3GN0A

Crystal structure of human arginase i in complex with difluoromethylornithine (dfmo)
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
315
structure length
315
Chain Sequence
SRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginase-1
publication title Binding of alpha,alpha-Disubstituted Amino Acids to Arginase Suggests New Avenues for Inhibitor Design
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 115
structure length 315
sequence length 315
chains with identical sequence B
ec nomenclature ec 3.5.3.1: Arginase.
pdb deposition date 2009-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 3gn0A00
1HQGA 4IE1A 1P8MA 4HWWA 1T4TA 3SL0A 3NIPA 1TBJA 4GSZA 1D3VA 4Q3RC 4MYNA 1T5GA 1ZPGA 4ITYA 1RLAA 1WOHA 4RHKA 2EIVA 1XFKA 4IXVA 5HJAA 2PHOA 2RLAA 4MXRA 4RLAA 4GSVA 3DJ8A 1P8RA 4DZ4A 4Q3SA 3NIQA 1HQ5A 1WVBA 1WVAA 3GMZA 1TBHA 1WOIA 2EF5A 3MFVA 4RHJA 4MYKA 4G3HA 3THHA 1ZPEA 4FCKA 3SKKA 1R1OA 4Q3VA 4Q42A 4IE3A 1PQ3A 4IU0A 3TH7A 3PZLA 4FCIA 4I06A 2CEVA 1HQFA 3CEVA 3M1RA 2ZAVA 4GSMA 4IU4A 1P8NA 3TF3A 4GWCA 1T4RA 4Q3TA 4Q3RA 3LP7A 1T4PA 3E6KA 4IXUA 2PLLA 1T4SA 1T5FA 3THEA 3NIOA 3E8ZA 5RLAA 4RHMA 3LHLA 1P8PA 3KV2A 4Q3UA 4IU5A 3E6VA 3LP4A 2EF4A 2A0MA 1P8OA 4HXQA 1TA1A 4CEVA 4Q3QA 1CEVA 3E8QA 4MYLA 1P8QA 1GQ6A 1P8SA 4RHLA 3MMRA 4Q3PA 3GN0A 1HQXA 2AEBA 5HJ9A 3THJA 1GQ7A 4IE2A 1TBLA 4Q41A 4HZEA 1WOGA 3MFWA 3E9BA 3RLAA 4GWDA 5CEVA 4MYFA 1HQHA 4IU1A 3SL1A 3F80A 4RHQA 4RHIA 2PHAA 3MJLA 3SJTA 4Q40A
chains in the Genus database with same CATH superfamily
3F0RA 1HQGA 4IE1A 1P8MA 3EWFA 4HWWA 5D1BA 2GH6A 4BZ6A 5DC6A 1T4TA 5A2SA 5FUEA 3SL0A 3NIPA 4ZUOA 1TBJA 2VQVA 4GSZA 5FCWA 1D3VA 4Q3RC 4MYNA 4BZ5A 4CQFA 1T5GA 1ZPGA 5EFHA 4ZURA 5IX0A 4BZ8A 3EW8A 4ITYA 4QA3A 4ZUNA 1W22A 1RLAA 1T67A 1WOHA 4RHKA 4ZUMA 5G0GA 1ZZ1A 3MZ4A 5JI5A 3SFFA 2EIVA 3EZPA 1XFKA 4IXVA 5HJAA 4QA5A 5G10A 3Q9CA 4CBTA 5EFNA 2PHOA 5DC5A 2RLAA 3MZ7A 3MAXA 4MXRA 1C3RA 1VKGA 4RLAA 4GSVA 3DJ8A 5DC8A 5THVA 1P8RA 4DZ4A 3MZ3A 4Q3SA 3NIQA 1HQ5A 1WVBA 1WVAA 3GMZA 5EFBD 1TBHA 2VQWG 4BZ7A 3Q9BA 3ZNSA 1WOIA 5DC7A 2EF5A 3MFVA 4RHJA 2VQOA 5ICNB 5G0IA 5G0HA 4MYKA 4G3HA 5G0XA 3THHA 1ZPEA 4QA7A 3SFHA 5LI3A 4FCKA 5EEFA 3SKKA 1C3PA 1R1OA 4Q3VA 2VQJA 5G1AA 5EENA 4QA2A 4Q42A 4IE3A 1PQ3A 4IU0A 3TH7A 3PZLA 4ZUPA 