3GN2A

Structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and inhibitor (ddd00066730)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
267
structure length
249
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase
publication title One scaffold, three binding modes: novel and selective pteridine reductase 1 inhibitors derived from fragment hits discovered by virtual screening.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 95
structure length 249
sequence length 267
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3gn2A00
1EK5A 4BGEA 4CLRA 2D5AA 1KY5A 2C82A 3KSUA 3VVBA 3SX2A 3WTCA 5KTKA 5TX7A 3E5RA 4DQUA 1ENZA 4WE3A 1YB4A 1U7TA 2Q49A 4YAIA 4LCJA 1EE9A 1P1HA 1UZLA 4N7RA 1RYDA 1GYQA 4OOEA 2B69A 1A72A 2ZATA 4R68A 4MKXA 3VH3A 4XKJA 4IDEA 1X1TA 4QUKA 3IJRA 4AJ4A 3EZLA 4O63O 1FJHA 3PVZA 2OBNA 1YBVA 4DRYA 3DZJA 2EJVA 2JJYA 3PGJA 4JP3A 2G82A 3NUGA 3E48A 1HSOA 3ZH2A 4WLOA 4MKRA 4CR7A 4CUZA 3RFTA 4CQLA 3Q9UA 1PGOA 4E4YA 3DHNA 1ZXBA 1PGQA 4CMKA 1F17A 2AEMA 5JAIA 2O2YA 4E5KA 3F47A 5JAMA 2Q45A 3G0OA 1C3VA 1C0KA 1FF9A 1PS8A 2DM6A 1P1IA 3GVIA 3ZU2A 4GX5A 4LK3A 3GOHA 3OIDA 4ZQFA 2RIRA 4HKTA 1M2WA 4KUEA 2HUNA 3I1JA 4CUKA 4J9UE 2VTDA 4PVCA 3ZV6A 4RLSA 1PL7A 4P38A 3WFIA 3D3EA 3GDFA 5DF1A 3NT5A 5JDCA 1RM3A 3S2EA 4D7AA 4OL9A 3DBVO 1X15A 3GN2A 3TZCA 4NDNE 4BO4A 4J7UA 1YDEA 4YQZA 3UGKA 1J49A 1R6DA 3DEYX 1QLJA 4A03A 2O4CA 3T4XA 1HEUA 2ZCVA 2IZ1A 2VWGA 1YL7A 4CLOA 4Y98A 1F0YA 5H83A 3FCOA 4Q3EA 5LCXA 5DT9A 2GNAA 3JD2A 5F5NA 2ZJ1A 4BV9A 4DLAA 2DPGA 3IUPA 2X0NA 4CL3A 1GFSA 1I10A 1XA0A 1U28A 5JW6A 5JY1A 1I3NA 4JLWA 2GN9A 1NM5A 2WEKA 4JXKA 4EW6A 1ISHA 1ISGA 2C2YA 1E7SA 5LDHA 5EL0A 2I3GA 4ZU3A 2C54A 5LDGA 1LDGA 3QHAA 4E2YA 3RIHA 5IXYA 5B4VA 4WOKA 2Q2WA 3ZWPA 3P7MA 5CEFA 2OHXA 1F12A 4BKOA 4YA6A 1UP4A 4NU6A 3L0DA 5I7SA 1R16A 3RAJA 2E37A 2DAPA 3I6QA 3PJEA 4NZ9A 4OHUA 4DQVA 4KMSA 3E8XA 3FN4A 3OEWA 4L4XA 3GLQA 2IODA 3LQFA 5B12A 5KCZA 5ILOA 1D7OA 2JCXA 1BXGA 3JYOA 3L6DA 3NAQA 4QSMA 4IIUA 4B79A 3VPHA 3JYNA 5CHEA 5AXBA 4E30A 5AXDA 1ZIDA 2J3KA 1GZ6A 1R0LA 3JD3A 3W8EA 1LRKA 2P2SA 2P4HX 4DUPA 3OJFA 1CERA 4E13A 1Z74A 2GZ2A 3EDMA 2Q1WA 3WYEA 4RF4A 1N5DA 1JAYA 1NFQA 2QYTA 3CUKA 1HE3A 3W4KA 3EAGA 3A28A 3FNFA 2FR8A 4M1QA 3HADA 5DBFA 4IS3A 4NBUA 1OC4A 3AWDA 1DOHA 2DBQA 2JCYA 3RD5A 3P5SA 4IZHA 4DIFA 4FCCA 1V8BA 1RM4A 1ARZA 4NBVA 3O8QB 3PHHA 4R3WA 3WLEA 4R69A 3AY7A 4JCOA 3D0OA 3V8BA 5L7YA 2E82A 4YAKA 3P19A 1DC3A 4XB2A 1MXHA 1TT5A 2DFVA 1E1MA 4GMFA 4ILKA 3MZ0A 3IAHA 3O03A 2DUWA 1UXHA 2FZEA 2IE0A 1IULA 1FDWA 1XSEA 3AK4A 3DZBA 1AGNA 3AU8A 4UUPA 3LT2A 3H5AA 3GZNB 5EMHA 5TGDA 1K5HA 3ICCA 3PFWO 3C7CB 3MJSA 5TJ9A 5FF9A 5CDTA 2D59A 3W6UA 3WIDA 4YJHB 4E6PA 4CR8A 2HQ1A 1TA4A 4PIVA 3BMOA 3G49A 4KOAA 3X2FA 4AJOA 1ZEJA 1Y5RA 3BTSA 3PPIA 1W0CA 3AM4A 1I33A 1WDMA 3PYLA 4PLYA 1UDAA 4EBFA 1ZSVA 5CG2A 4J90A 1K6JA 1U1IA 3CMMA 1E6EA 1PGPA 1U8XX 5AXAA 4B4VA 3SLKA 4CMHA 3N74A 1K6IA 1QV6A 3RASA 3U3XA 3N7UA 2EW8A 4GPD1 3R3JA 5I8ZA 2FY8A 3RI3A 4D0SA 2EKQA 4EJ6A 4NMHA 4EDFA 1EUZA 5COBA 2BI7A 2Y1FA 2NQTA 3FR8A 1CDOA 4OKNA 4RF5A 1E3EA 2DC1A 4E3ZA 4OO3A 1E92A 4BNVA 4DC0A 1PR3A 5DOZA 3K92A 2NTVA 1ZK4A 1E3IA 1ID1A 4Y6PA 1LDMA 5KOIA 2R6JA 3PP8A 4CM9D 2A92A 1B3BA 3ZW9A 5BR7A 5TT0A 3LT0A 2CVQA 4NFSA 3DAGA 3FPLA 1PJCA 2ZTLA 1OMOA 4AJHA 2NU7A 4E32A 4R5MA 3KEQA 4N54A 2VUTA 2QRJA 4K9DA 3ZI0A 2X23A 3VPXA 2JHFA 5BNIA 4RLHA 4UREA 1DPGA 2B4QA 4GMGA 2IYPA 1DAOA 4IMPA 1CQJA 4DYVA 4CM4B 4R16A 3JQ8B 4CQMD 1Q0LA 2B0JA 2DFDA 6LDHA 4PRKA 4TMFA 3FF4A 4R9RA 3GAFA 3K30A 2FMUA 1OI7A 2D5CA 3I52A 3FTPA 5TS3A 4B4UA 3P2YA 4EZBA 2VT3A 2CFCA 4L4RA 5I9MA 1LLDA 1LQTA 3H3JA 2PFGA 4M87A 2BGKA 3K5PA 5A9SB 4PLFA 4YAEA 3RKRA 2QRLA 4DQXA 4N18A 4IGFA 1I2BA 1MB4A 2E48A 3GGPA 1N7GA 4YBZA 1JW9B 2Y1EA 3Q3CA 1E3SA 2B4RO 1LDEA 4WLUA 4QTZA 3VZQA 3AUSA 3OEYA 3KLPX 5H81A 1DRWA 2EW2A 4LN1A 1NNUA 1XU9A 2BI8A 3V2UA 5HM8A 3GA0A 3ZNOA 5JYDA 1U7HA 2FR0A 3O8QA 4GGPA 3DBHB 3RKUA 4CMEA 3PXXA 5AVOA 1RM0A 1U4SA 3KV3O 3SC4A 3WMXA 3WXBA 2OUIA 5JMPA 3NJ4A 1O8CA 4XA8A 5JC8A 1CF2O 3OBBA 4RZHA 4CMEC 3JYPA 5JDIC 3LT1A 4HBGA 3U49A 4UVDA 2IEBA 2YJZA 4PG7A 1ISJA 1EDOA 4CLXA 3PDJA 1HZZA 1N2SA 2TMGA 3PIIA 3AI1A 1PJSA 3S2GA 3PLNA 4HXYA 2Y0EA 2HAEA 3GZNA 3AY3A 1H9BA 2NVUB 1BDMA 2PTGA 5JSFA 4BNMA 4YJHA 4IQGA 2B4TO 4PGFA 3JSAA 5A06A 2W98A 1JTVA 1WP4A 2YQ5A 3SJ7A 3ST7A 4BL5A 2Q99A 1IUKA 4F6CA 5KJCA 5C3MA 2NVBA 5L95A 1SOWA 3BTOA 3JQ7B 4DREA 4L8VA 5COQA 4X54A 1BXZA 4D43A 1NR7A 3AM5A 4GVLA 2AMFA 3INRA 3TPCA 3NTQA 3GNTA 1NFRA 4MVJF 2EJWA 5HTOA 4XRRA 4A0SA 3X2EA 1DB3A 3JCZA 1WXDA 2IDZA 2BGLA 1HTBA 1PSDA 3GRKA 4Q3CA 4ITUA 2NLOA 5A4DA 3G79A 1R37A 1Y9EA 4CMJA 2EXXA 3DWFA 1KC3A 2DTXA 4J7XA 4HUJA 1A4IA 2BHLA 3E03A 3FPCA 2VTEA 3MOGA 2ZYAA 2P4QA 1VSVA 2XF8A 1K2WA 3I5MA 4IDGA 1JKJA 1P9LA 4LISA 2AA3A 1N92A 2EERA 3QWBA 4ZQEA 4R5HA 3UAGA 2RH4A 4GSLA 1LA2A 3CKYA 4BNKA 1PWXA 1LSSA 1Y8RB 1VL0A 3E9QA 4XD2A 2P9CA 3EY4A 3D1LA 1ZW1A 3VDRA 2Y1DA 1S6YA 3HDQA 3INTA 5A04A 9LDTA 4DL9A 4CLHA 4XZ3A 3VZRA 3KXDA 4RPLA 4ZN6A 3IMFA 4TROA 4CM4A 2GD1O 1D4FA 3JQ8A 2PR2A 3H8VA 4P4LA 4FS3A 3UVEA 