3GN2A

Structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and inhibitor (ddd00066730)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
267
structure length
249
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title One scaffold, three binding modes: novel and selective pteridine reductase 1 inhibitors derived from fragment hits discovered by virtual screening.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords Pteridine reductase
total genus 95
structure length 249
sequence length 267
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3gn2A00
4PG5A 2VQ3A 3KV3O 2BF7A 4F6LA 3P2YA 1Q0LA 3IIEA 4CUJA 1C0IA 3KETA 3JCZA 1LDBA 1WNTA 5IZCA 2CY0A 2P5UA 4CMIA 1RM4A 3GOHA 4UUMA 4YTEA 3LF2A 3UW3A 3I3OA 4EJ6A 3HE3A 5FWNA 3JQDA 4GX1A 3TDKA 1E1LA 3RC2A 3WSVA 4YXFA 3EDMA 3DZHA 1X7DA 4TKLA 1K2WA 4CV1A 2B4TO 3LZ6A 3TQHA 3U4HA 3AU8A 2RHCA 3MTGA 4CQMA 4BGVA 3NTRA 2VYVA 2Y0DA 4HADA 1PS0A 4IPTA 1QYXA 1ZKMA 4AJHA 2PKQO 3DZJA 3UVEA 1VJTA 4W82A 3R6DA 1Q0HA 3K2EA 1N9GA 1PL8A 3GLQA 3MWEB 2AQKA 2UUPA 4I9NA 1E7MA 2Q1SA 1EBUA 5DF1A 2CDBA 4IZHA 4RLSA 4BNVA 3RIHA 3GFGA 1G1AA 1LU9A 5JO0A 4ZQGA 4WK6A 3D4OA 4WLNA 3O38A 3VH3A 3T7EA 4CMBA 5C5IA 2Z1MA 3E82A 4R68A 5FI5A 3GVIA 1I3MA 1BDMA 2GR9A 2X0RA 4I5FA 1DEHA 2IYPA 4GX0A 4OXNA 4A26A 4QQRA 4CLOB 4CM4B 5CG1A 1YE3A 3VH1A 3WMXA 5DP1A 5G0WA 5DOZA 3RAJA 4IM7A 4P22A 4KDFA 4MVJM 1JTVA 2GCGA 3S2FA 3UAGA 5L9AA 2VT2A 1DSSG 3KSUA 1A9YA 3IQDB 5FF9A 2QHXA 4UEJA 4MVJF 1A4UA 5K6AC 2ZJ0A 4BGEA 5I7FA 2DQ4A 1T25A 2Q3EA 2JFFA 4F3YA 3H3FA 2Y0CA 2BGLA 3SEFA 3ENNA 4P4GA 3IP3A 4EEZA 3NUGA 4E2ZA 1YH3A 4XQGA 4NG5A 3F46A 1X13A 1I33A 2NWQA 4J7XA 1T2DA 2P4QA 1DIGA 1OMOA 4GWKA 4YJHA 5JO9A 4XX0A 2Y1DA 1LXCA 2EV9A 1XQ1A 3OBBA 2VNAA 4BNWA 3H9UA 3HFGA 3FCOA 1E3JA 3KXDA 1GZ6A 3INRA 2ILTA 4BNXA 3M6IA 1NFFA 4R9RA 2Q1UA 2PKRA 1P1IA 4U6SA 2EWMA 3OA0A 3RKUA 1XWFA 2NVUB 4QXMA 1W8DA 1BXGB 1YL7A 4XZ3A 3GDGA 1W0CA 5T8KC 1UXKA 4DQXA 3ANLA 4RGBA 3ZWVA 4B3HA 3QVTA 4EJ0A 1V3UA 2NQTA 2WE8A 1HDRA 2YYYA 1YS4A 1YB5A 3G49A 2OP0A 1P31A 2NNLD 2D4AA 2O4CA 4ZU3A 3K5PA 1A72A 2PKQP 3I6QA 1Z82A 2X86A 4R1NA 4W6ZA 4Z9YA 2NSDA 4CR8A 4IDGA 2CDAA 4B7UA 4LSWA 3DZIA 1LNQA 4PG8A 5BSHA 1N1GA 3D3WB 3ICPA 1DFGA 1LQTA 1IPEA 2HK7A 4RPHA 4QECA 1M2WA 3GG9A 4JBIA 4O1MA 2UDPA 3L77A 4CM9D 3HWRA 1HDCA 1HZJA 4AICA 4JNKA 2PTGA 1V9LA 1ZK2A 3B1JA 4QTZA 2YZ7A 4IUYA 2CVQA 1ZK1A 3HB4X 3TOXA 1IHXA 3GRPA 3PP8A 4P8RA 1FJHA 4GH5A 2C5AA 2Q2QA 4HNHA 1LX6A 4ND2A 1R66A 1UP6A 5DT9A 4YAJA 2I76A 5J23A 4FJ0A 1PEDA 1EVYA 4G81A 1DAOA 4PLVA 5COBA 4DMLA 1A7KA 1LSSA 3JQBA 5DBFA 3DZBA 4CM5A 3ZV4A 3LT2A 4LVCA 1LBEA 4F45A 2DAPA 1B26A 2JL1A 5BNIA 4UUPA 5EERA 3ZWWA 4DIBA 2ZYDA 4WEOA 2QYSA 4AJNA 4EDFA 4FOOA 3BMOA 1X0VA 3RFVA 1C1DB 2ZIZA 4WPGA 2ZB3A 3A06A 1WMAA 3U49A 4P38A 4A2CA 4CQLA 4D3DA 4NFHA 1E1MA 1PR9A 3OQ1A 4RPKA 5JDIA 2ZB7A 1PZEA 1EVJA 1VL6A 5C7IO 5L7YA 3DMTA 1NQTA 2ZK7A 3RKRA 3U62A 4LSMA 3RUDA 3N7UA 3H3JA 5JCJA 1IPFA 1H93A 4J4TA 1MFZA 2PGLA 1C0KA 2C0CA 2FOIA 4E5PA 1C0PA 3GT0A 3ZWCA 3SJ7A 4E5YA 4J49A 4R16A 3UFXA 2G82A 2J3KA 3QIVA 3RWBA 5HS6A 1XKQA 3JQEA 1W4ZA 4C7KA 4YRBA 5HWSA 1Y8RB 5L4NA 2D3TA 4IJVA 3W4JA 4PVCA 1YQXA 3FR7A 5LC1A 4E4YA 1JW9B 2DBZA 4BNNA 5I8WA 3STHA 2AW5A 4JJGA 4Q3AA 4L8VA 1YJ8A 1B16A 4L4RA 3CKYA 1E92A 4D43A 2R00A 3OICA 2PNFA 4ZGWA 4WASA 1PTJA 1Z74A 5CDUA 1ENOA 1PX0A 1ULSA 3E03A 4IQ8A 3ZCXA 4YWJA 4DUPA 3FSRA 1ISIA 3W4IA 1HSOA 1MGOA 4IJUA 2RH8A 3PXXA 4A5OA 2FP4A 1PGPA 2GD1O 2X9VA 4QFCA 4DYDA 1U3WA 3JQ6A 3L9WA 4D42A 5JYEA 4ZQFA 2FY8A 4YJFB 2IZ1A 4CODB 4JLWA 1EDOA 3E48A 3B20A 7MDHA 2VYNA 3ROMA 2JHFA 2AEFA 5IDQA 2G76A 4CLRA 4FC7A 1T24A 4KTTE 3D64A 1NX6A 1PJTA 4YJGB 1LA2A 3D0OA 4FGSA 1S6YA 4NI5A 1YDEA 5IXYA 2O3TA 2DBRA 2HCTA 2X0IA 3OMLA 4QT0A 5EQFA 4CQMD 2VN8A 3L9XA 3K9QO 3WGOA 2JD1A 5TNXA 5A1TA 2VRBA 1R15A 4XRRA 2PV7A 3SC4A 4GX2A 1A5ZA 5F1KA 4MJLA 3T4XA 2H6EA 5KTKA 1E5LA 2ZB4A 4IIUA 1UDBA 4NBWA 1G0OA 1IULA 3A4VA 3ZDFA 4CM8B 3ADPA 3OIGA 4TRJA 4IZIA 4YACA 2UAGA 3JTMA 1ONNA 4ZICA 3DMTC 4DQUA 3FHLA 2J6IA 1E6WA 2QQ5A 4J90A 4KWIA 4U5QA 1NR1A 2C59A 4YJHB 2AA3A 3F9IA 3S55A 1E3IA 4BKRA 1VRWA 5L7TA 4MVJI 1IHYA 2Q46A 3IL2A 1J4AA 4C7JA 3DBRB 3NT4A 3VH4A 2TMDA 1MXFA 1T2CA 1HE4A 1QV7A 1VPDA 4E33A 3GY0A 1ZCJA 3I83A 2VZ8A 2PD3A 2ZCUA 4NZ9A 4AG3A 1ZMTA 1XGKA 2YDYA 2FHSA 3UICA 3UH1A 3DOJA 4AFNA 4D0SA 1LLCA 4YAGA 3HJAA 2C5EA 4N5NA 6ADHA 3S2IA 3EK2A 3K31A 1M76A 1XU7A 1OC4A 3CZRA 3FRJA 2P9EA 1Z73A 4W4TA 5TC4A 5AXAA 3RUFA 1ISMA 4WLEA 4EW6A 3KRTA 1H5QA 2AEJA 2A92A 3RFXA 1HRDA 4K6FA 3U09A 1JVBA 3UCXA 2HMVA 7ADHA 5TS3A 4R1SA 2YQ4A 3G1UA 2PR2A 2FZWA 2QG4A 5CHEA 1CQJA 3AI3A 4GLOA 1JU9A 2EJWA 4CUKA 4J4BA 3AY3A 2YV2A 1H2BA 3R1IA 3WJ7A 2HAEA 5JC8A 1ISGA 4Q3CA 1B14A 4QSMA 1LRLA 3UUWA 3JQGA 5CFZA 3G3EA 3ASUA 3GNSA 2Y68A 4NPCA 2Y1CA 4LMRA 4CMHA 2WEKA 4JCOA 4B4OA 2FRDA 1GZ3A 3QV1A 4ROSA 4UVDA 4EUEA 5G4LA 3WR5A 1SZJG 3SBOA 1YXMA 2V6MA 4AJLA 2PZKA 3N58A 4X54A 1ZH8A 4J1QA 3A14A 1PGOA 5I9LA 1JVSA 4MVJP 2BRUA 1QR6A 3KLPX 4PCVA 3WGTA 4CQMB 3VTFA 1Y8RA 3DC2A 3GVCA 3TOZA 3BMCA 4JGBA 1Q7CA 2BLLA 4PG6A 3KLMX 3QLJA 1R4NA 1PJSA 