3GMWA

Crystal structure of beta-lactamse inhibitory protein-i (blip-i) in complex with tem-1 beta-lactamase
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
261
structure length
261
Chain Sequence
ETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into positive and negative requirements for protein-protein interactions by crystallographic analysis of the beta-lactamase inhibitory proteins BLIP, BLIP-I, and BLP.
pubmed doi rcsb
source organism Escherichia sp. sflu5
molecule tags Protein binding
molecule keywords B-lactamase
total genus 91
structure length 261
sequence length 261
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3gmwA00
4XUXA 5CERA 3CJMA 3WRTA 5A93A 3ITBA 5F1GA 3WS2A 3EQVA 3FKVA 4DXBA 3UNWA 1WE4A 3AGEA 4R3JA 3HLCA 3PBTA 3MXSA 5CTNA 3S4XA 1E25A 3P09A 2ZM0A 4E3JA 1H8ZA 4JF6A 4MEZA 4P87A 1CI8A 3NC8A 4QU3A 2XF3A 2ZLYA 1WYCA 5FAOA 1HVBA 2H5SA 4R4SA 1ERQA 4HESA 2Y2PA 3A3IA 4KZ4A 5FATA 3IF6C 3Q1FA 4IEDA 2WADA 5JYOA 4U0XA 4O7DA 3G30A 4PM6A 1PZPA 3MZEA 4KG5A 5CHMA 1K6SA 2CC1A 2Y59A 3IWQA 4WZ4A 1E4DA 4P85A 3OPHA 5GLAA 3VOZA 1WYBA 4JF4A 3O3VA 4PM7A 4UA9A 5FDHA 1GHMA 5I94A 4D2OA 5E43A 3BLSA 1H5XA 4OQIA 4ZBEA 1BLPA 2DRWA 2OLUA 2WZZA 3EQUA 3UPNA 5EUAA 2EX6A 3UDXA 1SHVA 3VP4A 4PPRA 3SS4A 1IKGA 5GHYA 4OPRA 4WELA 3JYIA 3N6IA 3VOYA 2E8IA 3VFHA 3ISGA 4WEKA 5EVLA 3HREA 3RXWA 1K6RA 3A3FA 3Q7VB 3BLMA 1IKIA 5KZHA 2HDQA 3OCNA 3V39A 4ID4A 1K56D 2P9VA 5EOOA 5TR7A 2OLVA 4LV3A 3ZFZA 3GRJA 1XP4A 4Z9QA 3NIAA 3V5MA 1BTLA 1LHYA 3OZHA 1MWTA 5EVID 4OP8A 1RGYA 2VGJA 1O7EA 2VGKA 4CJNA 1NY0A 1Y54A 2FFYA 4BLMA 2XLNA 3PBNA 5CECA 2EFUA 2EX2A 2J9PA 4JXGA 4R1GA 1LI0A 1M40A 2QMIA 1MXOA 2XD5A 2IWDA 4OVDA 1XA7A 5HAPA 1ONHA 2A49A 1I2SA 1KDSA 1IYPA 3Q07A 4LCLA 1ESUA 3IH9A 5E2FA 1K57C 2WGWA 4JPMA 4N92A 5FAPA 4OOLA 1XGJA 3GR2A 4P0MA 1YLPA 2IWBA 5BOHA 5GLCA 4S2NC 2Q9MA 2XEPA 3CZDA 5AQAA 4N9LA 4C3QA 4OQ0A 2RCXA 1NJ4A 4BD0A 3TG9A 5DF7A 3ITAA 4KZ6A 4NETA 4KQRA 3TSGA 3PBRA 1PZOA 5EOEA 3CMZA 4OOMA 3NCKA 1ES5A 2P74A 4EBLA 3AGDA 5DVAA 5AQ7A 2Y2JA 3UE3A 3ZG0A 2X71A 2ZM2A 5CHJA 1DY6A 4DF6A 3B3XA 3M6BA 2WGWB 2Y2KA 3A3DA 5GLBA 5HFOA 1PI4A 3GTCA 3G4PA 2WZXA 3HLDA 2OV5A 3BFDA 4OKPA 2WK0A 4EV4A 1L0GA 4QD4A 2B5RA 4U0TA 5DTTA 4E6XA 2EXAA 3BFCA 3NDGA 5HAQA 1S6RA 1GA0A 1SKFA 4KQQA 4LCMA 3W4PA 4UAAA 3AGFA 2PBYA 1FOFA 3ZG7B 1K56A 3P98A 1IYOA 3HLWA 5EPHA 1JWPA 1ZG6A 3PBOA 1MWRA 1M6KA 1O07A 2EFXA 3N4IA 2QPNA 5AQ9A 3HVFA 4JF5A 2G2WA 5IHVA 4LV0A 5G18A 1K54A 4OPZA 1RP5A 3HLBA 5E2GA 4LENA 4E3OA 3IHBA 5HAIA 3M2JA 3Q7ZA 2XQZA 3MFDA 1FQGA 3ZG8B 2HPBA 2ZD8A 3BFGA 1BLCA 3UDIA 4FSFA 4MBKA 5L2FA 4JKTA 5EVIB 1MWSA 3N8SA 2ZC5B 1K38A 3OCLA 4KQOA 4DXCA 5JYPA 2HP9A 3UN7A 1L0DA 3PTEA 4WZ5C 4HBUA 4E3LA 3M2KA 1VM1A 1MBLA 4KG2A 2IWCA 2Y2OA 3FZCA 4UHUA 1HTZA 2ZM8A 3E2LA 3FV7A 3G34A 3QHYA 5FQQA 5FI2A 4WMCA 1AXBA 1PWDA 3HL9A 4WYYA 1PI5A 4GDBA 1K25A 5CXWA 1BT5A 2ZQCA 3GSGA 1ESIA 3PBSA 4UA6A 2XGNA 4E3KA 1QMFA 4R3BA 1NRFA 4MBFA 3MKEA 1KGFA 4OPYA 1PWGA 1ERMA 1SDEA 1W8YA 3Q82A 3QNCA 2BLSA 5CGXA 4K91A 3GMWA 2H0YA 2XK1A 1YT4A 4OLGA 2Z2MB 2QZ6A 2EX8A 4M3KA 2JBFA 5KSCA 3S22A 3UE1A 3DWZA 4FH2A 3NBLA 4N9KA 3FYZA 4EWFA 2PU4A 4EQIA 4Y0UA 1NYYA 4EUZA 4R23A 3PAEA 4X6TA 1EWZA 4U3TA 3N8LA 4QY5A 4IBXA 4WBGA 3NI9A 3WS0A 1BLSA 1BULA 5CGSA 4DE3A 5A92A 2ZJ9A 3OC2A 1MKIA 1CK3A 5FSRA 3LO7A 3PBQA 1TVFA 1LI9A 1BUEA 5DF8A 2C6WB 2Y2LA 5DTSA 5E2HA 3HUMA 5FQMA 1TEMA 5HARA 4Y7PA 5D3OA 1PYYA 3ZGAB 1K55A 2XFSA 4OH0A 4DE1A 3W4QA 1PIOA 3LY4A 4N1HA 3W4OA 4GD8A 4MBHA 5KSHA 1YLZA 3C4PA 3DW0A 2RL3A 1YLJA 5EVIA 4BD1A 2ZQ9A 4BL2A 2ZC4B 4Q8IA 4IVIA 2ZC7A 2J8YA 4GDNA 3UE0A 4EBNA 4FCFA 2ZQAA 1NZOA 4GZBA 1TDLA 3G32A 4K0WA 1FR6A 1KE3A 4GN2A 3V50A 2ZQ8A 1PW1A 1LL5A 3A3JA 2DCFA 4GB7A 1JTDA 1W5DA 1W7FA 2Y2MA 3BM6A 4F94A 1FCOA 3OPPA 2ZQDA 2P9VB 1E3UA 1KGGA 1S0WA 2HDUA 3G2ZA 2V1ZA 1K57A 5TGFA 3IXHA 4E6WA 2JE5A 1TDGA 1H8YA 1YQSA 4KG6A 4Y0OA 3HBRA 5HX9A 3O87A 2WGIA 3IF6B 4S2MA 1GHPA 4RVAA 3BECA 2X01A 4B4ZA 2Y2NA 2Q9NA 4E3IA 3WS5A 2I72A 2Z2LB 1MPLA 4KZ7A 3G31A 3VSKA 4YFMA 3G35A 1RCJA 4RX2A 3TOIA 2WKIA 4XXRA 2A3UA 3A3EA 5A91A 3FWLA 2Y2GA 5AQBA 2Y91A 3IXGA 4X68A 1NXYA 2HDSA 1CEFA 1FSWA 3NY4A 4H8RA 4JBFA 3MZDA 2X02A 5J8XA 5FA7A 3BYDA 3C7UA 3SS5A 4K0XA 4MNRA 1MWUA 4S2KA 2ZC3B 1N9BA 3IF6A 2XH9A 5FQ9A 1W79A 1JTGA 1KVLA 4X69A 4ZJ2A 4S2JA 5CHUA 3UO9A 1PWCA 2Y2QA 1DJCA 2V2FF 4HEFA 1ES2A 1N4OA 2Y4AA 1HZOA 3FKWA 4KZ8A 4OONA 4PMAA 4WEJA 1OMEA 4BL3A 1J9MA 4B88A 1ALQA 3RXXA 3OPRA 4S2PA 4XUZA 1MY8A 3VSLA 4KZ5A 5M1AA 1Q2PA 3GVBA 1YLWA 3SS3A 3SOIA 1EROA 1JWZA 4PM8A 4X53A 5GHZA 3LY3A 4JXSA 1K54C 1XX2A 5GL9A 3WRZA 1BLHA 3G2YA 3MKFA 4C75A 2BG1A 4CPKA 2V20A 1I5QA 1K55C 2WAFA 4GKUA 4RX3A 3ZG9B 3SH9A 4R0QA 3ZVTA 3ZVWA 5M18A 3ZCZA 1G6AA 1QMEA 4WM9A 2R9XA 2JC7A 4JLFA 1KE0A 2GDNA 2J7VA 3IT9A 3PAGA 4BQMA 4PM5A 5F83A 1XXMA 3WWXA 5CEDA 1W8QA 5M19A 3IXBA 1KE4A 4RYEA 2ZMAA 1KGEA 1C3BA 1GCEA 4GNUA 5E2EA 4DRTA 4DDSA 3I7JA 1YLTA 4GOGA 4E3NA 3ZG5A 3IXDA 4KZ3A 1CI9A 4ZJ3A 1GHIA 1YLYA 3IF5A 1FCMA 2H10A 3IHAA 4E3MA 1XA1A 4QHCA 2Y2IA 1G68A 4S2IA 4LV1A 4DE0A 3HUNA 1Z6FA 1CEGA 5FI6A 3UPOA 5FASA 4OPQA 1XGIA 3BEBA 3VMAA 4OQHA 4S2NA 3UY6A 3ZNTA 3S1YA 4X56A 5FQJA 2HP6A 3BRMA 3E2KA 4OOYA 4QB8A 3SH7A 4S2OA 5GLDA 3HLEA 3N7WA 4FH4A 3NDEA 2UWXA 5FI7A 3ZNYA 5CEBA 4KZBA 3ZHHA 1FSYA 1NZUA 1LLBA 3VP3A 4OQGA 4BENA 4YINA 3IWOA 3IQAA 3WS4A 2OSUA 1E3UD 4RA7A 2WAEA 4MLLA 4ZDXA 4L0LA 4ZAMA 5F82A 1ZG4A 3W8KA 1HD8A 3BFFA 1EI5A 4IBRA 2C5WB 4GD6A 1IYSA 1L0FA 2FFFB 4B4XA 5F1FA 1ES3A 3VP1A 3GQZA 2WKEA 4X55A 5A90A 3C4OA 5FAQA 3MXRA 2H0TA 3IH8A 4ZTKA 4JXWA 4R4RA 4DDYA 1DJBA 2JCHA 5CTMA 4LV2A 1L2SA 3WS1A 1IYQA 4DE2A 1JWVA 5DF9A 3DWKA 1LL9A 3LCEA 3V3SA 2Y55A 3UDFA 2XFTA 1XPBA 3HUOA 2XR0A 1I2WA 2DNSA 4HBTA 4N1XA 1FCNA 5CRFA 4EBPA 1XKZA 3O88A 2EX9A 4KZAA 2WGVA 1ZKJA 4OP5A 5FQKA 5TFQA 3RJUA 4Y0TA 5U47A 3SH8A 3ZDJA 1IELA 4BJPA 2WYXA 1KVMA 1YM1A 3O86A 5HL1A 2G2UA 4A5RA 5CGWA 1ONGA 3LEZA 3C5AA 2ZC6B 4OLDA 3N8RA 4P6BA 1IEMA 3CG5A 3QNBA 2J9OA 4JXVA 3M6HA 1PW8A 1BSGA 1FR1A 3C7VA 4S2LA 4DKIA 2WKHA 1VQQA 2EXBA 3HLFA 1GA9A 3UPPA 2ZQ7A 2R9WA 3MZFA 1K4EA 4WMCD 3IWIA 2PU2A 1U60A 5FQIA 1L0EA 4WZ5A 1KDWA 2HP5A 1BZAA 1SCWA 3VP0A 5DTKA 1NYMA 4QJGA 4PM9A 1ZC2A 1ES4A 3HLGA 1DJAA 2XDMA 5KMWA 5GHXA 4KENB 3VP2A 3V3RA 4IVKA 1YMXA 2WUQA 2XD1A 3Q81A 4FD8A 5EE8A 4C6YA 4UA7A 1SDNA 1YMSA 3DTMA 4ZJ1A 3GV9A 3Q7VA 3BFEA 3OPLA 5EVIC 1RGZA 4QY6A 1K4FA 2Y2HA 4NK3A 5EECA 3MBZA 4KZ9A 5HW3A 3VFFA 3D4FA 1JVJA 1Q2QA 2HDRA
chains in the Genus database with same CATH superfamily