4EUHA 3UF0A 3SLGA 3EZYA 3BZUA 5F21A 4K26A 3ZGYA 2QX7A 4XQ9A 4HNGA 1OAAA 4Y67A 5BNFA 1P31A 2CF5A 4H7PA 2VWQA 4XRGA 2O3TA 4UEOA 5A9SA 1WW8A 1AE1A 3KTDA 1JVBA 1VJTA 1Q7BA 4PFJA 1ADBA 1Q7CA 1P1JA 2PZMA 1QYWA 2FP4A 2DT5A 3RROA 3H2SA 5L9AA 1HE2A 2V6FA 3T4EA 2D0IA 1E77A 4QFDA 3QA9A 2V6GA 1IZ9A 2P91A 2HJSA 4NK5A 2AG8A 5I7EA 4XB1A 3NT2A 4J16A 4OSPA 5FI5A 3GNQA 3MJ4A 5KVQA 3GY0A 4YT2A 2PLAA 3RUAA 3L6OO 1UZMA 2AQHA 3DBHA 4XGNA 3QY9A 2J5QA 3FNEA 1ZK0A 1SOVA 2OZPA 1ZNQO 4OYRA 1AUPA 3GHHA 4NI5A 1DC5A 1I32A 1LLCA 1ZMTA 4UULA 4WLNA 3UN1A 3D3WA 4OXKA 1HDXA 5AXCA 4Y9DA 3RUHA 3UCFA 1T2EA 1R0SA 1YKFA 1WAMA 3A1NA 1AHHA 4YYZA 2SCUA 5JS6A 4BQPA 2B36A 3HN7A 1V3UA 3VH1A 4E12A 3MJVA 4DMLA 1HDYA 4KTVE 5THKA 3I9JA 2Y1CA 5A03A 1W73A 3F9IA 2EF1A 1XLTA 3FSRA 5EJ2A 2UVDA 2PGLA 4RPJA 1HF3A 2X58A 4HFJA 1BWSA 4MVJM 1NVTA 3HZZA 1LBEA 1LTHR 1N9GB 3FTNA 1HETA 1J4AA 5FEUA 3DBRB 3JQ7A 4DIOA 4JQCA 4IDFA 1GCUA 3GGOA 4Y6SA 3U4IA 1U2GA 2W90A 1I5RA 5FFFA 3ZWNA 4R4JA 5IFLA 1H94A 1HDZA 2ZB8A 3JQ9C 4CV3A 4E0BA 2BRUA 1LSOA 3CTMA 3EW7A 5F1PA 5CG1A 2OBYA 4TVOA 3PIDA 3I9KA 4UAGA 1E5QA 3VH2A 4ALJA 2QZ9A 1WDKA 2C0CA 4GX2A 4ZGWA 1E7YA 1ZVMA 2B5WA 4PG8A 3F4BA 2JD2A 1D1SA 5L4NA 2OXIA 4FFNA 3DOOA 1PJQA 4CMIB 2Y0DA 4II3A 4DPLA 2E49A 3LSYA 4OGWA 4XQEA 4TVBA 1ZZEA 5IDWA 4MVJI 1YBAA 4BO5A 4OH1A 5IAAA 2H63A 1HLPA 1Y8RA 5JFOA 3RU9A 4CM8B 2VYND 3GF4A 4I8XA 3UICA 2HRBA 5HRUA 1BVUA 1Q1NA 1DFIA 3Q0EA 3ZHXA 3DZIA 1TB4A 4B7CA 4I9NA 3PGXA 3PJDA 2NU9A 3WGGA 2BFPA 1I2CA 4HX5A 4U6SA 1O0SA 4UEKA 3DAPA 5HBRA 4MIEA 2J3IA 3IS3A 4S1VA 4ZA2A 3WJ7A 3VZPA 1CQIA 3TFOA 4CQMB 1D1TA 1UXJA 4K1LA 4J6FA 3PDUA 2BF7A 1PGNA 2J3JA 2RCYA 3F1LA 3LF1A 3V1YA 4PLGA 3F1KA 3T7EA 5JCXA 2CVZA 4AJ1A 4J7CA 1JWAB 3H9JA 4LRTB 2AW5A 3G3EA 3OFSA 9LDBA 3WGIA 2H5LA 4AVYA 5IJZA 3ITDA 3W6ZA 1DDOA 2AEFA 4BOYA 5TIIA 4LVUA 3HB5X 4BS9A 2W2LD 3S8MA 2BFOA 5CDGA 2VRBA 5A05A 3R0IA 3VDQA 2Q2QA 3AI2A 4OSOA 3I3OA 3HDYA 1LC0A 4BNTA 3PHGA 3ZZNA 1Z6ZA 1J0XO 5BSGA 5JXWA 4KP7A 1T4DA 1TLTA 4U7WA 3JQCA 3MJEA 3F5SA 3LDHA 1ZK3A 1K3TA 1PJBA 2JAPA 2D2IA 5KJEA 1VKNA 2GYYA 3L6EA 1GV0A 1E1LA 3R1IA 2WM3A 2YV3A 1KVRA 5JNLA 2V7PA 1RM5A 1KIFA 4HFRA 1KVUA 4AICA 4MVJH 1DC4A 3H4VA 4XIYA 3GGGA 1VJ1A 1ZO8A 2NNLD 3RUDA 5A5FA 3WDSA 4GX0A 4I5FA 5T5QA 3K2EA 4FOOA 1I0ZA 1UH5A 1KETA 4YAGA 1RPNA 4IQ8A 3JYQA 1D8AA 3HWRA 4ROSA 2W8ZA 2RHCA 5DNAA 1UXGA 4CODB 4XYBA 1JKIA 1QYVA 4XQCA 1VM6A 3IC5A 1N9GA 2GERA 3EVNA 1EFLA 3DBRA 1TT5B 3C85A 1NPTO 2Y68A 3OIFA 2G1UA 4YXFA 1MC5A 3WQQA 3HFSA 2PWZA 4RQTA 1ORRA 4S3MA 4BO9A 3GHYA 5IZCA 1T24A 2D1YA 3GRPA 4IS2A 3U0BA 2PD6A 4L75A 4R1UA 2PGDA 3TOZA 4BMNA 2YV2A 1I3MA 1YQGA 4U8GA 3F46A 1LSUA 3PI7A 3RC2A 3BMOB 1BXKA 5G0UA 3PYMA 1SC6A 1BDBA 2O7SA 4CMIA 2X8LA 1C1XA 2CMDA 1DFGA 4GAEA 4ALLA 3KRTA 3B1JA 4PLHA 4CM5A 4YT4A 4BO0A 5KJFA 2ZCUA 1KVSA 3QWFA 4CM3A 1F06A 1E7MA 1GQ2A 5JDCC 4CM8A 5K0ZA 1X14A 2Q1TA 5TF4A 1I2ZA 1Y9AA 3LLVA 4BMVA 5HWSA 4F6LA 2Z1NA 4CM9A 5ADHA 4OMUA 1ADGA 1SAYA 1ML3A 1I3LA 1E7QA 3C7AA 1N1GA 2VOEA 5T6BA 3IP3A 3TWOA 2ZYGA 4LGVA 5AOVA 1Y1PA 1ENOA 3HSKA 2YZ7A 2AQ8A 1DFHA 2YDXA 3JQAD 1GR0A 3UFXA 1WMAA 1YH3A 3GUYA 3JYLA 1NR1A 3O38A 5FI3A 4RDHA 1V35A 1W6UA 4J4BA 1FXSA 3ZWBA 1IL0A 1B8PA 3IOYA 3ROQA 1ENYA 4BB6A 1PZHA 2DQ4A 4CQMA 4YPOA 2Q46A 1YQDA 3WFJA 2I99A 3E18A 4QX6A 1UR5A 4J4HA 2R00A 1E7WA 3INGA 1LXCA 3W8FA 3K96A 2ET6A 4MKZA 4KWIA 4AG3A 5TNXA 3VPFA 1X7HA 1A27A 2YYYA 4PRLA 5G0TA 2JFFA 1JLLA 1KYQA 2R00C 1E7RA 3PYXA 4GWKA 1GV1A 1P77A 2VWHA 5G4LA 1ULUA 3NX4A 2HU2A 4BHTA 1NAIA 4WLEA 4TKLA 4G5HA 2Q50A 3MJTA 2DVMA 1LI4A 1YL5A 4LMRA 3AUTA 1MV8A 2PD3A 4WK6A 3TSCA 3M1AA 3WGHA 4GGOA 4PZEA 4DBVO 4HADA 4NIMA 4GBJA 5CDSA 3HB4X 2VHXA 2OFPA 4ZQBA 4B4WA 1ZBQA 1YJQA 2PKRA 4R3NA 1BGVA 5H82A 3TOXA 3WNVA 1TXGA 3WYCA 3MCVA 3DZFA 3WNQA 2WDZA 2Q3EA 2IRWA 2DU8A 4Y6RA 1PL6A 2P9GA 4PLPA 2PY6A 1B15A 1ZXLA 2YHIB 3DOJA 1H6CA 2FR1A 3IP1A 3D7LA 4RVFA 3EK2A 2C5AA 2JHGA 4RCVA 1RYEA 4WNIA 1QYCA 3OJEA 1XYGA 5F1KA 1SCUA 1HT0A 1VRWA 2Y93A 2X9NA 2ZKLA 2JD1A 3M6IA 2ZYDA 3B1KA 4NHEA 2C2XA 3FNHA 3QV1A 1HXHA 1U3VA 3G1UA 3ZU5A 1KOLA 3LF2A 4B3IA 5K6AA 4NFYA 2I66A 4CV1A 3ASUA 1D3AA 1P0CA 2WD7B 1Z7EA 1N7HA 2WTBA 3QVOA 1TT7A 1YWGO 3OA2A 1IOLA 1GAEO 2ZB7A 3LC7O 3UUWA 2FPGA 4ID9A 3C1AA 3RUEA 7ADHA 4B3JA 1O5IA 2CDCA 4FIZA 4KUGA 5C7LO 5I8WA 1PS0A 5IXSA 2DBZA 3D5TA 2ZTUA 3WB9A 3I9LA 2TMDA 2UDPA 1AN9A 3M2PA 3GDGA 5ICMA 2NSDA 4IJWA 3KM0A 3D5QA 1GUFA 1O89A 5HS4A 1WPQA 2XXJA 3O26A 5KKAA 1YL6A 3F6YA 3KYDB 3A06A 4W4TA 2RAFA 3NEPX 3RUFA 4BVAA 1PS9A 3DTYA 3CEAA 3GEDA 1PTJA 1PZEA 4NBWA 3OECA 4HP8A 1ISFA 3IUSA 3WGZA 5I9LA 4IMRA 1HDRA 1G0NA 3JQGB 3DHEA 3RC9A 5A3VA 3L77A 1F14A 8LDHA 4LRSB 1GZ3A 1PJ3A 1TEHA 3CZRA 3RUCA 3OSUA 3V2HA 3PLRA 3HJAA 4FGSA 4WECA 1ZSNA 5I7FA 1FMCA 4BNHA 3HFGA 4YTEA 2AEJA 1GUYA 2CUKA 4Y8VA 1LC3A 1GPDG 3EYWA 3QVSA 1T2CA 3GVPA 2NVWA 4PZCA 4DTIA 3JQFA 1G0OA 4E5PA 5DDIP 3KHUA 4AJLA 1WZIA 1DHRA 4H3VA 2O4UX 3H2ZA 4ND4A 1A7KA 3DBLB 4UUMA 3JQFC 3QJ5A 4W7HA 4XQGA 4MVJD 3RBZA 2FWMX 4J4TA 2JL1A 4IXTA 3NJ8A 3H6KA 4R41A 5CEJA 4XJTA 1PQWA 3M1LA 4JIGA 5BNTA 4YT8A 4BNZA 3ETDA 3RJ5A 5T8KA 1LRLA 1QRRA 