1N9GB 4J2HA 1E3SA 1C14A 3OJLA 3LLVA 1U4SA 3ZHYA 4WGGA 3SLGA 2V6BA 3D4NA 4JIGA 3KM0A 3AUUA 5A04A 1GAEO 5KKCA 1I30A 4ZRMA 2PY6A 1AHIA 4KQWA 4BO5A 3V8BA 3K73O 4FD3A 4JJIA 1GL3A 3B6ZA 1DHTA 4AL4A 3KO8A 2BKAA 4GPD1 4II3A 4XJTA 3DQPA 3AY6A 2O2SA 2DFVA 3AOEA 3VDRA 1IOLA 5C3MA 4ALIA 3JQ7B 1JN0A 3ABIA 4NMHA 1PL7A 2GLXA 4I9UA 2EIHA 1H6DA 2B5VA 4CPDA 2TMGA 2FN7A 3WTBA 2ZYGA 4GI2A 3D1LA 4TVOA 2QZZA 3I9KA 1NVTA 3HSKA 3PJEA 5A5EA 3V1YA 5JNLA 1KERA 2R6JA 4PLCA 3GN2A 3PZRA 4EEXA 1VI2A 3RASA 3OEYA 1DC5A 2G1UA 3HN7A 4PLHA 3AY7A 1EE2A 3ANNA 4N18A 4FFOA 3GR6A 1E77A 3EZLA 3I9OA 4JP2A 1UUFA 4PN3A 1U1IA 3FF4A 4A7PA 1LEHA 4DREA 3PJDA 2VWQA 4MOWA 2BFMA 1V6AA 1PU2A 2IZZA 3AJRA 2J8ZA 4Q39A 5G0SA 2Y1OA 3TN7A 2EKLA 1U8FO 3DBRA 4LVUA 4DQVA 3QWBA 1DIAA 1FDSA 1MG0A 1LSJA 1P1KA 2Q99A 1QXSA 2Y1EA 4MIOA 3ZWYA 2VT3A 3K6JA 3HDHA 4HX5A 5L51A 3COSA 2AEMA 2VTDA 2RCYA 3CINA 4WLUA 2C82A 2QYTA 4R54A 1TEHA 3H2SA 4OOEA 3TWOA 2VOEA 3W8FA 4DPKA 3M1LA 4BNKA 3AUTA 3H65A 1P45A 5CPBA 1U28A 2OOSA 4JX8A 1BXKA 1Q7BA 2HRBA 5G4KA 3V1UA 5ICSA 1ZSNA 3KEOA 1EUZA 4RF5A 3AFNA 2X5KO 3ADOA 1N92A 4A0SA 1BW9B 4WOJA 3T7CA 3NGLA 4B4VA 3ONFA 3DHYA 3GA0A 4NBTA 3RJ9A 3VH2A 2WYUA 2W2KA 1ENYA 4CM9A 1T2FA 2CDCA 1Y5RA 4YAEA 2D5AA 4CMEA 2O23A 4EYEA 2P4HX 4D0RA 2GN6A 3BZUA 3WB9A 2A9FA 4YVFA 5G4KB 1HDOA 3MJTA 2DBVO 2W98A 3OJOA 3D7LA 2EGHA 2ZB8A 4E2XA 4RJTA 1NHWA 1T1RA 2YUTA 3QVWA 4IDEA 2YW9A 4OGWA 1FMCA 1H0KA 2GN9A 4YYZA 2C2XA 1ZXLA 4D45A 1J6UA 3I9NA 3EHEA 1MUUA 3GQVA 4E13A 3E5MA 3WGYA 3PPIA 2PFGA 1UXGA 2EXXA 4CLRB 5G0VA 3ST7A 3WG9A 3G1TA 1Q2XA 4XIYA 4G65A 4UVIA 5DZSA 1I3NA 3QE3A 1GEEA 4YAIA 3Q3CA 3Q6IA 1R4NB 3W4KA 4XDZA 3RD5A 1HL3A 3NRCA 2DU8A 4FW8A 4IDCA 3WGQA 2EHDA 1HKUA 3DL2A 4ND3A 4PIVA 5GMOA 2BD0A 3GK3A 1I2ZA 5JLAA 4R5HA 2RIRA 4CM4A 1TT7A 5AYVA 1EQ2A 2HU2A 5T64A 3WFIA 2WSBA 5I7SA 5TT0A 5GZ1A 1SC6A 1E3WB 1SCUA 2D8AA 1ZJZA 5HBRA 3IKTA 1EFLA 2J3JA 2F1KA 2GPTA 3AI1A 1YONA 2Q45A 1PJBA 1E7WA 1GCUA 2HQ1A 3FBGA 2WD8A 2X58A 3GF4A 4BNIA 2NTJA 1KS9A 1ZXBA 1GADO 1MA0A 2EW8A 3JD4A 3PJFA 5KJ1A 2BMAA 4RCVA 1BMDA 2DC1A 2X0NA 2X7HA 4R4JA 1XEAA 3AFMA 3KEQA 4ND1A 3WSWA 4KMSA 5THQA 2XAAA 2C20A 4YRAA 1NYTA 3P2OA 4OYRA 1NFQA 2BI7A 5F1PA 5EN4A 4AJOA 5JDCA 5L95A 1QSGA 5JYDA 2JFHA 4DVJA 4LRTB 3I23A 3PEFA 2CZCA 4J0FA 2I3AA 3ORFA 1P0FA 3PFWO 3QVSA 5A3VA 1Y1PA 1J49A 4D44A 1E3WA 1D4FA 3M1AA 2QX7A 2O7SA 1BHSA 2NU8A 3W8DA 5CDGA 2DTEA 4TRMA 3PHGA 3PDUA 4ZA2A 4ALJA 4JROA 3AM5A 3V2UA 1NP3A 5KJ6A 5FI3A 1GUZA 1RKXA 1U3VA 2Y67A 5DDIP 3W8EA 4CMAA 3EY4A 2E48A 1LDYA 4L4XA 2SCUA 4CL3A 1G0NA 4XYLA 2V6FA 5BNTA 1ONOA 2I99A 1EFKA 2VYND 3E9QA 3MOIA 1VKNA 1ADGA 1H9BA 3GPIA 2PD4A 2QRLA 1B8VA 1V8BA 1VC2A 2Q1WA 2JCYA 1VKOA 1DO8A 1GQ2A 4HV4A 5L40A 2D1YA 4NBVA 3WQRA 1SMKA 3BMQB 5JAQA 4U0JA 1E7YA 3ZU4A 2VCYA 5L45A 3WFJA 4RV9A 5KJCA 1RJWA 4FC6A 3GDOA 4PGFA 5EQDA 5IZCC 4IIVA 1U7HA 3PYMA 3VZQA 1ZUD1 1A27A 2ZTUA 3V2HA 4E2WA 2WTBA 2RBEA 4MKZA 5DNAA 2HMUA 3K92A 3VKUA 1NXQA 2O3JA 1O5IA 4J0EA 4N5MA 4ZJUA 1HTBA 3FNFA 2JD2A 1HYEA 3OQ6A 2OMEA 3C8MA 2EEZA 5A06A 5DCYA 2IODA 3PQDA 4ZN6A 1B0AA 4ZQEA 5B4TA 9LDBA 4FR5A 4CR6A 3WGGA 1FDWA 4UAGA 3JD2A 2UUOA 3H5RA 1XDWA 3MEQA 5BSGA 2EKPA 5L7WA 4I5GA 2YJZA 3QJ5A 1LDGA 4YQYA 4LISA 3NTQA 4E32A 1K3TA 2C07A 4IY1A 2AQIA 3CH6A 1GDHA 1P1JA 1YQGA 5JY1A 4DLBA 2Y0EA 4H3VA 3DAGA 1H6CA 1QG6A 4OJNA 5F3RA 3C7CB 3OIFA 4PRKA 3ETGA 2CVZA 3JQ7A 4DIFA 4YEDA 4ALKA 3RUEA 5BNFA 1OC2A 1LTHR 3AI2A 2DPGA 4MVJA 4OM8A 4DXHA 3LF1A 4E12A 4RVHA 4Z6KA 3PIIA 2PWZA 1EK5A 3CEAA 3BIOA 3MJEA 3W1VA 4B7CA 5I9NA 3VZSA 5T5QA 3I5MA 2JCXA 5HS4A 4CMCA 1NM5A 3GC6A 4BS9A 3F4LA 3OJFA 1BRMA 1EEHA 2ZYAA 4CM1A 4M89A 2CFCA 2EKQA 3RU7A 5ITWA 5DOVA 3KYCA 1HYGA 3JQAB 3ZNQA 1EK6A 2D59A 3ULKA 3ZWMA 1LDEA 1BXGA 1K6JA 1YKFA 2ZKLA 3JQ9C 5KWEA 3INTA 4E5KA 3HNPA 2VYVD 1PJ4A 3PDJA 4QEDA 3DR3A 2AE1A 3LDHA 3MJSA 3S1LA 5IFLA 4RVSA 4BNFA 4AJ1A 4Z0TA 1X1EA 2EGGA 1HYHA 2YY7A 1Y9AA 2I66A 1TVEA 4H15A 1UDCA 5FYDA 5A05A 2IZ0A 3CE6A 3GVXA 1L7DA 4M55A 4GSLA 2EG9A 2FPPA 4RF2A 4Z9XA 3WXBA 5JAZA 3CXRA 3LYLA 3QP9A 4GWGA 5IJZA 2P9CA 1D3AA 1ARZA 1U3TA 3DOOA 3ZN2A 2DLDA 1NAIA 1LC3A 4BNMA 2Z5LA 1UP4A 4RPGA 3HN2A 3EW7A 4XIJA 3R3SA 1D1TA 4OXYA 1DRUA 2OBNA 4DC0A 3C7DB 2B0JA 3NDIA 3PYLA 2UV8A 2C7GA 3JYPA 5KJEA 5JMWA 2VNSA 4ZRNA 3BYZA 4Y9DA 1F12A 3B70A 2W8ZA 3UN1A 3NX4A 2G5CA 4U7WA 2A4KA 3EMKA 4RORA 3WNQA 2ZQYA 3I9JA 4ND5A 3F6YA 4UUNA 3TL3A 3SLKA 2X1HA 4IBOA 3ZI0A 1QYWA 1YOVB 2E6UX 3DHNA 4NR0A 2PH3A 2VHZA 1I32A 3L6OO 1V3TA 5CG2A 4GMFA 3GUCA 3I9LA 2EP5A 2ZQZA 3PHIA 1O9BA 1SOVA 4GKVA 4JP3A 1SOWA 4A27A 1WPQA 2OHXA 1BVUA 4NK5A 4XB2A 2YDXA 1DJNA 3WOHA 1H6AA 2NLOA 3KUXA 1PGNA 4XCVA 5EINA 3ZV6A 1P77A 1DJQA 3BTUA 4K26A 1P44A 4PLGA 5L4LA 1DB3A 1I24A 2NADA 1KVRA 4HFRA 4J1SA 1Y81A 1PZGA 4L76A 4XDYA 3KYBA 4IJKA 3LU1A 1CRWG 1QLHA 4DGSA 2NV6A 5KNLA 1M75A 2J5QA 4MIYA 2O48X 4Q3DA 2CVOA 2POQX 2VOJA 2I67A 3F1KA 3JQGB 4HFMA 1LJ8A 2B4QA 5EESA 2VWPA 1PJCA 4EI2A 4NJOA 4ALNA 3FI9A 2XF8A 4YB8A 2X9GA 1IZ0A 3FNGA 2PLAA 3GDFA 3JYQA 3MCVA 4OMUA 1ZK3A 5T8KA 1KEWA 1GCOA 1XR3A 2WJPA 1YVEI 3BMNA 1MB4A 3Q0EA 3N74A 2GRAA 4PG4A 1GQQA 4Q3EA 