3CJMA 3WS2A 1N9LA 2W3FA 3FKVA 3JVVA 1P9WA 3NOUC 5CTNA 4D60A 3P09A 3S7QA 1CI8A 3NC8A 4WL9A 2XF3A 2ZLYA 4LLOB 1WYCA 3CITA 5FAOA 4I3AA 2H5SA 4R4SA 1ERQA 3LIEA 3A3IA 5FATA 3IF6C 3Q1FA 4IEDA 4F3LB 4HP4A 2CC1A 2J3WA 3IWQA 1E4DA 4ESPA 3OPHA 3E4PA 5HDCA 4HQAA 1LSXA 2LB5A 4UA9A 3BLSA 4B9OA 5HWVA 4Y17A 4ZBEA 3EQUA 2WZZA 2EX6A 3QP8A 3H82B 3VFHA 3HREA 1XJ6A 3A0SA 5I5LA 1IKIA 3MJQA 4LV3A 2GNXA 3GRJA 4IUHA 2KLIA 4ZRRA 1GSWA 1O7EA 3P7NA 2PYRA 4NG2A 4JXGA 1MXOA 2XD5A 1ONHA 1KDSA 3IH9A 1K57C 2XROA 1FIKA 2WGWA 4OOLA 1XGJA 3GR2A 3K3CA 2HF6A 4BBVA 3T4KA 2RCXA 2V8CA 3ITAA 1PZOA 4I5SA 4OOMA 3AGDA 2Y2JA 3ZG0A 2Y2KA 3HLDA 2WK0A 2R78A 2B5RA 1AWIA 5HAQA 1S6RA 2ZMFA 1GA0A 2PBYA 1K56A 5LBRA 3IX8A 3PBOA 4Q0IA 1O07A 5AQ9A 1A0KA 1D7EA 2ZOIA 4R38A 3BQAA 3HLBA 4LENA 4ARZB 3M2JA 4ETXA 3MFDA 1FQGA 3T1SA 2Z6CA 4FSFA 5L2FA 3N8SA 4KQOA 2HP9A 4E3LA 4F3LA 3M2KA 2PT7A 3KYQA 4HNBA 4WMCA 1AXBA 1PWDA 1PI5A 1K25A 3ICYA 1PRQA 4EEUA 4MBFA 3KSIA 2PD8A 3QNCA 3Q82A 4EESA 2H0YA 1FILA 2VEAA 1YT4A 3UB9A 3F1NA 4M3KA 1S1ZA 2JBFA 3S22A 5J3WA 3UE1A 3FYZA 3CPTB 4Q0JA 3HJIA 2EWWA 3NI9A 2G7UA 4X25A 3LO7A 3PBQA 3F1OA 5E2HA 3HUMA 1TEMA 1K55A 2XFSA 3TJZC 1T1CA 5KSHA 1Y4OA 4BD1A 5EVIA 3F1PB 3BQ8A 1STZA 2ZC7A 2W1TB 4EEPA 3E4OA 4EBNA 2NUTC 3G32A 4BMWA 1FR6A 1KE3A 4GN2A 5G4ZA 2DCFA 1W5DA 1W63M 1X0OA 3HCYA 5EVEA 2EA9A 3IXHA 4E6WA 1TDGA 1YQSA 4KG6A 2GX5A 3H82A 2V0UA 4Y0OA 3HBRA 3O87A 2WGIA 3IF6B 3U4LP 3A0VA 2X01A 4B4ZA 3G35A 5L07A 5A91A 3FWLA 3IXGA 3C30A 3LR5A 5FA7A 3BYDA 3OLOA 1N9BA 2XH9A 4X69A 3UO9A 5DFYA 3FPWA 1HZOA 4PMAA 4KUKA 1DP9A 3ULFA 4B88A 5HPIA 4S2PA 4KZ5A 3RH8B 3EGDC 3GVBA 1YLWA 3SOIA 1EROA 1JWZA 4PM8A 4JXSA 1ZHHB 4C75A 5AJGA 2BG1A 4GKUA 3QP1A 2Q0OA 1P9RA 1QMEA 2JHEA 3MR0A 1KE0A 4GHIA 4CLCD 3IT9A 3WWXA 2A2LA 3K2NA 1C3BA 4DRTA 1YLTA 4EXOA 3IXDA 4KZ3A 1YLYA 1IFQA 3TE8A 4QHCA 2Y2IA 4LV1A 3MQQA 4JGPA 5FASA 4S2NA 4QB8A 4S2OA 2J3TD 5L09A 3N7WA 2VA0A 3NDEA 5FI7A 2W0NA 3ZNYA 3NOTC 3ZHHA 2LB9A 1UWPX 3EEHA 4OQGA 4CLCE 1F2KA 2OSUA 4ZAMA 1ZG4A 1HD8A 2OAQ1 4IBRA 3VP1A 4GW9A 5FAQA 3UMDA 4JXWA 3LCEA 3V3SA 2XFTA 3HUOA 2DNSA 4HBTA 4N1XA 5DKKA 3O5YA 4KZAA 4OP5A 4I3IA 2G2UA 4A5RA 2ZC6B 4P6BA 1IEMA 3CG5A 3QNBA 1PW8A 1FR1A 2BTFP 2WKHA 4UQIS 3HLFA 1OJGA 2R9WA 2HJ9C 1KDWA 1XFQA 1SCWA 3JPUA 5DTKA 1NYMA 3R7WA 2W1TA 3CHWP 2W1RA 2Z6DA 2WUQA 4C6YA 1YMSA 4ZJ1A 3LR0A 3S7NA 4NK3A 3MBZA 1GSXA 3VFFA 1JVJA 1NLZA 4XUXA 5CERA 5A93A 4R3AA 3T12B 2GJ3A 1WE4A 3AGEA 2EWVA 1G5UA 3PBTA 1P97A 1S67L 3LICA 2VV7A 3QP2A 3F1NB 4JF6A 4EETB 4QU3A 3RTYA 2WKRA 3G6OA 3PHYA 4PKYA 3LGOA 3G30A 3MZEA 4DJ3A 1MKMA 3KSHA 2W3DA 5GLAA 1YPRA 1VEUA 1WYBA 4JF4A 2INWA 5FDHA 1TS6A 5I94A 1H5XA 5F5YA 3C38A 2OLUA 3UPNA 5EUAA 2QKPA 3TRCA 3UDXA 4HHDA 4PPRA 3SS4A 5GHYA 3N6IA 2E8IA 4WEKA 3PYPA 3NULA 5EVLA 1K6RA 4G3VA 3A3FA 3Q7VB 2HDQA 1H0MA 3V39A 1K56D 5TR7A 2XSSA 1SKOB 1WA9A 3OZHA 5EVID 1RGYA 2VGKA 1Y54A 3QP6A 2EFUA 2IWDA 2A49A 1I2SA 3Q07A 1IYPA 4LCLA 3H7WA 1OTIA 2ZOHA 5FAPA 4N92A 1MZUA 2IWBA 1YLPA 2XEPA 4C3QA 4BD0A 2V9AA 4NETA 4KQRA 4R6LA 3NCKA 5DVAA 5AQ7A 3UE3A 5HDSA 2X71A 2ZM2A 4DF6A 3A3DA 4X1LA 3GTCA 3BFDA 4EV4A 4U0TA 5DTTA 4E6XA 2EXAA 3BFCA 1SZVA 4KQQA 3P98A 3HLWA 5EPHA 3R4KA 2VZWA 1H8MA 1ZG6A 3T4OA 3N4IA 2V8FA 2IA2A 2HZ5A 3BY8A 4JF5A 2OWHA 2V0WA 3T50A 3IHBA 5HAIA 3ZG8B 2HPBA 3UDIA 1SKOA 3GECA 2YKHA 2W3EA 4HBUA 3D9YA 3FV7A 2ZM8A 3G34A 3HL9A 1BT5A 2FZ0A 4E3KA 1ESIA 4UA6A 1QMFA 4R3BA 1OT6A 3CUEA 3LIBA 5CGXA 1DP6A 2XK1A 4PAUA 1OTDA 3EGXC 5KSCA 4WUJA 2XA7M 4FH2A 3NBLA 4N9KA 1N9OA 4EWFA 2VK3A 4R23A 5IS1A 1V9YA 1VB6A 4U3TA 3N8LA 4QY5A 4WBGA 3LI8A 3OC2A 1MKIA 1CK3A 5HZHA 1BUEA 5HARA 2Y2LA 5DTSA 4Y7PA 3LI9A 4OH0A 1YLZA 3C4PA 3DW0A 4BL2A 2ZQ9A 2ZC4B 1YSPA 4Q8IA 3UE0A 4FCFA 4GZBA 1F9IA 3V50A 2ZQ8A 1JTDA 3BM6A 2D02A 3CWFA 1E3UA 3H7WB 2HDUA 4DJ2A 4FOFA 5EM0A 1DP8A 3DBAA 3KX0X 5HX9A 4K08A 2QWSA 4E3IA 3WS5A 2Z2LB 1MPLA 5KIZA 3MXQA 4YFMA 1RCJA 3IS2A 4RX2A 3PXPA 4XXRA 2A3UA 3A3EA 2Y91A 5DFXA 2HDSA 3SW1A 1FSWA 3NY4A 5HWWA 4MNRA 1MWUA 3NJAA 4I39A 2Y2QA 4EERA 4MMNA 1OMEA 1JNUA 1ALQA 5HD3A 3RXXA 3D72A 4HJ3A 4XUZA 3VSLA 1OTEA 5MC7A 4AFIA 5M1AA 2W3GA 3F1OB 5C5KA 3G2YA 3ZG9B 2WAFA 1G6AA 4WM9A 1NWZA 1OTAA 1H3QA 2GDNA 2J7VA 4BQMA 4FTXA 5CEDA 2WKPA 3IXBA 1KE4A 4RYEA 5AVFA 1KGEA 5HSQA 3UB7A 4DDSA 3T4SA 4E3NA 1CI9A 4UEYA 3L9KA 2L0WA 3GDIA 1ACFA 3IHAA 1G68A 4S2IA 4DE0A 1Z6FA 3FPVA 3LR3A 3VMAA 3KSGA 3MMHA 2VGLM 4Y2FA 5FQJA 1T1BA 5GLDA 4JGOA 3HLEA 5IT5A 2UWXA 3QP5A 4KZBA 5DJUA 1FSYA 3KYZA 2PD7A 3VP3A 5HWTA 4YOFA 4RA7A 4NXEA 5F82A 1EW0A 3BFFA 1VHMA 1TS7A 4B4XA 2FFFB 3GQZA 5A90A 3C4OA 1T19A 4ZTKA 1GSVA 4CQHA 4R4RA 4DDYA 1DJBA 4CLCA 4P6ZM 3OOVA 4L9FA 3WS1A 4GJ4A 2PHYA 3DWKA 2Y55A 3UDFA 3B47A 2XR0A 4EBPA 5CRFA 2EX9A 2WGVA 4Y0TA 5TFQA 1IELA 1KVMA 3O86A 5CGWA 3LEZA 3N8RA 2J9OA 2O99A 4GHIB 2VJWA 3C7VA 4LPZA 1VQQA 3MZFA 2V1AA 2AVXA 1L0EA 1OT9A 1BZAA 3VP0A 3T1QB 3CAXA 2K2NA 5GHXA 4KENB 3QP4A 4MN5A 5EE8A 4UA7A 5DJTA 3DTMA 4HY8A 4LRYC 3OPLA 5EVIC 1RGZA 1K4FA 2H28A 5EECA 1Q2QA 2B18A 3ITBA 3HLCA 5HDDA 3MXSA 2K31A 4B93A 2ZM0A 4E3JA 3LEQA 1F5MA 1YSQA 1HVBA 4KZ4A 2WADA 3P01A 5JYOA 4O7DA 4PM6A 4KG5A 3LUQA 4WF0A 3ZYTA 3TW8A 4WZ4A 4P85A 4HH2A 3VOZA 1IOUA 2HV1A 4PM7A 1GHMA 4D2OA 4OQIA 1BLPA 3VP4A 4WELA 3JYIA 3RXWA 4MCWA 5G4YA 2P04A 3BLMA 3LIDA 3OCNA 4ID4A 2P9VA 2M1CA 2OLVA 3VE4A 3ZFZA 1XP4A 4MDZA 4EU0A 3NIAA 3V5MA 4XT2A 1LHYA 1MWTA 3DTKA 2VGJA 1NY0A 4BLMA 2XLNA 5CECA 2EX2A 2J9PA 4R1GA 1LI0A 2QMIA 4OVDA 5E2FA 1ESUA 4EQ1A 3DAVA 4CLCC 4LGWA 5EFWA 1HLUP 4P0MA 4JGQA 5BOHA 5GLCA 4S2NC 2Q9MA 1NJ4A 2P08A 3TG9A 4Y5FA 2PYPA 3C8CA 1CF0A 4KZ6A 5TBMA 3PBRA 5EOEA 3CMZA 3V67A 3C2WA 2P74A 4EBLA 2O9BA 4RQ9A 2ZL1A 3MQ0A 3W2ZA 1DY6A 3K3DA 3M6BA 2WGWB 2PR6A 5GLBA 5HFOA 4Z1WA 3G4PA 2OV5A 2M7VA 3RFBA 4QD4A 3NDGA 5F68A 1V9ZA 4LCMA 2JKFA 1FOFA 3ZG7B 1MC0A 1JWPA 2EFXA 2QYBA 2QPNA 1NLYA 4LV0A 5G18A 1K54A 3E0YA 2ACGA 1XJ2A 3S7OA 5E2GA 3BJNA 2O0YA 4HOIA 2XQZA 4NKPA 2ZD8A 1BYWA 5EVIB 1MWSA 4H6JA 2O9AA 1K38A 3OCLA 5JYPA 5FDSA 1L0DA 1MBLA 4KG2A 1XJ4A 4DN0A 4UHUA 1HTZA 3E2LA 2VGLS 1P0ZA 2Y8HA 4G3WA 5FI2A 4G3KA 3NOPC 5CX7A 2ZQCA 3PBSA 2XGNA 1NRFA 4OPYA 1PWGA 2BLSA 2QHKA 4K91A 3B42A 3MS6A 2GZAA 3E98A 2EX8A 3H9WA 5F69A 2PU4A 4EUZA 3PAEA 4X6TA 3PR6A 4IBXA 1BLSA 1BULA 1DRMA 2ZJ9A 5FSRA 1TVFA 1LI9A 5DF8A 5FQMA 1T1AA 2C6WB 2QJ7A 4DE1A 1KOUA 3W4QA 3W4OA 4GD8A 4MBHA 3VOLA 2RL3A 1YLJA 4IVIA 5L8MA 1TDLA 4K0WA 1PW1A 1LL5A 3A3JA 4GB7A 2ZQDA 2P9VB 1S0WA 2KX6A 2V1ZA 5TGFA 5J4EA 1H8YA 1NRJA 4S2MA 4RVAA 2Y2NA 2Q9NA 2I72A 3A0RA 3CPTA 5HD5A 2YKFA 2B02A 2Y2GA 4X68A 3ZQ5A 3MZDA 2X02A 3JVUA 3UMEA 3C7UA 4UQIM 2ZC3B 3IF6A 4IUKA 5FQ9A 1W79A 1JTGA 2B95A 4S2JA 4Y15A 4Z9QA 4OONA 1ES2A 2Y4AA 3FKWA 2OAP1 1MY8A 4E04A 3FG8A 1Q2PA 3KYEA 5TBMB 5HPFA 3LY3A 4LRXC 2D01A 3WRZA 4CPKA 2ZBBA 1I5QA 2V20A 1K55C 4R0QA 3ZVTA 1ZTUA 5M18A 3ZCZA 2R9XA 1XFNA 2JC7A 4JLFA 5FL3A 3PAGA 5F83A 5M19A 1W8QA 3T4QA 4GNUA 5E2EA 2KDKA 4HP9A 3ZG5A 2VLGA 4NXBA 2BASA 1LSWA 4LRZE 1GHIA 3IF5A 3T1RA 2H10A 4E3MA 1XA1A 4P6ZS 3VE3A 1J3WA 3HUNA 1CEGA 2L4RA 3UPOA 3IBJA 1XGIA 5A8BA 3UY6A 3ZNTA 3T1XA 3S1YA 1N9NA 2HP6A 3BRMA 3E2KA 3SH7A 3BWLA 3DTEA 3T4LA 5CEBA 1CQAA 2QJ5A 3VV4A 3IWOA 1L3LA 1E3UD 1OJ5A 4O01A 3W8KA 4JGRA 2ZMVA 1W63Q 1EI5A 2C5WB 1IYSA 1L0FA 5F1FA 1ES3A 3KSFA 3IX3A 2WKEA 2H0TA 