1ZUD1 4Z9YA 5EN4A 2PH5A 4HWKA 4E5NA 3QWAA 4AJ2A 5T8KC 4OXYA 4CM7A 2QZZA 4BNNA 4QECA 1I30A 5JLAA 4JJFA 5JAZA 4RVUA 4II2A 1R66A 1NAHA 1R15A 2CDAA 1MUUA 2D4AA 1QXSA 4K28A 3DONA 4RPGA 4M8SA 3DOCA 3HDJA 1XGKA 4JP2A 4WCFB 4XDYA 2WWRA 2FPIA 4HFNA 3ONFA 5G4KA 1YDWA 4RJTA 4LSMA 1CRWG 3F5QA 1P0FA 3FWZA 2OO5A 1LLQA 3TRIA 2YHIA 5ILGA 3NT4A 1NQOA 1BVRA 2FN7A 4ALNA 4M89A 4E5MA 1LRJA 4KDEA 4ESOA 1PZGA 1KVTA 4MP8A 2HDHA 1ISIA 4XIJA 4FQ8A 3HHPA 5MGBA 1JDJA 4WEQA 5TSDA 4MVJP 1B16A 5G0WA 2C7GA 3D3WB 2BKAA 5A9TA 4A5OA 4IZIA 2WD7A 3V1TC 2Z1MA 4XDZA 5IDXA 1AXGA 2GN6A 1FDSA 2FSSA 2Q1SA 3RUIA 3PHIA 2POQX 2WSBA 4N5LA 1ISMA 1VI2A 2FRDA 3MEQA 4J9VA 1LUAA 4MJLA 3PRJA 4J3FA 3PZBA 2NU8A 4GKBA 3ICPA 2BFAA 4JROA 4OM8A 4KTTE 3L07A 4Q9NA 2HO5A 3H9QA 4UEJA 1KY4A 3KYDA 3WGQA 3O4RA 4DGSA 2EWMA 2GRAA 2J6IA 1DRUA 3AUUA 2GO1A 1Y7TA 1B26A 4B4OA 3AY6A 3S2IA 3ZWXA 2QHXA 4FFPA 5BT9A 3D64A 1AXEA 3RC1A 2VCYA 1EVZA 1DJQA 2VYVD 5C5IA 3JQGA 2ZTVA 1NQTA 1PJTA 2BD0A 2GUGA 4NPCA 4D46A 1BTOA 4F45A 2X0IA 3H65A 3NDJA 4L0QA 5G0VA 5KVCA 3QW2A 4LMPA 3HE3A 2QIOA 4BKPA 2GZ1A 4CV2A 1RWBA 4KQXA 1Y6JA 2VYNA 3PJGA 1IHYA 1U8FO 2ZIZA 4L73A 3GC6A 4YRAA 4ND2A 4W99A 3OH8A 5JMWA 3BXXA 1Z82A 2IXBA 3AI3A 2J5RA 1JAXA 2V65A 2PH3A 3TZQA 2Z95A 1IB6A 3GR6A 3DBLA 4NR0A 5C7OO 5TC4A 2P9EA 4NJOA 2PZKA 3UXYA 4KDFA 4YQYA 2Y05A 3JQAB 1RJWA 4AJIA 4C4OA 3Q2IA 2C07A 3FNGA 2A9FA 3I4CA 4I1IA 1KC1A 4FFOA 1S7CA 5T57A 3U09A 1O94A 4ND3A 7MDHA 1VE9A 3QE3A 4FBGA 3OICA 1Q0HA 1B8VA 3CINA 4M86A 1WLYA 3DZHA 4INAA 1UJMA 4PLTA 3SBOA 1YBMA 1XG5A 4J49A 1NQAO 2GN8A 4CR6A 3GN1A 1A4UA 4LSWA 3VOSA 1H5QA 4CLDA 2PNFA 2FHSA 3AOEA 4FJ0A 4XYGA 4RPKA 4I9UA 4G65A 1ZJZA 4JN6B 1HRDA 3BTVA 2W2LA 1NVGA 1SO8A 2X5OA 1E5LA 2ZTMA 1C14A 4HY3A 1QLHA 5B4TA 4WCFA 3I9OA 2AQKA 4O6VA 1EBUA 3E5MA 1ZK1A 3QLJA 1XIVA 4Q3DA 1LSJA 3DZKA 2WMDA 3ZCXA 3HQ4O 4WCFC 5CEEA 4J91A 1LX6A 4WJZA 2HSDA 3KLMX 3BHMA 1IYZA 3D4OA 1X7DA 2NADA 3JQDA 4JX8A 2NQ8A 4TSKA 1UDBA 4CV0A 1U4OA 4XGKA 1M6WA 3A14A 3ABIA 2IXAA 2O3SA 1UZNA 3QRWA 3EC7A 2J8ZA 3OJLA 4EI2A 2GF2A 3EUWA 2O50A 3DHYA 5BQFA 5ICSA 2JAHA 2VRCD 2X0JA 1EEHA 2VNSA 2HMSA 3RWBA 3H3FA 4ALIA 1HSZA 5KWEA 1ENPA 3VAZA 4B3HA 4UUOA 4IJKA 3WX0A 1GU7A 3ENKA 4CLEA 5EIOA 1L7EA 5IG2A 1EVYA 4PZDA 5DBGA 4FR5A 2DBRA 4JNKA 2C20A 1Y81A 1EMDA 3BHJA 1QG6A 3ETGA 1E1NA 2PKQO 4WCDA 1CETA 2O23A 3VPGA 2Y67A 4EUEA 4MVJG 3WS7A 4IDDA 2RBEA 3CIFA 1E3JA 4BNXA 2CZCA 3E6AA 3HG7A 2HMVA 4ND1A 5TT1A 3ZNQA 4DXHA 1H93A 3KB6A 2NTNA 2FPPA 2XXBA 3V1UA 1R12A 3DB2A 3ZW8A 3OJOA 1BMDA 4W6ZA 5TLSA 4DVJA 1T1SA 4BMSA 2Y99A 3KZVA 1GQQA 5A9RA 5F5LA 1YVEI 1DEHA 2DKNA 2Q1UA 1O9BA 2GGSA 4ND5A 3CSDA 5TQVA 2NACA 1ONOA 4FDAA 3GDOA 1PWZA 3GPDG 4WASA 1GD1O 3WG9A 4TRRA 1A71A 1ZJYA 3WJAA 1KVQA 3GUCA 1B3RA 3VC7A 2PV7A 1LJ8A 1DSSG 1PQPA 1C1XB 3OQ6A 4E31A 3QIVA 2GR9A 2HMWA 3OHSX 5IDYA 3NGXA 4GLOA 3AJRA 1E0DA 3AW9A 3AFNA 4BNUA 2NM0A 2B35A 3EVTA 2X0RA 4Z0TA 4O59O 4XYLA 3CE6A 2Q4EA 4E2XA 1CEQA 3OIGA 1DAPA 4EUFA 3JQAA 1BRMA 1UP6A 3ETEA 3GVCA 4D3SA 1CYDA 3VVCA 1IPFA 3LLSA 4O0LA 1BSVA 1T2FA 4FGWA 1MG0A 4PLVA 4A2CA 4IIVA 4NH4A 2BGMA 4IDBA 1YOVB 2UUPA 4BKRA 4FB5A 2EGHA 3NGLA 4BO2A 1OFGA 2CNBA 1MGOA 2BELA 2VHYA 2ZQZA 4QO8A 1MLDA 5J23A 1OC2A 3NTRA 4GX1A 3PWZA 4RVSA 1BHSA 4FFLA 4NU5A 1XU7A 3B6ZA 5T64A 1W4ZA 2IEDA 4W9NA 4R9SA 4PG4A 1JN0A 4JJGA 1SB9A 1NVMB 2FOIA 3JQBA 4Z6KA 3GH3A 4BO8A 1NPYA 3HDHA 3F3SA 3ROMA 4DWVA 2UAGA 1FDUA 4L4SA 5IF3A 4TQGA 2I67A 2GZ3A 4DIBA 1J6UA 3E82A 1NPDA 3S55A 1U5AA 4A26A 4Z3KA 1MC4A 4QQRA 3IKVA 1EUDA 1LNQA 3FWNA 3DAFA 4J1QA 4O1MA 2VZ0A 2X9GA 1V3TA 5T67A 3ZWOA 5JYEA 1GYRA 3E9MA 3MWDB 5CDYA 1PGJA 1SEVA 1MFZA 4ZRMA 5IZ4A 4KWHA 1EVIA 1SEPA 1TVEA 1DRVA 3OP4A 5COAA 3TQHA 1CIVA 2JD0A 1Q7GA 4LCEA 3AFMA 3LZ6A 5L7TA 1SZJG 3UOGA 4AL4A 3QVWA 1HYHA 1SNYA 3WOHA 1E6UA 4NK4A 3VH4A 3Q11A 1PIWA 4R1SA 1M67A 4U0JA 3WMWA 4RGBA 2Y1OA 1GL3A 1FDVA 1YB1A 1JWBB 2DPHA 1HE5A 2Q2VA 3ADPA 3LC1O 4G2NA 1U9JA 2OORA 4RF2A 4RVHA 5GZ6A 1EDZA 2RHRA 4J2HA 3PWSA 1SMKA 1PL8A 3CMCO 3PQEA 1M6HA 2O3QA 2WJPA 3D4NA 1SB8A 5GY7A 2WE8A 1EQUA 1P1KA 3PFFA 1P74A 2UUOA 3GPIA 1MFPA 1X1EA 2A94A 2WYWA 3EMKA 3QWIA 2YHUA 1EVJA 2VT2A 3G17A 3TJRA 5FWNA 2PD4A 1PX0A 3CZMA 1T25A 4I9HA 4UVIA 3H7AA 2GCGA 2X1HA 4XEHA 3WQSB 2CSUA 3I23A 1X7GA 4OQYA 2ZJ0A 1QMGA 2YDYA 1H9AA 3AM3A 3RCBA 2OGUA 3GNSA 5CAEA 5JCJA 5HA5A 3KUXA 3NDIA 3B20A 3PZRA 4OJNA 4JJIA 1YXMA 3OA0A 5F3RA 2E4AA 3FRJA 4D41A 5IZCC 1HZJA 2WE7A 2AQIA 5CP8A 4D45A 1CJCA 4XR9A 2OL4A 5F1OA 3U5TA 3ZDFA 4R1NA 3DMTA 2YW9A 1DJNA 1GTMA 1I24A 3BYZA 4WUVA 4Z0HO 2VUSA 3MTJA 4AJKA 4PLWA 4B8WA 4YAJA 1QV7A 1EE2A 5A3JA 1R4MB 3DMTC 5G0SA 4AJNA 5L53A 5K9ZA 4QT0A 4EYEA 1T1RA 1A9ZA 1GY8A 1ADFA 3KO8A 6ADHA 1JA9A 4EEXA 1R4NB 1GZ4A 2J5KA 3ZWWA 4A73A 2QQ5A 3EGOA 3WGYA 3PK0A 4Q39A 5KIAA 1HLDA 1TI7A 1V0JA 1U3UA 3W4IA 3DFUA 3KYCB 2IZ0A 1R0KA 3WGTA 1DIAA 3B1FA 3DFZA 4MVJA 1YOVA 4GVXA 5B1YA 3SJUA 4B8ZA 4QEDA 3RJ9A 1UAGA 3IKTA 2PZJA 1IHXA 3IJPA 4MO2A 2JFHA 4PLCA 4FW8A 4RPHA 3GAZA 1A9YA 5KVVA 1B14A 4N5NA 1I36A 3ASVA 3OF2A 4RVGA 2W4QA 1P33A 1XQ1A 1X0XA 4BIIA 1DLIA 1P1RA 1Y8QA 2PK3A 5FYDA 1IZ0A 1XHLA 1GEEA 1LDBA 