3ANMA 2QRKA 1N2SA 4XQCA 4MIEA 1WAMA 2GYYA 2P9GA 2P5YA 2JAHA 3F4BA 3VVBA 2BFAA 3RUHA 1QYCA 1GQYA 1P74A 1ZK4A 3VZRA 5JSFA 4W9NC 1EQUA 4BNJA 5DP2A 4MKRA 4Z3KA 1GZ4A 3QVXA 3KZVA 3FPLA 1KVUA 1SO8A 3NJ8A 4MPDA 4PLZA 1AHHA 3BMNB 4E5NA 4JBHA 2DKNA 5JMPA 5KKAA 4DBZA 4RF3A 5ICMA 2XOXA 4I5DA 5EMHA 3LC2O 1ZNQO 4HUJA 2GF2A 3QA9A 3L4BC 3QQPA 1EDZA 3V5NA 3KSDO 1P33A 2WYVA 4HXYA 2EP7A 3HZZA 3OF2A 4AJ2A 1I10A 4XYBA 4LW8A 2P68A 1YWGO 1U5CA 2C7VA 3F3SA 1UDAA 2ZCVA 4KZPA 4PZEA 3SXPA 5CDSA 1YGYA 3D5QA 3Q2KA 1Y8QA 5IDYA 1RM3A 1PQWA 1R0LA 2H1SA 5CDTA 5KCZA 5AOVA 1R6DA 3BXXA 1M6WA 1U3UA 1X7GA 3KSZO 4XR9A 4RF4A 5AVOA 3GGOA 1FK8A 4OHUA 1IE3A 5TLSA 4YJDA 1VSVA 5A02A 2RHRA 1A71A 1AXGA 4J1TA 4PFJA 3HFSA 5H83A 4OH1A 4II2A 1WMBA 4XGNA 4IDDA 3NDJA 3L0DA 5IXSA 1WW8A 3DTTA 4FOSA 2Z95A 2I3GA 4GKBA 4HWKA 4R9SA 5JCJD 2NACA 1F0YA 2GSDA 3QWHA 2OUIA 3KB6A 3WYCA 3HHPA 4IGFA 3TPCA 4MVJG 1QLJA 2OFPA 4BV8A 5CEJA 3WIEA 1KOLA 3RU9A 3H9EO 3FNEA 2NUAA 4AJ4A 1KY5A 3SX2A 3PGJA 1N7HA 1GYRA 4KTVE 4CJXA 3P7MA 4LGVA 2BI8A 4KQXA 1Y7TA 1CYDA 3GFBA 3F5QA 1I0ZA 4N5LA 1ISFA 1XLTA 2XXJA 3DZFA 1U4OA 1KVTA 4ZVVA 3UOGA 4CM3A 5KVVA 2O7QA 2JKVA 3IUSA 5IZ4A 4AJPA 1YO6A 1H9AA 4J16A 2A35A 2HMWA 5IDWA 2G17A 1UXIA 1E1NA 2R00C 4J9UE 3PJGA 1WP4A 4PG7A 1AXEA 3TNLA 1HETA 2YQ5A 3E5RA 3M2TA 4WLFA 4CLXA 4XRGA 2NVUA 3MJ4A 2P91A 5F5LA 4RQUA 4Z0PA 1PL6A 3OP4A 4BNLA 1DXYA 5JFOA 1J0XO 1DBVO 4D3FA 1CJCA 5L3ZA 3TZKA 1HSZA 4B4WA 1BGVA 1QMGA 4JN6B 4L4SA 4O5OA 4HFJA 1VLLA 5G0UA 1A4IA 3VPXA 2W4QA 4B8ZA 3VDQA 1QORA 2HKIA 4I1IA 5HM8A 1NQ5A 2UYYA 3I1JA 1K6XA 4XYGA 1KC1A 3W6UA 1W6UA 4LCJA 2ZTLA 5LCXA 3R3JA 2IXAA 3DDNA 1WZIA 2IRWA 4W7HA 4EJMA 3R0IA 3WS7A 3X2EA 2J3IA 3TZ6A 1HLDA 4I08A 1X7HA 1HDZA 3GMSA 5BR7A 1Z75A 3PLNA 2BHLA 3CIFA 3OJEA 2FWMX 4AJKA 4YT4A 2GNAA 1QP8A 4WNCA 5L53A 3FN4A 1YBMA 4MO2A 4AJJA 4CL8A 1ZO8A 2H5LA 3X2FA 3ASVA 4L73A 2PK3A 1I8TA 3ZHXA 2C54A 3GVHA 4WOKA 2CF5A 4J7CA 1IZ9A 1RYEA 3PHJA 1NPDA 1JWBB 3PWSA 3S2GA 3LT0A 4OOFA 1D8AA 4J3FA 5LDGA 2VUUA 1KVSA 3P5SA 4NBUA 1GEGA 2JCVA 3IKVA 1WLYA 4O59O 1HT0A 4B3IA 4E3ZA 3RC7A 1ADBA 3PIDA 1UAYA 1HF3A 4IQGA 3TF5A 1BW9A 2E49A 3DBLB 5B1YA 4YJFA 5G0TA 1F17A 4FFPA 1E6UA 3JQAD 1GUFA 4EUHA 1EUDA 4BNZA 3U9LA 5T6BA 2ZTMA 4BVAA 5A9RA 5B4UA 3ICCA 3ZU3A 1VL8A 4FIZA 3JQ8A 1X15A 4G2NA 1YJQA 3VPFA 2OGUA 3FR8A 3OM9A 1LDMA 2E37A 5JCXA 1XIVA 1A7AA 4FFNA 1MV8A 3KOUA 4M86A 2NU7A 3HB5X 3QSGA 3B1FA 4L74A 3WICA 4WKGA 3JQCA 4HNGA 4BKPA 3QWIA 3IOYA 1XSEA 2Q4BA 3OSUA 2GN8A 5ENVA 1LDNA 3ZW8A 4CLOA 3UHAA 1I2BA 1PS9A 1T1SA 1SB8A 3PZBA 4OXKA 3HUDA 1U5AA 1HE2A 4FS3A 1I2CA 1W73A 4K9DA 3U4CA 4S3MA 4W9NA 4WUVA 3EYWA 3Q11A 5G2OA 3WQQA 1WVGA 1B15A 2DFDA 1I3KA 4NU6A 1DHRA 4R3WA 2VUTA 1HDXA 3FNHA 4BO8A 2CNBA 3GAZA 4ZQHA 2Z1NA 2Q4EA 4BMSA 1EVIA 1I3LA 1ZEMA 3BHJA 4BL5A 4RVUA 4CMJA 1T26A 4BNYA 3PGXA 4H16A 1PIWA 2VHYA 2X5OA 3O4RA 3OECA 4RVGA 1EMDA 1XU9A 3NDRA 3ZHBA 3H9JA 4RZIA 3OQBA 1V3VA 4I9HA 3UCFA 4NNJA 2O4UX 4RLHA 3ZWAA 1UZNA 1D7OA 1T4BA 2O50A 2OORA 1DIHA 4IJWA 3JQFC 4WE3A 3CMMA 4YDRA 2FMUA 4PZCA 4UEOA 4UVEA 3C1AA 3VTZA 1KYQA 4BKUA 1RM5A 2PA3A 1HLPA 1E6EA 3PRJA 1F14A 3H6KA 4NDNE 4R1TA 5BQFA 1PJLA 4CMIB 2VHXA 1VL0A 2O3UA 1JQBA 3GNQA 1RWBA 3JQ9A 4S1VA 2X4GA 1ZJYA 3DTYA 3DBHA 1CETA 4BO2A 4B8WA 1F06A 4WCFA 1LLDA 3U4IA 4BO6A 2X8LA 4OSPA 1H2HA 2X9NA 4AJIA 2HK8A 5AXBA 8ADHA 3U5TA 3ONDA 3ROKA 5ES3A 2WM3A 1R12A 4E30A 1LI4A 1XCBA 2AQ8A 1H6BA 3JD3A 3JQAA 3RUCA 1QV6A 1GYPA 3ZWBA 4DBVO 3NYWA 1IB6A 1U8XX 4FJ1A 4UVGA 4OQYA 5K6AA 2UVDA 4O0LA 4Q3BA 4R51A 1DIRA 2X23A 4BHTA 4GLLA 1NPYA 4NJMA 3D3WA 3DBHB 2I5PO 5CEEA 1YDWA 3NKLA 4WCFB 3F1LA 1SNYA 3CMCO 5DBGA 4XGIA 4BO0A 1DC3A 4U0KA 4BNUA 2AXQA 2V7PA 1CEQA 2VHWA 5ER9A 2YV3A 1R0KA 2AHRA 1ID1A 3PQFA 3UXYA 4FGWA 4IXWA 2QZ9A 4OO3A 2Y66A 4IQ0A 3EGOA 1EZ4A 4NIMA 3EVNA 4DPMA 4XR4A 4FJ2A 5GZ6A 2RAFA 3IC5A 3WYBA 3FTNA 1Z7EA 2PZMA 2B37A 1T2AA 4FDAA 2Y1FA 2HMSA 4M87A 1BSVA 4NK4A 4RZHA 2OP1A 1XQ6A 5EL0A 5C7LO 3UF0A 4GGPA 2CD9A 3GEGA 4MVJH 1ULUA 3KYDB 4YR9A 3EC7A 3DWFA 4RPLA 1YB4A 3H2ZA 2OXIA 3E8XA 5AQ1A 4IS2A 3FPCA 3TZHA 2HJSA 2Q1TA 4IINA 3PWKA 1DPGA 4QO7A 4J9VA 4D41A 3ZNNA 3GGGA 1I36A 3MZ0A 5JY6A 4RQTA 3DEYX 4R3NA 5MDHA 3AK4A 3PTZA 4A03A 4J43A 4CV0A 1N5DA 4KWHA 3QRWA 1PJ3A 3KTDA 3KYDA 3D4PA 4TSKA 4TVBA 4BOYA 3PFFA 2X6TA 3WGIA 4B4UA 2IEBA 2FSSA 3BTSA 2O3SA 1B3RA 1NNUA 3HQ4O 3MTJA 1ENZA 3DAPA 5T57A 3RUIA 1LC0A 1UR5A 5JBIA 1KETA 3LC1O 3DBVO 4WEQA 4IDAA 3ONEA 3SVTA 3AUAA 5A5FA 3VAZA 1PZHA 1A9ZA 2WD7A 3B1KA 1PWZA 3OH8A 4RO0A 4CLEA 3OEWA 4UULA 1AN9A 3ZNPA 3E6AA 4FFRA 3PHHA 3GEDA 1P3DA 4PRLA 4YT8A 5I7VA 3GPDG 3ETEA 4BO4A 1ZFNA 1HDGO 4CQLB 1UH5A 3M2PA 4FBGA 5EJ2A 1GYQA 2HJRA 1HWYA 5DCWA 2NU9A 4GGOA 4WCFC 3G0OA 4A73A 4L0QA 1YOVA 4LMPA 3U4DA 3O26A 3W6ZA 3HDQA 5TRTA 3VKVA 3TZQA 3GG2A 1GFSA 4DLAA 2DTXA 1YL6A 3K96A 2O3RA 3GEMA 5CP8A 4ZHSA 1CF2O 3V2GA 4QUKA 2I65A 5CPFA 4MP3A 4BQPA 4MVJD 5L4SA 1N8KA 2B69A 4PLYA 5A3JA 3QWFA 3ZV5A 3U0BA 1OOEA 3ZV3A 5B12A 1ENPA 4D7AA 2YV1A 3GH3A 4TQGA 4PLFA 3GZNA 1P9LA 3V1TC 4FB5A 1YBAA 4NH4A 4XGKA 3KHUA 1Q7GA 4RDHA 6LDHA 3K8ZA 1TA4A 1NASA 2PZJA 4NBRA 4CV3A 1C0LA 1RPNA 2WMDA 