3GMZA

Crystal of human arginase in complex with l-ornithine. resolution 1.43 a.
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
315
structure length
315
Chain Sequence
SRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginase-1
publication title Binding of alpha,alpha-Disubstituted Amino Acids to Arginase Suggests New Avenues for Inhibitor Design
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 116
structure length 315
sequence length 315
chains with identical sequence B
ec nomenclature ec 3.5.3.1: Arginase.
pdb deposition date 2009-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 3gmzA00
1ZPGA 2RLAA 4Q3RC 4Q42A 2PHOA 4IU4A 1HQGA 3E9BA 1CEVA 4DZ4A 2CEVA 3E6VA 4RHJA 4RHIA 4Q3QA 4MYLA 4FCIA 1T4PA 1ZPEA 2AEBA 4HXQA 4MYFA 4Q40A 1P8OA 4IXVA 4CEVA 4Q3PA 4IU0A 3TH7A 1T5FA 3MFWA 1HQFA 1D3VA 4IE1A 4RHQA 3LHLA 1GQ6A 5HJ9A 3RLAA 2A0MA 2EF5A 3SL1A 1RLAA 1TA1A 1WVBA 2EIVA 2EF4A 2PHAA 4IE3A 4Q3UA 4MYKA 3NIPA 1XFKA 3E8QA 4Q3RA 1P8PA 4GSMA 1R1OA 4RHLA 1WOIA 1HQ5A 3PZLA 3TF3A 1T4SA 4GWDA 3M1RA 3KV2A 4GWCA 2PLLA 4GSVA 1HQXA 1T4RA 4MXRA 4IXUA 1GQ7A 3MJLA 1TBHA 1TBJA 3MMRA 3SL0A 4Q41A 3GMZA 4IE2A 4G3HA 4RHKA 3LP7A 1P8QA 4Q3TA 1WOHA 3THJA 3GN0A 1WVAA 1T5GA 1WOGA 4RHMA 4IU5A 5RLAA 4GSZA 1P8RA 4ITYA 1T4TA 5HJAA 3THEA 1HQHA 2ZAVA 4HWWA 3NIOA 4I06A 4Q3SA 1P8MA 4FCKA 3NIQA 4Q3VA 1P8SA 1PQ3A 4IU1A 3E8ZA 3MFVA 3DJ8A 4RLAA 1TBLA 5CEVA 4MYNA 3LP4A 3SKKA 3F80A 3THHA 1P8NA 4HZEA 3SJTA 3E6KA 3CEVA
chains in the Genus database with same CATH superfamily
1ZPGA 3MZ3A 4BZ7A 5G1AA 4CBYA 2RLAA 4Q3RC 4Q42A 3EW8A 4QA1A 2VCGA 5EFBD 5G3WA 5DC8A 5EFGA 2PHOA 5THTA 5G13A 1C3RA 5G0JA 5ICNB 4IU4A 1HQGA 3E9BA 1CEVA 4DZ4A 2CEVA 3E6VA 4RHJA 3Q9CA 4RHIA 4Q3QA 4MYLA 1C3PA 4FCIA 1T4PA 1ZPEA 3C0YA 5G0IA 2AEBA 5D1BA 3MZ6A 4RN0A 3MAXA 1C3SA 1W22A 5G12A 4HXQA 5G10A 5EF8A 4MYFA 4Q40A 4QA2A 5LI3A 3F0RA 5EF7A 1VKGA 1P8OA 4IXVA 4BKXB 4CEVA 4ZUPA 4Q3PA 4IU0A 5EFKB 1T5FA 3TH7A 3MFWA 2VQQA 4QA4A 5DC5A 1HQFA 5EFNA 1D3VA 4BZ5A 5DC6A 4IE1A 5A2SA 4RHQA 3LHLA 3F06A 3RQDA 1GQ6A 5HJ9A 5JI5A 3RLAA 2A0MA 2EF5A 3SL1A 1RLAA 5BWZA 5EFJD 4QA6A 1TA1A 1WVBA 2EIVA 5EENA 2EF4A 2PHAA 4IE3A 4Q3UA 4ZUOA 4MYKA 3MENA 3NIPA 4RN1A 4ZUNA 1XFKA 3ZNSA 3E8QA 4A69A 1ZZ1A 5FCWA 4QA3A 5THUA 2V5XA 3Q9FA 3C10A 1P8PA 