1X0VA 3TL3A 4EJ0A 1YE3A 2DUUA 3TF5A 3QWHA 1V9LA 2NUAA 5TJHA 4BGUA 1WVGA 4HNHA 4JK3A 2OP0A 1C1DB 2VHWA 4RO0A 3OMLA 3RC7A 1BW9B 4CPDA 5U1PA 3QSGA 1EQ2A 4I5DA 4L9RA 1HE4A 3CXRA 1RKXA 5KVSA 4GKVA 4ZJUA 3ONDA 4HFMA 2I65A 3ADOA 5DP2A 4R51A 1ONNA 3DQPA 4XJSA 4GI2A 3PTZA 1MA0A 1T2AA 5G4KB 5L3ZA 2D8AA 1WWKA 2Q4BA 5EINA 3V2GA 4P4GA 2YFHA 3VTFA 1Q2XA 2H6EA 2HJRA 1K6XA 4ZHSA 1NWCA 1QP8A 2HRZA 1SBYA 1C0IA 1T26A 3L9XA 2QG4A 2HK8A 4BGVA 3FI9A 2HKIA 1XELA 4OXNA 2Y1GA 4UVGA 4TZTA 4BNYA 3ROPA 4EEZA 4R01A 1F8FA 3AUAA 3OETA 3ZWCA 4B7XA 2UYYA 3G1TA 4GWGA 2IZZA 4BO6A 3U4DA 1ULSA 3JQEA 1NP3A 4IINA 4ALKA 4BNJA 5EESA 2VZ8A 4K6CA 3FD8A 1H2HA 2VHVA 3DC2A 1IE3A 1Y5MA 3ZN2A 2G5CA 4XYMA 3UW3A 4N5MA 5K6AC 3GEGA 2AHRA 3GVHA 4F46A 5C7IO 4RZIA 2GPTA 2YUTA 3A4VA 1VJ0A 1PJLA 3GVXA 4KQWA 1H2BA 2CD9A 4U5QA 3RQSA 2FSVA 5U4QA 3W8DA 2XAAA 4Z3DA 2I3AA 2X6TA 5ER9A 1N1EA 3LU1A 1ZK2A 1ADCA 3P2OA 3W4JA 5BSFA 5IN4A 2VYVA 1JKFA 1YJ8A 3EHEA 4FFRA 3VHRA 5IN5A 3I9NA 1BG6A 1WDLA 4NBTA 5L4LA 3RVDA 5JCJD 4W7IA 1UP7A 1GYPA 1H6DA 1R4MA 1XDWA 3BHIA 4TRJA 5I7VA 1E3WB 4L74A 3K9QO 1NWHA 3Q6IA 3E1KA 1K0UA 2F00A 3SXPA 3F4LA 3U4HA 4YWJA 3I9MA 2B83A 5JY6A 1R4NA 2X4GA 2Y0CA 2ZK7A 4ZVVA 1VPDA 1KEWA 1MXFA 1T4BA 2B37A 1X13A 4IGEA 5KJ6A 1A5ZA 3GZ4A 3OJ0A 4LVCA 4WPGA 3LVFO 2B5VA 4OAQA 2GLXA 2O7QA 3KYCA 1JU9A 1Z73A 5A02A 3K73O 2JFGA 1LDYA 1GUZA 4AJEA 3Q9NA 5GZ3A 3TL2A 5A1TA 1F8GA 1CWUA 4MP6A 4E21A 4DLLA 1JQBA 3FBTA 3HNPA 3ZHYA 1HDGO 1WZEA 2C29D 3U4CA 3PHJA 1I3KA 1QYDA 2CVOA 4R54A 4DYDA 4PLZA 5L51A 3QVXA 3ZWAA 5DP1A 4RL6A 3L9WA 3PJFA 3KOUA 3IL2A 5BSEA 4E33A 3C7DB 4Z9FA 1HKUA 1LDNA 4FC6A 4IBOA 4NJMB 5DBIA 1IPEA 2X7HA 4U0KA 4MOWA 3W1VA 1GADO 4U6QA 3C8MA 5B37A 5KJ1A 2QYSA 3ZNNA 1M66A 3GT0A 3GQVA 3STHA 5DOVA 3C24A 2VZ9A 4E2WA 4M55A 2VHZA 4CMGA 4J1NA 4C7KA 1C1DA 2O48X 4Z0PA 3MWEB 1BW9A 2UV8A 4BNIA 3RU7A 1KEUA 2EKLA 1P3DA 1J5PA 2JCVA 5IDQA 1XR3A 3ZWMA 5AYVA 1HWYA 5I9NA 1YO6A 4GL4A 2C59A 4YJFB 4YJDA 4RF3A 3WICA 1ONPA 2R2GA 1XEAA 2RH8A 3R3SA 3IDSA 2EP7A 4WEOA 1PZFA 2NV6A 4D79A 4TRNA 2HK7A 4GSKA 3VTZA 3S1LA 2CY0A 3ZU3A 1NX6A 4GLLA 1PU2A 2GDZA 2HK9A 4EITA 3L4BA 3PHLA 5JO9A 3ZU4A 3K2BA 4ZRNA 1DIHA 4J1TA 4FN4A 4YR9A 2PGJA 2VRCA 1LU9A 3QVTA 4LW8A 3WSVA 4IM7A 2HMUA 3JV7A 3WWYA 4C7JA 3K31A 4BO7A 2C7VA 1DO8A 3L4BC 1VSUA 2O2SA 3JTMA 5ENDA 3NRCA 2EHDA 4BUCA 3TDKA 4BB5A 1B8UA 1EFKA 1JVSA 3FBGA 3NDRA 1XWFA 2OP1A 2G0TA 4I5EA 1P45A 1NTOA 4R1TA 4BNGA 4DLBA 2X5JO 4ONEA 4IUYA 2OMEA 2ILTA 4XX0A 1W8DA 4BNWA 1U2DA 1VLLA 3T7CA 4BO1A 3M2TA 3NV9A 2I76A 3MOIA 2LDXA 3LYLA 3S2FA 2WYUA 2PZLA 3H5NA 2VN8A 4A10A 4JBHA 5U9CA 2X9VA 3PQFA 3DDNA 1YB5A 1KEVA 1PQUA 4URFA 1NHGA 4P22A 5THQA 4IJUA 4M54A 5L40A 5CFZA 2DTEA 2I5PO 4EJMA 1NYTA 4J1SA 1LLUA 2X86A 3KVOA 2NWQA 4ZQHA 4BNFA 2V6MA 1FDTA 4JGBA 5JDIA 3BMCB 2E6UX 1VC2A 4F3YA 2XOXA 1NFFA 1UDCA 4NNJA 4IXWA 2HLPA 2ZB4A 5JE8A 1E1KA 3WR5A 3WBBA 1DC6A 3WYBA 2PA3A 4MINA 2YV1A 2EG9A 1C0LA 2WYVA 4PVDA 1NQ5A 3K6JA 3JD0A 1E6WA 1E3WA 4RDIA 3Q1LA 3GEMA 3ULKA 4D42A 4FPXA 4OOFA 2J3HA 4BQRA 1DHTA 1UXIA 3DO5A 3GFBA 1K89A 2FZWA 1YRLA 3FR7A 3VZSA 3ZNPA 3ANLA 2H9IA 4UVEA 1P1FA 1T2DA 2ZB3A 5AQ1A 4RV9A 2AG5A 2GASA 1AHIA 4P8RA 3ZHBA 3BMNB 4I08A 3LC2O 2W2KB 4ZICA 4OIMA 5DCUA 2EGGA 2O3JA 3FHLA 4JBGA 2A35A 3K8ZA 3GG2A 2AE1A 3UKOA 2EP5A 4RQUA 4FOSA 4E5YA 1OBFO 2P5YA 5CDUA 2YQ4A 3MTGA 3AU9A 3DTTA 1HYEA 4J0FA 1QR6A 3RFVA 4YACA 3KEOA 3GFGA 3H9EO 3JQ6A 1KEPA 4YVFA 4DA9A 1O95A 3TN7A 4BV8A 3LT4A 3QQPA 3ENNA 4RORA 5LC1A 1ZSYA 3H9GA 3D4PA 4NJMA 1U3WA 1N8KA 1E3LA 2Y66A 2AE2A 3UHAA 4CJXA 3WQRA 4YT5A 3B70A 3ZWYA 2YFQA 1HL3A 4TZKA 1GEGA 1DXYA 3H9UA 1LEHA 4CMAA 4MP3A 3QP9A 1L7DA 2P68A 3ORFA 3C1TA 3DMYA 5DCWA 4AJJA 1M76A 3KETA 4IQ0A 4FC7A 1GDHA 4YJFA 2VOJA 3PEFA 2DLDA 4TWRA 5JAQA 3ANMA 1NBOA 3HUDA 1UXKA 4G81A 3AOEC 1OOEA 1DBVO 4WLVA 5CPFA 1VL8A 3TZHA 1Z45A 3DXFA 1B7GO 4MVJE 3NKLA 3ANNA 3BAZA 4IJVA 1H0KA 1PR9A 1Z75A 4AFNA 5L7WA 3SEFA 5ER6A 5B4UA 3COSA 2O3UA 4GH5A 1U3TA 4NFHA 3GMDA 2A4KA 4P4NA 3BIOA 1YS4A 5BSHA 3BMQB 1WMBA 2YY7A 1H6BA 1KS9A 1GCOA 3PQDA 1EUCA 1PEDA 1G6KA 4CM1A 4H15A 4O5OA 1G1AA 1YQXA 4Q3BA 4K6FA 1WNTA 4Q3NA 4TKMA 5DZSA 2XPCA 3KBOA 4XR4A 3GMSA 4YDRA 4DBZA 3HN2A 3ROKA 2IYOA 4HV4A 4E2ZA 3ITKA 4FJ2A 1DIBA 1O6ZA 3WWZA 1DIGA 4I5GA 4DMMA 4CUJA 5GMOA 1EBFA 3N58A 4ZD6A 4J0EA 1ZMOA 4NBRA 5EQDA 4BGIA 4PG6A 4UVHA 4FFMA 3BMCA 4YJGB 3ON5A 3LK7A 4DPKA 1UUFA 4WNCA 2EV9A 4NQZA 2BFMA 3UCXA 5ITVA 4CM6A 4CLRB 4OKIA 3DR3A 5GZ1A 2NU6A 3R6DA 2X22A 2ZQYA 3PWKA 4GQAA 4H16A 3ZV3A 4DPMA 2VNAA 4WOJA 2BH9A 1YGYA 2BMAA 2EKPA 5G2OA 3H5RA 5ENVA 3BTUA 1Q0QA 5TRTA 4OQZA 2DTDA 3I6IA 3WGOA 3WTBA 2NVUA 4WKGA 3WSWA 5KKCA 2VWPA 3ZV5A 5ITWA 5JC1A 3DZGA 3WBFA 1L1FA 4D3DA 3TFQA 5MDHA 3KYBA 3BMNA 4MPDA 3JD1A 2CF6A 2F1KA 4YCAA 2W2KA 1KERA 2AXQA 2O3RA 4XYEA 2BLLA 5A5EA 1XKQA 2DBVO 3CPSA 4RVDA 2LDBA 3JQ9A 5EERA 1QKIA 3U62A 4CL8A 3GG9A 3KSDO 4FSHA 4TRMA 3CH6A 3L4SO 3IIEA 4JBIA 2GSDA 4L76A 4NG5A 5JO0A 4CQLB 2EEZA 1YONA 3UCEA 4BNLA 2P5UA 1ZFNA 3UH1A 1NASA 3SVTA 4IY1A 3TNLA 1UAYA 1LQUA 3ZHZA 2H1SA 1H6AA 2QRKA 1NXQA 3C3XA 3OM9A 3OQ1A 1XQ6A 1MP0A 1QSGA 2CDBA 2X5KO 8ADHA 