1XJ3A 2PDRA 3EOIA 2DMWA 5CTMA 1L2SA 2FH5A 1LL9A 2VKSA 1XPBA 1I2WA 4II7A 1FCNA 3RJUA 3IX4A 5FQKA 2WYXA 1ONGA 4OLDA 4JXVA 3M6HA 1BSGA 3UE6A 4S2LA 4YWZA 4DKIA 2EXBA 1GA9A 3S7PA 4WMCD 3IWIA 4IJGA 2PU2A 1F98A 2NUPC 4BBUA 2PRFA 4QJGA 4ME4A 1ES4A 3HLGA 1DJAA 2XDMA 3BY9A 1TF1A 4IVKA 3V3RA 1YMXA 3Q81A 4FD8A 1UWNX 3Q7VA 3BFEA 2JKRM 4FUWA 2Y2HA 3MSHA 4KZ9A 5HW3A 1G28A 3D4FA 3MFXA 4HI4A 3WRTA 1TS8A 1D1JA 5F1GA 5FEFA 3EQVA 4DXBA 3UNWA 4R3JA 2WKQA 3S4XA 1E25A 1VEUB 1H8ZA 5K5BA 4MEZA 4P87A 4GS9A 4WN5A 4HESA 3R7WB 1T18A 2Y2PA 2Y79A 4KUOA 4U0XA 4O0PA 1PZPA 5CHMA 1K6SA 2Y59A 5EV0A 3O3VA 5TJJA 3NHQA 5E43A 2DRWA 4XT2B 1SHVA 1IKGA 4OPRA 3VOYA 3ISGA 3SZTA 5KZHA 2XA7S 5EOOA 1D06A 3F1PA 4I38A 1BTLA 4OP8A 4CJNA 2FFYA 3PBNA 2PR5A 1M40A 4NXGA 1XA7A 5HAPA 1LSVA 4HJ6A 4JPMA 3CZDA 5AQAA 4N9LA 3CI6A 1S4SA 4OQ0A 5DF7A 3TSGA 5EM1A 1ES5A 1ODVA 1CJFA 5CHJA 3UB5P 3B3XA 1PI4A 2WZXA 4OKPA 1L0GA 5F6AA 1SKFA 3W4PA 2HGVA 4UAAA 3AGFA 1TS0A 1IYOA 4H6JB 1S1YA 4BWIA 1MWRA 1M6KA 1UGUA 2J3TC 1G6OA 1OPXA 3HVFA 4PHTA 2G2WA 5IHVA 4MN7A 4OPZA 1RP5A 1YAXA 4E3OA 3Q7ZA 4Y3IA 3BFGA 1BLCA 2JKGA 4HIAA 4MBKA 4JKTA 3LIAA 2ZC5B 3T4TA 4DXCA 3MF0A 3UN7A 3PTEA 1PFLA 4WZ5C 4L9GA 2A24B 1VM1A 2IWCA 2Y2OA 3FZCA 5FQQA 3QHYA 2OWJA 4WYYA 4GS9B 4GDBA 5CXWA 3GSGA 5FEGA 4M4XA 3MKEA 1KGFA 2CMNA 1W8YA 1ERMA 1SDEA 3GMWA 4OLGA 2Z2MB 1Y28A 2QZ6A 3T4JA 3DWZA 3HJKA 2JKTM 4EQIA 4Y0UA 1NYYA 1EWZA 3WS0A 4NEED 5CGSA 4DE3A 5A92A 3UB6A 1VETB 2UV0E 5D3OA 3UB8A 1PYYA 2VX8A 1PIOA 4MN6A 3LY4A 4N1HA 2W27A 2J8YA 4Q0HA 4GDNA 4EUVA 2J80A 2ZQAA 3U2AA 1NZOA 2V1BA 2P7JA 4QWOA 1W7FA 2Y2MA 4F94A 1FCOA 3OPPA 2OOLA 1KGGA 3G2ZA 1K57A 2JE5A 2HJEA 1S66L 1GHPA 3BECA 4KZ7A 1LL8A 3G31A 3VSKA 4O8GA 2ZL1B 3D3OA 2O9CA 3TOIA 2WKIA 5AQBA 2MJ6A 1NXYA 1CEFA 4WLAA 4H8RA 4JBFA 4Y13A 5J8XA 3SS5A 4K0XA 4GCZA 3L7HA 4S2KA 1KVLA 4ZJ2A 5CHUA 1PWCA 1DJCA 2V2FF 4HEFA 1N4OA 4KZ8A 4BL3A 4WEJA 5DKLA 1J9MA 3OPRA 5L10A 3LYXA 4I3JA 3SS3A 1K0KA 4X53A 5GHZA 1VETA 1K54C 1XX2A 5GL9A 1BLHA 3MKFA 4RX3A 4L9EA 3SH9A 3ZVWA 4GLQA 3NECA 1S4RA 4IHQA 4PM5A 1XXMA 3LIFA 4YNRA 2ZMAA 3E4QA 3KO6A 1GCEA 3I7JA 4GOGA 3IS2B 3EEAA 4ZJ3A 1FCMA 3CUEC 3DTIA 4X1MA 2W3HA 3OBFA 5FI6A 5HL6A 5IU1A 1YKDA 4OPQA 3BEBA 2VV6A 4OQHA 1Z09A 4X56A 4OOYA 3LFVA 4KQDA 2I9VA 4FH4A 3EWKA 1NZUA 1LLBA 1TD5A 4BENA 4YINA 3IQAA 3CLOA 3WS4A 2JKRI 2WAEA 4MLLA 4ZDXA 4L0LA 3MQOA 4PKYG 2JKTI 4GD6A 2K7SA 4X55A 2JN7A 1LT0A 3MXRA 3IH8A 2JCHA 4NXFA 4LV2A 1IYQA 4DE2A 1JWVA 5AVEA 5DF9A 2M7UA 4HJ4A 1OTBA 3BW6A 2XRNA 1XKZA 3O88A 1ZKJA 5U47A 3SH8A 3ZDJA 4BJPA 1YM1A 1PNEA 2E8JA 5HL1A 3C5AA 2PAVP 3FC7A 4R70A 3UPPA 3LR4A 2ZQ7A 4LFUA 2L1MA 1K4EA 1U60A 5FQIA 4BBTA 5J7EA 4WZ5A 4EW7A 2VV8A 2HP5A 4ETZA 2KOIA 2PBDP 3IBRA 4PM9A 1ZC2A 4DMZA 4CLCB 5KMWA 4QPRA 3VP2A 2XD1A 2A24A 4ARZA 1SDNA 3GV9A 4HH3A 4QY6A 3B33A 3ZGAB 2HDRA
chains in the Genus database with same CATH topology
4XUXA 5CERA 3CJMA 3WRTA 5A93A 3ITBA 5F1GA 3WS2A 3EQVA 3FKVA 4DXBA 3UNWA 1WE4A 3AGEA 4R3JA 3HLCA 3PBTA 3MXSA 5CTNA 3S4XA 1E25A 3P09A 2ZM0A 4E3JA 1H8ZA 4JF6A 4MEZA 4P87A 1CI8A 3NC8A 4QU3A 2XF3A 2ZLYA 1WYCA 5FAOA 1HVBA 2H5SA 4R4SA 1ERQA 4HESA 2Y2PA 3A3IA 4KZ4A 5FATA 3IF6C 3Q1FA 4IEDA 2WADA 5JYOA 4U0XA 4O7DA 3G30A 4PM6A 1PZPA 3MZEA 4KG5A 5CHMA 1K6SA 2CC1A 2Y59A 3IWQA 4WZ4A 1E4DA 4P85A 3OPHA 5GLAA 3VOZA 1WYBA 4JF4A 3O3VA 4PM7A 4UA9A 5FDHA 1GHMA 5I94A 4D2OA 5E43A 3BLSA 1H5XA 4OQIA 4ZBEA 1BLPA 2DRWA 2OLUA 2WZZA 3EQUA 3UPNA 5EUAA 2EX6A 3UDXA 1SHVA 3VP4A 4PPRA 3SS4A 1IKGA 5GHYA 4OPRA 4WELA 3JYIA 3N6IA 3VOYA 2E8IA 3VFHA 3ISGA 4WEKA 5EVLA 3HREA 3RXWA 1K6RA 3A3FA 3Q7VB 3BLMA 1IKIA 5KZHA 2HDQA 3OCNA 3V39A 4ID4A 1K56D 2P9VA 5EOOA 5TR7A 2OLVA 4LV3A 3ZFZA 3GRJA 1XP4A 4Z9QA 3NIAA 3V5MA 1BTLA 1LHYA 3OZHA 1MWTA 5EVID 4OP8A 1RGYA 2VGJA 1O7EA 2VGKA 4CJNA 1NY0A 1Y54A 2FFYA 4BLMA 2XLNA 3PBNA 5CECA 2EFUA 2EX2A 2J9PA 4JXGA 4R1GA 1LI0A 1M40A 2QMIA 1MXOA 2XD5A 2IWDA 4OVDA 1XA7A 5HAPA 1ONHA 2A49A 1I2SA 1KDSA 1IYPA 3Q07A 4LCLA 1ESUA 3IH9A 5E2FA 1K57C 2WGWA 4JPMA 4N92A 5FAPA 4OOLA 1XGJA 3GR2A 4P0MA 1YLPA 2IWBA 5BOHA 5GLCA 4S2NC 2Q9MA 2XEPA 3CZDA 5AQAA 4N9LA 4C3QA 4OQ0A 2RCXA 1NJ4A 4BD0A 3TG9A 5DF7A 3ITAA 4KZ6A 4NETA 4KQRA 3TSGA 3PBRA 1PZOA 5EOEA 3CMZA 4OOMA 3NCKA 1ES5A 2P74A 4EBLA 3AGDA 5DVAA 5AQ7A 2Y2JA 3UE3A 3ZG0A 2X71A 2ZM2A 5CHJA 1DY6A 4DF6A 3B3XA 3M6BA 2WGWB 2Y2KA 3A3DA 5GLBA 5HFOA 1PI4A 3GTCA 3G4PA 2WZXA 3HLDA 2OV5A 3BFDA 4OKPA 2WK0A 4EV4A 1L0GA 4QD4A 2B5RA 4U0TA 5DTTA 4E6XA 2EXAA 3BFCA 3NDGA 5HAQA 1S6RA 1GA0A 1SKFA 4KQQA 4LCMA 3W4PA 4UAAA 3AGFA 2PBYA 1FOFA 3ZG7B 1K56A 3P98A 1IYOA 3HLWA 5EPHA 1JWPA 1ZG6A 3PBOA 1MWRA 1M6KA 1O07A 2EFXA 3N4IA 2QPNA 5AQ9A 3HVFA 4JF5A 2G2WA 5IHVA 4LV0A 5G18A 1K54A 4OPZA 1RP5A 3HLBA 5E2GA 4LENA 4E3OA 3IHBA 5HAIA 3M2JA 3Q7ZA 2XQZA 3MFDA 1FQGA 3ZG8B 2HPBA 2ZD8A 3BFGA 1BLCA 3UDIA 4FSFA 4MBKA 5L2FA 4JKTA 5EVIB 1MWSA 3N8SA 2ZC5B 1K38A 3OCLA 4KQOA 4DXCA 5JYPA 2HP9A 3UN7A 1L0DA 3PTEA 4WZ5C 4HBUA 4E3LA 3M2KA 1VM1A 1MBLA 4KG2A 2IWCA 2Y2OA 3FZCA 4UHUA 1HTZA 2ZM8A 3E2LA 3FV7A 3G34A 3QHYA 5FQQA 5FI2A 4WMCA 1AXBA 1PWDA 3HL9A 4WYYA 1PI5A 4GDBA 1K25A 5CXWA 1BT5A 2ZQCA 3GSGA 1ESIA 3PBSA 4UA6A 2XGNA 4E3KA 1QMFA 4R3BA 1NRFA 4MBFA 3MKEA 1KGFA 4OPYA 1PWGA 1ERMA 1SDEA 1W8YA 3Q82A 3QNCA 2BLSA 5CGXA 4K91A 3GMWA 2H0YA 2XK1A 1YT4A 4OLGA 2Z2MB 2QZ6A 2EX8A 4M3KA 2JBFA 5KSCA 3S22A 3UE1A 3DWZA 4FH2A 3NBLA 4N9KA 3FYZA 4EWFA 2PU4A 4EQIA 4Y0UA 1NYYA 4EUZA 4R23A 3PAEA 4X6TA 1EWZA 4U3TA 3N8LA 4QY5A 4IBXA 4WBGA 3NI9A 3WS0A 1BLSA 1BULA 5CGSA 4DE3A 5A92A 2ZJ9A 3OC2A 1MKIA 1CK3A 5FSRA 3LO7A 3PBQA 1TVFA 1LI9A 1BUEA 5DF8A 2C6WB 2Y2LA 5DTSA 5E2HA 3HUMA 5FQMA 1TEMA 5HARA 4Y7PA 5D3OA 1PYYA 3ZGAB 1K55A 2XFSA 4OH0A 4DE1A 3W4QA 1PIOA 3LY4A 4N1HA 3W4OA 4GD8A 4MBHA 5KSHA 1YLZA 3C4PA 3DW0A 2RL3A 1YLJA 5EVIA 4BD1A 2ZQ9A 4BL2A 2ZC4B 4Q8IA 4IVIA 2ZC7A 2J8YA 4GDNA 3UE0A 4EBNA 4FCFA 2ZQAA 1NZOA 4GZBA 1TDLA 3G32A 4K0WA 1FR6A 1KE3A 4GN2A 3V50A 2ZQ8A 1PW1A 1LL5A 3A3JA 2DCFA 4GB7A 1JTDA 1W5DA 1W7FA 2Y2MA 3BM6A 4F94A 1FCOA 3OPPA 2ZQDA 2P9VB 1E3UA 1KGGA 1S0WA 2HDUA 3G2ZA 2V1ZA 1K57A 5TGFA 3IXHA 4E6WA 2JE5A 1TDGA 1H8YA 1YQSA 4KG6A 4Y0OA 3HBRA 5HX9A 3O87A 2WGIA 3IF6B 4S2MA 1GHPA 4RVAA 3BECA 2X01A 4B4ZA 2Y2NA 2Q9NA 4E3IA 3WS5A 2I72A 2Z2LB 1MPLA 4KZ7A 3G31A 3VSKA 4YFMA 3G35A 1RCJA 4RX2A 3TOIA 2WKIA 4XXRA 2A3UA 3A3EA 5A91A 3FWLA 2Y2GA 5AQBA 2Y91A 3IXGA 4X68A 1NXYA 2HDSA 1CEFA 1FSWA 3NY4A 4H8RA 4JBFA 3MZDA 2X02A 5J8XA 5FA7A 3BYDA 3C7UA 3SS5A 4K0XA 4MNRA 1MWUA 4S2KA 2ZC3B 1N9BA 3IF6A 2XH9A 5FQ9A 1W79A 1JTGA 1KVLA 4X69A 4ZJ2A 4S2JA 5CHUA 3UO9A 1PWCA 2Y2QA 1DJCA 2V2FF 4HEFA 1ES2A 1N4OA 2Y4AA 1HZOA 3FKWA 4KZ8A 4OONA 4PMAA 4WEJA 1OMEA 4BL3A 1J9MA 4B88A 1ALQA 3RXXA 3OPRA 4S2PA 4XUZA 1MY8A 3VSLA 4KZ5A 5M1AA 1Q2PA 3GVBA 1YLWA 3SS3A 3SOIA 1EROA 1JWZA 4PM8A 4X53A 5GHZA 3LY3A 4JXSA 1K54C 1XX2A 5GL9A 3WRZA 1BLHA 3G2YA 3MKFA 4C75A 2BG1A 4CPKA 2V20A 1I5QA 1K55C 2WAFA 4GKUA 4RX3A 3ZG9B 