4NJMB 3LQFA 2BELA 1B2LA 2AQHA 3GHHA 5K0ZA 4JBGA 1Y6JA 5F5NA 3WGZA 1C1DA 3ZHZA 3RFTA 4AJEA 4GQAA 1MFPA 1XELA 1P1RA 5K9ZA 5HRUA 2W2LD 4EZBA 2BH9A 4WJZA 5U4QA 1TT5A 1GUYA 2JAPA 1K5HA 2OZPA 3ON5A 1QRRA 5H81A 4YT2A 5JAMA 4K1LA 4DWVA 1ML3A 2NQ8A 4GX5A 4E6PA 4XD2A 5JC1A 1J5PA 1ZBQA 4Z3DA 1DC4A 1PQPA 4EUFA 4URFA 3I4FA 3DMYA 4FN4A 2VWHA 4YAKA 1ZSVA 4GMGA 3PI7A 1BXZA 3FTPA 4PVDA 4BGUA 2DT5A 2GASA 3AM4A 3RBZA 1MG5A 4JXKA 4DLLA 1TT5B 1PSDA 4O6VA 5IG2A 5JAIA 5IN5A 1M67A 1X1TA 4IDFA 4R01A 5DN9A 5TF4A 1E7QA 3Q2IA 5A4DA 2Q2WA 2DPHA 1O94A 4BNGA 3O03A 4MINA 3TRIA 5CDYA 3OJ0A 3JQ8B 1DIBA 1UP7A 4BQRA 2WE7A 4Y6PA 2DUUA 3EUWA 3ZWNA 2IE0A 4WNIA 5F1OA 5KJFA 2C2YA 3AM3A 5B4VA 1Z7BA 1LQUA 1I01A 1P1HA 3ITDA 5A03A 1H94A 4TRRA 1IL0A 1N1EA 2D2IA 4N54A 1DRWA 1UZMA 4YT5A 3IS3A 3C85A 1DDOA 4Y6RA 3AW9A 3ZWOA 1U2GA 4HBGA 4PLTA 2WDZA 2QRJA 5ENDA 1VSUA 4Y6SA 5I8ZA 5TJ9A 1L1FA 1IY8A 2V6GA 2OBYA 3MWDB 3KVOA 4KUEA 4CR7A 3O9ZA 1HEUA 1NFRA 2GN4A 1ZZEA 3DHEA 1NWHA 1IUKA 4OAQA 3RI3A 1T4DA 3NEPX 1RYDA 1MP0A 1Y9EA 3I6IA 4XA8A 3OHSX 4JQCA 1HXHA 4IDBA 4XB1A 4IMRA 1BG6A 3WWZA 3BTVA 1M6HA 1U2DA 1U9JA 4KOAA 5ER6A 3E9MA 3LC7O 1OBFO 1YRLA 1NWCA 3MJCA 4ITUA 1C1XA 1K89A 4NFSA 2FSVA 5AXDA 3D3EA 3A1NA 3UCEA 2H9IA 2B4RO 3HG7A 3DZKA 2WWRA 1GD1O 3GRKA 1CIVA 4BNTA 2GO1A 5JXWA 1E0DA 3QVOA 1FF9A 3LSYA 5AXCA 2J5RA 4Q3NA 1EUCA 3BMCB 1K6IA 8LDHA 3GZ4A 4FQ8A 1GPDG 2ZTVA 2PD6A 3E9NA 3RVDA 4E2YA 4Y98A 5JPIA 4DRYA 1SPXA 1C1XB 2GDZA 3DXFA 1D1SA 1NVMB 1YQDA 3L6DA 1PJ2A 3TSCA 3GNTA 5HA5A 3SC6A 2CMDA 2GERA 4TMFA 4F46A 2VTEA 1JKJA 1CWUA 1KVQA 3ZWXA 2Q2VA 1PQUA 1KEUA 1KBZA 4I8XA 1C3VA 4U6QA 1JKIA 3E1KA 4OQZA 3RQSA 1B7GO 2BFOA 5KVQA 1E7RA 2PGJA 3VHRA 3PVZA 1OZAA 3RBXA 3I9MA 1Q0QA 5TGDA 1KC3A 2O2YA 3VPHA 1KEPA 3GAFA 1MX3A 4BKQA 4C4OA 2B5WA 2GZ3A 4GVXA 2OO5A 3NV9A 4GSKA 2B35A 3RROA 3ITKA 1HE3A 1MLDA 4BMVA 1XG5A 3BMOB 2J5KA 4EITA 4BIIA 4R41A 3RCBA 4QFDA 1Q1NA 4FPXA 1O95A 3LK7A 4K6CA 2LDBA 3WLEA 1NVGA 3WBFA 3BAZA 3BHMA 4W7IA 5JE8A 3Q9NA 4BV9A 5A9SA 1WXDA 4PLWA 3KBOA 1SBYA 1PZFA 2Y93A 3P19A 2AE2A 1DAPA 4GVLA 1E1KA 3GVPA 3ROQA 5I7EA 1NAHA 2ZJ1A 1CDOA 4D79A 5KOIA 3INGA 1O89A 2AG5A 3BTOA 3LT4A 4P4NA 2VUSA 4DMMA 3FWZA 4E31A 3IP1A 1Y5MA 4R1UA 4E0BA 3I4CA 4IXTA 4Q9NA 1WZEA 1ONPA 3OA2A 4B79A 1R4MB 1CERA 2B36A 4RVDA 3ZNOA 2GUGA 3RJ5A 2JJYA 4JJFA 2HDHA 2IDZA 5GY7A 3ZZNA 2BFPA 4RPJA 3PQEA 4YPOA 3MJVA 4CM8A 1Z45A 5FFFA 1JAXA 3BA1A 1VJ1A 4CLDA 4WECA 2EJVA 5TX7A 3OETA 4DYVA 4J7UA 4KUHA 4BO7A 4XKJA 4LRSB 3UKOA 4ESOA 3SJUA 1LRKA 1WWKA 3C3XA 5JS6A 3H8VA 3TJRA 1E5QA 4GAEA 3NT2A 4ZQBA 1ZVMA 3GHYA 1WDLA 5JDCC 3WX0A 1BWSA 5U1PA 4EGFA 1R4MA 1HDYA 4TROA 1GR0A 1B3BA 3K30A 2FR1A 4HP8A 5CAEA 5B37A 2AMFA 1UAGA 1ADFA 5DCUA 4WCDA 4XJSA 1UXHA 3GN1A 2DUWA 3IJPA 4LN1A 1X0XA 3JSAA 3H4VA 1MC5A 3L4SO 4J1NA 4OSOA 5ILOA 5ITVA 3F5SA 3DO5A 2YFHA 2Y99A 1GV1A 3IAHA 3LT1A 1SAYA 2X0JA 3PLRA 1JAYA 3WQSB 3WYEA 1ZK0A 4J2OA 1R37A 1SEPA 2PGDA 3JQFA 1FXSA 1VM6A 3VZPA 1BDBA 1LLUA 1XHLA 4XQEA 4DA9A 5ILGA 1UJMA 1DC6A 1HE5A 3KYCB 1NQAO 3F47A 4H7PA 4R5MA 3IJRA 1XYGA 3C24A 1LSOA 3DZGA 2X5JO 3EZYA 3O8QB 4TKMA 3G79A 4Y8VA 5TJHA 4RL6A 4Y67A 2NVBA 2VZ0A 4ID9A 3DAFA 4XYEA 4MVJE 2XXBA 4DPLA 2BGKA 2D5CA 4MKXA 4CMGA 3JD1A 1DLIA 3Q1LA 4BNHA 2PZLA 5KVCA 3PK0A 2Q50A 2HRZA 4DIOA 1GY8A 3NJ4A 4RDIA 2P2SA 5T67A 3ROPA 4BO3A 4BKOA 3VOSA 1JKFA 4TZKA 4FFMA 2H63A 3HADA 1E3LA 3CSDA 5ADHA 1YBVA 4CV2A 3S8MA 3O8QA 3CPSA 4JK3A 2PH5A 3WLFA 1FDVA 3DBLA 2GGSA 4NHEA 3TFOA 2FR8A 1TXGA 2V65A 3JYLA 5THKA 4Z9FA 5IF3A 3AOGA 2NU6A 4BGIA 1UXJA 2NTNA 3PYXA 1AGNA 1O6ZA 1TLTA 4BO1A 3DONA 3PHLA 1NQOA 3AU9A 2HLPA 4M54A 4TRNA 1NR7A 4N7RA 1F8FA 5KVSA 4UUOA 4WLOA 2Y1GA 4BB6A 1ZSYA 3TFQA 3ZW9A 1DOHA 4TZTA 1QYDA 1I5RA 1JWAB 3RSHA 1ISHA 1T2EA 5TIIA 5FEUA 1PR3A 2C29D 3EAGA 2GZ1A 3WTCA 2VRCA 2HK9A 3K2BA 1VJ0A 2DTDA 2VHVA 1TI7A 4HY3A 5DULA 4GBJA 1K0UA 3DOCA 3ZH2A 3WDSA 4A10A 4CLHA 4BUCA 5EPOA 1ADCA 2W2LA 5MGBA 2QW8A 1SEVA 2D0IA 3ZU2A 2VRCD 4U8GA 3AOEC 3S2EA 3U3XA 2E82A 1EE9A 2DVMA 1KEVA 3LLSA 3RC9A 1DFIA 3WNVA 2EF1A 1P1FA 5KIAA 4D46A 4NQZA 3A28A 3H9QA 4LCEA 1TB4A 4PLPA 4KDEA 4J91A 1OAAA 1NPTO 1PJQA 1B8PA 4OL9A 3FBTA 2J3HA 2JHGA 3ENKA 4R69A 2VWGA 3HDYA 1R16A 1OI7A 2EERA 1G6KA 2W90A 1EVZA 3H5NA 3L4BA 1AUPA 2NM0A 3HDJA 1YB1A 1Y8QB 3H5AA 2NTVA 3VPSA 3GMDA 3MOGA 5C37A 4UREA 4FCCA 1X14A 1E3EA 1V0JA 3AUSA 3L07A 4M49A 4CMEC 4DC1A 4HFNA 2F00A 4L9RA 3DFUA 2ZATA 4D3SA 4XEHA 4YBZA 3RUAA 1ZEJA 2A94A 2I6TA 2YFQA 4IMPA 1U7TA 3RBVA 1P0CA 1AE1A 3DFZA 5TSDA 3CTMA 9LDTA 1LRJA 2B83A 3VPGA 5H82A 4BMNA 3JQBC 4IGEA 5TQVA 4OKNA 2JD0A 1M66A 2DM6A 2YHUA 3C1OA 1QYVA 5COAA 3GZNB 2FPGA 1PWXA 4IS3A 5JW6A 5EIOA 3IDSA 4O63O 2W2KB 5TT1A 2I9PA 2AG8A 1MXHA 1RM0A 5DBIA 3GUYA 4HKTA 3TL2A 1B8UA 2NVWA 4ZD6A 4AVYA 4CMKA 1ZIDA 3C7AA 4YQZA 3OFSA 5COQA 3NT5A 4YA6A 3CZMA 3NGXA 2FPIA 1GU7A 2EW2A 3PWZA 2Y05A 1GPJA 4M8SA 2R2GA 4PZDA 4ALLA 4KUGA 4YCAA 2IEDA 4DTIA 5JDIC 4EBFA 3WWYA 3QWAA 3C1TA 4LK3A 3T4EA 2O3QA 5C7OO 4I5EA 2WYWA 2G0TA 1JA9A 1R0SA 1ORRA 1BVRA 1DLJA 2RH4A 3E18A 5I9MA 2OL4A 3CUKA 1JDJA 4CUZA 1PGJA 1NBOA 4MDHA 1F8GA 3VVCA 2JFGA 3NTOA 5BSEA 4ILKA 