4ALMA 2I9PA 3ONEA 3OQBA 4IDCA 1ZKMA 4A7PA 1V3VA 3AOGA 4KUHA 4PCVA 3MJCA 4J2OA 4A27A 1HDOA 1GPJA 1VL6A 4EGFA 4YRBA 1MG5A 2PKQP 4J43A 5HS6A 3NYWA 3V5NA 1B2LA 2WD8A 2GN4A 2Z5LA 4QO7A 2HCTA 4FD3A 1EZ4A 1V6AA 4D44A 1A7AA 1PJ2A 1C0PA 4IPTA 3RBVA 4CLOB 5C37A 2NTJA 3E9NA 2QW8A 4WGGA 1HDCA 3DL2A 5DN9A 1Y8QB 3RBXA 2G17A 1SPXA 4PG5A 4W9NC 4D0RA 1ZH8A 4KZPA 1IY8A 2G76A 4B7UA 4YRDA 3JQBC 1MX3A 4MIOA 1NHWA 4FJ1A 3TZKA 4YB8A 1PJ4A 4XGIA 4M49A 3I4FA 5L45A 4MIYA 2EIHA 5EPOA 4Q3AA 4BKUA 5L4SA 1VKOA 5KNLA 1GQYA 3WLFA 2C5EA 4WLFA 3C1OA 3JD4A 4IDAA 4BKQA 3BMQA 5CPBA 4MDHA 3ZV4A 1QYXA 4Z9XA 3TZ6A 4QFCA 1P44A 3ZWVA 4XCVA 4QXMA 3VKVA 1EK6A 2OOSA 4AJPA 4CMBA 1DIRA 2HMTA 3NTOA 1FK8A 4D3FA 1M75A 1U5CA 1I8TA 1DLJA 4ZQGA 4CMCA 3A9WA 4UUNA 2I6TA 1KBZA 2VUUA 5DULA 5JBIA 3RFXA 3O9ZA 4PN3A 3Q2KA 1XCBA 3RSHA 3GK3A 3SC6A 2VQ3A 5DCYA 3IQDB 3VKUA 1BXGB 1OZAA 5ES3A 1Z7BA 3U9LA 1ZCJA 1I01A 3WIEA 2V6BA 3VPSA 1ZEMA 3I83A 1QORA 1HYGA 4XWYA 4YJGA 3BA1A 5EQFA 4DC1A 5JPIA 1B0AA 2D3TA 4W82A 3KSZO 4YEDA 4BO3A 2JKVA
chains in the Genus database with same CATH superfamily
1EK5A 1Q1GA 5TV2A 4CFSA 4CLRA 3Q7SA 1XTSA 3SX2A 1BCSB 2PBZA 5ALXA 5HE9A 2R6AA 5J4YA 1PT5A 2YYSA 3A1EA 3Q15C 4DQUA 2HQOA 2PBFA 2YMPA 4I2NA 2EC5A 5J2UA 4LQDA 2Q49A 4LDAA 4ZHQA 1EE9A 1LI5A 2PEZA 4LYDA 5DBHX 3V1KA 3U4MA 1NIJA 1RYDA 2UZIR 3VOBA 1UPBA 2ZATA 1Y8CA 2AJCA 5EI5A 1NBAA 4MKXA 5DV9A 3EHDA 1NMXA 3V8PA 1HKHA 4OAPA 4XKJA 3GAMA 2RONA 4IDEA 5CYOA 3VH3A 4A8TA 1X1TA 4DE5A 1I94B 4CEJB 4CWAA 2CD7A 1IY9A 2QUHA 2XUHA 1B1AA 4FFVA 1KDZA 4EFDA 1VBKA 2HHAA 2YZ2A 2BHNA 2A59A 3IQZA 1EP3B 3G0DA 4I8DA 1OKKD 3E48A 3HBJA 3KKPA 3AESB 2B6NA 4WLOA 3OO0A 1FLVA 2TYSB 1RZUA 2RAVA 3DYIA 3JX9A 4UHHA 2A4MA 3RVQA 3ZBQA 1XA3A 3VHQA 4CQLA 3I12A 2Y1KA 4R2MA 4X3CA 1GN8A 1ZXBA 1I7QB 5KX5A 2ZWAA 1CUDA 2DF8A 3OTQA 1F4PA 1FNNA 2HCRA 2XE6A 3HDTA 1FU8A 3IHKA 5JAMA 4EB6A 1OV4A 2Q45A 4NOKA 2O8FB 2I7XA 1VB5A 3MTAA 5LQNA 2RIRA 4HKTA 2ZBFA 3AF6A 3TTYA 4DM7A 5HQ3B 5JBNA 1Z2EA 3C87A 2A33A 4MPRA 1VJGA 3P8ZA 5A4KA 2J9FA 5BOSA 3D8TA 3RS9A 5D00A 3ZV6A 1A97A 3EWIA 3C3PA 5DNVA 5TE9A 1IWBB 1JFLA 3NT5A 3MJRA 3PNLA 3GJ3A 2E5WA 1R8QA 2XKBA 3CH4B 3CRRA 3S2EA 1UOQA 1X15A 1U1DA 4K40A 4ROTA 3IBFA 4K9OA 4J7UA 4NDNE 5EMJA 3UZUA 5FLXA 4UMDA 3D6HA 1Y6FA 2ODTX 3T4XA 4UCQA 2AD1A 1PJ8A 2IZ1A 2ZCVA 4CLOA 3P2MA 3DLBA 3OE7A 4Y1FA 2GJKA 2ID9A 2FV8A 4G4GA 4NZZA 4Q3EA 5F5NA 2GNAA 5LQRA 3P2IA 2ZJ1A 1ZJ4A 2DPGA 4ZGBA 4H7JA 5A62A 2AV6A 3MGAA 1FP4A 5DLYA 1U28A 5HYVA 4X1IA 3JR7A 4JLWA 4KNWA 3MJDA 4FGUA 2GNOA 4JKYA 1XNHA 1E2FA 1C7QA 1CUEA 1V9CA 1U28C 1MQ8B 3SDBA 2ZRIA 1TYZA 2J4FA 4MYCA 1R9NA 4DIEA 5IKXA 2A9PA 4LIPD 8OHMA 5TVKA 1PSZA 1U90A 1XJ0A 3DNMA 4RNDB 2WJAA 5LDGA 4F85A 1AXRA 3BD9A 1LDGA 3CZ5A 4BC0A 2V3VA 2OA0A 1E63A 3RIHA 3ES9A 5IXYA 4JI4B 1XFDA 1II8B 2Q2WA 4G1FA 1Y82A 2Q27A 5SICE 3AXTA 5CEFA 2G3YA 3RYIB 4BATA 3C8DA 4YP1A 1JEEA 1Y6QA 3WMEA 3VPDA 1JKMA 1KJQA 1Z6QA 1WABA 5CLFA 3L1JA 1JFTA 4R6WA 1F7VA 2ID8A 4ECAA 4Y1RA 1VE5A 3H2GA 3UV3A 1XTZA 5EFOA 3UA4A 5BR4A 2N0SA 3H6HA 4FONA 1R16A 3RAJA 2DAPA 4OHUA 4X64B 3ANTA 5E38A 3RVSA 3ABQB 3WSTA 2C2HA 2C7QA 3D31A 4DDVA 3PHCA 1E1CB 5KCZA 5FTKA 4QJIA 1P2GA 4W5NA 3BFVA 1GGJA 5JNVA 5AVYA 2OCIA 4B79A 1RSZA 3DR5A 5CHEA 2E6KA 4TS3A 1T4MA 1R0LA 2DHQA 3KQTA 5GJVC 1N3BA 3ILVA 3TLCA 1T9ZA 4P86A 3TJZA 2WILA 2P4HX 3DD5A 4N3AA 4DUPA 1OWNA 3OJFA 1YULA 1CERA 4K87A 2KS6A 5DSXA 1EP2B 3WAJA 2ZRNA 4OA5A 3GJTA 5BYJA 3EDMA 5BUZA 2IS4A 5DTMA 5E7IA 3ND5A 4NYIQ 1NLZA 4RF4A 4YAFA 3UAVA 3O94A 3WI7A 4B82A 3W4KA 1HE3A 3U31A 3ELDA 3IBYA 4Q0MA 3A28A 5IYZA 1XNRB 3S2ZA 3SVLA 4IS3A 4I36A 1HDEA 3P9YA 4WY8A 4ETMA 2I29A 3FPFA 1OC4A 1W4CA 2W0SA 4HDMB 3THRA 1N0HA 2SBTA 2AOTA 2RMKA 3ZHRA 3O1HB 3DHVA 3Q1KA 3B7PA 4QM7A 2NZWA 1Z9BA 3E9RA 2IWHA 3AHGA 4U39A 1KPHA 3T41A 3GUUA 3IA2A 4ILEA 4R3WA 1A9SA 3EVAA 2A1UA 4JCOA 1SWVA 4A8PA 1TK9A 1EP1B 4BLVA 1VSBA 2WTEA 5JU6A 1SVLA 3TW0A 1DC3A 5BWCA 4KR3A 1T0IA 1SN7A 2APJA 2ZTSA 2IYLD 2DFVA 3V6MA 3ZXSA 3EZFA 1MW9X 1T5HX 1JDNA 1RZVA 4WKOA 3ZLTA 3ZCPA 3AR9A 3QKRB 2DUWA 2IE0A 3AK4A 5ALYA 3TQIA 1XSEA 1YI1A 1Z0UA 3AU8A 2RFLA 1M1UA 4X9XA 3VU9A 3W5HA 3H5AA 4LF9B 1WL8A 4CN8A 3Q5GA 4IDQA 5E0KB 2WUWE 1F60A 3LOPA 4ATNA 5EMHA 5TGDA 3GLIA 3ICCA 4P32A 1TIPA 1AG9A 1N25A 3ZVRA 2EJTA 3FOWA 4GPBA 2D59A 1D2NA 3LKDA 4KR0A 3W34A 3W6UA 2IYRA 1TD9A 4V0SA 2HHJA 4U5XA 4OX9B 4CR8A 3AL2A 2AXEA 3G49A 1L6IA 5LZ2A 1ZEJA 1Q57A 3BA6A 3H18A 3IAFA 4PO8A 5JG7A 1MW8X 3AW8A 1I33A 1WDMA 3PGVA 1Q19A 4EGQA 3C3KA 4HPXB 1UDAA 1Z8FA 4DCGA 1EB9A 1Q74A 1ZSVA 4LDRA 3KWFA 3BRWA 1U1IA 3CMMA 1U8XX 1UBCA 1UT5A 3R5HA 4X44A 5AXAA 3UHOA 4WH0A 1QHGA 3SLKA 1N2EA 3NP9A 2P9JA 1I6LA 2RGCA 4V1CA 1WB9A 3O9VA 3R3JA 721PA 2D54A 1AHNA 1JG7A 1OW3B 3RI3A 2QAJA 2HXGA 2W6ID 5DN6A 3V8QA 4E6EA 2JNWA 4KFUA 4NMHA 1HT1E 2WPDD 4PIPA 1FRQA 1EUZA 4MQFB 4CKCA 1C4WA 5COBA 1AMNA 1CLEA 3O8RA 4TXHA 3DZCA 5DIZA 2RGAA 3V80A 3OFNA 1A9QA 2P3SA 4RF5A 1E3EA 2DC1A 2FGJA 1RU3A 1VXRA 2ANCA 3D6MA 3N70A 3O8OB 1G8HA 2ZE8A 2ZRAA 1RYNA 1E92A 4WKCA 3DKRA 4DC0A 3RYFA 5DNDA 3K92A 5DOZA 4G23A 1YI0A 4FUQA 5ERYA 1QIDA 3HXOA 1M1YA 4DEXA 3PP8A 2WF8A 