3GNFB

P1 crystal structure of the n-terminal r1-r7 of murine mvp
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
376
structure length
365
Chain Sequence
EAIIRIPPYHYIHVLDQNSNVSRVEVGPKTYIRQDNERVLFAPVRMVTVPPRHYCIVANPVSRDAQSSVLFDVTGQVRLRHADQEIRLAQDPFPLYPGELLEKDITPLQVVLPNTALHLKALLDFEDKNGDKVMAGDEWLFEGPGTYIPQKEVEVVEIIQATVIKQNQALRLRARKECFDRDGKERVTGEEWLVRSVGAYLPAVFEEVLDLVDAVILTEKTALHLRARQNFKDLRGVAHRTGEEWLVTVQDTEAHVPDVYEEVLGVVPITTLGPRHYCVILDPMGPDGKNQLGQKRVVKGEKSFFLQPGERLERGIQDVYVLSEQQGLLLKALQAHQAGDRWLIRGPLEYVPSAKVEVVEERQAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major vault protein
publication title The mechanism of vault opening from the high resolution structure of the N-terminal repeats of MVP
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein
total genus 52
structure length 365
sequence length 376
ec nomenclature
pdb deposition date 2009-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01505 Vault Major Vault Protein repeat domain
B PF17794 Vault_2 Major Vault Protein repeat domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.550 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3gnfB04
2.30.30.550 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3gnfB05
2.30.30.550 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3gnfB03
2.30.30.550 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3gnfB07
2.30.30.560 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3gnfB06
2.30.30.560 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3gnfB02
2.30.30.570 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3gnfB01
3GNGA 3GF5A 1Y7XA 3GNFB
chains in the Genus database with same CATH superfamily