4FCIA 4BZ9A 4I06A 2CEVA 2VQMA 5G3WA 1HQFA 5EF8A 3CEVA 3M1RA 2ZAVA 2VQQA 4GSMA 1ZZ3A 2V5XA 1P8NA 3MJLA 4GWCA 4IU4A 4QA1A 4RN1A 3TF3A 1T4RA 5EFKB 1T69A 4Q3TA 4Q3RA 3ZNRA 1C3SA 3LP7A 1T4PA 3E6KA 4IXUA 1T64A 2PLLA 3C0ZA 4RN0A 3Q9FA 1T4SA 1T5FA 3Q9EA 4QA6A 5THUA 3THEA 3NIOA 5G0JA 3E8ZA 5EEIA 3EZTA 5RLAA 4RHMA 4LY1A 3LHLA 4ZUQA 1P8PA 3KV2A 5IWGA 5EF7A 4Q3UA 4IU5A 4A69A 5G12A 3MZ6A 3E6VA 3LP4A 5G0YA 2EF4A 5G17A 5D1DA 5G11A 2A0MA 4BKXB 1P8OA 5EFJD 4HXQA 1ZZ0A 1TA1A 4CEVA 4Q3QA 3C0YA 1CEVA 3E8QA 3F06A 4MYLA 1P8QA 1GQ6A 1P8SA 4QA4A 4QA0A 4RHLA 3MMRA 4Q3PA 4RN2A 3GN0A 5G1CA 5EEMA 2VCGA 4LXZA 1HQXA 2AEBA 5G1BA 5HJ9A 3THJA 5BWZA 1GQ7A 4IE2A 1TBLA 4Q41A 5G13A 4HZEA 1WOGA 3E9BA 5EFGA 5EEKA 3RLAA 3MENA 5THTA 4GWDA 3RQDA 3F07A 5CEVA 4MYFA 1HQHA 2V5WA 4IU1A 5D1CA 3F80A 3C10A 4RHQA 2PHAA 4RHIA 3SL1A 4CBYA 3MFWA 3SJTA 4Q40A 5THSA
chains in the Genus database with same CATH topology
1HQGA 4IE1A 1P8MA 4HWWA 1T4TA 3SL0A 3NIPA 1TBJA 4GSZA 1D3VA 4Q3RC 4MYNA 1T5GA 1ZPGA 4ITYA 1RLAA 1WOHA 4RHKA 2EIVA 1XFKA 4IXVA 5HJAA 2PHOA 2RLAA 4MXRA 4RLAA 4GSVA 3DJ8A 1P8RA 4DZ4A 4Q3SA 3NIQA 1HQ5A 1WVBA 1WVAA 3GMZA 1TBHA 1WOIA 2EF5A 3MFVA 4RHJA 4MYKA 4G3HA 3THHA 1ZPEA 4FCKA 3SKKA 1R1OA 4Q3VA 4Q42A 4IE3A 1PQ3A 4IU0A 3TH7A 3PZLA 4FCIA 4I06A 2CEVA 1HQFA 3CEVA 3M1RA 2ZAVA 4GSMA 4IU4A 1P8NA 3TF3A 4GWCA 1T4RA 4Q3TA 4Q3RA 3LP7A 1T4PA 3E6KA 4IXUA 2PLLA 1T4SA 1T5FA 3THEA 3NIOA 3E8ZA 5RLAA 4RHMA 3LHLA 1P8PA 3KV2A 4Q3UA 4IU5A 3E6VA 3LP4A 2EF4A 2A0MA 1P8OA 4HXQA 1TA1A 4CEVA 4Q3QA 1CEVA 3E8QA 4MYLA 1P8QA 1GQ6A 1P8SA 4RHLA 3MMRA 4Q3PA 3GN0A 1HQXA 2AEBA 5HJ9A 3THJA 1GQ7A 4IE2A 1TBLA 4Q41A 4HZEA 1WOGA 3MFWA 3E9BA 3RLAA 4GWDA 5CEVA 4MYFA 1HQHA 4IU1A 3SL1A 3F80A 4RHQA 4RHIA 2PHAA 3MJLA 3SJTA 4Q40A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HQG A;  4IE1 A;  1P8M A;  4HWW A;  1T4T A;  3SL0 A;  3NIP A;  1TBJ A;  4GSZ A;  1D3V A;  4Q3R C;  4MYN A;  1T5G A;  1ZPG A;  4ITY A;  1RLA A;  1WOH A;  4RHK A;  2EIV A;  1XFK A;  4IXV A;  5HJA A;  2PHO A;  2RLA A;  4MXR A;  4RLA A;  4GSV A;  3DJ8 A;  1P8R A;  4DZ4 A;  4Q3S A;  3NIQ A;  1HQ5 A;  1WVB A;  1WVA A;  3GMZ A;  1TBH A;  1WOI A;  2EF5 A;  3MFV A;  4RHJ A;  4MYK A;  4G3H A;  3THH A;  1ZPE A;  4FCK A;  3SKK A;  1R1O A;  4Q3V A;  4Q42 A;  4IE3 A;  1PQ3 