5GADl 3KTAA 2SKEA 3FWYA 2A92A 2KB0A 3KDPA 2ZIXB 2GBCA 1M34A 2WWTA 1FLNA 1W52X 3L93A 3MTBA 4MAMA 1U2EA 4QUJA 5BP7A 5JR3A 2IS2A 3RC3A 3L49A 3IHWA 4QOHA 1PJCA 5K6RA 3NIFB 1S9HA 3PE6A 4Q9AA 3S29A 1PVDA 2A8YA 3U3KA 3MNFA 5A3RA 1YHNA 2HL6A 1L5FA 4TTJA 4B71A 3ANSA 4RL4A 1Z34A 1NA5A 1HTTA 3MAJA 3UPTA 1LZKA 1UDRA 2PGOA 2X23A 3VPXA 2W2NA 3IERA 4GMGA 4MUJA 4BXOB 1KI8A 2MSKA 3FJ1A 3U3JA 2OD9A 4UM5A 3X1WA 4A0FA 1C29B 2PX8A 3FMGA 1O6GA 1K66A 1W9HA 1JJVA 2VAMA 3Q3HA 3TL6A 5CFQA 5EJEA 3LVQE 2R62A 3SPXA 2QMUA 3ZKWA 5K3FB 1Q0LA 3VTKA 4DQLA 4PRKA 4TTVA 4IOMA 2JGMA 3GAFA 3HSYA 5AW4A 4DCVA 4KH0A 3HMQA 1OI7A 3KD2A 4G5YA 5JRZA 2CYCA 2YW2A 3FTPA 1JPJA 3M34A 2FKNA 1NY5A 3EGIA 3L0IB 3M4JA 2CFCA 5KYGA 1K9VF 4QUEA 1VRCA 3LY8A 3QF4A 1LLDA 2C7OA 4EX6A 1BHQ1 1YS9A 2OV6A 4LWZA 3LWDA 4QBGB 1R1DA 4TWBA 4LX8A 5P8WA 1RI4A 2PS0A 4PLFA 1YC5A 4C3VA 1KPIA 2QRLA 1QLWA 4EKIA 2UU9B 2X41A 4IGKA 4XRRA 2FP4B 3D81A 4CCYB 3IP5A 1WZUA 1T9GR 4UPEA 3PDWA 3GGPA 5LNK6 4ZWNA 3ZGZA 5HTKA 1XMJA 3EVBA 2C2OA 4L15A 3SR4A 4FLMA 2X4DA 4EMSA 1KMNA 1XMXA 3VDNB 1L5QA 3BL5A 4UM9D 4R05A 1IMOA 2DSNA 4CU2A 1LDEA 4C07A 4QTZA 2LKCA 3MRSA 3OEYA 2C8VA 4HRAA 2NAFA 1DRWA 5DNCA 1CJVC 3HA3A 5DSTA 2VPIA 5IAEA 5EEHA 3ZNOA 5BSVA 5JYDA 5GOTA 3R9KA 2VXBA 1SU6A 3QBJA 3RKUA 3R3HA 1RYYA 2VCHA 1C4OA 4CMEA 1RM0A 1SC3A 1ZGZA 3AF1A 4R7GA 2OUIA 1KR5A 2EBUA 1Q14A 4C0LA 1T1EA 1C9EA 4W7SA 3K1YA 5DSZA 4DIDA 2ZBRA 1CF2O 1DQRA 1N6PA 3GJXC 3OBBA 3PUZA 4CMEC 3LUAA 4YASA 5JDIC 2CXTA 2LPMA 1FW8A 2QTGA 4ME6A 4H7HA 1AU9A 4JP8A 2PUJA 2PQ2A 1ISJA 2QXUA 4URXR 3FGZA 4PS1A 2GCPA 3GFVA 4CLXA 3PDJA 1HZZA 3B9RA 1PEYA 4JLMA 5I9TA 3AKEA 4BASA 1UDWA 2WJHA 3CV3A 4DN6A 4DF3A 5B3AA 2EJUA 2NVUB 1AO3A 1NV9A 1YDFA 3AP2A 3STTA 5J2UF 1COWA 4FGLA 4BNMA 2BKVA 2WR8A 2ZSAA 2B4TO 1M10A 3F7TA 3NC0C 4L5BA 4UJ5A 2FRXA 2I8LA 3BSYA 2Z6VA 2OXRA 1XZMA 3UMCA 4WKBA 1GZSA 4X62B 1JTVA 2UUBB 1WHSA 2NP6A 3C6KA 3EAFA 3NOQA 2AOUA 3U7GA 1YT5A 4D4MA 4LWPA 2XKAA 2OOKA 3BTOA 4DREA 3OMXA 5COQA 3TCNA 4B48A 1Q0SA 3ZE2B 1P5FA 4FW9A 4QJ4A 2VH5R 3NAGA 3AM5A 4YGXB 1R0CA 2VP0A 4RZQA 3NTQA 3BB3A 4GM4A 3T9DA 4MVJF 4RENA 4AF6A 1XK7A 2EJWA 3V1NA 2CJFA 3EQZA 3FMPB 3QXGA 4TT3A 1FX0A 4WNYA 2ZUFA 3BH0A 2AXNA 1ULBA 4QRHA 1DTEA 3ACBA 1RRMA 5J4VA 4I1OA 4Q7LA 3SZ3A 5HZMA 1SBCA 4Q3CA 2NLOA 4L0CA 3G79A 1YZNA 4GECA 2DTXA 3K8OE 4J7XA 4BBJA 5KNBA 5CAEA 4GUAA 1NATA 3C6QA 4M2LA 4MUNA 4C0QC 3UFBA 1X1BA 1H4VB 5K3BA 2IEYA 2XF8A 4HLQB 4BCBA 4C0XA 2F3UA 4H1WA 3W9UA 1JEDA 1P9LA 3P26A 5HILA 2AA3A 3DHWC 4JI0B 4YI5A 4ZQEA 5TY0A 1ZGHA 3MLBA 1LA2A 4CEIB 5AVWA 5ALPA 1TMGE 4B6FA 1Y8RB 4CQJA 4ZKDA 3VR5A 5TEVA 3VR6A 1VGQA 4UEWA 2P9CA 2ZIEA 1NBEA 5F5XA 2G08A 4RD1A 1ZW1A 4N3NA 5DT2A 2H31A 3INTA 3VDRA 3NHMA 2P11A 4GXTA 4MMZB 2IHUA 2WAOA 1P2SA 3VZRA 2Y6VA 1NUSA 4P3KA 5L3VA 4BZWA 3KXDA 4MSUA 3IMFA 1ZM2A 4F2PA 3U4QB 4CM4A 1W7AA 2GD1O 1D4FA 3T38A 1VPLA 3FYDA 3H8VA 3NU1A 4EUHA 4X85A 2OZLB 3EF3A 3UF0A 3O6VA 3I6YA 3NJRA 4LZWA 4Q4CA 2YJTD 3U3RA 1M72A 3BZUA 2M98A 4K1XA 4RIHA 2OYRA 2QX7A 5K8LA 1A8PA 3U37A 4JVNA 5BNFA 2AR0A 1P31A 2CF5A 1XMSA 3NOXA 4IDPA 4LYFA 4X6UA 4XGQA 1QQ5A 2O3TA 4EG7A 4XRGA 4DNFA 5A9SA 3FY4A 3R9WA 1SUBA 4DDMA 2JH3A 4PIMA 4DEVA 5JTUA 1MKYA 1P1JA 2JLRA 2PUHA 2DT5A 2FF7A 5DGXA 3FTCA 1EX1A 1SD2A 3AVXA 2VHCA 1HE2A 3UUFA 5A5VA 3ZJTA 2G0NA 4HZUB 3TZEA 5C46F 1KJZA 3PQ8A 4HXFB 4QFDA 2GK3A 4BE9A 2V6GA 2V1XA 3BULA 2CGEA 3NWBA 3ND8A 2VJLA 2XF2A 3NHUA 3I04M 4G0ZA 3K20A 1EFHA 3NT2A 2OHFA 4L5JA 4OSPA 3GNQA 3NNDA 1J7JA 4IX1A 3GY0A 5AP9A 3T9BA 2LKDA 3TIXB 1KJIA 1IZZA 3H13A 3H8JA 2P6UA 3L6OO 3AYZB 1JR4A 1UZMA 5DCLA 2PFSA 3EWAA 4PHHA 4XFKA 4YV2A 3FNEA 2PSEA 4G6ZA 4PC6A 4RESA 1SVNA 1WMFA 4IYRA 4JYCA 4JUCA 1SOVA 3GHHA 2F1OA 1C41A 1LLCA 1G63A 2IPLA 3PGLA 4UULA 1F0NA 4Z1MA 1L5GB 3UN1A 5IH3A 4TTAA 1LVUA 3UCFA 3HUFA 4BLTA 4HXEB 1WAMA 4AMVA 2OPBA 3UG7A 3B9BA 4V3CA 1R6XA 1EFPA 3H2JA 1ATIA 3AV0B 1E2UA 4QGGA 1YVPA 3NKFA 2JGDA 4KPUA 1V3UA 1TKCA 3VH1A 1M74A 4KWTA 1WX1A 4CRWB 3QEBZ 1FS4A 3V4ZA 1HDYA 5E3HA 2GXUA 1DUVG 1E2DA 2EZTA 2R1ZA 3QPVA 4HEHA 1NP7A 3I9JA 4JUAA 3R5TA 1L5KA 2Y1CA 3UOAB 1MX1A 1F1JA 4XVHA 2OSBA 3F9IA 3UXHA 1F2UA 3ETNA 2WOJA 5EJ2A 2UVDA 4JBYA 4REOA 5JMOA 1RYMA 3FSGD 4RDXA 1QU2A 4HFJA 4MVJM 1WXWA 3HZZA 3D7MA 1HETA 4RKYA 2GH1A 5FEUA 3RSGA 1FU7A 2C2WA 3K3PA 2YKGA 2XMZA 1GTG1 3OZIA 4JQCA 1TW2A 1GCUA 1K2VN 1N2XA 1QS0A 2HREA 5K8IA 2HIAA 3U4IA 1CRQA 3O8DA 3QLVA 4M1SA 1I5RA 5TPWB 3SBEA 3TX2A 2WYOA 3UK2A 5C8DA 3Q12A 3MCWA 2ZB8A 2J08A 4YJ3B 4OQDA 2PXXA 3C3YA 1JG3A 1QH0A 5AJYA 5T3YA 4ARAA 4CV3A 4ZDJA 1BE0A 2JJ2A 2FSIA 4KQJA 3EW7A 2Q5EA 3QLVC 4YECA 2QQGA 2W43A 4IJ6A 1JH9A 3ED1A 4ALJA 3L0SA 3VYUB 1WDKA 2C0CA 2ODAA 3T61A 1G3UA 4KMMA 1ZA1A 4ZGWA 1ZVMA 1DAKA 4UOZA 5IPFA 1KO1A 4HN9A 1AV7A 4A6XA 1VHTA 4WBNB 1E0KA 1U0TA 4G9EA 4A0SA 1PI3A 2BCJQ 3DOOA 1AKUA 1PJQA 1QTIA 2CCGA 3PITA 3PX2A 2CJYA 1L9XA 2RI0A 3CLRC 2Y0DA 3BIXA 1PG5A 3EW9A 1MAHA 4X41A 3EXHA 4DPLA 4IICA 4OGWA 5IDWA 1ZOPA 4TVBA 5FUBA 4KR6A 3GOQA 2VH1A 4AMYA 2V03A 1DKQA 5IP5A 1YBAA 5CFLA 4G0WA 3OEHD 4RPCA 3UOWA 1TLFA 1QZZA 4NC9A 2J0QA 4OBXA 3AJEA 2H63A 4OYLA 4X1YA 3LY5A 2AOWA 2ZDHA 