3HFOA 1AD5A 3VS4A 1NYGA 2DFUA 1UJ0A 1X01A 1QMCA 4MZMA 4X9DA 1AT1B 2CREA 3V8JA 4F17A 1SRMA 2CZ7B 3X20B 2OAWA 2VXFA 4M7DA 4MZPA 4A4EA 1OEBA 2OTLQ 4M7DB 4NL2A 4DOVA 1IRXA 2W0ZA 3SEMA 3L2ZA 3SFMA 2FO0A 1UTIA 1KHIA 2HL3A 2E65A 2EGCA 5KYUA 1EZZB 5KCOA 4Q5WA 1UHFA 3UA7A 1BCOA 3FIFA 2KI7A 2YRDA 3HSBA 3H0HA 2VV5A 3OYJA 2ESWA 1WHMA 4KGZB 3OYNA 2C0TA 4LD9K 2EYZA 2QA4T 1QCFA 3OSSC 1YJNQ 1YJ9T 2MCNA 2RF0A 3PT9A 1PCXA 2PUOB 4R0KA 3OYAA 4X34A 2BUDA 3PMTA 2DTIA 2YLBA 4N0AA 1TSFA 2DL7A 4M77G 4RTZA 1VYUA 2G6FX 3VV0A 2QXFA 2E41A 4OP0A 4C8QE 2HQHA 1X2QA 1XJWB 3RNJA 4QQGA 1KC8C 4FW1A 1WZOA 1IZ6A 2JTMA 2AKLA 2QTVA 3JCMf 4ZN3A 1I5LA 3JB9H 5GANg 1M1KR 4PJOE 1N27A 1P92A 2WSCE 1RAIB 5CQYA 4M78A 2DRKA 2RQTA 4N4IA 3VU3C 3SDZA 4M78B 3VUBA 5CVIA 3BDLA 2RM4A 1VQ6T 4LDYA 1M4ZA 4BDYA 5GAN2 5HY6A 3BE3A 3G6EQ 1VQMQ 1DJ7B 4KGVB 2FVUA 2RN8A 4LDWA 3HHTB 1K4US 4QT7A 4CC2A 1VQ4Q 1VQ5A 2K4YA 3CPWS 2WSFE 4IIMA 2DXCA 2J05A 3TVTA 1VQ7T 1BI3A 2J6KA 3QHSA 4TVRA 2BE9B 2OJ2A 4C5EA 4KRTA 1W1FA 5KE2A 3FDRA 1OZ3A 1VQPA 1KQSA 2DVJA 4LNPA 3HRSA 2LJ1A 2PNIA 4ZGEB 2DO3A 4D6WA 1E6HA 2L8DA 2DIGA 1X75C 3I5SA 3VRYA 5GJVB 5L8RE 4AFZC 1QKXA 3P8HA 1NJIC 2A37A 1T0JA 1M1FA 2O9SA 1Q86U 1GCQA 2DXTA 1N8RC 3VYGA 1U1TA 5L23A 3C94A 4B9XA 3OYBA 2OTLA 2NUPA 2DD4A 2EGEA 4E7JA 4A63B 3CCLT 2DEQA 5D6WA 2NUPB 1AOJA 1TXQA 4FSXA 5GJWB 2DX1A 2JMCA 4GLKA 1ZSZA 4XTZA 2M51A 1Q7YC 2JS0A 3OBWA 2EYWA 4F7UF 2B8AA 1ZSZB 1M30A 4HT9A 4ANJA 3OMGA 3PIPA 4MZTA 1HXDA 4PJJA 1H8KA 2H3JA 3G4ST 2GFAA 1K73C 5IXFA 1M90R 2KROA 4NOYA 1BI2A 4BDZA 1M3AA 3AT1B 4QQDA 2K7AA 1D1CA 5FU6C 2L2PA 5GMKm 4D8DA 4XQ3A 1N6AA 1VA7A 2DJQA 2CDTA 3OS2A 4FIBA 1N5ZA 2QEXT 1D0YA 2CT3A 3X24B 3M0QA 4PL6A 1VQKQ 2MIOA 2IVWA 1UG1A 3MKDA 4XU3A 1M1KU 1AZEA 1SKUB 1AVZC 3M4GA 1KK7A 2DZ9A 1K8AC 1VQMA 3G6EA 2M02A 2QI2A 3EGXB 2JMAA 1SG5A 3OMCA 1PKTA 2CKKA 1RAEB 5GAMj 1VQ4A 2DBKA 4F7UG 2HSEB 2EBPA 2RO0A 1JB0E 1VIFA 2L3SA 2DETA 2DAQA 4HVWA 3CBPA 4C8QF 3JAME 4J6XA 2JZ2A 5I21A 4ZGDB 1UJYA 1SSFA 2DJZA 1U8RA 2DXUA 1R8OB 3BDUA 3RESA 2DM1A 1OU9A 2EQKA 1YNZA 2BTTA 2LQNA 4C92C 3EFRA 3OS0A 4X1VA 2LDMA 2I2LA 1ABOA 1SHGA 2GQIA 5KYYA 2PU9B 2F2VA 5GANd 1MNEA 4C0FA 2X4XA 5KYYB 5LJ3g 3CCET 2XD0A 1IO6A 2MYSA 2KMTA 1BIBA 1LCKA 3OYIA 2KT8A 2OX7A 3QKJA 3JCMJ 2XDBA 4PFZA 1AWOA 2DYIA 3OA6A 