A;  4IU0 A;  3TH7 A;  3PZL A;  4FCI A;  4I06 A;  2CEV A;  1HQF A;  3CEV A;  3M1R A;  2ZAV A;  4GSM A;  4IU4 A;  1P8N A;  3TF3 A;  4GWC A;  1T4R A;  4Q3T A;  4Q3R A;  3LP7 A;  1T4P A;  3E6K A;  4IXU A;  2PLL A;  1T4S A;  1T5F A;  3THE A;  3NIO A;  3E8Z A;  5RLA A;  4RHM A;  3LHL A;  1P8P A;  3KV2 A;  4Q3U A;  4IU5 A;  3E6V A;  3LP4 A;  2EF4 A;  2A0M A;  1P8O A;  4HXQ A;  1TA1 A;  4CEV A;  4Q3Q A;  1CEV A;  3E8Q A;  4MYL A;  1P8Q A;  1GQ6 A;  1P8S A;  4RHL A;  3MMR A;  4Q3P A;  3GN0 A;  1HQX A;  2AEB A;  5HJ9 A;  3THJ A;  1GQ7 A;  4IE2 A;  1TBL A;  4Q41 A;  4HZE A;  1WOG A;  3MFW A;  3E9B A;  3RLA A;  4GWD A;  5CEV A;  4MYF A;  1HQH A;  4IU1 A;  3SL1 A;  3F80 A;  4RHQ A;  4RHI A;  2PHA A;  3MJL A;  3SJT A;  4Q40 A; 
#chains in the Genus database with same CATH topology
 3F0R A;  1HQG A;  4IE1 A;  1P8M A;  3EWF A;  4HWW A;  5D1B A;  2GH6 A;  4BZ6 A;  5DC6 A;  1T4T A;  5A2S A;  5FUE A;  3SL0 A;  3NIP A;  4ZUO A;  1TBJ A;  2VQV A;  4GSZ A;  5FCW A;  1D3V A;  4Q3R C;  4MYN A;  4BZ5 A;  4CQF A;  1T5G A;  1ZPG A;  5EFH A;  4ZUR A;  5IX0 A;  4BZ8 A;  3EW8 A;  4ITY A;  4QA3 A;  4ZUN A;  1W22 A;  1RLA A;  1T67 A;  1WOH A;  4RHK A;  4ZUM A;  5G0G A;  1ZZ1 A;  3MZ4 A;  5JI5 A;  3SFF A;  2EIV A;  3EZP A;  1XFK A;  4IXV A;  5HJA A;  4QA5 A;  5G10 A;  3Q9C A;  4CBT A;  5EFN A;  2PHO A;  5DC5 A;  2RLA A;  3MZ7 A;  3MAX A;  4MXR A;  1C3R A;  1VKG A;  4RLA A;  4GSV A;  3DJ8 A;  5DC8 A;  5THV A;  1P8R A;  4DZ4 A;  3MZ3 A;  4Q3S A;  3NIQ A;  1HQ5 A;  1WVB A;  1WVA A;  3GMZ A;  5EFB D;  1TBH A;  2VQW G;  4BZ7 A;  3Q9B A;  3ZNS A;  1WOI A;  5DC7 A;  2EF5 A;  3MFV A;  4RHJ A;  2VQO A;  5ICN B;  5G0I A;  5G0H A;  4MYK A;  4G3H A;  5G0X A;  3THH A;  1ZPE A;  4QA7 A;  3SFH A;  5LI3 A;  4FCK A;  5EEF A;  3SKK A;  1C3P A;  1R1O A;  4Q3V A;  2VQJ A;  5G1A A;  5EEN A;  4QA2 A;  4Q42 A;  4IE3 A;  1PQ3 A;  4IU0 A;  3TH7 A;  3PZL A;  4ZUP A;  4FCI A;  4BZ9 A;  4I06 A;  2CEV A;  2VQM A;  5G3W A;  1HQF A;  5EF8 A;  3CEV A;  3M1R A;  2ZAV A;  2VQQ A;  4GSM A;  1ZZ3 A;  2V5X A;  1P8N A;  3MJL A;  4GWC A;  4IU4 A;  4QA1 A;  4RN1 A;  3TF3 A;  1T4R A;  5EFK B;  1T69 A;  4Q3T A;  4Q3R A;  3ZNR A;  1C3S A;  3LP7 A;  1T4P A;  3E6K A;  4IXU A;  1T64 A;  2PLL A;  3C0Z A;  4RN0 A;  3Q9F A;  