3SH9A 4R0QA 3ZVTA 3ZVWA 5M18A 3ZCZA 1G6AA 1QMEA 4WM9A 2R9XA 2JC7A 4JLFA 1KE0A 2GDNA 2J7VA 3IT9A 3PAGA 4BQMA 4PM5A 5F83A 1XXMA 3WWXA 5CEDA 1W8QA 5M19A 3IXBA 1KE4A 4RYEA 2ZMAA 1KGEA 1C3BA 1GCEA 4GNUA 5E2EA 4DRTA 4DDSA 3I7JA 1YLTA 4GOGA 4E3NA 3ZG5A 3IXDA 4KZ3A 1CI9A 4ZJ3A 1GHIA 1YLYA 3IF5A 1FCMA 2H10A 3IHAA 4E3MA 1XA1A 4QHCA 2Y2IA 1G68A 4S2IA 4LV1A 4DE0A 3HUNA 1Z6FA 1CEGA 5FI6A 3UPOA 5FASA 4OPQA 1XGIA 3BEBA 3VMAA 4OQHA 4S2NA 3UY6A 3ZNTA 3S1YA 4X56A 5FQJA 2HP6A 3BRMA 3E2KA 4OOYA 4QB8A 3SH7A 4S2OA 5GLDA 3HLEA 3N7WA 4FH4A 3NDEA 2UWXA 5FI7A 3ZNYA 5CEBA 4KZBA 3ZHHA 1FSYA 1NZUA 1LLBA 3VP3A 4OQGA 4BENA 4YINA 3IWOA 3IQAA 3WS4A 2OSUA 1E3UD 4RA7A 2WAEA 4MLLA 4ZDXA 4L0LA 4ZAMA 5F82A 1ZG4A 3W8KA 1HD8A 3BFFA 1EI5A 4IBRA 2C5WB 4GD6A 1IYSA 1L0FA 2FFFB 4B4XA 5F1FA 1ES3A 3VP1A 3GQZA 2WKEA 4X55A 5A90A 3C4OA 5FAQA 3MXRA 2H0TA 3IH8A 4ZTKA 4JXWA 4R4RA 4DDYA 1DJBA 2JCHA 5CTMA 4LV2A 1L2SA 3WS1A 1IYQA 4DE2A 1JWVA 5DF9A 3DWKA 1LL9A 3LCEA 3V3SA 2Y55A 3UDFA 2XFTA 1XPBA 3HUOA 2XR0A 1I2WA 2DNSA 4HBTA 4N1XA 1FCNA 5CRFA 4EBPA 1XKZA 3O88A 2EX9A 4KZAA 2WGVA 1ZKJA 4OP5A 5FQKA 5TFQA 3RJUA 4Y0TA 5U47A 3SH8A 3ZDJA 1IELA 4BJPA 2WYXA 1KVMA 1YM1A 3O86A 5HL1A 2G2UA 4A5RA 5CGWA 1ONGA 3LEZA 3C5AA 2ZC6B 4OLDA 3N8RA 4P6BA 1IEMA 3CG5A 3QNBA 2J9OA 4JXVA 3M6HA 1PW8A 1BSGA 1FR1A 3C7VA 4S2LA 4DKIA 2WKHA 1VQQA 2EXBA 3HLFA 1GA9A 3UPPA 2ZQ7A 2R9WA 3MZFA 1K4EA 4WMCD 3IWIA 2PU2A 1U60A 5FQIA 1L0EA 4WZ5A 1KDWA 2HP5A 1BZAA 1SCWA 3VP0A 5DTKA 1NYMA 4QJGA 4PM9A 1ZC2A 1ES4A 3HLGA 1DJAA 2XDMA 5KMWA 5GHXA 4KENB 3VP2A 3V3RA 4IVKA 1YMXA 2WUQA 2XD1A 3Q81A 4FD8A 5EE8A 4C6YA 4UA7A 1SDNA 1YMSA 3DTMA 4ZJ1A 3GV9A 3Q7VA 3BFEA 3OPLA 5EVIC 1RGZA 4QY6A 1K4FA 2Y2HA 4NK3A 5EECA 3MBZA 4KZ9A 5HW3A 3VFFA 3D4FA 1JVJA 1Q2QA 2HDRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XUX A;  5CER A;  3CJM A;  3WRT A;  5A93 A;  3ITB A;  5F1G A;  3WS2 A;  3EQV A;  3FKV A;  4DXB A;  3UNW A;  1WE4 A;  3AGE A;  4R3J A;  3HLC A;  3PBT A;  3MXS A;  5CTN A;  3S4X A;  1E25 A;  3P09 A;  2ZM0 A;  4E3J A;  1H8Z A;  4JF6 A;  4MEZ A;  4P87 A;  1CI8 A;  3NC8 A;  4QU3 A;  2XF3 A;  2ZLY A;  1WYC A;  5FAO A;  1HVB A;  2H5S A;  4R4S A;  1ERQ A;  4HES A;  2Y2P A;  3A3I A;  4KZ4 A;  5FAT A;  3IF6 C;  3Q1F A;  4IED A;  2WAD A;  5JYO A;  4U0X A;  4O7D A;  3G30 A;  4PM6 A;  1PZP A;  3MZE A;  4KG5 A;  5CHM A;  1K6S A;  2CC1 A;  2Y59 A;  3IWQ A;  4WZ4 A;  1E4D A;  4P85 A;  3OPH A;  5GLA A;  3VOZ A;  1WYB A;  4JF4 A;  3O3V A;  4PM7 A;  4UA9 A;  5FDH A;  1GHM A;  5I94 A;  4D2O A;  5E43 A;  3BLS A;  1H5X A;  4OQI A;  4ZBE A;  1BLP A;  2DRW A;  2OLU A;  2WZZ A;  3EQU A;  3UPN A;  5EUA A;  2EX6 A;  3UDX A;  1SHV A;  3VP4 A;  4PPR A;  3SS4 A;  1IKG A;  5GHY A;  4OPR A;  4WEL A;  3JYI A;  3N6I A;  3VOY A;  2E8I A;  3VFH A;  3ISG A;  4WEK A;  5EVL A;  3HRE A;  3RXW A;  1K6R A;  3A3F A;  3Q7V B;  3BLM A;  1IKI A;  5KZH A;  2HDQ A;  3OCN A;  3V39 A;  4ID4 A;  1K56 D;  2P9V A;  5EOO A;  5TR7 A;  2OLV A;  4LV3 A;  3ZFZ A;  3GRJ A;  1XP4 A;  4Z9Q A;  3NIA A;  3V5M A;  1BTL A;  1LHY A;  3OZH A;  1MWT A;  5EVI D;  4OP8 A;  1RGY A;  2VGJ A;  1O7E A;  2VGK A;  4CJN A;  1NY0 A;  1Y54 A;  2FFY A;  4BLM A;  2XLN A;  3PBN A;  5CEC A;  2EFU A;  2EX2 A;  2J9P A;  4JXG A;  4R1G A;  1LI0 A;  1M40 A;  2QMI A;  1MXO A;  2XD5 A;  2IWD A;  4OVD A;  1XA7 A;  5HAP A;  1ONH A;  2A49 A;  1I2S A;  1KDS A;  1IYP A;  3Q07 A;  4LCL A;  1ESU A;  3IH9 A;  5E2F A;  1K57 C;  2WGW A;  4JPM A;  4N92 A;  5FAP A;  4OOL A;  1XGJ A;  3GR2 A;  4P0M A;  1YLP A;  2IWB A;  5BOH A;  5GLC A;  4S2N C;  2Q9M A;  2XEP A;  3CZD A;  5AQA A;  4N9L A;  4C3Q A;  4OQ0 A;  2RCX A;  1NJ4 A;  4BD0 A;  3TG9 A;  5DF7 A;  3ITA A;  4KZ6 A;  4NET A;  4KQR A;  3TSG A;  3PBR A;  1PZO A;  5EOE A;  3CMZ A;  4OOM A;  3NCK A;  1ES5 A;  2P74 A;  4EBL A;  3AGD A;  5DVA A;  5AQ7 A;  2Y2J A;  3UE3 A;  3ZG0 A;  2X71 A;  2ZM2 A;  5CHJ A;  1DY6 A;  4DF6 A;  3B3X A;  3M6B A;  2WGW B;  2Y2K A;  3A3D A;  5GLB A;  5HFO A;  1PI4 A;  3GTC A;  3G4P A;  2WZX A;  3HLD A;  2OV5 A;  3BFD A;  4OKP A;  2WK0 A;  4EV4 A;  1L0G A;  4QD4 A;  2B5R A;  4U0T A;  5DTT A;  4E6X A;  2EXA A;  3BFC A;  3NDG A;  5HAQ A;  1S6R A;  1GA0 A;  1SKF A;  4KQQ A;  4LCM A;  3W4P A;  4UAA A;  3AGF A;  2PBY A;  1FOF A;  3ZG7 B;  1K56 A;  3P98 A;  1IYO A;  3HLW A;  5EPH A;  1JWP A;  1ZG6 A;  3PBO A;  1MWR A;  1M6K A;  1O07 A;  2EFX A;  3N4I A;  2QPN A;  5AQ9 A;  3HVF A;  4JF5 A;  2G2W A;  5IHV A;  4LV0 A;  5G18 A;  1K54 A;  4OPZ A;  1RP5 A;  3HLB A;  5E2G A;  4LEN A;  4E3O A;  3IHB A;  5HAI A;  3M2J A;  3Q7Z A;  2XQZ A;  3MFD A;  1FQG A;  3ZG8 B;  2HPB A;  2ZD8 A;  3BFG A;  1BLC A;  3UDI A;  4FSF A;  4MBK A;  5L2F A;  4JKT A;  5EVI B;  1MWS A;  3N8S A;  2ZC5 B;  1K38 A;  3OCL A;  4KQO A;  4DXC A;  5JYP A;  2HP9 A;  3UN7 A;  1L0D A;  3PTE A;  4WZ5 C;  4HBU A;  4E3L A;  3M2K A;  1VM1 A;  1MBL A;  4KG2 A;  2IWC A;  2Y2O A;  3FZC A;  4UHU A;  1HTZ A;  2ZM8 A;  3E2L A;  3FV7 A;  3G34 A;  3QHY A;  5FQQ A;  5FI2 A;  4WMC A;  1AXB A;  1PWD A;  3HL9 A;  4WYY A;  1PI5 A;  4GDB A;  1K25 A;  5CXW A;  1BT5 A;  2ZQC A;  3GSG A;  1ESI A;  3PBS A;  4UA6 A;  2XGN A;  4E3K A;  1QMF A;  4R3B A;  1NRF A;  4MBF A;  3MKE A;  1KGF A;  4OPY A;  1PWG A;  1ERM A;  1SDE A;  1W8Y A;  3Q82 A;  3QNC A;  2BLS A;  5CGX A;  4K91 A;  3GMW A;  2H0Y A;  2XK1 A;  1YT4 A;  4OLG A;  2Z2M B;  2QZ6 A;  2EX8 A;  4M3K A;  2JBF A;  5KSC A;  3S22 A;  3UE1 A;  3DWZ A;  4FH2 A;  3NBL A;  4N9K A;  3FYZ A;  4EWF A;  2PU4 A;  4EQI A;  4Y0U A;  1NYY A;  4EUZ A;  4R23 A;  3PAE A;  4X6T A;  1EWZ A;  4U3T A;  3N8L A;  4QY5 A;  4IBX A;  4WBG A;  3NI9 A;  3WS0 A;  1BLS A;  1BUL A;  5CGS A;  4DE3 A;  5A92 A;  2ZJ9 A;  3OC2 A;  1MKI A;  1CK3 A;  5FSR A;  3LO7 A;  3PBQ A;  1TVF A;  1LI9 A;  1BUE A;  5DF8 A;  2C6W B;  2Y2L A;  5DTS A;  5E2H A;  3HUM A;  5FQM A;  1TEM A;  5HAR A;  4Y7P A;  5D3O A;  1PYY A;  3ZGA B;  1K55 A;  2XFS A;  4OH0 A;  4DE1 A;  3W4Q A;  1PIO A;  3LY4 A;  4N1H A;  3W4O A;  4GD8 A;  4MBH A;  5KSH A;  1YLZ A;  3C4P A;  3DW0 A;  2RL3 A;  1YLJ A;  5EVI A;  4BD1 A;  2ZQ9 A;  4BL2 A;  2ZC4 B;  4Q8I A;  4IVI A;  2ZC7 A;  2J8Y A;  4GDN A;  3UE0 A;  4EBN A;  4FCF A;  2ZQA A;  1NZO A;  4GZB A;  1TDL A;  3G32 A;  4K0W A;  1FR6 A;  1KE3 A;  4GN2 A;  3V50 A;  2ZQ8 A;  1PW1 A;  1LL5 A;  3A3J A;  2DCF A;  4GB7 A;  1JTD A;  1W5D A;  1W7F A;  2Y2M A;  3BM6 A;  4F94 A;  1FCO A;  3OPP A;  2ZQD A;  2P9V B;  1E3U A;  1KGG A;  1S0W A;  2HDU A;  3G2Z A;  2V1Z A;  1K57 A;  5TGF A;  3IXH A;  4E6W A;  2JE5 A;  1TDG A;  1H8Y A;  1YQS A;  4KG6 A;  4Y0O A;  3HBR A;  5HX9 A;  3O87 A;  2WGI A;  3IF6 B;  4S2M A;  1GHP A;  4RVA A;  3BEC A;  2X01 A;  4B4Z A;  2Y2N A;  2Q9N A;  4E3I A;  3WS5 A;  2I72 A;  2Z2L B;  1MPL A;  4KZ7 A;  3G31 A;  3VSK A;  4YFM A;  3G35 A;  1RCJ A;  4RX2 A;  