1N75A 3NHSA 3W5SA 1ZD4A 3I3SR 3EMBA 1JLSA 1R0XA 3GF4A 4I8XA 4QNNA 1FA9A 1XDGA 3AHEA 2XMRA 4HYEA 1Q3TA 3OLXA 2C8KA 2IZ6A 2G88A 3DZIA 4OPMA 1VHQA 2QN2A 3PJDA 5EJGA 2NGRA 3JALB 1X1QA 2C7BA 1U4NA 4PU0A 2NU9A 3EEYA 4O0MA 2J48A 1T8SA 3VNSA 4XVUA 1SR8A 2Z1DA 5KYXA 4QQ8A 5EZYB 3J81A 3DAPA 5T4FA 4CDMA 1FCJA 4UBNA 3IS3A 1ECCA 2YWDA 1RWVA 1MRSA 2CNNA 1OFVA 3FFBA 5F4ZA 5FNVF 2A0YA 3VZPA 2IHNA 3OZFA 3RYHB 4HGNA 1P39A 5ALDA 1PZNA 3BWEA 2PZBA 3PDUA 3G85A 4COOA 3LF1A 3V1YA 3PHBE 1TYDE 3QK7A 4D9EA 1I2AA 5JCXA 5M04A 2ZEJA 2CVZA 4V39A 3WLSA 4AJ1A 1UEXC 3L06A 1JWAB 4LRTB 3V7WA 4DMKA 4KKVA 3P52A 3A4LA 3TAXA 3I28A 3ITDA 3SHVA 1NGSA 4BOYA 4HH3C 3RSZA 2JAOA 1SOMA 4GDMA 4LVUA 4RZXA 2W2LD 3ROFA 2GFHA 3I8SA 5CDGA 4UUBA 2R97A 2G1PA 2XTAA 3QH4A 1L0BA 5CH8A 2GN1A 2R6R1 3I3OA 1XHFA 1LC0A 4BNTA 4EMTA 1A50B 2QAGA 3N0TA 1SD5A 2XBLA 3T06B 4UM9B 5GIPE 4PQGA 3JQCA 5CK5A 1DZIA 4XLLA 3F5SA 4GI5A 4O33A 3DH0A 5K3EA 1N9ZA 1FQJA 1K3TA 1W0KA 2D2IA 3B1XA 5KJEA 3F6BX 3WA6A 4EP1A 2GYYA 4DR1B 1WG8A 4RC9A 4G0XA 1OB5A 5C5EA 1FTSA 3N6XA 2WM3A 3ANYB 4WOPA 3N2KA 5JNLA 4IJ5A 1HE8B 4JQYA 4HFRA 4BECA 4EOGA 4YRMA 5BV8A 4KR7A 2X6RA 3JQQA 1QZUA 2L0XA 5EVCA 2A2ZA 1JJ7A 4Q7EA 2PAFA 3PKZA 1EWTA 2NNLD 3RUDA 4BZZA 3THWB 3TD2A 4RQBA 3WDSA 3DEZA 5EP1A 4KXLA 5T5QA 4BRUA 2QRVA 4AX4A 5HJ7A 1KETA 4YAGA 2QN8A 5C18A 2QX8A 3HWRA 1OPXA 3K70D 2RHCA 3QHQA 1COZA 1HA3A 2VVTA 5JWRA 1HYBA 1IN4A 2BI4A 3I0ZA 3WBKA 1L2TA 3IVXA 3IT1A 1FNCA 2HPHA 3VSAA 4GR4A 2QN3A 2F3RA 3DBRA 2VK2A 3KQPA 4XUEA 2SKDA 1NPTO 2Y68A 4WADA 4DABA 1FPMA 5B1HA 4PYLA 1CUFA 1MAWA 1DOZA 1O6BA 2HSGA 3ABOB 3HFSA 4HR7A 3UY4A 2C5SA 1J2TA 1W4BA 2AFVA 3MILA 3QFSA 4R2JA 4S3MA 3WLRA 3GHYA 4C29A 1T24A 2QV0A 4AP5A 2GZRA 5IKEA 3GRPA 4IS2A 1RZRD 4NZMA 2PD6A 3HPRA 5DYGA 3FUUA 2PGDA 1OLUA 3OHPA 1AS0A 5IFKA 1PAUA 2YXPX 2E1RA 1LVGA 5AM3A 4Z2YA 1R6AA 3PI7A 1DT5A 3RC2A 3BMOB 4DV2B 5A7GA 2ZYIA 1GKKA 1PDWA 4ZPXA 2G6TA 2XUZA 2QVGA 4PZUA 2ZETA 3W06A 4CMIA 4CQMB 3TEMA 4QD3A 4WVFA 1ZJJA 3P0RA 3VPAA 2GPSA 4F6RA 4HDRA 1JJFA 1NZDA 3BD7A 2AFHE 4N0DA 1ODLA 1ST3A 4P0QB 1N8NA 4NEGA 1KZHA 5JYBA 1KVSA 4CM3A 2A9RA 4AAYA 5DBEX 2H1IA 1EEXB 2KSQA 2J41A 2I2BA 4CM8A 5C9ZA 3PXBA 2Q1TA 3A6KA 3P4YA 4UPDA 1I2ZA 2LCIA 4BMVA 3LYAA 4F6LA 4Z4QA 4OFWA 2GEUA 1MEEA 1ML3A 1I3LA 2YVAA 3CCFA 3MBIA 2VOEA 3AX6A 2I2XB 3T15A 3TWOA 4BRSA 3IELA 4RE5A 2Q8NA 3FMIA 3IRVA 5AOVA 1Y1PA 4FHEA 2AQ8A 3QTLA 4HLCA 1Z2PX 4UNQA 1U7UA 5A4JA 1N78A 1VSQA 1X1DA 3E3LA 3LVBA 1YH3A 2Z6AA 1TDJA 2HBRA 5DW0A 1V35A 2CL6X 3LUCA 1FXSA 1LPAB 2GPYA 1BO6A 4BX9A 2EWWA 2EATA 3IBSA 3ROQA 4BB6A 1PZHA 4UZFA 5LN1A 2F59A 2R5WA 3WFJA 4PC1A 3RAGA 1P29A 1QVWA 3ACDA 3N76A 4Y2QA 3JWJA 3AT1A 3HCWA 1FIUA 3IOBA 4F4CA 1LXCA 2XMSA 3D59A 3QHPA 1A98A 5TNXA 3VPFA 3B1YA 2YYYA 1A27A 5J2TB 2JFFA 3PYXA 4GWKA 5AM1A 2H2FA 2C9ZA 2IX3A 2B92A 3BFPA 3OCYA 4CIWA 1MH1A 2NX2A 2P6MA 4R1QA 1HT2E 3UGQA 1Y1SA 3VSBA 5D2CA 4ZYWA 4CNQA 4TKLA 1CR1A 4G5HA 1O97C 2EHJA 4LXXA 4RGQA 4DG5A 3O7MA 3NBKA 1I3CA 3AUTA 3AEXA 2XMPA 2XYVA 4L4UA 1PUIA 4FMDF 4NIMA 1SBIA 1Z6TA 4Q24A 5DHAA 2OFPA 1HOXA 4ZYXA 2PKRA 1K86A 1BGVA 4GPTA 5AI0A 2PWAA 2FCAA 3VKGA 5CW2A 1NXXA 3H0CA 4OQXA 3TOXA 3HVUA 4G1MB 4IMJB 5BN5B 3WYCA 1R5OA 3MCVA 1UBRS 4PYQA 2IRWA 4DBLE 3BXOA 3TO5A 4IGAA 3C8UA 4ES6A 4AULA 1MC1A 2PY6A 1TCBA 2VJBA 1B15A 1OFIA 2YHIB 3E9EA 4MV0A 4DMGA 2FR1A 1FNDA 3IP1A 3E61A 2FJ0A 3RVKA 3NGMA 3PCRB 3OJEA 3QTTA 4DCCA 4UD2A 5F1KA 1VRWA 1W88A 3G5UA 4ZCQA 3KUUA 3BGOS 1QHEA 3E58A 2OQVA 3RUPA 3SG0A 3EH2A 1UINA 3L3BA 3P71T 2C4TA 4ZCLA 3PJRA 4KKXB 4C5BA 2O5VA 3BL6A 5ICEA 3CCCA 4OQEA 1QDLB 4B40A 3PNPA 4CV1A 4B6QA 5FUXA 1D3AA 2ZRMA 1N2CB 1Q20A 1Z7EA 1GNSA 1TPYA 4A6EA 4IV0A 3WDMA 3EG9A 1XTTA 3T7RA 2E2WA 3OA2A 1IOLA 5DW3A 1N5IA 1PQ4A 2ZB7A 1KZ4A 2ARKA 5KDOA 5FV7A 1ZMXA 5F1YA 2FPGA 1Z17A 3WOVA 7ADHA 2ZAOA 2CDCA 3L84A 5ILQA 4A2PA 3BFJA 1QIMA 2ZTUA 2PGNA 3BCSA 4QRDA 2IXGA 3WP0A 1AN9A 5ICMA 1ZAYA 2NSDA 4RFSB 3KM0A 1XZBA 2C5GA 1G8PA 2XXJA 3PF8A 1KHHA 1A9TA 4H3KB 1XVLA 3TQQA 4E15A 3TW8A 1E2EA 2PTHA 4O3FA 5IXJA 2ZRDA 4RKWA 1PEAA 5JEDA 2BGGA 3DTYA 3K16A 4R1OA 3M89A 4NBWA 5NLLA 2V3CC 2B3DA 4URWR 4G0VA 4KE8A 4MVWA 3CR8A 1YK1A 1Q2UA 2R11A 1L5OA 4IMRA 3UAYA 4EA7A 2W42A 3SF8B 4XWAA 1T3GA 4WN9A 1UK9A 3O0TA 1GTJ1 1GZ3A 1PJ3A 2ZJAA 1TEHA 4JT8A 3W7AA 2DEUA 5LMZA 2R5NA 3HJAA 4RIIA 4X95A 4JBNA 1U9CA 3FLEA 2KQUA 5CTAA 3ADKA 4DLYA 1SCBA 4FFBB 2JJQA 3SS7X 2WOOA 4ZAWA 4EVIA 2PSHA 5AW5A 3GVPA 2NVWA 5EGNA 4DTIA 2NQ2C 2Q41A 4RJ2A 4E5PA 3U5ZB 1SCAA 3OUTA 2CL7X 5CH3A 3UENA 4MS3B 1E3MA 3AR2A 4YRNA 4UEQA 2O0JA 2J67A 1A7KA 1U8UA 3KLOA 4W7HA 1AKMA 3QJ5A 3V4RA 1DKMA 1GRNA 4MVJD 4X84A 2BFCB 5BYAA 4J4TA 2HADA 2GRUA 2P0EA 1JJBA 3OPVA 3W2FA 3ZS8A 5BWBA 4JITA 2FDCA 7ABPA 3LW7A 2E89A 4JX9A 3LDUA 4DV1B 5LJLA 5ARCA 3ZWDA 4FT2A 1NMQA 3ORHA 5BNTA 3N0VA 3RSQA 1QRDA 5FLEX 1QQBA 3RJ5A 4NESA 1LRLA 1JDBB 1ZUD1 5C0OE 2I9KA 2EBWA 3I01A 4Z4IA 1P6XA 3AHIA 3QWAA 1MTZA 4N6NA 4RZUA 4AJ2A 2QTVB 4Q1AA 2QZZA 4TLLB 4ARSA 2CL5A 4JDPA 1IPHA 1QVVA 4TM7A 3RW9A 1Z5ZA 4O08A 4CBVA 3PTAA 1R15A 1RT9A 2ZW9A 4D4LA 3TIIA 5TR9A 3HDJA 4BFVA 2JI6A 3GQBB 3WWCA 4HFNA 4AF7A 3ONFA 