1T4S A;  1T5F A;  3Q9E A;  4QA6 A;  5THU A;  3THE A;  3NIO A;  5G0J A;  3E8Z A;  5EEI A;  3EZT A;  5RLA A;  4RHM A;  4LY1 A;  3LHL A;  4ZUQ A;  1P8P A;  3KV2 A;  5IWG A;  5EF7 A;  4Q3U A;  4IU5 A;  4A69 A;  5G12 A;  3MZ6 A;  3E6V A;  3LP4 A;  5G0Y A;  2EF4 A;  5G17 A;  5D1D A;  5G11 A;  2A0M A;  4BKX B;  1P8O A;  5EFJ D;  4HXQ A;  1ZZ0 A;  1TA1 A;  4CEV A;  4Q3Q A;  3C0Y A;  1CEV A;  3E8Q A;  3F06 A;  4MYL A;  1P8Q A;  1GQ6 A;  1P8S A;  4QA4 A;  4QA0 A;  4RHL A;  3MMR A;  4Q3P A;  4RN2 A;  3GN0 A;  5G1C A;  5EEM A;  2VCG A;  4LXZ A;  1HQX A;  2AEB A;  5G1B A;  5HJ9 A;  3THJ A;  5BWZ A;  1GQ7 A;  4IE2 A;  1TBL A;  4Q41 A;  5G13 A;  4HZE A;  1WOG A;  3E9B A;  5EFG A;  5EEK A;  3RLA A;  3MEN A;  5THT A;  4GWD A;  3RQD A;  3F07 A;  5CEV A;  4MYF A;  1HQH A;  2V5W A;  4IU1 A;  5D1C A;  3F80 A;  3C10 A;  4RHQ A;  2PHA A;  4RHI A;  3SL1 A;  4CBY A;  3MFW A;  3SJT A;  4Q40 A;  5THS A; 
#chains in the Genus database with same CATH homology
 1HQG A;  4IE1 A;  1P8M A;  4HWW A;  1T4T A;  3SL0 A;  3NIP A;  1TBJ A;  4GSZ A;  1D3V A;  4Q3R C;  4MYN A;  1T5G A;  1ZPG A;  4ITY A;  1RLA A;  1WOH A;  4RHK A;  2EIV A;  1XFK A;  4IXV A;  5HJA A;  2PHO A;  2RLA A;  4MXR A;  4RLA A;  4GSV A;  3DJ8 A;  1P8R A;  4DZ4 A;  4Q3S A;  3NIQ A;  1HQ5 A;  1WVB A;  1WVA A;  3GMZ A;  1TBH A;  1WOI A;  2EF5 A;  3MFV A;  4RHJ A;  4MYK A;  4G3H A;  3THH A;  1ZPE A;  4FCK A;  3SKK A;  1R1O A;  4Q3V A;  4Q42 A;  4IE3 A;  1PQ3 A;  4IU0 A;  3TH7 A;  3PZL A;  4FCI A;  4I06 A;  2CEV A;  1HQF A;  3CEV A;  3M1R A;  2ZAV A;  4GSM A;  4IU4 A;  1P8N A;  3TF3 A;  4GWC A;  1T4R A;  4Q3T A;  4Q3R A;  3LP7 A;  1T4P A;  3E6K A;  4IXU A;  2PLL A;  1T4S A;  1T5F A;  3THE A;  3NIO A;  3E8Z A;  5RLA A;  4RHM A;  3LHL A;  1P8P A;  3KV2 A;  4Q3U A;  4IU5 A;  3E6V A;  3LP4 A;  2EF4 A;  2A0M A;  1P8O A;  4HXQ A;  1TA1 A;  4CEV A;  4Q3Q A;  1CEV A;  3E8Q A;  4MYL A;  1P8Q A;  1GQ6 A;  1P8S A;  4RHL A;  3MMR A;  4Q3P A;  3GN0 A;  1HQX A;  2AEB A;  5HJ9 A;  3THJ A;  1GQ7 A;  4IE2 A;  1TBL A;  4Q41 A;  4HZE A;  1WOG A;  3MFW A;  3E9B A;  3RLA A;  4GWD A;  5CEV A;  4MYF A;  1HQH A;  4IU1 A;  3SL1 A;  3F80 A;  4RHQ A;  4RHI A;  2PHA A;  3MJL A;  3SJT A;  4Q40 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...