3WGHA 5IAAA 2FZEA 4M1QA 4OIMA 2WD7B 4B3JA 1NHGA 2XPCA 4FFLA 2ET6A 2Q49A 3JD0A 2HSDA 3QW2A 4TWRA 1MC4A 2X22A 4E5MA 1KIFA 1DFHA 1YL5A 2HMTA 1DRVA 5IN4A 3FWNA 4NFYA 2CSUA 3GGPA 3I52A 3NAQA 3VC7A 4ALMA 1N7GA 5CEFA 1OFGA 1WDMA 4OKIA 2CF6A 3ZU5A 3AWDA 4XQ9A 4RVFA 2CUKA 3ZGYA 2YHIB 4BO9A 2IYOA 1ZW1A 4FSHA 1LLQA 3FD8A 2DBQA 3L6EA 5A9TA 1FDTA 1VE9A 1SB9A 2BGMA 5LDHA 3G17A 3H7AA 1L7EA 3RC1A 1CQIA 3UGKA 3OIDA 4F6CA 1GTMA 3WJAA 1GV0A 1O8CA 4UEKA 4E21A 4INAA 4MP8A 5U9CA 2VZ9A 4QO8A 3TZCA 4ONEA 4CM7A 1ZMOA 1ISJA 4BB5A 3Q9UA 4P4LA 4K28A 4KP7A 5BT9A 4J6FA 3JYNA 1LUAA 2YHIA 4XYMA 4YRDA 4NU5A 2QIOA 3IMFA 1BTOA 4WLVA 3D5TA 3JV7A 1WDKA 4J4HA 3JYOA 5IDXA 1O0SA 4YJGA 4QX6A 2LDXA 4B7XA 3EVTA 1E7SA 3QHAA 4MP6A 5BSFA 3BHIA 3WIDA 2HUNA 4G5HA 3DB2A 5HTOA 1S7CA 3QY9A 4GL4A 4DL9A 1XA0A 1Z6ZA 5F21A 4W99A 3A9WA 3ETDA 3ZWPA 3WMWA 2GZ2A 3LVFO 3IUPA 5A9SB 1IYZA 1V35A 1PS8A 1KY4A 4UVHA 4CM6A 2IXBA 1NTOA 4ND4A 1UZLA 3H9GA 1PGQA 5GZ3A 4XWYA 1JLLA 3BMQA 4L75A 2HO5A 4Z0HO 1EBFA 2FR0A 3WBBA 2E4AA 1LSUA 1QKIA 1HZZA 1FDUA
chains in the Genus database with same CATH superfamily
4PG5A 2RIPA 3MWGA 4EF4A 3MF4A 4OBBA 5K3FA 4D4HA 4PXYA 3KV3O 1J25A 1QRDA 2D2XA 4IIHA 4R83A 4F6LA 5CA1F 4N12A 3ICEA 4WSOA 4CUJA 1AURA 4YUXA 4B5LA 3DHVA 1CDDA 4HS9A 2FPKA 1SQ5A 3JCZA 1ZNZA 1LDBA 3NIWA 3NXKA 4BFCA 4ZVTA 1RM4A 2TS1A 4UUMA 2HPHA 4DADA 1CZRA 2BJVA 3OZTA 4Y0NA 2GHQA 3UW3A 3H9BA 1N2CB 3FB1A 3I3OA 5SY4A 4EJ6A 3DZ8A 5BXQC 5KTSA 1GM5A 4TV9A 1DKUA 1ZGBA 3DEIA 4K05A 4F11A 1N36B 2FJUA 4RLQA 5JS1A 3RC2A 3NWJA 3I2FA 4WUTA 4ZO9A 3LBNA 1X7DA 3EIEA 5LDDC 10MHA 4KIJA 3ITNA 3QOWA 1CF9A 3O0TA 1L5MA 3REFA 2P7IA 4JI6B 3CCBA 3NNNA 2FEOA 2D00A 3MINB 4TWIA 2RHCA 3B8HA 3MTGA 2R97A 1ZXXA 3RS0A 3RF7A 4CQMA 4EG4A 2BGJA 3ZE7A 4BMOB 1XB2A 3EPPA 1QYXA 5FHRA 5MN4A 1BH6A 1ZD9A 1FYXA 4W8GA 4EHAA 3UJHA 2ORIA 3PXEA 2QPAA 5AVVA 4GNKA 3I76A 4UW9A 2F1IA 1F48A 1PKXA 1R0XA 4CFZA 3GLQA 1YGPA 2HI0A 2Q1SA 5DF1A 5FA8A 4BNVA 2AI2A 3K6SA 3A6GA 2BISA 3RIHA 4MUKA 3GFSA 1EP1B 4M9QA 1LU9A 1I7SB 3GIWA 4L08A 2H51A 3DZDA 1YA8A 3U3DA 3E84A 4O4HA 5KMGB 1G291 3IHTA 3OTIA 3WLOA 1SUAA 3O38A 3T7JA 1ZUNA 3BKXA 3T7EA 3E82A 2DETA 1FFYA 2FN4A 3GVIA 1I3MA 1BDMA 4OXNA 1E9FA 4QQRA 5CG1A 2GWHA 5CVUA 3HCRA 3WMXA 2OV6A 5G0WA 2P2YA 2XOKA 4ZKEA 3CF0A 2V9PA 4WN9B 4QA9A 3BIJA 1RRVA 1CNEA 4FGJA 2PJRA 1J21A 3PNKA 4WXEA 3HB9A 3K2IA 5BN4A 2BGRA 1DSSG 4QBTA 3KSUA 5AHXA 3ZG6A 3TW4A 2F3TA 4W1SA 1T5OA 3H18A 3IQDB 3NHZA 4B3BA 5IEJA 1N5IA 4H60A 4RZSA 4RHFA 5FF9A 1A4UA 3IVAA 4IDHA 3CCFA 4EG0A 3IYLW 3DQQA 4I19A 4PR3A 4XGRA 3V6LA 5LQJA 5LQSA 4JI0B 2MR6A 1BQ3A 1NVAA 1PTJC 3I2HA 2P9ZA 4QYIB 1PR6A 1ZC3A 2V4MA 3BFVA 3WQBA 4AG5A 1JQ5A 1CT9A 3NUGA 3I34X 4EEZA 5J2TA 2ZVDA 4C01A 5IKMA 4BFSA 3QXHA 1RJEA 3ENWA 3INNA 3H5OA 4AZ3B 1X13A 5DNDA 3MUOA 4QGGA 4HNVA 4ZZ3A 4Y2QA 1JDZA 5JARA 5JO9A 4JXZA 3AYZB 1G5QA 2FCRA 1YJCA 3OCCA 3KXIA 1XDDA 3PNYA 2EV9A 3TOVA 4D8VA 4UHFA 3KQLA 1FLNA 3ZDDA 2Y76A 1N0WA 1SUBA 2VNAA 4GZ5A 1TAHA 2IYFA 2QUJA 4RIHA 3HFGA 4P35A 4RK1A 2R48A 1CF4A 1Z83A 1GTL1 2R8PA 3INRA 2OFWA 1LPPA 1IN1A 2FEXA 4BLPA 2TSYB 2YCLA 1WD5A 1OXKB 4MKHA 4HAYA 4FDMA 3ZZTA 1E99A 3EEIA 3NS7A 2ZBRA 1MABB 3OA0A 4Q4HA 2KI5A 1JLHA 2R1UA 3QU7A 4I2NA 1JAZA 2BSAA 1U3CA 2FVYA 4MSUA 4PAWA 4BJ6A 5B6PA 5J2TB 1F6WA 1USWA 1XTVA 4C4SA 2JC3A 3PF8A 1QC5B 3H8WA 5B2FA 1MOSA 4RGBA 3T1NA 1TDJA 5ALDA 4BJHB 3LP6A 3PXBA 1T2VA 2YFYA 5BRNA 2AXNA 1YZLA 2NQTA 4G1VA 4EF6A 4IEEA 1HDRA 1OLXA 1R8YA 5I9BA 3G49A 1A8IA 3PR1A 2E1PA 3GIDA 2Q5OA 2FUNB 4U3JA 2IHZA 3W2TA 2XGSA 5DW0A 1QZ3A 1W8IA 3Q41A 4HDSA 4C07A 5EJ6A 2QTFA 1A72A 2PKQP 3I8OA 1GUDA 1ECPA 1M1ZA 4CR8A 3HYSA 4QTYA 1UK8A 4IDGA 3D54D 3W2GA 4B7UA 4MV0A 4LSWA 2IVFA 1CULC 3UEOA 5HK9A 2B6NA 3FMIA 3QEOA 3DZIA 2LCQA 3FF1A 4YDQA 4PG8A 3EEOA 5BUQA 1KHTA 2GEFA 2GK6A 1N1GA 3VJKA 4RPHA 4B3FX 4YO8A 2CLOB 3UGTA 4J0HA 4U2GA 1GTZA 1T8RA 4OEHA 4CM9D 4YPVA 1JILA 5DM1A 1HDCA 2VHEA 3L1HA 1DMRA 4IGKA 1V9LA 2QRMA 2GEDA 3GFPA 3R4CA 1ZC4A 3IJEB 3QXGA 3C3AA 4HTAA 1ZK1A 2F1HA 1W29A 3EOAI 3PP8A 4MRVA 4UBKA 4XCXA 1FJHA 1JXQA 3NORA 2C5AA 1JS1X 2Q2QA 3AKDA 1C4WA 3F7NA 1CUCA 3KUUA 4WKNA 2VT6A 3AP1A 3LI2A 3R3XA 3UAWA 1D0VA 5DHUA 4BLUA 1W19A 4F4IA 4ZIRB 1IHDA 4G81A 4TMXA 1QK5A 2PU5A 1Z15A 5FBKA 4CE6A 2GKSA 1Y34E 3IPLA 4ZPJA 4F5WA 4UBIA 4BWFB 5DBFA 3LT2A 1NOKA 5T4EA 3WLRA 2CVPA 3LOPA 1F1JA 4R81A 4Y3UA 5EERA 4QXAA 4U6NA 1V37A 3S6JA 3DS8A 2QYSA 4JODA 1XHEA 2XWJI 4R9NA 4WEOA 4AJNA 4EDFA 1W36C 2CLKB 5C51B 2NO5A 1C1DB 4WPGA 2Z0MA 2QAGC 4FE3A 3ZDCA 3U49A 3H6HA 3WZMA 2ZI5A 3GMIA 5AO9A 2H2HA 1GA1A 3Q7RA 4F84A 3IIKA 4NFHA 3E3MA 1LLFA 1E1MA 3OQ1A 2WYIA 2GNPA 3MMZA 2HRCA 1JWLA 1PZEA 1VL6A 1P2FA 2X3YA 3MYYA 4IXMA 1S3IA 3VZBA 1NQTA 2V7EA 5B58C 2O8VA 4EVRA 5FBQB 3RUDA 1B00A 2PCLA 5ABPA 5TMEA 1UKYA 3WP1B 2IJGX 1IPFA 1H93A 4J4TA 1MFZA 2PGLA 4I3FA 1YHNA 4HATA 1D6JA 2XE6A 4H3KB 3WRXA 5EHIA 2JGJA 2C03A 2RHWA 3R7AA 5KX5F 1C0PA 3GT0A 1E4VA 4AN1A 2GPWA 4Y7DA 3H97A 4E5YA 1H4QA 4J49A 1FSFA 1MX9A 2G82A 2J3KA 4V3BA 1CU1A 1TK9A 3A26A 3I01A 4W8HA 3O8OB 3RWBA 4W5JA 1GG9A 1LTKA 2WKSA 3CNEA 4WY2A 2H9AA 3UMJA 1RXYA 3V8QA 4AF7A 5L4NA 