4Q3RA 4CQFA 4GSMA 5G11A 3ZNRA 3EWFA 1R1OA 5THVA 4RHLA 1WOIA 1HQ5A 3PZLA 3TF3A 1T4SA 4GWDA 3M1RA 3MZ7A 3KV2A 5D1CA 4GWCA 2PLLA 4GSVA 1HQXA 1T4RA 4MXRA 4IXUA 1GQ7A 3MJLA 4QA7A 1TBHA 5D1DA 3C0ZA 1TBJA 3MMRA 5G1BA 3SL0A 4Q41A 3GMZA 3Q9EA 4ZURA 3SFFA 3SFHA 4IE2A 4G3HA 4RHKA 3EZPA 3LP7A 5DC7A 1P8QA 2GH6A 4Q3TA 1WOHA 3THJA 3GN0A 5THSA 1WVAA 1T5GA 5G0XA 1WOGA 4RHMA 4IU5A 4ZUMA 5RLAA 2VQMA 4GSZA 1P8RA 4ITYA 4LXZA 3EZTA 4QA0A 5EEFA 2VQJA 5IX0A 5G0GA 1T4TA 4CBTA 5G0HA 5EEKA 1T69A 4RN2A 4LY1A 5HJAA 3THEA 1HQHA 1ZZ3A 2ZAVA 4HWWA 3NIOA 4I06A 4QA5A 4Q3SA 4ZUQA 1P8MA 5IWGA 2VQOA 5G0YA 1T67A 5G17A 4BZ8A 1ZZ0A 3NIQA 4FCKA 5FUEA 1T64A 4Q3VA 2V5WA 1P8SA 1PQ3A 3MZ4A 4IU1A 3E8ZA 4BZ9A 3MFVA 3DJ8A 4BZ6A 4RLAA 1TBLA 5CEVA 4MYNA 5EFHA 2VQWG 3LP4A 5EEIA 5G1CA 3F80A 5EEMA 3F07A 1P8NA 2VQVA 4HZEA 3SKKA 3THHA 3Q9BA 3SJTA 3E6KA 3CEVA
chains in the Genus database with same CATH topology
1ZPGA 2RLAA 4Q3RC 4Q42A 2PHOA 4IU4A 1HQGA 3E9BA 1CEVA 4DZ4A 2CEVA 3E6VA 4RHJA 4RHIA 4Q3QA 4MYLA 4FCIA 1T4PA 1ZPEA 2AEBA 4HXQA 4MYFA 4Q40A 1P8OA 4IXVA 4CEVA 4Q3PA 4IU0A 3TH7A 1T5FA 3MFWA 1HQFA 1D3VA 4IE1A 4RHQA 3LHLA 1GQ6A 5HJ9A 3RLAA 2A0MA 2EF5A 3SL1A 1RLAA 1TA1A 1WVBA 2EIVA 2EF4A 2PHAA 4IE3A 4Q3UA 4MYKA 3NIPA 1XFKA 3E8QA 4Q3RA 1P8PA 4GSMA 1R1OA 4RHLA 1WOIA 1HQ5A 3PZLA 3TF3A 1T4SA 4GWDA 3M1RA 3KV2A 4GWCA 2PLLA 4GSVA 1HQXA 1T4RA 4MXRA 4IXUA 1GQ7A 3MJLA 1TBHA 1TBJA 3MMRA 3SL0A 4Q41A 3GMZA 4IE2A 4G3HA 4RHKA 3LP7A 1P8QA 4Q3TA 1WOHA 3THJA 3GN0A 1WVAA 1T5GA 1WOGA 4RHMA 4IU5A 5RLAA 4GSZA 1P8RA 4ITYA 1T4TA 5HJAA 3THEA 1HQHA 2ZAVA 4HWWA 3NIOA 4I06A 4Q3SA 1P8MA 4FCKA 3NIQA 4Q3VA 1P8SA 1PQ3A 4IU1A 3E8ZA 3MFVA 3DJ8A 4RLAA 1TBLA 5CEVA 4MYNA 3LP4A 3SKKA 3F80A 3THHA 1P8NA 4HZEA 3SJTA 3E6KA 3CEVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZPG A;  2RLA A;  4Q3R C;  4Q42 A;  2PHO A;  4IU4 A;  1HQG A;  3E9B A;  1CEV A;  4DZ4 A;  2CEV A;  3E6V A;  4RHJ A;  4RHI A;  4Q3Q A;  4MYL A;  4FCI A;  1T4P A;  1ZPE A;  2AEB A;  4HXQ A;  4MYF A;  4Q40 A;  1P8O A;  4IXV A;  4CEV A;  4Q3P A;  4IU0 A;  3TH7 A;  1T5F A;  3MFW A;  1HQF A;  1D3V A;  4IE1 A;  4RHQ A;  3LHL A;  1GQ6 A;  5HJ9 A;  3RLA A;  2A0M A;  2EF5 A;  3SL1 A;  1RLA A;  1TA1 A;  1WVB A;  2EIV A;  2EF4 A;  2PHA A;  4IE3 A;  4Q3U A;  4MYK A;  3NIP A;  1XFK