2QQRA 4KUIA 4C0DB 5J3BA 1H641 4C0GA 4V2SA 4Y92A 5CKBA 1RABB 2ZCFB 5KCHA 2V1RA 1SRLA 2XU8A 2CYZB 1QVGS 2RJDA 1LVKA 4FYXB 3GNGA 2DVEA 3CCJA 2CP5A 1T3SA 1SSHA 1D1AA 3QIIA 3SHWA 4M7DC 2RNAA 2QG9B 3MHXA 4EIKA 3ER0A 2O31A 4L6V5 3CC7T 5GAN6 1M90U 4N4GA 2EJFA 4C8QG 1GCPA 5I22A 3CMEA 1NG2A 3UATA 3TSWA 5GAOl 2EKHA 4C8QD 1X6GA 1KC8R 1WIEA 3WVEB 4PJOG 1U1SA 3V7CA 2COWA 4PJMA 1GRIA 2PZ1A 1BBZA 3CCQQ 1PWTA 2AT1B 2A0FB 1VQKA 2HKNA 2VB6A 3NTKA 4N4HA 3LH5A 4XTWA 2JS2A 4RCBA 3VS2A 1BI0A 3C95A 2E3HA 1IB8A 2CUDA 3I55A 2GTJA 4M7AF 1I8FA 2LCLA 2V1QA 4J6YA 2RHUA 2RJEA 1PD0A 1FWZA 1JO8A 2EYXA 4N0AC 5AYFA 4BB7A 2PVGB 3ZL7C 2GFUA 1PRLC 4E7SA 2RHXA 2NYSA 4QVZA 4RUGA 2DBMA 1R77A 2YWWA 3FEOA 1RI0A 1GBRA 3OSVA 3S3NA 1UE9A 3TEEA 2EQMA 3OY9A 2VGNA 4M78C 1M1GA 1GL5A 2IIMA 3NGPA 1MGQA 1NJIR 4PKCC 4ZGJB 3JCMe 1N8RR 2P84A 1QVFP 2LX7A 3RMSA 1NLOC 2O01E 4LXCA 3CCUT 2CT4A 1O9SA 3I56Q 1Q86R 5J26A 1M3CA 3H0IA 2K2MA 2E64A 2V26A 1OX9A 3LYIA 1UUEA 2K79A 3TCJA 1TUCA 5AT1B 5A0LA 3E9FA 2GNCA 1SPKA 1TUGB 3NPFA 3EHRA 3F70A 3CD6Q 1M3BA 4OVAA 3V7RA 3RUXA 4YTLA 1K73R 2AK5A 2HMAA 2X4JA 2EQUA 3OYGA 2YHTA 2LP5A 4OB3B 1GCQC 4M7AD 5FWBA 1K9MC 4QW2A 2COZA 2A28A 5I11A 1WHHA 1VQLA 1T0HA 1ZSZC 1WYXA 3CCVT 2QK0A 1RLQC 2FG0A 2KY9A 5IAYA 3X26B 2CUBA 4XU0A 4DBHA 4OMOA 3CCQA 3EGUA 2FYKA 5LJ3d 2IPOB 2KNBB 1VQ8A 1TTHB 1MNDA 1VQNQ 1S72Q 2CP2A 1AHJB 4BI4A 1T3LA 3VYHB 5GAN8 3OYKA 2K3XA 4IURA 1K8AR 2EYQA 5GAMd 3LGLA 2O9VA 2OTJT 4RTUA 3P8DA 1D09B 2G3RA 4J9DA 1M8VA 3JCMX 1UEBA 4J5YA 2M16A 3L2QA 1D3BA 1VUBA 2KR3A 1FMKA 1F1BB 4XTYA 4C92E 4OMQA 1D3BB 1Q81C 3NHNA 3E19A 1JXOA 4FYYB 1VQ5Q 2KEAA 3GPLA 1FYNA 2BZ8A 2DTOA 1YITA 1YJWQ 2RHYA 3QDFA 2O88A 4PNOA 3RKWA 3MP6A 1YI2Q 3NTHA 3O5ZA 2LVMA 1ABQA 3M54A 5A0DA 3QJYA 4WCIA 3CEYA 1VQPQ 8AT1B 4LUEA 2QQAA 1NJIU 1N9SA 3J7AF 5CQXA 4F7UB 1VIEA 2KVQG 2RJCA 3OQ5A 2JXBA 1OPKA 4ZNXA 3QG1A 4JRKA 2KXCA 4KH0B 3UA6A 1KD1R 1YIJA 3U23A 3QO3A 1UGPB 5GANj 2DERA 4DA4A 3TQ7P 2V8IA 4M7DE 3CBMA 2EYYA 4CI0C 3CD6A 1W4SA 3R6OA 3DLLA 2EIFA 