3TOI A;  2WKI A;  4XXR A;  2A3U A;  3A3E A;  5A91 A;  3FWL A;  2Y2G A;  5AQB A;  2Y91 A;  3IXG A;  4X68 A;  1NXY A;  2HDS A;  1CEF A;  1FSW A;  3NY4 A;  4H8R A;  4JBF A;  3MZD A;  2X02 A;  5J8X A;  5FA7 A;  3BYD A;  3C7U A;  3SS5 A;  4K0X A;  4MNR A;  1MWU A;  4S2K A;  2ZC3 B;  1N9B A;  3IF6 A;  2XH9 A;  5FQ9 A;  1W79 A;  1JTG A;  1KVL A;  4X69 A;  4ZJ2 A;  4S2J A;  5CHU A;  3UO9 A;  1PWC A;  2Y2Q A;  1DJC A;  2V2F F;  4HEF A;  1ES2 A;  1N4O A;  2Y4A A;  1HZO A;  3FKW A;  4KZ8 A;  4OON A;  4PMA A;  4WEJ A;  1OME A;  4BL3 A;  1J9M A;  4B88 A;  1ALQ A;  3RXX A;  3OPR A;  4S2P A;  4XUZ A;  1MY8 A;  3VSL A;  4KZ5 A;  5M1A A;  1Q2P A;  3GVB A;  1YLW A;  3SS3 A;  3SOI A;  1ERO A;  1JWZ A;  4PM8 A;  4X53 A;  5GHZ A;  3LY3 A;  4JXS A;  1K54 C;  1XX2 A;  5GL9 A;  3WRZ A;  1BLH A;  3G2Y A;  3MKF A;  4C75 A;  2BG1 A;  4CPK A;  2V20 A;  1I5Q A;  1K55 C;  2WAF A;  4GKU A;  4RX3 A;  3ZG9 B;  3SH9 A;  4R0Q A;  3ZVT A;  3ZVW A;  5M18 A;  3ZCZ A;  1G6A A;  1QME A;  4WM9 A;  2R9X A;  2JC7 A;  4JLF A;  1KE0 A;  2GDN A;  2J7V A;  3IT9 A;  3PAG A;  4BQM A;  4PM5 A;  5F83 A;  1XXM A;  3WWX A;  5CED A;  1W8Q A;  5M19 A;  3IXB A;  1KE4 A;  4RYE A;  2ZMA A;  1KGE A;  1C3B A;  1GCE A;  4GNU A;  5E2E A;  4DRT A;  4DDS A;  3I7J A;  1YLT A;  4GOG A;  4E3N A;  3ZG5 A;  3IXD A;  4KZ3 A;  1CI9 A;  4ZJ3 A;  1GHI A;  1YLY A;  3IF5 A;  1FCM A;  2H10 A;  3IHA A;  4E3M A;  1XA1 A;  4QHC A;  2Y2I A;  1G68 A;  4S2I A;  4LV1 A;  4DE0 A;  3HUN A;  1Z6F A;  1CEG A;  5FI6 A;  3UPO A;  5FAS A;  4OPQ A;  1XGI A;  3BEB A;  3VMA A;  4OQH A;  4S2N A;  3UY6 A;  3ZNT A;  3S1Y A;  4X56 A;  5FQJ A;  2HP6 A;  3BRM A;  3E2K A;  4OOY A;  4QB8 A;  3SH7 A;  4S2O A;  5GLD A;  3HLE A;  3N7W A;  4FH4 A;  3NDE A;  2UWX A;  5FI7 A;  3ZNY A;  5CEB A;  4KZB A;  3ZHH A;  1FSY A;  1NZU A;  1LLB A;  3VP3 A;  4OQG A;  4BEN A;  4YIN A;  3IWO A;  3IQA A;  3WS4 A;  2OSU A;  1E3U D;  4RA7 A;  2WAE A;  4MLL A;  4ZDX A;  4L0L A;  4ZAM A;  5F82 A;  1ZG4 A;  3W8K A;  1HD8 A;  3BFF A;  1EI5 A;  4IBR A;  2C5W B;  4GD6 A;  1IYS A;  1L0F A;  2FFF B;  4B4X A;  5F1F A;  1ES3 A;  3VP1 A;  3GQZ A;  2WKE A;  4X55 A;  5A90 A;  3C4O A;  5FAQ A;  3MXR A;  2H0T A;  3IH8 A;  4ZTK A;  4JXW A;  4R4R A;  4DDY A;  1DJB A;  2JCH A;  5CTM A;  4LV2 A;  1L2S A;  3WS1 A;  1IYQ A;  4DE2 A;  1JWV A;  5DF9 A;  3DWK A;  1LL9 A;  3LCE A;  3V3S A;  2Y55 A;  3UDF A;  2XFT A;  1XPB A;  3HUO A;  2XR0 A;  1I2W A;  2DNS A;  4HBT A;  4N1X A;  1FCN A;  5CRF A;  4EBP A;  1XKZ A;  3O88 A;  2EX9 A;  4KZA A;  2WGV A;  1ZKJ A;  4OP5 A;  5FQK A;  5TFQ A;  3RJU A;  4Y0T A;  5U47 A;  3SH8 A;  3ZDJ A;  1IEL A;  4BJP A;  2WYX A;  1KVM A;  1YM1 A;  3O86 A;  5HL1 A;  2G2U A;  4A5R A;  5CGW A;  1ONG A;  3LEZ A;  3C5A A;  2ZC6 B;  4OLD A;  3N8R A;  4P6B A;  1IEM A;  3CG5 A;  3QNB A;  2J9O A;  4JXV A;  3M6H A;  1PW8 A;  1BSG A;  1FR1 A;  3C7V A;  4S2L A;  4DKI A;  2WKH A;  1VQQ A;  2EXB A;  3HLF A;  1GA9 A;  3UPP A;  2ZQ7 A;  2R9W A;  3MZF A;  1K4E A;  4WMC D;  3IWI A;  2PU2 A;  1U60 A;  5FQI A;  1L0E A;  4WZ5 A;  1KDW A;  2HP5 A;  1BZA A;  1SCW A;  3VP0 A;  5DTK A;  1NYM A;  4QJG A;  4PM9 A;  1ZC2 A;  1ES4 A;  3HLG A;  1DJA A;  2XDM A;  5KMW A;  5GHX A;  4KEN B;  3VP2 A;  3V3R A;  4IVK A;  1YMX A;  2WUQ A;  2XD1 A;  3Q81 A;  4FD8 A;  5EE8 A;  4C6Y A;  4UA7 A;  1SDN A;  1YMS A;  3DTM A;  4ZJ1 A;  3GV9 A;  3Q7V A;  3BFE A;  3OPL A;  5EVI C;  1RGZ A;  4QY6 A;  1K4F A;  2Y2H A;  4NK3 A;  5EEC A;  3MBZ A;  4KZ9 A;  5HW3 A;  3VFF A;  3D4F A;  1JVJ A;  1Q2Q A;  2HDR A; 
#chains in the Genus database with same CATH topology
 3CJM A;  3WS2 A;  1N9L A;  2W3F A;  3FKV A;  3JVV A;  1P9W A;  3NOU C;  5CTN A;  4D60 A;  3P09 A;  3S7Q A;  1CI8 A;  3NC8 A;  4WL9 A;  2XF3 A;  2ZLY A;  4LLO B;  1WYC A;  3CIT A;  5FAO A;  4I3A A;  2H5S A;  4R4S A;  1ERQ A;  3LIE A;  3A3I A;  5FAT A;  3IF6 C;  3Q1F A;  4IED A;  4F3L B;  4HP4 A;  2CC1 A;  2J3W A;  3IWQ A;  1E4D A;  4ESP A;  3OPH A;  3E4P A;  5HDC A;  4HQA A;  1LSX A;  2LB5 A;  4UA9 A;  3BLS A;  4B9O A;  5HWV A;  4Y17 A;  4ZBE A;  3EQU A;  2WZZ A;  2EX6 A;  3QP8 A;  3H82 B;  3VFH A;  3HRE A;  1XJ6 A;  3A0S A;  5I5L A;  1IKI A;  3MJQ A;  4LV3 A;  2GNX A;  3GRJ A;  4IUH A;  2KLI A;  4ZRR A;  1GSW A;  1O7E A;  3P7N A;  2PYR A;  4NG2 A;  4JXG A;  1MXO A;  2XD5 A;  1ONH A;  1KDS A;  3IH9 A;  1K57 C;  2XRO A;  1FIK A;  2WGW A;  4OOL A;  1XGJ A;  3GR2 A;  3K3C A;  2HF6 A;  4BBV A;  3T4K A;  2RCX A;  2V8C A;  3ITA A;  1PZO A;  4I5S A;  4OOM A;  3AGD A;  2Y2J A;  3ZG0 A;  2Y2K A;  3HLD A;  2WK0 A;  2R78 A;  2B5R A;  1AWI A;  5HAQ A;  1S6R A;  2ZMF A;  1GA0 A;  2PBY A;  1K56 A;  5LBR A;  3IX8 A;  3PBO A;  4Q0I A;  1O07 A;  5AQ9 A;  1A0K A;  1D7E A;  2ZOI A;  4R38 A;  3BQA A;  3HLB A;  4LEN A;  4ARZ B;  3M2J A;  4ETX A;  3MFD A;  1FQG A;  3T1S A;  2Z6C A;  4FSF A;  5L2F A;  3N8S A;  4KQO A;  2HP9 A;  4E3L A;  4F3L A;  3M2K A;  2PT7 A;  3KYQ A;  4HNB A;  4WMC A;  1AXB A;  1PWD A;  1PI5 A;  1K25 A;  3ICY A;  1PRQ A;  4EEU A;  4MBF A;  3KSI A;  2PD8 A;  3QNC A;  3Q82 A;  4EES A;  2H0Y A;  1FIL A;  2VEA A;  1YT4 A;  3UB9 A;  3F1N A;  4M3K A;  1S1Z A;  2JBF A;  3S22 A;  5J3W A;  3UE1 A;  3FYZ A;  3CPT B;  4Q0J A;  3HJI A;  2EWW A;  3NI9 A;  2G7U A;  4X25 A;  3LO7 A;  3PBQ A;  3F1O A;  5E2H A;  3HUM A;  1TEM A;  1K55 A;  2XFS A;  3TJZ C;  1T1C A;  5KSH A;  1Y4O A;  4BD1 A;  5EVI A;  3F1P B;  3BQ8 A;  1STZ A;  2ZC7 A;  2W1T B;  4EEP A;  3E4O A;  4EBN A;  2NUT C;  3G32 A;  4BMW A;  1FR6 A;  1KE3 A;  4GN2 A;  5G4Z A;  2DCF A;  1W5D A;  1W63 M;  1X0O A;  3HCY A;  5EVE A;  2EA9 A;  3IXH A;  4E6W A;  1TDG A;  1YQS A;  4KG6 A;  2GX5 A;  3H82 A;  2V0U A;  4Y0O A;  3HBR A;  3O87 A;  2WGI A;  3IF6 B;  3U4L P;  3A0V A;  2X01 A;  4B4Z A;  3G35 A;  5L07 A;  5A91 A;  3FWL A;  3IXG A;  3C30 A;  3LR5 A;  5FA7 A;  3BYD A;  3OLO A;  1N9B A;  2XH9 A;  4X69 A;  3UO9 A;  5DFY A;  3FPW A;  1HZO A;  4PMA A;  4KUK A;  1DP9 A;  3ULF A;  4B88 A;  5HPI A;  4S2P A;  4KZ5 A;  3RH8 B;  3EGD C;  3GVB A;  1YLW A;  3SOI A;  1ERO A;  1JWZ A;  4PM8 A;  4JXS A;  1ZHH B;  4C75 A;  5AJG A;  2BG1 A;  4GKU A;  3QP1 A;  2Q0O A;  1P9R A;  1QME A;  2JHE A;  3MR0 A;  1KE0 A;  4GHI A;  4CLC D;  3IT9 A;  3WWX A;  2A2L A;  3K2N A;  1C3B A;  4DRT A;  1YLT A;  4EXO A;  3IXD A;  4KZ3 A;  1YLY A;  1IFQ A;  3TE8 A;  4QHC A;  2Y2I A;  4LV1 A;  3MQQ A;  4JGP A;  5FAS A;  4S2N A;  4QB8 A;  4S2O A;  2J3T D;  5L09 A;  3N7W A;  2VA0 A;  3NDE A;  5FI7 A;  2W0N A;  3ZNY A;  3NOT C;  3ZHH A;  2LB9 A;  1UWP X;  3EEH A;  4OQG A;  4CLC E;  1F2K A;  2OSU A;  4ZAM A;  1ZG4 A;  1HD8 A;  2OAQ 1;  4IBR A;  3VP1 A;  4GW9 A;  5FAQ A;  3UMD A;  4JXW A;  3LCE A;  3V3S A;  2XFT A;  3HUO A;  2DNS A;  4HBT A;  4N1X A;  5DKK A;  3O5Y A;  4KZA A;  4OP5 A;  4I3I A;  2G2U A;  4A5R A;  2ZC6 B;  4P6B A;  1IEM A;  3CG5 A;  3QNB A;  1PW8 A;  1FR1 A;  2BTF P;  2WKH A;  4UQI S;  3HLF A;  1OJG A;  2R9W A;  2HJ9 C;  1KDW A;  1XFQ A;  1SCW A;  3JPU A;  5DTK A;  1NYM A;  3R7W A;  2W1T A;  3CHW P;  2W1R A;  2Z6D A;  2WUQ A;  4C6Y A;  1YMS A;  4ZJ1 A;  3LR0 A;  3S7N A;  4NK3 A;  3MBZ A;  1GSX A;  3VFF A;  1JVJ A;  1NLZ A;  4XUX A;  5CER A;  5A93 A;  4R3A A;  3T12 B;  2GJ3 A;  1WE4 A;  3AGE A;  2EWV A;  1G5U A;  3PBT A;  1P97 A;  1S67 L;  3LIC A;  2VV7 A;  3QP2 A;  3F1N B;  4JF6 A;  4EET B;  4QU3 A;  3RTY A;  2WKR A;  3G6O A;  3PHY A;  4PKY A;  3LGO A;  3G30 A;  3MZE A;  4DJ3 A;  1MKM A;  3KSH A;  2W3D A;  5GLA A;  1YPR A;  1VEU A;  1WYB A;  4JF4 A;  2INW A;  5FDH A;  1TS6 A;  5I94 A;  1H5X A;  5F5Y A;  3C38 A;  2OLU A;  3UPN A;  5EUA A;  2QKP A;  3TRC A;  3UDX A;  4HHD A;  4PPR A;  3SS4 A;  5GHY A;  3N6I A;  2E8I A;  4WEK A;  3PYP A;  3NUL A;  5EVL A;  1K6R A;  4G3V A;  3A3F A;  3Q7V B;  2HDQ A;  1H0M A;  3V39 A;  1K56 D;  5TR7 A;  2XSS A;  1SKO B;  1WA9 A;  3OZH A;  5EVI D;  1RGY A;  2VGK A;  1Y54 A;  3QP6 A;  2EFU A;  2IWD A;  2A49 A;  1I2S A;  3Q07 A;  1IYP A;  4LCL A;  3H7W A;  1OTI A;  2ZOH A;  5FAP A;  4N92 A;  1MZU A;  2IWB A;  1YLP A;  2XEP A;  4C3Q A;  4BD0 A;  2V9A A;  4NET A;  4KQR A;  4R6L A;  3NCK A;  5DVA A;  5AQ7 A;  3UE3 A;  5HDS A;  2X71 A;  2ZM2 A;  4DF6 A;  3A3D A;  4X1L A;  3GTC A;  3BFD A;  4EV4 A;  4U0T A;  5DTT A;  4E6X A;  2EXA A;  3BFC A;  1SZV A;  4KQQ A;  3P98 A;  3HLW A;  5EPH A;  3R4K A;  2VZW A;  1H8M A;  1ZG6 A;  3T4O A;  3N4I A;  2V8F A;  2IA2 A;  2HZ5 A;  3BY8 A;  4JF5 A;  2OWH A;  2V0W A;  3T50 A;  3IHB A;  5HAI A;  3ZG8 B;  2HPB A;  3UDI A;  1SKO A;  3GEC A;  2YKH A;  2W3E A;  4HBU A;  3D9Y A;  3FV7 A;  2ZM8 A;  3G34 A;  3HL9 A;  1BT5 A;  2FZ0 A;  4E3K A;  1ESI A;  4UA6 A;  1QMF A;  4R3B A;  1OT6 A;  3CUE A;  3LIB A;  5CGX A;  1DP6 A;  2XK1 A;  4PAU A;  1OTD A;  3EGX C;  5KSC A;  4WUJ A;  2XA7 M;  4FH2 A;  3NBL A;  4N9K A;  1N9O A;  4EWF A;  2VK3 A;  4R23 A;  5IS1 A;  1V9Y A;  1VB6 A;  4U3T A;  3N8L A;  4QY5 A;  4WBG A;  3LI8 A;  3OC2 A;  1MKI A;  1CK3 A;  5HZH A;  1BUE A;  5HAR A;  2Y2L A;  5DTS A;  4Y7P A;  3LI9 A;  4OH0 A;  1YLZ A;  3C4P A;  3DW0 A;  4BL2 A;  2ZQ9 A;  2ZC4 B;  1YSP A;  4Q8I A;  3UE0 A;  4FCF A;  4GZB A;  1F9I A;  3V50 A;  2ZQ8 A;  1JTD A;  3BM6 A;  2D02 A;  3CWF A;  1E3U A;  3H7W B;  2HDU A;  4DJ2 A;  4FOF A;  5EM0 A;  1DP8 A;  3DBA A;  3KX0 X;  5HX9 A;  4K08 A;  2QWS A;  4E3I A;  3WS5 A;  2Z2L B;  1MPL A;  5KIZ A;  3MXQ A;  4YFM A;  1RCJ A;  3IS2 A;  4RX2 A;  3PXP A;  4XXR A;  2A3U A;  3A3E A;  2Y91 A;  5DFX A;  2HDS A;  3SW1 A;  1FSW A;  3NY4 A;  5HWW A;  4MNR A;  1MWU A;  3NJA A;  4I39 A;  2Y2Q A;  4EER A;  4MMN A;  1OME A;  1JNU A;  1ALQ A;  5HD3 A;  3RXX A;  3D72 A;  4HJ3 A;  4XUZ A;  3VSL A;  1OTE A;  5MC7 A;  4AFI A;  5M1A A;  2W3G A;  3F1O B;  5C5K A;  3G2Y A;  3ZG9 B;  2WAF A;  1G6A A;  4WM9 A;  1NWZ A;  1OTA A;  1H3Q A;  2GDN A;  2J7V A;  4BQM A;  4FTX A;  5CED A;  2WKP A;  3IXB A;  1KE4 A;  4RYE A;  5AVF A;  1KGE A;  5HSQ A;  3UB7 A;  4DDS A;  3T4S A;  4E3N A;  1CI9 A;  4UEY A;  3L9K A;  2L0W A;  3GDI A;  1ACF A;  3IHA A;  1G68 A;  4S2I A;  4DE0 A;  1Z6F A;  3FPV A;  3LR3 A;  3VMA A;  3KSG A;  3MMH A;  2VGL M;  4Y2F A;  5FQJ A;  1T1B A;  5GLD A;  4JGO A;  3HLE A;  5IT5 A;  2UWX A;  3QP5 A;  4KZB A;  5DJU A;  1FSY A;  3KYZ A;  2PD7 A;  3VP3 A;  5HWT A;  4YOF A;  4RA7 A;  4NXE A;  5F82 A;  1EW0 A;  3BFF A;  1VHM A;  1TS7 A;  4B4X A;  2FFF B;  3GQZ A;  5A90 A;  3C4O A;  1T19 A;  4ZTK A;  1GSV A;  4CQH A;  4R4R A;  4DDY A;  1DJB A;  4CLC A;  4P6Z M;  3OOV A;  4L9F A;  3WS1 A;  4GJ4 A;  2PHY A;  3DWK A;  2Y55 A;  3UDF A;  3B47 A;  2XR0 A;  4EBP A;  5CRF A;  2EX9 A;  2WGV A;  4Y0T A;  5TFQ A;  1IEL A;  1KVM A;  3O86 A;  5CGW A;  3LEZ A;  3N8R A;  2J9O A;  2O99 A;  4GHI B;  2VJW A;  3C7V A;  4LPZ A;  1VQQ A;  3MZF A;  2V1A A;  2AVX A;  1L0E A;  1OT9 A;  1BZA A;  3VP0 A;  3T1Q B;  3CAX A;  2K2N A;  5GHX A;  4KEN B;  3QP4 A;  4MN5 A;  5EE8 A;  4UA7 A;  5DJT A;  3DTM A;  4HY8 A;  4LRY C;  3OPL A;  5EVI C;  1RGZ A;  1K4F A;  2H28 A;  5EEC A;  1Q2Q A;  2B18 A;  3ITB A;  3HLC A;  5HDD A;  3MXS A;  2K31 A;  4B93 A;  2ZM0 A;  4E3J A;  3LEQ A;  1F5M A;  1YSQ A;  1HVB A;  4KZ4 A;  2WAD A;  3P01 A;  5JYO A;  4O7D A;  4PM6 A;  4KG5 A;  3LUQ A;  4WF0 A;  3ZYT A;  3TW8 A;  4WZ4 A;  4P85 A;  4HH2 A;  3VOZ A;  1IOU A;  2HV1 A;  4PM7 A;  1GHM A;  4D2O A;  4OQI A;  1BLP A;  3VP4 A;  4WEL A;  3JYI A;  3RXW A;  4MCW A;  5G4Y A;  2P04 A;  3BLM A;  3LID A;  3OCN A;  4ID4 A;  2P9V A;  2M1C A;  2OLV A;  3VE4 A;  3ZFZ A;  1XP4 A;  4MDZ A;  4EU0 A;  3NIA A;  3V5M A;  4XT2 A;  1LHY A;  1MWT A;  3DTK A;  2VGJ A;  1NY0 A;  4BLM A;  2XLN A;  5CEC A;  2EX2 A;  2J9P A;  4R1G A;  1LI0 A;  2QMI A;  4OVD A;  5E2F A;  1ESU A;  4EQ1 A;  3DAV A;  4CLC C;  4LGW A;  5EFW A;  1HLU P;  4P0M A;  4JGQ A;  5BOH A;  5GLC A;  4S2N C;  2Q9M A;  1NJ4 A;  2P08 A;  3TG9 A;  4Y5F A;  2PYP A;  3C8C A;  1CF0 A;  4KZ6 A;  5TBM A;  3PBR A;  5EOE A;  3CMZ A;  3V67 A;  3C2W A;  2P74 A;  4EBL A;  2O9B A;  4RQ9 A;  2ZL1 A;  3MQ0 A;  3W2Z A;  1DY6 A;  3K3D A;  3M6B A;  2WGW B;  2PR6 A;  5GLB A;  5HFO A;  4Z1W A;  3G4P A;  2OV5 A;  2M7V A;  3RFB A;  4QD4 A;  3NDG A;  5F68 A;  1V9Z A;  4LCM A;  2JKF A;  1FOF A;  3ZG7 B;  1MC0 A;  1JWP A;  2EFX A;  2QYB A;  2QPN A;  1NLY A;  4LV0 A;  5G18 A;  1K54 A;  3E0Y A;  2ACG A;  1XJ2 A;  3S7O A;  5E2G A;  3BJN A;  2O0Y A;  4HOI A;  2XQZ A;  4NKP A;  2ZD8 A;  1BYW A;  5EVI B;  1MWS A;  4H6J A;  2O9A A;  1K38 A;  3OCL A;  5JYP A;  5FDS A;  1L0D A;  1MBL A;  4KG2 A;  1XJ4 A;  4DN0 A;  4UHU A;  1HTZ A;  3E2L A;  2VGL S;  1P0Z A;  2Y8H A;  4G3W A;  5FI2 A;  4G3K A;  3NOP C;  5CX7 A;  2ZQC A;  3PBS A;  2XGN A;  1NRF A;  4OPY A;  1PWG A;  2BLS A;  2QHK A;  4K91 A;  3B42 A;  3MS6 A;  2GZA A;  3E98 A;  2EX8 A;  3H9W A;  5F69 A;  2PU4 A;  4EUZ A;  3PAE A;  4X6T A;  3PR6 A;  4IBX A;  1BLS A;  1BUL A;  1DRM A;  2ZJ9 A;  5FSR A;  1TVF A;  1LI9 A;  5DF8 A;  5FQM A;  1T1A A;  2C6W B;  2QJ7 A;  4DE1 A;  1KOU A;  3W4Q A;  3W4O A;  4GD8 A;  4MBH A;  3VOL A;  2RL3 A;  1YLJ A;  4IVI A;  5L8M A;  1TDL A;  4K0W A;  1PW1 A;  1LL5 A;  3A3J A;  4GB7 A;  2ZQD A;  2P9V B;  1S0W A;  2KX6 A;  2V1Z A;  5TGF A;  5J4E A;  1H8Y A;  1NRJ A;  4S2M A;  4RVA A;  2Y2N A;  2Q9N A;  2I72 A;  3A0R A;  3CPT A;  5HD5 A;  2YKF A;  2B02 A;  2Y2G A;  4X68 A;  3ZQ5 A;  3MZD A;  2X02 A;  3JVU A;  3UME A;  3C7U A;  4UQI M;  2ZC3 B;  3IF6 A;  4IUK A;  5FQ9 A;  1W79 A;  1JTG A;  2B95 A;  4S2J A;  4Y15 A;  4Z9Q A;  4OON A;  1ES2 A;  2Y4A A;  3FKW A;  2OAP 1;  1MY8 A;  4E04 A;  3FG8 A;  1Q2P A;  3KYE A;  5TBM B;  5HPF A;  3LY3 A;  4LRX C;  2D01 A;  3WRZ A;  4CPK A;  2ZBB