 3C2PA 3M6XA 3BREA 2GQCA 2E5GA 5L39A 3BGLA 3V6KA 2R8GA 2DRAA 3W3SA 1DRZA 5KFLA 1KQGB 5KG0A 2M88A 4ELTA 1W25A 5KFJA 1BLUA 1L5UA 1Q81T 1NKEA 3RR8A 1TQLA 1U4BA 4FN5A 2HGMA 4QWBA 1K8AT 4B9NA 1N33F 2QO3A 2VKRA 3O1LA 4HLBA 1CPZA 4HTJA 1N5QA 1SJRA 1R8BA 2R8HA 4ZCLA 3DLHA 1CVJA 4X84A 2HHPA 1F0XA 2LQJA 2XY5A 2KT2A 3D28A 4OJHA 3SMZA 2DNKA 2KN4A 2Y1IA 2KVIA 2LA6A 3CD0A 2GGPA 3MFHA 2MJNA 5SZTA 4KAIA 2KJVA 2FLOA 4DG1A 7FDRA 1SIZA 2ZHOA 2MZ1A 3TRGA 4FS2A 5THWA 1M5OC 5KT4A 3PW2A 3MEDB 1WELA 1R3NA 2MY8A 1Q78A 4PG8A 5KG7A 2AX0A 1RYRA 1GX5A 1X4HA 1Q16B 1BQMA 3DYAA 3TUZC 4DV6F 2AJQA 3O44A 3X3UA 2KXNB 3TAMB 4DL0C 3IXQA 1UL3A 2LVWA 2GGPB 4DL5A 4DG1B 1HI8A 2XCPA 2BABA 2C2EA 1CQNA 2YWEA 2ZOGA 4BBYA 1XEZA 5KFXA 4YHHF 1TK0A 5KT6A 4ZVGA 2DNRA 2MY7A 3PW5A 1BQMB 1QLNA 3DYAB 5H9EJ 1NB7A 3T6BA 3IA0A 2XMVA 4LT6A 1UEUA 2AX1A 2H5EA 4KQZA 5E0OA 3TYTA 2LEBA 4MYUA 4KO0A 2ZH8A 4DQRA 1JIHA 3CCUS 2R2TA 4HYKA 2RIJA 2YVSA 3BS9A 2WSFC 1URNA 5DO2A 1QM9A 2I8EA 1S72S 4I1TA 5GAEU 1XNQF 6FD1A 4NA3A 3R5AA 3I4PA 5B0AA 4B3SF 1Q8LA 3GR1A 4KO0B 2VL1A 3DOKB 2ZUGA 1M5VC 3LO3A 3VQTA 3KKFA 1C2PA 4R5PA 1VQOS 1E6YA 5CQGA 1QAXA 4RBVA 3UCGA 2VH7A 3CPWR 4JV5F 3JSMA 4PXDA 1X5OA 4MK7A 4ZPWR 5GAHU 4RW4A 2BDPA 4ZHRB 2HHQA 2XSJA 2NUUG 1SC6A 2CYYA 1Q1KA 4K0KF 4PKDB 1MROA 2HFZA 4RNMA 2GIRA 2OMOA 3KG1A 4ALZA 4AUKA 1Q8IA 1OO0B 3QLHA 1JK9B 1G1XA 2A10A 2AGQA 4I68A 4O23A 4R5PB 3GE9A 4K59A 1E6YB 1VQ6S 3NRBA 2NPFA 1YJWS 1X4BA 3JSMB 4PPDA 3G96A 3P5TL 4RW4B 5DM7Q 3OFHA 1LXNA 2XSJB 4YB7A 2HWHA 2EFOA 1MROB 3Q23A 2FVSA 4ILRA 1NRKA 2JH3A 1UJ4A 5KFAA 4DV4F 3QLHB 3T9ZA 4TY8B 2KU7A 2YNFA 4DL3A 2NR0A 1HD1A 3FVYA 4ZA1A 1XC9A 4IYQA 3VAKA 3OV7A 3CDAA 1SKRA 4QQBA 3U02A 2BRLA 1Z2LA 3V4MA 3PZPA 