3W4JA 3V4PB 1YQXA 1A5BB 4KFUA 3NMUF 1JW9B 3C3PA 3DYIA 4O2AB 3T5BA 1TM4E 3SP1A 3EX7C 3RYIB 1N6PA 2RC6A 1B16A 1HLGA 1Y4SA 1BC5A 3K6KA 3M6AA 3OEED 1HQKA 3NH9A 2IP2A 4YHBA 1VGVA 2DFKB 5EE0A 5FADA 5FJJA 5FLXA 2AD1A 2WJAA 5A7HA 4GG1A 3H87A 4TLDA 4UCWA 5CDUA 1RRMA 1Z74A 2VJLA 1ENOA 3F7OA 1ULSA 3H1AA 4K2AA 1D07A 1KZGB 1G2PA 4MVYA 5EPUA 1JYSA 3SKYA 1Z0JA 2H8KA 3WYAA 1QB7A 2OM2A 1MGOA 3TVDA 4N1AA 3PV0A 1KJJA 2GT1A 5DTQA 3VR6A 3JQ6A 5JYEA 1W4RA 3EJWA 1IWPB 4ZQFA 2HU8A 3CA8A 1LS1A 4DEYA 4FGZA 2IZ1A 2ATEA 4G4IA 3KOMA 2V0GA 1FYDA 3E48A 7REQA 2QTMA 5AVKA 5IS2A 2ZXUA 4Q1BA 3K3PA 4DDKA 1MO4A 3N2KB 3R0QA 1FX0B 1NX6A 3H05A 4OAPA 4PQFA 4Y6OA 2O2GA 4KO3S 3HCCA 3HVKA 5FNVB 1S6YA 2WMYA 1YDEA 4IIGA 2O3TA 1G8SA 2DBRA 2HCTA 4Q02A 2P2CA 3FZGA 1R5BA 4QT0A 2AN1A 5D1NA 4CQMD 5KWSA 1GZHB 2VN8A 3ITEA 3TB6A 5BO5A 3GGJA 3Q72A 4OY3A 3SIXA 1XVUA 3LC0A 4RDCA 2VSQA 2JD1A 4ZVOA 5K3BA 1U3DA 5C5CA 4PTLA 1R15A 2JCGA 4XRRA 4GX2A 1NRWA 1RWWA 5F1KA 3T4XA 3OZXA 3BK1A 5KTKA 1E5LA 2ZB4A 4HDSB 1FLVA 4HAUA 4LF7B 4G0WA 4MHTA 1B6GA 1IULA 1SELA 1Y4UA 3CEMA 3A4VA 4RADA 3ZDFA 4BJ3A 4EA9A 4EIWA 4TRJA 1P0PA 2WF9A 4YACA 3R7WA 2PEZA 1P60A 2WHRA 3DMTC 2WINI 1XZPA 3FHLA 1V3QE 1ZGJA 1P1BA 4DQUA 5K20A 1OX6A 2J6IA 1E6WA 6NULA 1W9MA 4KWIA 1UJ4A 3GCDA 3KOZA 4X1YB 4CHGA 5HZMA 5JROA 1V7QA 4YJHB 2O2XA 2WIAA 5FKJA 1W1UA 2BLNA 1OFIA 2HBYA 2WZDA 1IEWA 3DDHA 4OLBA 4RK7A 2QMYA 4OQQA 1T2CA 4F2GA 2PLRA 4P93A 2A9OA 4CF3A 3DPIA 1VPDA 1TQDA 4FKMA 4E33A 3GY0A 2WTUA 2ZCUA 2X5XA 2BDUA 3E23A 4NZ9A 2QMEA 5E6RB 2RDMA 1ISSA 3KQQA 4QU9A 3SU8A 2XBLA 3E05A 5EPEA 1VE6A 4A82A 4TV9F 4DNXA 5K8IA 1CRQA 1Y7LA 2J3EA 2FETA 1N57A 4TL7A 4Z4CA 4YWHA 2VSFA 1U0TA 1DEOA 3I72A 1RQGA 3MQ2A 1A9PA 4Z7JA 4RYLA 1LBIA 1IIBA 2JEOA 2C5EA 3PXUA 3R6GA 4N5NA 3WL7A 2D06A 2DXIA 3QSYA 1UWVA 5C3MA 5JZSA 2CJPA 1BN6A 3KK0A 4WXPA 3CZRA 1SVMA 4F93B 2GM3A 4OI4A 2XGOA 3NH6A 4QLOA 2PUCA 1YKSA 4W4TA 5TC4A 4LAFA 2V59A 2AFHA 1ISMA 4FZRA 3H19A 4B31A 1K5DA 2WAOA 2P5SA 4KMOA 3SOPA 2EQAA 1X70A 1JVBA 3S28A 4H31A 3V32A 1P2SA 3CZCA 3G1UA 4R1SA 5TS3A 1KYXA 1UINA 2FZWA 3OFVA 4AYXA 4H7FA 3QE0A 1AQUA 1QGUA 1OLSA 3AI3A 4GLOA 1F2UA 1JHOA 1GTG1 2KB0A 3ZLUA 4JLKA 4UBJA 3C3WA 1R0WA 5H3CA 4CIYA 1ISGA 4ZYXA 2ZYTX 2YIJA 1LRLA 3WY9A 3SR3A 3ASUA 3WS7A 3X2EA 4NPCA 4I1PA 2JGNA 2WIJA 3U4MA 4MV8A 3L7AA 5NLLA 1YDMA 2NO7A 2VZEA 3T3GA 4ROSA 4B4OA 5JVDF 2KS6A 4JZKA 4NCAA 1SG6A 1W34A 3C6MA 1M2KA 3TAXA 1Y37A 4X54A 4J1QA 3A14A 4CWAA 5B7QA 2XUQA 3E9DA 4MVJP 4RSHA 1VFNA 4US1R 5CA0A 4PCVA 2C42A 4EJ2A 1DQZA 1GZSA 2ORYA 3R6TA 2DWQA 2H4JA 3COYA 3QKWA 4JGBA 4AZWA 1Q7CA 1NDQA 4F1KA 3T1VA 4TVKA 3GLGB 4AI6A 3KLMX 3QLJA 2QRVB 1YT5A 1ADYA 3LX8A 3FOAA 1QHIA 2ZIVB 1LF0A 1E3SA 4AAYA 4I50F 2EL9A 2XNKA 4KNVA 3M3HA 2CSXA 4LF6B 4P7BA 3SLGA 4JIGA 3EDOA 4MVWA 4TMZA 3EF1A 3KM0A 4E03A 3G8CA 1Q0TA 1RLJA 1RBZA 4X20A 3PBKA 2PFKA 5EWMB 3SBXA 4MQFB 2EKDA 2L82A 3QLTA 1R0CA 1AHIA 2PY6A 4KVGA 1L0BA 1SHKA 2OYRA 2HA3A 4FD2A 3VI4B 4B9AA 4H08A 4FD3A 3BFKA 1GL3A 2VJYA 3B6ZA 4MWGA 3DE3X 4ZALA 4HUTA 4PYJA 1T8WA 4GPD1 5K8VA 3HPRA 4G4JA 1Z2CA 3ABOB 4II3A 5IJ0B 3OZWA 5AM4A 2I4IA 3AY6A 4MR7A 4ZQIA 2DFVA 2A14A 3AOEA 3VUFA 3VDRA 3BSYA 2BIFA 2G9VA 2UVQA 2WA1A 4R2JA 1XX6A 3H1EA 4RHEA 4DCGA 2IY7A 5JR3A 2IXGA 3I0ZA 1RRKA 2GLXA 4I9UA 2HA2A 4D5GA 3PXDA 1QE5A 4P54A 2PS3A 1H6DA 2NO4A 2IYLD 2TMGA 3V9PA 2BR4A 1TEVA 4GI2A 3U4AA 5H9WA 1Z9BA 4JFRA 2ZSJA 1RADA 3PJEA 2L69A 3V1YA 2FWAA 4XE5A 1P62B 3U3MA 1VDZA 2Q6VA 2IX3A 3C5VA 3RQIA 5HGXA 2FRDC 5LBUA 1CY4A 3IAS1 4I50B 2ZRKA 3V4RA 1VP9A 3ZDBA 1JQ3A 1L4HA 2GMWA 2JGFA 3IO5A 3OEYA 4QPPA 3LT5A 1DC5A 1FYFA 2P30A 3NOVA 1GPLA 3PC6A 4BVGA 5SZKB 4R1PA 1X74A 2DZDA 1G9TA 3ANNA 1AQ6A 4E6EA 4WK4B 3Q5GA 4BDTA 3E2MA 1WZNA 3NVMB 4D4LA 2XB2A 2OV2A 4JSTA 4OHVA 3ZLBA 4I81A 4A7PA 1LEHA 3H1FA 1KGSA 5L8VA 3GP3A 1V1MA 2QMHA 1PU2A 1A2KC 3JAKA 5G0SA 3TN7A 2Y1OA 2G9QA 4ABYA 4DQVA 3JZFA 3QWBA 5ED4A 3ZS8A 1XQXA 3AEZA 1LSJA 1O95C 4C88A 5M04A 2QN9A 5KYUB 1SBQA 2MSNA 2Z3ZA 3ZWYA 2XD9A 3VHXA 2C1XA 1GKUB 3U60B 2BGUA 3FPKA 4S2EA 1B93A 2QW0X 4XLLA 4HX5A 5D00A 4N5DA 5L51A 3COSA 4G0XA 4B4KA 1WCWA 2Y9PB 1E9BA 5EIWA 4AF8A 3E53A 5EJFA 4FOLA 3RVMA 5JCZA 2R7KA 2VOEA 2HEIA 2O2JA 3FPHA 5KSWB 1D9XA 4NBKA 2WUVA 1J42A 1PKEA 4AP6A 1EA7A 4JX8A 2HRBA 2AVNA 3DUWA 4MNTA 4CF5A 2ODPA 1OPXA 2H3EA 5E3JA 2Q29A 4BJ5A 1A77A 3W78A 1G20B 1EUZA 5DU2A 5AJTA 1UBCA 3FCYA 1AZWA 1D2RA 3ED5A 3ZY6A 3H2IA 1TK2A 1Z7GA 2R1VA 2PZAA 3GT3A 3PRKE 2BEUA 1U0LA 4XVQA 3FOZA 1BW9B 5K2OA 1N5JA 1PAUA 2C61A 4Q47A 3GEHA 4XD7D 2RG7A 1ZUHA 2PJDA 2VF7A 3WNDA 3VH2A 5AIBA 1T3GA 3OZIA 4JT4A 1BJTA 3W8NA 2O23A 3CT6A 1N8SA 1NMXA 3ZYZA 2GEUA 3ZHQA 2I2FA 3K0AB 4ZDIA 3WB9A 4DC9A 1EQAA 2NO1A 2V3VA 3AR3A 3D7SA 4FZ5A 4MH0R 3GUVA 5LOVB 1TF2A 1YVUA 2HZ7A 5DNVA 2I8AA 2ZB8A 4H3HB 4XOUA 4RJTA 3QVWA 2FA9A 3DMDA 2AZXA 5CJPA 3GT4A 1H3NA 2GN9A 4Y2UA 1UMBB 4ZCRA 2C2XA 4J7AA 2HHJA 1OH5A 3OIWA 1J6UA 2HNAA 3MT0A 4N0MA 4WKOA 3LKZA 1MUUA 1GCIA 1U8EA 5DM4A 1UMDB 5T6MA 3WFZA 4DA7A 4EHIA 4NNPA 3PPIA 3DAOA 1NM5C 1O95D 3N3BC 5HK8A 2GZMA 3TEMA 1TYBE 3QITA 5JFGA 5EMLA 2GB4A 3K16A 2B4KA 3UGJA 1ULTA 2ZSUA 4YP6A 2IU0A 4PFQA 