A;  1I5Q A;  2V20 A;  1K55 C;  4R0Q A;  3ZVT A;  1ZTU A;  5M18 A;  3ZCZ A;  2R9X A;  1XFN A;  2JC7 A;  4JLF A;  5FL3 A;  3PAG A;  5F83 A;  5M19 A;  1W8Q A;  3T4Q A;  4GNU A;  5E2E A;  2KDK A;  4HP9 A;  3ZG5 A;  2VLG A;  4NXB A;  2BAS A;  1LSW A;  4LRZ E;  1GHI A;  3IF5 A;  3T1R A;  2H10 A;  4E3M A;  1XA1 A;  4P6Z S;  3VE3 A;  1J3W A;  3HUN A;  1CEG A;  2L4R A;  3UPO A;  3IBJ A;  1XGI A;  5A8B A;  3UY6 A;  3ZNT A;  3T1X A;  3S1Y A;  1N9N A;  2HP6 A;  3BRM A;  3E2K A;  3SH7 A;  3BWL A;  3DTE A;  3T4L A;  5CEB A;  1CQA A;  2QJ5 A;  3VV4 A;  3IWO A;  1L3L A;  1E3U D;  1OJ5 A;  4O01 A;  3W8K A;  4JGR A;  2ZMV A;  1W63 Q;  1EI5 A;  2C5W B;  1IYS A;  1L0F A;  5F1F A;  1ES3 A;  3KSF A;  3IX3 A;  2WKE A;  2H0T A;  1XJ3 A;  2PDR A;  3EOI A;  2DMW A;  5CTM A;  1L2S A;  2FH5 A;  1LL9 A;  2VKS A;  1XPB A;  1I2W A;  4II7 A;  1FCN A;  3RJU A;  3IX4 A;  5FQK A;  2WYX A;  1ONG A;  4OLD A;  4JXV A;  3M6H A;  1BSG A;  3UE6 A;  4S2L A;  4YWZ A;  4DKI A;  2EXB A;  1GA9 A;  3S7P A;  4WMC D;  3IWI A;  4IJG A;  2PU2 A;  1F98 A;  2NUP C;  4BBU A;  2PRF A;  4QJG A;  4ME4 A;  1ES4 A;  3HLG A;  1DJA A;  2XDM A;  3BY9 A;  1TF1 A;  4IVK A;  3V3R A;  1YMX A;  3Q81 A;  4FD8 A;  1UWN X;  3Q7V A;  3BFE A;  2JKR M;  4FUW A;  2Y2H A;  3MSH A;  4KZ9 A;  5HW3 A;  1G28 A;  3D4F A;  3MFX A;  4HI4 A;  3WRT A;  1TS8 A;  1D1J A;  5F1G A;  5FEF A;  3EQV A;  4DXB A;  3UNW A;  4R3J A;  2WKQ A;  3S4X A;  1E25 A;  1VEU B;  1H8Z A;  5K5B A;  4MEZ A;  4P87 A;  4GS9 A;  4WN5 A;  4HES A;  3R7W B;  1T18 A;  2Y2P A;  2Y79 A;  4KUO A;  4U0X A;  4O0P A;  1PZP A;  5CHM A;  1K6S A;  2Y59 A;  5EV0 A;  3O3V A;  5TJJ A;  3NHQ A;  5E43 A;  2DRW A;  4XT2 B;  1SHV A;  1IKG A;  4OPR A;  3VOY A;  3ISG A;  3SZT A;  5KZH A;  2XA7 S;  5EOO A;  1D06 A;  3F1P A;  4I38 A;  1BTL A;  4OP8 A;  4CJN A;  2FFY A;  3PBN A;  2PR5 A;  1M40 A;  4NXG A;  1XA7 A;  5HAP A;  1LSV A;  4HJ6 A;  4JPM A;  3CZD A;  5AQA A;  4N9L A;  3CI6 A;  1S4S A;  4OQ0 A;  5DF7 A;  3TSG A;  5EM1 A;  1ES5 A;  1ODV A;  1CJF A;  5CHJ A;  3UB5 P;  3B3X A;  1PI4 A;  2WZX A;  4OKP A;  1L0G A;  5F6A A;  1SKF A;  3W4P A;  2HGV A;  4UAA A;  3AGF A;  1TS0 A;  1IYO A;  4H6J B;  1S1Y A;  4BWI A;  1MWR A;  1M6K A;  1UGU A;  2J3T C;  1G6O A;  1OPX A;  3HVF A;  4PHT A;  2G2W A;  5IHV A;  4MN7 A;  4OPZ A;  1RP5 A;  1YAX A;  4E3O A;  3Q7Z A;  4Y3I A;  3BFG A;  1BLC A;  2JKG A;  4HIA A;  4MBK A;  4JKT A;  3LIA A;  2ZC5 B;  3T4T A;  4DXC A;  3MF0 A;  3UN7 A;  3PTE A;  1PFL A;  4WZ5 C;  4L9G A;  2A24 B;  1VM1 A;  2IWC A;  2Y2O A;  3FZC A;  5FQQ A;  3QHY A;  2OWJ A;  4WYY A;  4GS9 B;  4GDB A;  5CXW A;  3GSG A;  5FEG A;  4M4X A;  3MKE A;  1KGF A;  2CMN A;  1W8Y A;  1ERM A;  1SDE A;  3GMW A;  4OLG A;  2Z2M B;  1Y28 A;  2QZ6 A;  3T4J A;  3DWZ A;  3HJK A;  2JKT M;  4EQI A;  4Y0U A;  1NYY A;  1EWZ A;  3WS0 A;  4NEE D;  5CGS A;  4DE3 A;  5A92 A;  3UB6 A;  1VET B;  2UV0 E;  5D3O A;  3UB8 A;  1PYY A;  2VX8 A;  1PIO A;  4MN6 A;  3LY4 A;  4N1H A;  2W27 A;  2J8Y A;  4Q0H A;  4GDN A;  4EUV A;  2J80 A;  2ZQA A;  3U2A A;  1NZO A;  2V1B A;  2P7J A;  4QWO A;  1W7F A;  2Y2M A;  4F94 A;  1FCO A;  3OPP A;  2OOL A;  1KGG A;  3G2Z A;  1K57 A;  2JE5 A;  2HJE A;  1S66 L;  1GHP A;  3BEC A;  4KZ7 A;  1LL8 A;  3G31 A;  3VSK A;  4O8G A;  2ZL1 B;  3D3O A;  2O9C A;  3TOI A;  2WKI A;  5AQB A;  2MJ6 A;  1NXY A;  1CEF A;  4WLA A;  4H8R A;  4JBF A;  4Y13 A;  5J8X A;  3SS5 A;  4K0X A;  4GCZ A;  3L7H A;  4S2K A;  1KVL A;  4ZJ2 A;  5CHU A;  1PWC A;  1DJC A;  2V2F F;  4HEF A;  1N4O A;  4KZ8 A;  4BL3 A;  4WEJ A;  5DKL A;  1J9M A;  3OPR A;  5L10 A;  3LYX A;  4I3J A;  3SS3 A;  1K0K A;  4X53 A;  5GHZ A;  1VET A;  1K54 C;  1XX2 A;  5GL9 A;  1BLH A;  3MKF A;  4RX3 A;  4L9E A;  3SH9 A;  3ZVW A;  4GLQ A;  3NEC A;  1S4R A;  4IHQ A;  4PM5 A;  1XXM A;  3LIF A;  4YNR A;  2ZMA A;  3E4Q A;  3KO6 A;  1GCE A;  3I7J A;  4GOG A;  3IS2 B;  3EEA A;  4ZJ3 A;  1FCM A;  3CUE C;  3DTI A;  4X1M A;  2W3H A;  3OBF A;  5FI6 A;  5HL6 A;  5IU1 A;  1YKD A;  4OPQ A;  3BEB A;  2VV6 A;  4OQH A;  1Z09 A;  4X56 A;  4OOY A;  3LFV A;  4KQD A;  2I9V A;  4FH4 A;  3EWK A;  1NZU A;  1LLB A;  1TD5 A;  4BEN A;  4YIN A;  3IQA A;  3CLO A;  3WS4 A;  2JKR I;  2WAE A;  4MLL A;  4ZDX A;  4L0L A;  3MQO A;  4PKY G;  2JKT I;  4GD6 A;  2K7S A;  4X55 A;  2JN7 A;  1LT0 A;  3MXR A;  3IH8 A;  2JCH A;  4NXF A;  4LV2 A;  1IYQ A;  4DE2 A;  1JWV A;  5AVE A;  5DF9 A;  2M7U A;  4HJ4 A;  1OTB A;  3BW6 A;  2XRN A;  1XKZ A;  3O88 A;  1ZKJ A;  5U47 A;  3SH8 A;  3ZDJ A;  4BJP A;  1YM1 A;  1PNE A;  2E8J A;  5HL1 A;  3C5A A;  2PAV P;  3FC7 A;  4R70 A;  3UPP A;  3LR4 A;  2ZQ7 A;  4LFU A;  2L1M A;  1K4E A;  1U60 A;  5FQI A;  4BBT A;  5J7E A;  4WZ5 A;  4EW7 A;  2VV8 A;  2HP5 A;  4ETZ A;  2KOI A;  2PBD P;  3IBR A;  4PM9 A;  1ZC2 A;  4DMZ A;  4CLC B;  5KMW A;  4QPR A;  3VP2 A;  2XD1 A;  2A24 A;  4ARZ A;  1SDN A;  3GV9 A;  4HH3 A;  4QY6 A;  3B33 A;  3ZGA B;  2HDR A; 
#chains in the Genus database with same CATH homology
 4XUX A;  5CER A;  3CJM A;  3WRT A;  5A93 A;  3ITB A;  5F1G A;  3WS2 A;  3EQV A;  3FKV A;  4DXB A;  3UNW A;  1WE4 A;  3AGE A;  4R3J A;  3HLC A;  3PBT A;  3MXS A;  5CTN A;  3S4X A;  1E25 A;  3P09 A;  2ZM0 A;  4E3J A;  1H8Z A;  4JF6 A;  4MEZ A;  4P87 A;  1CI8 A;  3NC8 A;  4QU3 A;  2XF3 A;  2ZLY A;  1WYC A;  5FAO A;  1HVB A;  2H5S A;  4R4S A;  1ERQ A;  4HES A;  2Y2P A;  3A3I A;  4KZ4 A;  5FAT A;  3IF6 C;  3Q1F A;  4IED A;  2WAD A;  5JYO A;  4U0X A;  4O7D A;  3G30 A;  4PM6 A;  1PZP A;  3MZE A;  4KG5 A;  5CHM A;  1K6S A;  2CC1 A;  2Y59 A;  3IWQ A;  4WZ4 A;  1E4D A;  4P85 A;  3OPH A;  5GLA A;  3VOZ A;  1WYB A;  4JF4 A;  3O3V A;  4PM7 A;  4UA9 A;  5FDH A;  1GHM A;  5I94 A;  4D2O A;  5E43 A;  3BLS A;  1H5X A;  4OQI A;  4ZBE A;  1BLP A;  2DRW A;  2OLU A;  2WZZ A;  3EQU A;  3UPN A;  5EUA A;  2EX6 A;  3UDX A;  1SHV A;  3VP4 A;  4PPR A;  3SS4 A;  1IKG A;  5GHY A;  4OPR A;  4WEL A;  3JYI A;  3N6I A;  3VOY A;  2E8I A;  3VFH A;  3ISG A;  4WEK A;  5EVL A;  3HRE A;  3RXW A;  1K6R A;  3A3F A;  3Q7V B;  3BLM A;  1IKI A;  5KZH A;  2HDQ A;  3OCN A;  3V39 A;  4ID4 A;  1K56 D;  2P9V A;  5EOO A;  5TR7 A;  2OLV A;  4LV3 A;  3ZFZ A;  3GRJ A;  1XP4 A;  4Z9Q A;  3NIA A;  3V5M A;  1BTL A;  1LHY A;  3OZH A;  1MWT A;  5EVI D;  4OP8 A;  1RGY A;  2VGJ A;  1O7E A;  2VGK A;  4CJN A;  1NY0 A;  1Y54 A;  2FFY A;  4BLM A;  2XLN A;  3PBN A;  5CEC A;  2EFU A;  2EX2 A;  2J9P A;  4JXG A;  4R1G A;  1LI0 A;  1M40 A;  2QMI A;  1MXO A;  2XD5 A;  2IWD A;  4OVD A;  1XA7 A;  5HAP A;  1ONH A;  2A49 A;  1I2S A;  1KDS A;  1IYP A;  3Q07 A;  4LCL A;  1ESU A;  3IH9 A;  5E2F A;  1K57 C;  2WGW A;  4JPM A;  4N92 A;  5FAP A;  4OOL A;  1XGJ A;  3GR2 A;  4P0M A;  1YLP A;  2IWB A;  5BOH A;  5GLC A;  4S2N C;  2Q9M A;  2XEP A;  3CZD A;  5AQA A;  4N9L A;  4C3Q A;  