4KULA 4MMLA 3CC4T 1WXTA 1SHFA 3VUZA 1RL2A 3CCSA 2QGGA 1PHTA 1V29B 1QVPA 2X51A 1JEGA 2CP7A 3N5BB 2CH4W 2XG8D 3M56A 2XI9A 2E1HA 3JCMg 1ZUYA 3S3OA 2RH2A 2VYTA 4C0DC 3OYLA 2FRWA 3VS6A 3MPUB 3CCUA 2GCXA 4BACA 2R5MA 3H41A 4QVDA 3JB9J 4ORZA 3GP8A 2MOXA 2LQWA 1OU8A 1VQNA 2LMJA 5KYNA 5LJ5g 1S72A 3HP9A 2D0QB 4J9IA 3I5RA 4M77D 4OMMA 3EFOA 2ABLA 2A08A 4OB0B 3EFOB 1NLPC 4X9CA 2LCCA 4LDVA 3CPFA 3PVLA 4C8QA 4JJCA 1B34A 3VS3A 3EFSA 3EH1A 4C8QB 1B34B 4DEYA 2QGFB 3FC3A 4M78E 2FZGB 5C6SA 5FRNA 4OGCA 3MEWA 4QQ6A 1W70A 2SEMA 1YJWA 3J81E 4KT0E 1Q82C 3MCAB 2RI2A 3L42A 1YI2A 2V8JA 1UDLA 4J9HA 2QA4Q 1VQOA 5EG2A 1VOMA 3ZBDA 2DMOA 3G1JA 4RG8A 4MDXA 5ECAA 1ZUUA 3DKMA 5D6XA 2VC8A 1WFWA 1ZBXA 2NUZA 3G71T 1WJRA 1UFFA 2D8HA 1OI1A 3RBBB 1TH7A 2HCKA 4FM4B 4J9CA 5LJ3h 1LPLA 2JVVA 3QZ9B 3H9NA 5GAOp 3VRZA 2LQKA 1A0NB 2PVDB 4FYVB 4C92F 2E3IA 1K1ZA 1KD1U 2CGHA 1VQ6Q 1QW1A 5GAMh 3FRNA 1WLPB 3JV3A 4A4HA 4E7IA 3JCMP 2QQSA 3EG2A 4RG2A 3VKIA 4JJDA 2EWNA 2JNGA 2ENMA 1B07A 1I81A 2WSEE 1K9MR 2BZXA 3CC2A 2QDLA 4NS5A 4AG2C 2F5TX 1YHQT 2E10A 4RTVA 3CCRT 1W2BP 3CMAT 2NWMA 3CCJQ 2ZPBB 1LJOA 3VJPA 2DNUA 3OS5A 2XIDA 4M7AA 2KYBA 3JCMc 1ACMB 2EGAA 3A1PA 4M7AB 4HXJA 1QWEA 5GAOn 4FT2A 3CMEQ 3LW5E 2F2WA 2KRMA 2ATCB 4XU1A 1QVFA 1H92A 1YWOA 3UF4A 4J6WA 3CCLQ 4M75E 3PNWC 1GXIE 2P0PA 1NE8A 2J6OA 2QTXA 5LJ3j 1WJSA 2HZYA 4Z02A 5IH2A 5A2QE 2A36A 3EGXA 2JM9A 4L5GA 4C92G 1YBYA 1WDXA 2JJ9A 3OYCA 3I55Q 4J9FA 3MP1A 1B7TA 2GBQA 4JS4A 2MF2A 1Q81R 5GMKl 3G4SQ 1PRMC 3V8KA 3OYDA 4OMFB 2XDPA 1CKBA 2FPEA 2EFIA 3M0UA 3M5AA 4DOWA 2SRCA 2QA4A 1JU5C 1YJ9A 1KQSS 2KDSA 2R5AA 1B3QA 2YRVA 3NTIA 3BW1A 4OF1A 2ECZA 5IXBA 1N9RA 2MPXC 2HSPA 3M0PA 4PJOF 5LJ5d 2JTEA 5GAOr 4Z89A 2L89A 3RKXA 5GAOq 1AEYA 3IQLA 4M78F 2ZPIB 2K3BA 5D6YA 4M7DG 4QKUA 5KH6A 4E7ZA 4A4FA 1Y96A 3JCMV 4OMNA 5IHKA 1VQ6A 4FW2A 3CBOA 1Y96B 3I9QA 1QKWA 4A53A 4FSSA 3EAEA 2H3EB 2DXBA 4DBRA 4Z88A 3THKA 5HK3A 3EG9A 1J3TA 3KXTA 1UECA 3A8HB 3RMQA 4F14A 2DZCA 3EG9B 1V76A 1VQ7A 2OAUA 2KRSA 1GFCA 1SF9A 3QJ6A 2MWOA 