4OJYA 1EFUA 2ZRMA 2B99A 3PL5A 3QE3A 3U80A 5AUOB 2W6MA 5JAOA 4LJ9A 3B89A 1AKNA 1OXMA 3E3LA 1Y3CE 3R23A 1FTSA 3HL0A 4ENQA 3G5LA 3HJUA 3NRCA 4BMDA 1T1EA 3ABZA 3QU9A 2FFAA 4FW8A 4HQFA 4WXRA 2CFOA 5JZMA 4FEAA 4PIVA 4QM6A 2CNLA 3PDIA 3L82B 3T54A 1NUPA 3UMYA 2BD0A 1O0CA 1I2ZA 5TB5A 4DV4B 3C2QA 1X7WB 3KU1A 1PK8A 3DE0X 3W5CA 1UJ2A 4LRWA 1TT7A 2GYWA 2A30A 1GGNA 3AF1A 4JKIA 4WA8A 1Q2UA 3NRBA 3P20A 3WFIA 3X1WA 2IEZA 4KQKA 5TT0A 1E0AA 1SC6A 1JE1A 4I55B 4M9CA 2QTCA 1FOEB 5HBRA 4UFPA 2WWWA 5A5GA 4HGOA 1OJLA 4X9XA 4G8CA 2ECKA 4PS0A 4P5EA 2QL7A 2VYFA 2QMQA 3AI1A 3IUQA 2XRYA 3MRSA 4NU8X 4V0NA 3SQMA 3ZBTA 1E7WA 4ZHQA 1JEYA 4BNIA 4KO1S 4HWGA 4KFCA 5F2KA 1KS9A 1YTUA 1MA0A 2Q8PA 4XTCS 5SY9A 4DY4A 4WZZA 4ZC1A 5KJ1A 5HDQA 1BMDA 1UOOA 2X7HA 1K7EB 1QE0A 3WSWA 3LE8A 2EFCB 3HA5A 4KMSA 5THQA 1NYTA 5F1PA 3WL8A 1NFQA 221PA 1C4KA 3RGGA 4BFVA 4DLUA 1Z8FA 1C1HA 1AU9A 3HY3A 1PK7A 5DWDA 4DVJA 4U7TB 2HPAA 3I23A 3LZCA 4M7RA 4J0JA 4KN6A 5BN3B 4DR3B 1W5BA 3K0CC 1T5TA 5IM5A 5A3VA 1Y1PA 1RPZA 3ICVA 2TYSB 5K3SA 3RVKA 4D44A 1CUZA 3SC2A 5E6SB 2FLVA 3W8DA 1XOIA 4AZVA 2QRQA 3PHGA 4RY0A 4ZA2A 2IX9A 3TUZC 2IUYA 3W5JA 3IKLA 4BN4A 4ED9A 5FI3A 1GUZA 1P9NA 3KJQA 3SHVA 1OVMA 2Y67A 4MX8A 4CMAA 5DPMA 1VBMA 1LDYA 1KEEB 4L4XA 3MSCA 1ND6A 2OLJA 4NCKA 3TECE 1G0NA 1XRJA 4PCAA 3PI6A 1CV2A 3MOIA 1SRQA 1SKBA 2QV7A 1I0LA 2VYND 2CHUA 1VKNA 1PO7A 4L5IA 1R8QA 1YACA 1H9BA 2PD4A 2WA2A 2Y4NA 3LA8A 1YZVA 1N8NA 1VC2A 1MO6A 2JCYA 5L40A 3DE5X 3BZWA 3TL6A 1OGJA 5JZBA 3WQRA 4GP7A 2OCYC 4ARCA 4DZZA 2NSJA 4JC8A 3ZU4A 4PGGA 2VRNA 4RV9A 5KJCA 2HRDA 1DX9A 2CNWD 4G4GA 3ZTWA 4EA6A 3AKEA 1EJ2A 3O1HB 1YSCA 3VZQA 2XECA 3W05A 1TZ2A 4PGHA 4OL0A 2O7VA 3RHSA 2WTBA 3CJQA 4JZYA 4XWTA 3VO2A 5DNAA 1G38A 1TECE 5CVCA 3HDGA 3JAMA 3UHOA 2R1VB 3VKUA 2ZS8A 2D4HA 5BWBA 3SJAA 2PBLA 2O3JA 1KXJA 2ZRPA 4OVKA 2OFOA 3THWB 2E55A 5ALRA 4N5MA 1PVOA 1HTBA 2NXNA 4WESB 1MB0A 1ZIOA 4YRRA 1AS2A 1II9A 5DT2A 4NE2A 2EEZA 3KV1A 1JDSA 1QTQA 2IODA 3PQDA 4ZN6A 1GRCA 2R8ZA 3KFLA 3M1YA 3TIVA 4PAGA 3O8BA 2CUTA 2F1RA 1YK0A 3JD2A 1D1PA 4GOLD 2KMLA 4GPZA 4UAGA 3RIMA 5BSGA 3ZKAA 3FTDA 3FNRA 3K1YA 2EFGA 2VKQA 3R5TA 2YJZA 4ADSG 1JT9A 2GK4A 4EI8A 2OVFA 4YQYA 4NS1A 4UM7A 5EUBA 2ZTHA 4BLTA 3NBXX 4JUBA 4LRYA 1O5TA 1AA9A 4DEVA 3A9RA 4IY1A 3AGQA 2I2AA 3EQ8A 1QH8A 1C80A 1JYEA 2FW8A 2AQIA 1YS6A 5LU9A 3G2PA 4C21A 5J40A 1LNSA 3PX2A 4F0JA 5EJ5A 1QG6A 4L7QA 3C7CB 5F3RA 2AV6A 3ETGA 3EAFA 3O9VA 1KE2A 3I1IA 4M8NE 3RUEA 3KEFA 4DXHA 3U6KA 1EG2A 3LF1A 4E12A 2QMUA 4B81A 3KYJB 2NT4A 1KDZA 4F1WA 4H6WA 1EK5A 3MJEA 4Z6KA 3O3NB 4X6UA 1UFQA 2LW7A 4B7CA 5F2NA 5AM1A 2BGWA 4XJVA 1ZVQA 4CMCA 1AVTA 1FRFS 2BONA 2QX8A 1EEHA 3F4LA 3CPEA 4BZQA 4M89A 4PAMA 2CFCA 1T4CA 2EKQA 2VPIA 3CN9A 3PUHA 5EKXA 3RTDA 3I39X 3LY8A 2PX4A 5K0NA 1NN1A 2J67A 4LOKA 3KYCA 1HYGA 2QXUA 4ON9A 2D59A 1E1DA 1WPGA 5DOVA 1MAWA 1XHFA 4BV2A 4CQNA 1LDEA 1WKCA 4O1IA 4CL2A 1K6JA 1FJXA 1JFFB 3JQ9C 1FUYB 3HKEB 3HNPA 1M2OB 4IYJA 4Y6GB 2AE1A 4UUQA 5IFLA 4YAUA 4LZZA 2JFZA 3GJQA 3RRMA 4ABTA 1NTRA 1KDRA 4PZLA 4JELA 4BNFA 1EDDA 3TNDA 1HEYA 4OSEA 2B1QA 5C8YB 4QRDA 1MQSA 2EGGA 5JAUA 2ASEA 5JBNA 1N34B 3IEVA 1NQXA 1Y9AA 2NV0A 2I66A 3A4TA 1UDCA 1DKOA 4IIJF 1JR3A 1Y3FE 2BKEA 2IZ0A 2XE4A 1W5EA 2FPPA 1HQYE 4QLAA 2X8BA 1CUBA 1LVGA 5IC5A 5IJZA 2OQRA 2QGZA 4QOEA 2N46A 2F3PA 2PTHA 3L8YA 1GUBA 3KJGA 4F9FA 3ZN2A 2DLDA 3NGMA 1NAIA 3GJSA 4LK2A 4X66B 2XWQA 4ZAYA 4BNMA 4YCCA 2GAFA 3CO0S 2C77A 4RELA 3UHPA 5IVPA 4JVOA 4RPGA 1HX7A 4RK6A 1MW8X 1G4HA 3X1KA 1VLVA 3EW7A 1GPNA 4TS9A 3R3SA 4TSRA 3R7NA 1G66A 4M76B 5CNIA 2RGDA 2HIAA 1KKLA 3AJ8A 2C9ZA 1RTTA 4DC0A 4ZT5A 5JQGA 3ZY3A 5G1PA 2ZPTX 3SAJA 4DNFA 2C7GA 1VGQA 4URYR 5JMWA 1ESMA 4ND8B 2X1LA 3BYZA 4QDXA 2JJ1A 4UMFA 3CM0A 5IT5A 1F12A 3E9RA 3PPVA 2JI6A 2XVYA 3L6UA 1IN7A 3OTOB 2JH8A 4FX2A 2HF9A 1QHYA 3S29A 3QKSA 2YMMA 4HWSA 2W6QA 3TSYA 1AGPA 1AF4A 3M4ZA 5KTTA 3VNUA 1YUMA 2IXEA 2C4UA 3F6BX 3LXUX 4UUNA 4V3CA 3SLKA 3Q85A 3DHNA 4NR0A 3A6KA 2PH3A 3ZWKA 1VB3A 4DV0B 1XN4A 2E89A 5I7RA 3I9LA 2I91A 2EP5A 2H9YA 1O9BA 1WXEA 3D8TA 4HAWA 2DFPA 2P3SA 2PAFA 1WPQA 1S3GA 1WMFA 1BVUA 4NK5A 4Y0VA 4XB2A 3NTUA 1AJEA 1G2QA 3WOHA 3TZLA 5EG5A 4Q1VA 4GP9A 3RYCA 1J0DA 1G42A 1RHRA 4CCYA 2QXTA 2BUAA 1DJQA 3BTUA 2EJCA 3OKFA 5C5DA 1TPYA 5L4LA 4NZZA 1A4RA 2CL0X 3CNOA 4OAOA 2QL9A 4J1SA 1Y81A 3RTGA 2PWBA 3B82A 1IXSB 3LHDA 4MRAA 3WLHA 2IOQA 1KWGA 1QLHA 5KU7A 3U7EB 4ANFA 4Z53A 3CZQA 3N87A 3EPRA 5EZQA 2J5QA 5FT9A 3UHJA 3NASA 2XA2A 3KU4A 3L7CA 2X8JB 3EZ9A 1D9ZA 1MIOA 4A8HA 1LJ8A 2B4QA 2JAXA 4Z4QA 4JB0A 3PXAA 1E89A 1PJCA 3E4DA 4L4UA 4LJ5A 3N6VA 2I80A 3NZEA 4LWZA 4MA0A 4NJOA 4EI2A 1ST3A 1YJXA 2ZSAA 1GKYA 1FVFA 2X9GA 1IZ0A 1IXKA 2P9TA 3GDFA 1DC8A 3KD2A 3ZQUA 2PX3A 1YZNA 2W7TA 4OMUA 1KEWA 3S70A 721PA 1X92A 2YOFA 3CRQA 3KBBA 3GBPA 3THXA 4KLCA 3I61A 4FMDF 1E3MA 1ZG3A 1ODSA 3EGXB 1VOTA 2ZRAA 3Q0EA 4LA4A 4NMXB 5AHKA 3OM0A 4RSMA 1GQQA 3A36A 1KKUA 5BURA 1A3CA 4UHJA 4LXQA 1QS0B 3D6MA 5BPHA 4KAAA 2AJLI 4C7BA 1ZJ5A 2LCFA 5EZYB 2XKBA 3I3SR 3U31A 2P9GA 4EPXA 3G2OA 3VO9A 1CC1S 1SPBS 2VHCA 2D5LA 1M6VB 3AIMA 3F4BA 1KAQA 2FFHA 3VVBA 3GRYA 4WKBA 1GQYA 1Y0BA 2QVGA 5DW3A 