3LPYA 4A47A 1A9NB 1S79A 3QGGA 2BM1A 1RYSA 2ZJRQ 1ZOTA 2FLLA 4IQXA 2VQEF 1Q79A 2YNFB 3KLVA 2ZZNA 2FJAB 4WXOA 5L8RC 4ES3A 2VZ9A 2VBXA 2QA4G 2RD5C 3CDUA 1S6OA 4WCEQ 3MPYA 3GIKA 2V8VA 2Z0GA 4DQSA 1HL6A 4QIFA 1RT7A 2N3OA 5B0EA 5FJ4A 4KHMA 4NLSA 3T6JA 4I6AA 1M5HA 3H2VE 1N6QB 2RQKA 1PO6A 2AU0A 5C42A 4NCBA 4BC9A 1JLAA 2KKHA 3G8QA 5KT2A 3R1HA 2VFUA 4NXMF 2FGCA 1TFYA 3ZZUA 4DEZA 1WEYA 2QLXA 3B8HA 3N6NA 1U1QA 3ONQA 3UR0A 2MZTA 2HNYA 1N4LA 2DISA 2OP5A 2P9CA 3BN4A 2C3MA 2LECA 1RT6A 2E44A 1RT7B 5DG8A 5FLXY 5KFNA 2QA2A 1FRMA 2XSFA 3T5KA 5C42B 2F8HA 3PFEA 4WFNQ 3FZBA 1JLAB 3MTKA 3HHLC 2R7WA 4X65F 2FLNA 2JC0A 1CEZA 5DQIA 1YJRA 4X4SA 4UOCA 2E7WA 4H4OA 1I6JA 4IRKA 2HNYB 3P3DA 1FNOA 2G0CA 3EPGA 3CMES 2VC0A 1RT6B 1TV6A 4NLQA 2CQDA 2GQQA 1FD8A 1SL1A 2RSQA 5A6PA 2K3KA 3NCRA 5A8RA 2JVRA 2IM0A 3RW7A 4ICLA 3TVYA 2WHOA 5CYQA 1BQNA 4DSEA 2V9WA 1LWCA 2Q6CA 3UD3P 1MW7A 2CPHA 3BO2A 2E5HA 1BD6A 2CPIA 1QAJA 4H4OB 4ZP9A 3BO4A 1NH8A 4IH5A 2NS1B 5D4PA 3HZGA 1B0PA 1RT2A 4N8OA 1TV6B 1PILA 2ZC4A 4K4YA 4Y2CA 3VAFA 2D3OR 2B7CB 4NLVA 3VTIA 3OVAA 5A8RB 5CD4H 4FPRA 1VGYA 1FF2A 1FRXA 4ICLB 1VJWA 5CYQB 5F8JA 1BQNB 1LWFA 2RS8A 1LFPA 1SBRA 2YX4A 4I56A 3SCLE 4FS1A 4O3RA 1AW0A 3L09A 1Q7LB 5KFMA 1FVQA 4KTQA 3RB6A 1YITS 2WTFA 2M8DB 2DR7A 2QA1A 2MGZA 2UUCF 4CO1A 2MPUA 1YVFA 2RJZA 5ADZA 1N0UA 4RUHA 2ZH6A 1RT2B 2JC1A 4GO5X 1VQ5S 4UUXA 2VOOA 2AYEA 2Q43A 3I32A 2C42A 3DXSX 3H5YA 1X0PA 3EUNA 3MR3A 1OWXA 2D3ZA 3G6ES 5CCMA 3M9OB 1LWFB 2MSTA 2W9CA 2ZH9A 3NBPA 2J0XA 1M0SA 2LDIA 2ILZA 3EZUA 3J7ZT 3CWJA 4K5SA 3EZ5A 1M5SA 5K8OA 3U7JA 1B7FA 5L9NA 1TL4A 2IMOA 5DGAA 1M5PC 2OSRA 2RQCA 1YJNS 1L3SA 3O3LA 5DDRC 2BW2A 3BGUA 4NLXA 4I6WA 4YP3A 5BYRA 4HL9A 1XK8A 2EK6A 3FGVA 4C98A 