A;  3E8Q A;  4Q3R A;  1P8P A;  4GSM A;  1R1O A;  4RHL A;  1WOI A;  1HQ5 A;  3PZL A;  3TF3 A;  1T4S A;  4GWD A;  3M1R A;  3KV2 A;  4GWC A;  2PLL A;  4GSV A;  1HQX A;  1T4R A;  4MXR A;  4IXU A;  1GQ7 A;  3MJL A;  1TBH A;  1TBJ A;  3MMR A;  3SL0 A;  4Q41 A;  3GMZ A;  4IE2 A;  4G3H A;  4RHK A;  3LP7 A;  1P8Q A;  4Q3T A;  1WOH A;  3THJ A;  3GN0 A;  1WVA A;  1T5G A;  1WOG A;  4RHM A;  4IU5 A;  5RLA A;  4GSZ A;  1P8R A;  4ITY A;  1T4T A;  5HJA A;  3THE A;  1HQH A;  2ZAV A;  4HWW A;  3NIO A;  4I06 A;  4Q3S A;  1P8M A;  4FCK A;  3NIQ A;  4Q3V A;  1P8S A;  1PQ3 A;  4IU1 A;  3E8Z A;  3MFV A;  3DJ8 A;  4RLA A;  1TBL A;  5CEV A;  4MYN A;  3LP4 A;  3SKK A;  3F80 A;  3THH A;  1P8N A;  4HZE A;  3SJT A;  3E6K A;  3CEV A; 
#chains in the Genus database with same CATH topology
 1ZPG A;  3MZ3 A;  4BZ7 A;  5G1A A;  4CBY A;  2RLA A;  4Q3R C;  4Q42 A;  3EW8 A;  4QA1 A;  2VCG A;  5EFB D;  5G3W A;  5DC8 A;  5EFG A;  2PHO A;  5THT A;  5G13 A;  1C3R A;  5G0J A;  5ICN B;  4IU4 A;  1HQG A;  3E9B A;  1CEV A;  4DZ4 A;  2CEV A;  3E6V A;  4RHJ A;  3Q9C A;  4RHI A;  4Q3Q A;  4MYL A;  1C3P A;  4FCI A;  1T4P A;  1ZPE A;  3C0Y A;  5G0I A;  2AEB A;  5D1B A;  3MZ6 A;  4RN0 A;  3MAX A;  1C3S A;  1W22 A;  5G12 A;  4HXQ A;  5G10 A;  5EF8 A;  4MYF A;  4Q40 A;  4QA2 A;  5LI3 A;  3F0R A;  5EF7 A;  1VKG A;  1P8O A;  4IXV A;  4BKX B;  4CEV A;  4ZUP A;  4Q3P A;  4IU0 A;  5EFK B;  1T5F A;  3TH7 A;  3MFW A;  2VQQ A;  4QA4 A;  5DC5 A;  1HQF A;  5EFN A;  1D3V A;  4BZ5 A;  5DC6 A;  4IE1 A;  5A2S A;  4RHQ A;  3LHL A;  3F06 A;  3RQD A;  1GQ6 A;  5HJ9 A;  5JI5 A;  3RLA A;  2A0M A;  2EF5 A;  3SL1 A;  1RLA A;  5BWZ A;  5EFJ D;  4QA6 A;  1TA1 A;  1WVB A;  2EIV A;  5EEN A;  2EF4 A;  2PHA A;  4IE3 A;  4Q3U A;  4ZUO A;  4MYK A;  3MEN A;  3NIP A;  4RN1 A;  4ZUN A;  1XFK A;  3ZNS A;  3E8Q A;  4A69 A;  1ZZ1 A;  5FCW A;  4QA3 A;  5THU A;  2V5X A;  3Q9F A;  3C10 A;  1P8P A;  4Q3R A;  4CQF A;  4GSM A;  5G11 A;  3ZNR A;  3EWF A;  1R1O A;  5THV A;  4RHL A;  1WOI A;  1HQ5 A;  3PZL A;  3TF3 A;  1T4S A;  4GWD A;  3M1R A;  3MZ7 A;  3KV2 A;  5D1C A;  4GWC A;  2PLL A;  4GSV A;  1HQX A;  1T4R A;  4MXR A;  4IXU A;  1GQ7 A;  3MJL A;  4QA7 A;  1TBH A;  5D1D A;  3C0Z A;  1TBJ A;  3MMR A;  5G1B A;  3SL0 A;  4Q41 A;  3GMZ A;  3Q9E A;  4ZUR A;  3SFF A;  3SFH A;  4IE2 A;  4G3H A;  4RHK A;  3EZP A;  3LP7 A;  5DC7 A;  1P8Q A;  2GH6 A;  4Q3T A;  1WOH A;  3THJ A;  3GN0 A;  5THS A;  1WVA A;  1T5G A;  5G0X A;  1WOG A;  4RHM A;  4IU5 A;  4ZUM A;  5RLA A;  2VQM A;  4GSZ A;  1P8R A;  4ITY A;  4LXZ A;  3EZT A;  4QA0 A;  5EEF A;  2VQJ A;  5IX0 A;  5G0G A;  1T4T A;  4CBT A;  5G0H A;  5EEK A;  1T69 A;  4RN2 A;  4LY1 A;  5HJA A;  3THE A;  1HQH A;  1ZZ3 A;  2ZAV A;  4HWW A;  3NIO A;  4I06 A;  4QA5 A;  4Q3S A;  4ZUQ A;  1P8M A;  5IWG A;  2VQO A;  5G0Y A;  1T67 A;  5G17 A;  4BZ8 A;  1ZZ0 A;  3NIQ A;  4FCK A;  5FUE A;  1T64 A;  4Q3V A;  2V5W A;  1P8S A;  1PQ3 A;  3MZ4 A;  4IU1 A;  3E8Z A;  4BZ9 A;  3MFV A;  3DJ8 A;  4BZ6 A;  4RLA A;  1TBL A;  5CEV A;  4MYN A;  5EFH A;  2VQW G;  3LP4 A;  5EEI A;  5G1C A;  3F80 A;  5EEM A;  3F07 A;  1P8N A;  2VQV A;  4HZE A;  3SKK A;  3THH A;  3Q9B A;  3SJT A;  3E6K A;  3CEV A; 
#chains in the Genus database with same CATH homology
 1ZPG A;  2RLA A;  4Q3R C;  4Q42 A;  2PHO A;  4IU4 A;  1HQG A;  3E9B A;  1CEV A;  4DZ4 A;  2CEV A;  3E6V A;  4RHJ A;  4RHI A;  4Q3Q A;  4MYL A;  4FCI A;  1T4P A;  1ZPE A;  2AEB A;  4HXQ A;  4MYF A;  4Q40 A;  1P8O A;  4IXV A;  4CEV A;  4Q3P A;  4IU0 A;  3TH7 A;  1T5F A;  3MFW A;  1HQF A;  1D3V A;  4IE1 A;  4RHQ A;  3LHL A;  1GQ6 A;  5HJ9 A;  3RLA A;  2A0M A;  2EF5 A;  3SL1 A;  1RLA A;  1TA1 A;  1WVB A;  2EIV A;  2EF4 A;  2PHA A;  4IE3 A;  4Q3U A;  4MYK A;  3NIP A;  1XFK A;  3E8Q A;  4Q3R A;  1P8P A;  4GSM A;  1R1O A;  4RHL A;  1WOI A;  1HQ5 A;  3PZL A;  3TF3 A;  1T4S A;  4GWD A;  3M1R A;  3KV2 A;  4GWC A;  2PLL A;  4GSV A;  1HQX A;  1T4R A;  4MXR A;  4IXU A;  1GQ7 A;  3MJL A;  1TBH A;  1TBJ A;  3MMR A;  3SL0 A;  4Q41 A;  3GMZ A;  4IE2 A;  4G3H A;  4RHK A;  3LP7 A;  1P8Q A;  4Q3T A;  1WOH A;  3THJ A;  3GN0 A;  1WVA A;  1T5G A;  1WOG A;  4RHM A;  4IU5 A;  5RLA A;  4GSZ A;  1P8R A;  4ITY A;  1T4T A;  5HJA A;  3THE A;  1HQH A;  2ZAV A;  4HWW A;  3NIO A;  4I06 A;  4Q3S A;  1P8M A;  4FCK A;  3NIQ A;  4Q3V A;  1P8S A;  1PQ3 A;  4IU1 A;  3E8Z A;  3MFV A;  3DJ8 A;  4RLA A;  1TBL A;  5CEV A;  4MYN A;  3LP4 A;  3SKK A;  3F80 A;  3THH A;  1P8N A;  4HZE A;  3SJT A;  3E6K A;  3CEV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...