2J48A 1FU7A 1TMOA 3HU2A 1ZM7A 2V5VA 3KHSA 4L5YA 5TQ2A 5DP2A 2HBZA 1H42A 1OFUA 1JLSA 3ZVKA 1ZCFA 2HXGA 1NNEA 2J08A 4B80A 2CMKA 1IDN1 3CLTD 3V3TA 3IA7A 4G9GA 2IUTA 4MPDA 1IN8A 1AHHA 4RFVA 4BEWA 1H3EA 2SHKA 1XJ0A 4X1IA 4JI5B 1Z12A 4JBHA 1N33B 2XGMA 2BEWB 1OBVA 5C4MA 4FILA 5CK4A 2XJ9A 4BPRA 2XOXA 3LC2O 3MSXA 3BD9A 4QDJA 3ZE1B 4M83A 4S05A 1B0ZA 4IQ4A 4TMVA 3WGUA 4BYGA 1KK3A 3ONWA 4JL5A 4HXYA 2GXSA 4UTPA 1JDUA 3QX3A 4XYBA 3JXEA 4LW8A 3L7LA 1S8FA 5GV8A 2BGGA 1I4LD 2R68A 2ZCVA 4PZEA 3SXPA 1QONA 4JSRA 1DADA 1L4BA 2ENWA 1L8OA 2QWXA 1NW4A 4HEA6 4HR7A 8OHMA 3WK4A 2V5AA 4A0RA 1CQWA 2DQSA 2O19A 1P75A 1PQWA 1R5NA 1RXVA 5KCZA 3RS7A 1V11A 1IM5A 4ARVA 3NNDA 1JA0A 1JIIA 1SK8A 5AVOA 4LF8B 4EFDA 2XWPA 4OHUA 3HN6A 3R7WB 4WD3A 1TU4A 2Q3HA 2CXSA 4YJDA 2HCBA 1KBOA 1A71A 4MV1A 3UG6A 5A02A 2QN3A 4DCCA 1O5OA 4X00A 2ZUUA 5F77A 2ECFA 2AZ4A 4A8TA 1WMBA 2QR5A 3HKCB 2P35A 3SYRA 2CEKA 1FSZA 1K68A 5AKGA 4EDHA 3GLGE 2PUAA 4K2HA 1Q1ZA 5HMMA 1WW8A 2XOKD 1XCJA 4H7HA 1XNHA 4RK0A 4B2IA 1DQRA 1BU8A 2NV2B 3WHKA 3A37A 1NW9B 1F0YA 3OX3A 2WRZA 3L0OA 3ZXYA 1E9CA 3WYCA 1C4OA 3JAWA 2OFPA 3NLLA 1S9DA 1ODCA 1WSBA 1X6VA 3KFXA 3PDIB 3PFBA 3KKPA 4NZYA 1P18A 2H7YA 3TS1A 1V1RB 2EKZA 3AM1A 4PZUA 4AJ4A 3UMBA 4UAJA 5AW5A 4CJXA 3B3FA 1C3XA 4FWTA 4UNSA 1Q5PA 3KUDA 1CYDA 4HMQA 4MDFA 4R8LA 4F4DA 4EF5A 2CD7A 5CD9A 2AG1A 3M6FA 1AHNA 1TM1E 1STOA 4Y9SA 4HNTA 1JQAA 5KVVA 4B3GA 3UOGA 4CM3A 4L72A 5KVAA 1GTRA 1ISPA 2O7QA 3IUSA 4J8PA 1BS2A 2YC4C 1YO6A 4QSHA 4AJPA 2QOEA 4O4JB 3WKBA 1XLVA 3O1LA 3PQ8A 4X7RA 1U90A 1UADA 2Y0BA 1E1NA 1N6LA 3K0EA 2R00C 2MSDB 4ZKDA 3ZIUA 2YQ5A 2H4WA 2ATVA 3MGGA 4ZCQA 1WHSB 4V0RA 3T35A 3P9XA 4LV5B 1X1QA 4LRXA 2W6JD 2I8LA 2BFWA 3D7RA 5F5LA 3WJ1A 2ZTSA 1DXYA 5JFOA 5LJLA 5AVWA 3I04A 5LN1A 1N78A 4RETA 4PBRA 1CJCA 1RAIA 2N0SA 5L3ZA 3TZKA 1BGVA 1QMGA 2JFPA 4D3FA 5JFTA 1YVRA 4O5OA 4AKGA 5KOHA 3TLZA 1XQVA 4URVR 1VLLA 1L5KA 1A4IA 4KSCA 2W4QA 3VPXA 1JF8A 1DPFA 4WOCA 4BE4A 5A2GA 3QPAA 1SRRA 3EPKA 4YCBA 3SQDA 2Q9AA 1DBSA 4IX9A 3B53X 3BWMA 1KC1A 3WK5A 4U2KA 2EZ4A 3HYTA 1R00A 2FTKE 3DDNA 5EKDA 3NC1C 1PNRA 2Q4OA 4OFBA 2GM9A 4RZQA 2QL5A 1J39A 3JX9A 5CH3A 4OQ4A 5IW8A 2N1BA 1OBCA 4FBLA 1RWVA 2ONCA 1HDZA 3V7FA 5LP6A 5BR7A 4GD3Q 1K7XB 5K0CA 2VPPA 3ETHA 2Z83A 3I53A 1DEKA 2LTAA 3PLNA 1G20A 1F1BA 1XDBA 4Y2TA 3LGXA 4OU5A 5IKOA 5LQMA 2HB6A 3CIFA 3OJEA 3P8ZA 4AJKA 1NMYA 4FTWA 3UB4A 3MHTA 2SNIE 3NYQA 4HRXA 3JALA 2WJ4A 3NWEA 4MUGA 3N8KA 1JPVA 4H3SA 2K4MA 3IE1A 1ZO8A 1Q15A 3GAAA 1WCIB 3IAUA 1T0IA 4N3NA 5FOQA 4L73A 1T6BY 2CBZA 1J23A 2YVQA 2TMYA 3COWA 5BQXA 3ZHXA 1TMYA 1FYWA 2BFDA 1Z0KA 3GVHA 5E4TA 3QY0A 2VJBA 2RHHA 4DV2B 1N4AA 1N0UA 3MHPA 3ABSB 3FOFC 1QH9A 2X0FA 3FFXA 5DHQA 4AZSA 1RYEA 2JAUA 3PHJA 4UPVA 1JWBB 2HX1A 3PWSA 3K15A 3LT0A 3CKMA 4OOFA 1D8AA 4YJ3B 5LZ8A 1YNSA 4UNIA 3KQKA 1OH8A 2MYNA 2VA8A 2VUUA 4P7JA 1U1GA 1M5UA 1PUXA 4PRZA 1FYVA 5FWXB 1A9RA 1FUUA 2FE4A 5DNEA 4B3IA 2H4ZA 1TL7C 1O77A 2JDIA 4LJ6A 3RVPA 3UXMA 1QIGA 3RC7A 4EJSC 3TX6A 1UAYA 5EKSA 3VISA 5KYXB 1I3CA 2E49A 2QN2A 4KLRA 4OP2A 3SZGA 5JXGA 4YJFA 3T0IA 1Y6GA 1Z68A 2QUAA 3VKHA 3ABRB 1OD6A 4FFPA 4L8GA 1Q11A 4BU1A 5CB0A 5FPYA 1JUDA 3T7AA 1GUFA 2VTBA 4BNZA 3TX2A 4TWZA 3U9LA 5T6BA 2ZTMA 2OAEA 3ICCA 3UMVA 2EDCA 3SX4A 2QD1A 2WFMA 4G2NA 3RVBA 1YJQA 2PMCA 3WA7A 1RRPA 2J85A 2OGUA 3FR8A 3KOYA 1N1MA 3OLYA 3LCCA 2JFYA 1RTKA 1XIVA 3AI7A 1Z08A 1DARA 3DH0A 2NYRA 4M86A 2B8EA 2NU7A 3HB5X 3QSGA 5KYUA 3CVOA 2DERA 4FKZA 3DMGA 1UJCA 2QJOA 2O7NA 2P8JA 3QWIA 3NBFA 4RKQA 3JATB 3X1MA 3QPBA 2OY0A 1N2CA 1RWXA 4P92A 1I2BA 4MUFA 1JQLB 1NMSA 1T1SA 2ZAMA 4LY0A 3ZE0B 3OT5A 1U5AA 3BH0A 4FS3A 4WN9A 4EW3A 4ZCIA 1M83A 5IT4A 5G2OA 4O3FA 3GLIB 1B15A 1OYYA 2H31A 2O0KA 4NU6A 4YO7A 1CTQA 1WEKA 1L5NA 4DSAA 1CR1A 3UJNA 4RNDB 5B7PA 2BKUA 2V9ZA 4TSFD 2CHFA 3ELDA 1ZL2A 2QE7A 2Z1NA 2OTCA 3M34A 4XWWA 1N25A 4CT0A 1JJ7A 3BHJA 4YRFA 4RW0A 4CMJA 3T5AA 2A1IA 4M0EA 2NSLA 3GLSA 1IC6A 3PGXA 5D7BA 3UMGA 2X5OA 1H8HD 1CYEA 3E58A 4PPNA 4IDPA 2KE5A 3DMFA 4HLUA 4F71A 1YR6A 1R4ZA 4HVTA 4DUGD 4KQGA 3VR6D 1JLLB 3N8DA 1BEEA 3H9JA 1KI6B 4LPSA 1AKTA 1VL1A 2EIXA 3EFOB 3HABA 1ECFA 2AF3C 3UCFA 4MPRA 3T4PA 2EBHX 4RLHA 3N2GB 4H18A 4TSFA 5CXSA 2OORA 2P0EA 2CNOA 2J4DA 3K9WA 3JQFC 4GUDA 2OHOA 4QNMA 3RYTC 1IAVA 3LUKA 1U1EA 4PZCA 4L8WB 5AM5A 4BRWA 4B09A 2VK2A 4RACA 1I13A 5MFPA 4D9EA 3PITA 4UVEA 4IO0A 4YLYA 5LMNB 3Q7IA 2E9SA 5CGQB 1U6KA 3HS3A 3I1FA 2HF8A 4IL5A 3H6KA 4R1TA 4KIGA 2YIDA 3ZI7A 2H0QA 2XR1A 2YWDA 1M2JA 3W90A 1TU0A 5JD5A 4PC1A 1RWBA 1UWLA 1H2FA 1VRVA 2B78A 2X4GA 3LO8A 5LM3A 1IBLB 4HTFB 2EFJA 3O4FA 5FOSA 3DBHA 3IE0A 1CETA 4D8UA 1UBTS 4WCFA 3F3MA 1M10A 3D4LA 4H4EA 3KKMA 3L0CA 3BRCA 1XA3A 3JZMA 3MAGA 4AJIA 1O54A 1C7JA 1ONSA 3PUZA 1YS1X 4LY6A 3U5TA 2WTEA 4B46A 4YRLA 4XH9B 4M7OA 2W00A 4GR5A 3TTTA 2WMNB 1FB5A 1RI5A 5F3DA 1T9CA 2ZFUA 1LI4A 4CKXA 3O8RA 1V25A 2HIMA 2XQGA 3T7TA 4EFNA 1JQKA 3RK1A 4A6DA 4PGAA 4GPIB 1IM8A 2IUUA 5ALKA 4DVGA 5K6AA 2EAUA 4I6GA 1Z5ZA 4MUYA 2IPAB 2VPQA 3DBHB 5CEEA 1SIUA 3OHPA 2VK4A 4WCFB 3CMCO 4UTRA 2ECOA 4XGIA 1DC3A 1MA3A 3Q3HA 3TAHA 4BB9A 1GFZA 3PU6A 2PZ8A 4KE9A 3G2KA 2AXQA 5EZSA 2V7PA 4CT4B 2ZUEA