4OQ0 A;  2RCX A;  1NJ4 A;  4BD0 A;  3TG9 A;  5DF7 A;  3ITA A;  4KZ6 A;  4NET A;  4KQR A;  3TSG A;  3PBR A;  1PZO A;  5EOE A;  3CMZ A;  4OOM A;  3NCK A;  1ES5 A;  2P74 A;  4EBL A;  3AGD A;  5DVA A;  5AQ7 A;  2Y2J A;  3UE3 A;  3ZG0 A;  2X71 A;  2ZM2 A;  5CHJ A;  1DY6 A;  4DF6 A;  3B3X A;  3M6B A;  2WGW B;  2Y2K A;  3A3D A;  5GLB A;  5HFO A;  1PI4 A;  3GTC A;  3G4P A;  2WZX A;  3HLD A;  2OV5 A;  3BFD A;  4OKP A;  2WK0 A;  4EV4 A;  1L0G A;  4QD4 A;  2B5R A;  4U0T A;  5DTT A;  4E6X A;  2EXA A;  3BFC A;  3NDG A;  5HAQ A;  1S6R A;  1GA0 A;  1SKF A;  4KQQ A;  4LCM A;  3W4P A;  4UAA A;  3AGF A;  2PBY A;  1FOF A;  3ZG7 B;  1K56 A;  3P98 A;  1IYO A;  3HLW A;  5EPH A;  1JWP A;  1ZG6 A;  3PBO A;  1MWR A;  1M6K A;  1O07 A;  2EFX A;  3N4I A;  2QPN A;  5AQ9 A;  3HVF A;  4JF5 A;  2G2W A;  5IHV A;  4LV0 A;  5G18 A;  1K54 A;  4OPZ A;  1RP5 A;  3HLB A;  5E2G A;  4LEN A;  4E3O A;  3IHB A;  5HAI A;  3M2J A;  3Q7Z A;  2XQZ A;  3MFD A;  1FQG A;  3ZG8 B;  2HPB A;  2ZD8 A;  3BFG A;  1BLC A;  3UDI A;  4FSF A;  4MBK A;  5L2F A;  4JKT A;  5EVI B;  1MWS A;  3N8S A;  2ZC5 B;  1K38 A;  3OCL A;  4KQO A;  4DXC A;  5JYP A;  2HP9 A;  3UN7 A;  1L0D A;  3PTE A;  4WZ5 C;  4HBU A;  4E3L A;  3M2K A;  1VM1 A;  1MBL A;  4KG2 A;  2IWC A;  2Y2O A;  3FZC A;  4UHU A;  1HTZ A;  2ZM8 A;  3E2L A;  3FV7 A;  3G34 A;  3QHY A;  5FQQ A;  5FI2 A;  4WMC A;  1AXB A;  1PWD A;  3HL9 A;  4WYY A;  1PI5 A;  4GDB A;  1K25 A;  5CXW A;  1BT5 A;  2ZQC A;  3GSG A;  1ESI A;  3PBS A;  4UA6 A;  2XGN A;  4E3K A;  1QMF A;  4R3B A;  1NRF A;  4MBF A;  3MKE A;  1KGF A;  4OPY A;  1PWG A;  1ERM A;  1SDE A;  1W8Y A;  3Q82 A;  3QNC A;  2BLS A;  5CGX A;  4K91 A;  3GMW A;  2H0Y A;  2XK1 A;  1YT4 A;  4OLG A;  2Z2M B;  2QZ6 A;  2EX8 A;  4M3K A;  2JBF A;  5KSC A;  3S22 A;  3UE1 A;  3DWZ A;  4FH2 A;  3NBL A;  4N9K A;  3FYZ A;  4EWF A;  2PU4 A;  4EQI A;  4Y0U A;  1NYY A;  4EUZ A;  4R23 A;  3PAE A;  4X6T A;  1EWZ A;  4U3T A;  3N8L A;  4QY5 A;  4IBX A;  4WBG A;  3NI9 A;  3WS0 A;  1BLS A;  1BUL A;  5CGS A;  4DE3 A;  5A92 A;  2ZJ9 A;  3OC2 A;  1MKI A;  1CK3 A;  5FSR A;  3LO7 A;  3PBQ A;  1TVF A;  1LI9 A;  1BUE A;  5DF8 A;  2C6W B;  2Y2L A;  5DTS A;  5E2H A;  3HUM A;  5FQM A;  1TEM A;  5HAR A;  4Y7P A;  5D3O A;  1PYY A;  3ZGA B;  1K55 A;  2XFS A;  4OH0 A;  4DE1 A;  3W4Q A;  1PIO A;  3LY4 A;  4N1H A;  3W4O A;  4GD8 A;  4MBH A;  5KSH A;  1YLZ A;  3C4P A;  3DW0 A;  2RL3 A;  1YLJ A;  5EVI A;  4BD1 A;  2ZQ9 A;  4BL2 A;  2ZC4 B;  4Q8I A;  4IVI A;  2ZC7 A;  2J8Y A;  4GDN A;  3UE0 A;  4EBN A;  4FCF A;  2ZQA A;  1NZO A;  4GZB A;  1TDL A;  3G32 A;  4K0W A;  1FR6 A;  1KE3 A;  4GN2 A;  3V50 A;  2ZQ8 A;  1PW1 A;  1LL5 A;  3A3J A;  2DCF A;  4GB7 A;  1JTD A;  1W5D A;  1W7F A;  2Y2M A;  3BM6 A;  4F94 A;  1FCO A;  3OPP A;  2ZQD A;  2P9V B;  1E3U A;  1KGG A;  1S0W A;  2HDU A;  3G2Z A;  2V1Z A;  1K57 A;  5TGF A;  3IXH A;  4E6W A;  2JE5 A;  1TDG A;  1H8Y A;  1YQS A;  4KG6 A;  4Y0O A;  3HBR A;  5HX9 A;  3O87 A;  2WGI A;  3IF6 B;  4S2M A;  1GHP A;  4RVA A;  3BEC A;  2X01 A;  4B4Z A;  2Y2N A;  2Q9N A;  4E3I A;  3WS5 A;  2I72 A;  2Z2L B;  1MPL A;  4KZ7 A;  3G31 A;  3VSK A;  4YFM A;  3G35 A;  1RCJ A;  4RX2 A;  3TOI A;  2WKI A;  4XXR A;  2A3U A;  3A3E A;  5A91 A;  3FWL A;  2Y2G A;  5AQB A;  2Y91 A;  3IXG A;  4X68 A;  1NXY A;  2HDS A;  1CEF A;  1FSW A;  3NY4 A;  4H8R A;  4JBF A;  3MZD A;  2X02 A;  5J8X A;  5FA7 A;  3BYD A;  3C7U A;  3SS5 A;  4K0X A;  4MNR A;  1MWU A;  4S2K A;  2ZC3 B;  1N9B A;  3IF6 A;  2XH9 A;  5FQ9 A;  1W79 A;  1JTG A;  1KVL A;  4X69 A;  4ZJ2 A;  4S2J A;  5CHU A;  3UO9 A;  1PWC A;  2Y2Q A;  1DJC A;  2V2F F;  4HEF A;  1ES2 A;  1N4O A;  2Y4A A;  1HZO A;  3FKW A;  4KZ8 A;  4OON A;  4PMA A;  4WEJ A;  1OME A;  4BL3 A;  1J9M A;  4B88 A;  1ALQ A;  3RXX A;  3OPR A;  4S2P A;  4XUZ A;  1MY8 A;  3VSL A;  4KZ5 A;  5M1A A;  1Q2P A;  3GVB A;  1YLW A;  3SS3 A;  3SOI A;  1ERO A;  1JWZ A;  4PM8 A;  4X53 A;  5GHZ A;  3LY3 A;  4JXS A;  1K54 C;  1XX2 A;  5GL9 A;  3WRZ A;  1BLH A;  3G2Y A;  3MKF A;  4C75 A;  2BG1 A;  4CPK A;  2V20 A;  1I5Q A;  1K55 C;  2WAF A;  4GKU A;  4RX3 A;  3ZG9 B;  3SH9 A;  4R0Q A;  3ZVT A;  3ZVW A;  5M18 A;  3ZCZ A;  1G6A A;  1QME A;  4WM9 A;  2R9X A;  2JC7 A;  4JLF A;  1KE0 A;  2GDN A;  2J7V A;  3IT9 A;  3PAG A;  4BQM A;  4PM5 A;  5F83 A;  1XXM A;  3WWX A;  5CED A;  1W8Q A;  5M19 A;  3IXB A;  1KE4 A;  4RYE A;  2ZMA A;  1KGE A;  1C3B A;  1GCE A;  4GNU A;  5E2E A;  4DRT A;  4DDS A;  3I7J A;  1YLT A;  4GOG A;  4E3N A;  3ZG5 A;  3IXD A;  4KZ3 A;  1CI9 A;  4ZJ3 A;  1GHI A;  1YLY A;  3IF5 A;  1FCM A;  2H10 A;  3IHA A;  4E3M A;  1XA1 A;  4QHC A;  2Y2I A;  1G68 A;  4S2I A;  4LV1 A;  4DE0 A;  3HUN A;  1Z6F A;  1CEG A;  5FI6 A;  3UPO A;  5FAS A;  4OPQ A;  1XGI A;  3BEB A;  3VMA A;  4OQH A;  4S2N A;  3UY6 A;  3ZNT A;  3S1Y A;  4X56 A;  5FQJ A;  2HP6 A;  3BRM A;  3E2K A;  4OOY A;  4QB8 A;  3SH7 A;  4S2O A;  5GLD A;  3HLE A;  3N7W A;  4FH4 A;  3NDE A;  2UWX A;  5FI7 A;  3ZNY A;  5CEB A;  4KZB A;  3ZHH A;  1FSY A;  1NZU A;  1LLB A;  3VP3 A;  4OQG A;  4BEN A;  4YIN A;  3IWO A;  3IQA A;  3WS4 A;  2OSU A;  1E3U D;  4RA7 A;  2WAE A;  4MLL A;  4ZDX A;  4L0L A;  4ZAM A;  5F82 A;  1ZG4 A;  3W8K A;  1HD8 A;  3BFF A;  1EI5 A;  4IBR A;  2C5W B;  4GD6 A;  1IYS A;  1L0F A;  2FFF B;  4B4X A;  5F1F A;  1ES3 A;  3VP1 A;  3GQZ A;  2WKE A;  4X55 A;  5A90 A;  3C4O A;  5FAQ A;  3MXR A;  2H0T A;  3IH8 A;  4ZTK A;  4JXW A;  4R4R A;  4DDY A;  1DJB A;  2JCH A;  5CTM A;  4LV2 A;  1L2S A;  3WS1 A;  1IYQ A;  4DE2 A;  1JWV A;  5DF9 A;  3DWK A;  1LL9 A;  3LCE A;  3V3S A;  2Y55 A;  3UDF A;  2XFT A;  1XPB A;  3HUO A;  2XR0 A;  1I2W A;  2DNS A;  4HBT A;  4N1X A;  1FCN A;  5CRF A;  4EBP A;  1XKZ A;  3O88 A;  2EX9 A;  4KZA A;  2WGV A;  1ZKJ A;  4OP5 A;  5FQK A;  5TFQ A;  3RJU A;  4Y0T A;  5U47 A;  3SH8 A;  3ZDJ A;  1IEL A;  4BJP A;  2WYX A;  1KVM A;  1YM1 A;  3O86 A;  5HL1 A;  2G2U A;  4A5R A;  5CGW A;  1ONG A;  3LEZ A;  3C5A A;  2ZC6 B;  4OLD A;  3N8R A;  4P6B A;  1IEM A;  3CG5 A;  3QNB A;  2J9O A;  4JXV A;  3M6H A;  1PW8 A;  1BSG A;  1FR1 A;  3C7V A;  4S2L A;  4DKI A;  2WKH A;  1VQQ A;  2EXB A;  3HLF A;  1GA9 A;  3UPP A;  2ZQ7 A;  2R9W A;  3MZF A;  1K4E A;  4WMC D;  3IWI A;  2PU2 A;  1U60 A;  5FQI A;  1L0E A;  4WZ5 A;  1KDW A;  2HP5 A;  1BZA A;  1SCW A;  3VP0 A;  5DTK A;  1NYM A;  4QJG A;  4PM9 A;  1ZC2 A;  1ES4 A;  3HLG A;  1DJA A;  2XDM A;  5KMW A;  5GHX A;  4KEN B;  3VP2 A;  3V3R A;  4IVK A;  1YMX A;  2WUQ A;  2XD1 A;  3Q81 A;  4FD8 A;  5EE8 A;  4C6Y A;  4UA7 A;  1SDN A;  1YMS A;  3DTM A;  4ZJ1 A;  3GV9 A;  3Q7V A;  3BFE A;  3OPL A;  5EVI C;  1RGZ A;  4QY6 A;  1K4F A;  2Y2H A;  4NK3 A;  5EEC A;  3MBZ A;  4KZ9 A;  5HW3 A;  3VFF A;  3D4F A;  1JVJ A;  1Q2Q A;  2HDR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...