1IBKF 2R8JA 4LFCF 1S0MA 3L7PA 2ADBA 1GQEA 5KG6A 4G1IA 3M8RA 2GMJA 1X4FA 4ZP8A 4Y65A 2F8MA 2W9CB 3NBPB 5AXLA 2B4OA 3E8OA 3BEGB 2GJ2A 3P96A 3CJKA 3TI0A 4ECZA 2XO7A 1N5TA 3M8SA 3D1QA 2VFTA 4DF8A 2EFNA 3BR9A 1MMDA 1YG0A 1K0VA 3QJLA 1R6YA 4CO3A 5F8HA 3CEDA 3CO9A 3HKZD 1HNXF 3GFYA 3U1MA 4ITSA 3MDFA 1IQTA 3CJKB 3QAUA 4ELUA 3DOMA 5GMKa 3UE2A 3SQGA 1SJFA 1V3RA 3I9V9 1WHWA 2YTCA 5E3RA 2OJ3A 4FVMA 4NX9A 2M3DA 5B0FA 2C2RA 4QPXA 1KOOA 2DITA 2BYCA 1RK8A 3ZZOA 1DBDA 1KONA 1N88A 3LF0A 3TOQA 1D0EA 3JAMY 2VFVA 4KBIA 3ZZZA 3K59A 4EBEA 4FBTA 2LQ9A 3C3LA 4MK8A 3DDNA 1Q53A 4A8MP 2FVRA 5LMNF 2F4VF 4ED5A 1JJ4A 4N8NA 3V4IA 2HNZA 1VBXA 1UJ5A 3SQGB 3KLHB 1TAUA 2DCLA 4R0EA 4BDPA 1TL1A 1KVIA 4WTYA 3T5LA 3HDSA 2VKZG 2MDAA 3L3CA 1R8PA 5K9FA 4X4TA 2DR8A 2J0QD 1TKZA 2C3UA 1RTIA 5KFRA 1YBAA 2MQPA 1LW2A 2FLPA 1Y00A 3MHYA 1TAQA 3S6EA 2IM1A 1RA6A 4RX6A 3LP0A 2RDIA 5F8LA 1URRA 3B4MA 4ED3A 1X4DA 1VRUA 2ASDA 2FHOB 2HNZB 4X64F 3EGNA 2YNIA 2FJXA 3Q8PB 3FDSA 2JEGA 4ED0A 2I38A 4F50A 1TL1B 4HHJA 1HW9A 2IYIA 3NAHA 1VC5A 2OH2A 4HI1A 1TKZB 4DHVA 2HHHF 1LW2B 4ZCMA 2NUHA 3CB4A 4YDXA 4ZP7A 2F1FA 2XMKA 3LP0B 5CXTA 3G6XA 2XWYA 1X4CA 1VRUB 2Y1RI 3N5FA 4I64A 3IR6B 1D1UA 2QIFA 2YNIB 5IM0A 1N56A 2VA3A 2ACYA 3CXCR 3H40A 1T03A 3EGZA 4H54A 2YKPA 2V2KA 3CDBA 4IFYA 1Y3JA 3RBDA 4HT7A 3D0GE 3PXGa 2WW8A 4NPOA 1K73T 3KK3A 4QWAA 3MEEA 4H4MA 3OPKA 1FJGF 2NSCA 2UU9F 4FZVA 4X66F 2QLWA 4EYHB 3OVBA 3QAEA 1T03B 4GC6A 4KPYA 4A8YA 4DL2A 4J5OA 5HMZA 2UUTA 2X1FA 4PUOA 3PFOA 1O51A 4PXBA 4DFKA 1RT4A 2ABYA 5CCLA 3HP6A 3IG1A 2FJBB 1LK5A 2DVIA 5J1EA 4Q44A 3KK3B 1IKWA 2B9YA 2EW9A 3MEEB 3Q8QB 3TAPA 4H4MB 1BWEA 3RRGA 1WG4A 2MYFA 2JFDA 3MD1A 4UQGA 3CSKA 3BO3A 3OL9A 1PSDA 2MZQA 2W24A 2PA3A