4BJ5A 3BCUA 3U7IA 2QZ4A 3JZIA 3IA7A 1C7FA 1FFDA 1RCUA 1DPFA 1UJ5A 1IN8A 2PEYA 3P1JA 3Q8MA 4ACAA 4HXGA 5KSOA 2WLTA 1Y1LA 2INGX 2FN7A 4RV5A 3OT1B 4E5MA 1XZNA 1AZLA 1TUBB 1KVTA 3U61B 1AGYA 1Q11A 1JRLA 2HDHA 2QVYX 4IOJA 4JJZA 4MAFA 5IBQA 3THOA 3FPAA 2Q2NA 1SQGA 3SVZA 2ZBVA 3CLUD 3HA2A 3OTGA 1RBYA 1WSDA 1IUPA 3RWOA 4BY9E 1E18A 2GBFA 2W2QA 2YXEA 4DYHA 5JVDA 4EABA 4HMOA 5H9WA 2BEUA 5JRDS 1B16A 4Q4AB 3F8TA 2CW5A 3K71B 2AKEA 3VGPA 5IBPA 5A9TA 3SM9A 3DWIA 2NN3C 3H2BA 4IZIA 1YQWA 5AHKA 2P0YA 3BF8A 3GWGA 5E1BA 5C5DA 5IDXA 1BFUA 2Q1SA 4NCHA 4CKBB 1TJYA 3K70B 3DCNA 3VNQA 3N2EA 3PHIA 3ZXXA 3W7BA 2CLHB 3EGDB 2FRDA 1Z2AA 3MEQA 3GLHA 1YQTA 1U0OC 3QOXA 2R8ZA 3DE6X 4MJLA 2P5TB 4MGYR 3COZA 2F3PA 2FRDC 1RVDA 2HXSA 4Q82A 1WB6A 4P54A 3P0JA 1E1DA 1X87A 2FQ1A 1T6NA 4GYWA 2FETA 4C4ZA 5HRAA 4X7RA 2A86A 3L07A 3GO4A 1A8IA 3N7AA 4Q9NA 3TLEA 3T5PA 2QSZA 2ZQ5A 4YMGA 3VU3A 1OX6A 1SCQA 1RJGA 1J70A 3AZOA 1XZDA 3NIWA 4FSXA 4X8MA 4EZEA 5C8YB 1SUAA 3T7SA 4BMYA 2EWMA 2O19A 1XP8A 3R7BA 2XW6A 2EFEB 3R5SA 4C14A 1CZRA 2AGVA 2GO1A 3CW9A 2FPPB 2P77A 2XGGA 3NKVA 2PXCA 2QK4A 4GZ5A 4E5VA 2XXAA 5E9WA 3S2IA 3ZWXA 1TK3A 1R8YA 4FFPA 2XD4A 5HUQA 2FPUA 1IWOA 5FOXA 1V47A 1GKLA 4N01A 1EVZA 2FEXA 4QUHA 2NUTB 3QOYA 3JQGA 2ZTVA 4QBHA 3SJCA 1PNTA 3WB0A 4EA6A 1YU6A 4A1FA 2GUGA 1Z16A 5F7ZA 3FF1A 5AKLA 1L7MA 4F5WA 3NDJA 1J8QA 3RJZA 4OHRA 4CKEB 2VJMA 1NI4A 3F78A 3HE3A 3TZLA 3KHTA 1I3OA 3KQKA 4WZBB 2W2XA 4KO8A 3NBQA 1DEXA 3SX0A 1RWBA 2IYFA 2QSYA 3GPBA 4F8YA 3LWBA 5EHNA 1TYBE 1U0HC 2A1TR 1N5JA 4EI9A 1ZIPA 5PGMA 2ZIZA 4Q3LA 3WRVA 5JXIA 3QA3E 2DMRA 4MJ3A 5JMWA 1EDDA 5FPKA 1BDIA 2IXBA 4UHKA 4OYYA 1WDTA 1EK1A 1CP3A 2FWIA 4BDTA 1JAXA 4L16A 2PH3A 3TZQA 1L4BA 1E9VA 2Z95A 1PW5A 4TLAA 3GR6A 5FA8A 3DBLA 2M32A 3IUQA 4HJRA 5TC4A 2P9EA 2QE7A 3IHLA 3HXLA 3IO5A 4UE3S 2ON6A 5CVJA 2PZKA 1PT7A 3UANA 3B3GA 4G01B 4BVHA 1JLMA 2R7MA 2W6PA 3A8TA 3L7YA 4NYJR 3UXYA 2D2XA 2OHVA 5HDQA 4AJIA 4LNUB 2WBLC 1JR3A 3FNGA 1EIZA 3IVAA 4B6RA 4Z8YA 2NW6A 1KH3A 4G24A 4I1IA 5T57A 3G2MA 3UWKA 2QY6A 5CXQA 7MDHA 1VE9A 2BEVA 2RK6A 3QE3A 3OICA 3ZIUA 4H77A 3UWOA 1B8VA 3CINA 5D87A 1GG8A 5JARA 2J0UB 1CUWA 4DNPA 1ZM7A 1WLYA 2XTJA 5EHXA 2AX3A 1AB6A 2X8JA 3DZHA 4PLTA 2OQRA 4PZAA 3SBOA 5ADWA 4J49A 2GN8A 2IPOA 2ECKA 4CR6A 1XQYA 2ZR8A 4JB2A 1A4UA 4Q1DA 1EGQA 3WHLA 2YWJA 2VKQA 1VFNA 3HWWA 3PUXA 4M9UA 5ENZA 4F04A 3QEMA 5E6SB 4Z7JA 1NVGA 2X5OA 2H92A 1E5LA 3OIVA 5CH5A 1Z0SA 2VA8A 2BGWA 2IQIA 5FL7D 1NN3A 2D06A 4G5RA 4HTAA 4UFNA 5FBKA 2AQKA 4P93A 1EBUA 1K7YA 4UDYX 3QLJA 2Y3IA 3D7NA 3RE1A 1LSJA 5JZOA 4PR0A 3NTXA 121PA 3FPJA 2NP7A 5CDFE 1S3IA 1T3ZA 1WF6A 1Z18A 4GLFA 4J91A 2HSDA 5EA2A 2I62A 5ADVA 2FHPA 1F0PA 4W5WA 3AEUA 3ZJVA 1IBSA 3C98A 1Y8ZA 3DF7A 2NYUA 3UQZA 4JX8A 4BPRA 3P4UA 1K7XB 4RH1A 1U4OA 3CLKA 4XGKA 1H2AS 1M6WA 1RWQA 3A14A 3IUNA 3FLAA 5B7PA 1QQ7A 2A6PA 3IJEB 5FTLA 5JTTA 2IUYA 2REQA 2QORA 1R18A 2I87A 3ROGA 4EI2A 4YV1A 2O50A 3EN0A 2JAHA 4KXMA 3CNEA 1EEHA 3WK5A 4HT3B 1PLKA 4H7IA 5AIAA 4ALIA 3G0HA 1XJ5A 1M7BA 2PS1A 1RHQA 4Y1EA 4E1BA 1PCXA 1G60A 4H6VA 1DQSA 3B2QA 1PFVA 5F9FA 3REOA 3L8DA 2DB3A 1JAIA 4FR5A 1EFVB 4H4DA 4F5YA 1USWA 3ETGA 3ZE9A 4YCLA 3PC8C 4L1KA 5JQGF 4C2UA 3LQYA 3CRQA 1Z15A 2O23A 4R1MA 4QODA 1BMFD 3RYCB 4ZC1A 2C92A 4QFBA 3R20A 4M1EA 1T0JB 1NLFA 2VK8A 4WMLA 2QI9F 1PWHA 1E3JA 2RGEA 3AR5A 2YV5A 2CZCA 2G5GX 2C5HA 3HG7A 4FE7A 4TMTA 2GXQA 1ZM9A 3ZNQA 3JZAA 3CF4A 221PA 3KG2A 2ZXEA 3HYTA 3KB6A 2NTNA 4NBSA 2H7CA 4UTVA 3ONWA 3AF4A 3O90A 4D4HA 1BMDA 2ATXA 1W85B 3EG5A 4J8PA 2PGXA 1SXJA 3CF6R 1FLAA 1N6LA 3LCCA 4JP1A 4B81A 1P2UA 5EJIA 4MS4B 3ET4A 2BBSA 4GMDA 1LPBB 1GQQA 2EL7A 4QGHA 1JMVA 5CAEB 4AQ7A 1Q1EA 3LM8A 5GOZA 4GI1A 2Q1UA 1SXJC 1P9NA 4TXNA 2HSZA 4I50F 1N2GA 1VPTA 3MS4A 4HMQA 1EPUA 3CSDA 3L7AA 1DDIA 4NBKA 4V0QA 4NXNB 4PONA 2I4OA 5CA1A 3FVRA 2IX9A 1IN7A 2FW0A 2JIBA 2FX3A 3PSHA 1REQB 3MYYA 3B12A 1H1LB 2WIDA 1H8EA 1D2HA 2X1VA 1B3RA 5CVUA 5HM6A 3DE1X 4LA4A 4DZRA 3V8NA 1VB3A 4HL6A 1PQPA 1DSSG 1ORWA 1C1XB 2QPOA 2LCQA 1F2VA 4GXRA 3TQTA 2GR9A 4LXYA 1T5LA 2KJQA 4RS3A 2I2DA 4PQYA 4F2GA 2RC6A 4GLOA 1OLSA 2X4LA 3FHTA 1R9GA 3AW9A 3KSRA 1LPOA 3AFNA 4M0LA 5CM8B 1EVEA 5LM3A 5BVHB 3EVTA 2X0RA 1Z29A 4B2PA 2ZYWX 4XYLA 1NBMA 2IFTA 4E2XA 2ICAA 1J21A 2EKZA 1CEQA 3OIGA 4EUFA 3JQAA 3GVCA 2B1GA 1IPFA 2EFJA 1BSVA 3D8BA 3OZUA 3PUJA 2B8TA 4LTMA 2HLDA 2ZSUA 1MG0A 4PLVA 4A2CA 3Q3GE 4IIVA 3U3OA 3FZNA 2H1LA 1P7PA 1ZUNB 4O2AA 1GRCA 2WHYA 1YOVB 3CX8A 2ISQA 4DADA 4PPYA 1KSFX 3F6EX 4Y2VA 1FBNA 2BP7B 2XCTB 4BO2A 3FVQA 5CFPA 1OFGA 4IO0A 3QX3A 2BELA 4MX8A 1B76A 3NTRA 4LJRA 5EMNA 4QYTA 5JZMA 1L7XA 1VHWA 1XU7A 3OY7A 1W4ZA 4PBSA 4YP6A 4GOKA 2AZDA 1T5IA 4PG4A 1GU1A 5DFAA 1JG2A 1Q22A 3AMVA 3ESDA 1AKNA 3JQBA 5LOVF 2EZ9A 3WMGA 4HN4B 2CT8A 4Z6KA 3GH3A 1VI5A 2CLLB 3OP1A 4BO8A 1B0ZA 3JRWA 1P4GA 3KKLA 3KQOA 3ROMA 3KAJA 3R74A 2UAGA 4URHA 5B1SA 4II7A 4HHEA 3CM0A 3K5IA 5EKTA 4P83A 5D3KA 3OIWA 2FEAA 2ZZMA 4C43A 4F71A 5CA0A 1KKMA 3T9FA 2QJRA 3JPYA 4REMA 2WJ3A 1GNLA 4TLMB 4DIBA 1RXCA 4BKMA 1ZD5A 1KF0A 1SKYB 1Y63A 3S55A 3NM6B 4CGZA 1RC8A 1W1UA 1Z7YA 5DLQC 5DXAA 5ALMA 4H17A 2ZSHA 3QJYA 4HNAA 2DJIA 5IK2A