1WXUA 1PD1A 3HPWA 2CSQA 2KGTA 3GIBA 2DK3A 2HDAA 1JJ2P 5A0GA 3C12A 1VQ9T 4AT1B 2L0AA 2YLCA 1YFNA 9ATCB 2DE0X 4VUBA 1CKAA 1YWPA 2DL8A 4PJNA 3CCMT 1VQLQ 5LJ3f 1QVFS 2FZKB 2VASA 1M8MA 3EG0A 1EX4A 3CCEQ 3CCLA 3ASKA 1BIAA 3A8GB 4ESRA 4PJOD 1MMGA 2LNVA 3M55A 1VQ8Q 4OMPA 1HYOA 1OOTA 1MV3A 1PC0A 4M78G 4RCCA 5GAMf 2VGMA 3GLXA 3S3MA 3QYGB 3CQTA 4XTVA 3M0SA 2BZYA 1K9AA 4HA8A 1MHNA 3SWNA 3L2VA 4M77A 2AIRB 4MDWA 1YHQA 3G4SA 5KYXA 2YXYA 3SWNB 2KQWA 3I56T 2KAFA 4M77B 1M5Q1 1G5VA 5KYXB 2K9GA 3MP8A 1Q82R 4M4ZA 2PVOB 2EJGA 2E4HA 1EFNA 2RK2A 1TS9A 4L59A 1WJQA 3ULRB 3LWIA 1BU1A 2AZSA 1MMDA 2LNHB 1M1KC 2VKNA 3LX7A 3QSUA 2BIVA 1UGSB 2ROTA 4C8QC 4MMKA 2JT4A 1NBEB 1YCSB 1YITQ 2RHIA 2C06A 4M75F 1UB4A 2DL5A 2HQEA 2NUTA 2QYZA 2QEXA 3M0RA 2NUTB 3OS1A 5IN1A 4CC3A 2FRYA 3L1AA 4LDUA 1LNXA 2P4RA 2ZZDA 2J6FA 3V7SA 5M9OA 1UGQB 2P0KA 1G3SA 1I07A 1Q7YR 1XTDA 3EG3A 1YIJQ 3OYFA 2CSIA 2ZPEB 2JN0A 4LE9A 5DY9A 3UT1A 2E70A 3E9GA 5IT9E 3QXEB 2YRCA 2E12A 4A4GA 3CCSQ 4J9BA 3JB9F 3JCMW 2F69A 4E7HA 2DYBA 2RPNA 3S6WA 5GANe 2P4TA 2RI3A 1X6OA 3CXCP 3FJPA 1WNLA 2RJFA 3TSZA 2R58A 3L2UA 3CCUQ 1C1AA 4M75G 1WX6A 5LJ5h 4AFSC 3CCEA 4JLGA 1H3ZA 4OMLA 4IUQA 4HT8A 1X27A 4J7FA 4M75D 1KC8U 3DLMA 2ZAEA 2HAXA 4PFPA 5GANh 4AMCA 4RMOA 4P5NA 4R56A 1M90C 2LX9A 2E6NA 2RQUA 2LJ0A 3NMZC 4RTYA 2XMFA 3Q1JA 1VQPT 3QYHB 4B9WA 1Q95G 4J9EA 1CSKA 1PKSA 4M7AC 3GBQA 5DLQE 2DKGA 2KXDA 3OW2P 2EPDA 2QDYB 5LL6S 2IG0A 1W6XA 3UWNA 5CKHA 5FLXE 1UGRB 2HQXA 3CC7A 4FCYA 1WGSA 2XK0A 2D8JA 3SB2A 1TG0A 4JPBW 2OTLT 2M0OA 1OYXA 1W2BA 2K5IA 3CCVQ 1RADB 1VQOQ 3JB9G 2F1LA 3MEUA 4BE1A 1ZUKA 2RQWA 3EHQA 1M27C 5HKCA 3QUIA 1XQHA 4LN2A 3JB9D 1EIFA 3PIOA 4F7UA 3BY7A 1N8RU 2Y4YA 5CKEA 3BFMA 3URGA 4D8KA 5CK9A 5LJ5j 1HD3A 1MMAA 4C5IA 5GAN4 1E7OA 1XNIA 3PMIA 4DQ2A 4HCBA 1YJNT 3X25B 2OTJQ 1MUZA 3AHUA 1MV0B 1ZX6A 1Q7YU 1D0ZA 3HKSA 3KFVA 4PJLA 4C5HA 4OB1B 1KFZA 1VYTA 4ZTFA 1U5SA 4KBMB 2O4XA 3NFCA 3TREA 2LC4A 2RB6A 2EQJA 5FRMA 2O4XB 5GMKh 4RKUE 5CKDA 3C4SA 2KRNA 1K73U 2YSQA 2CP0A 3CC2Q 1GBQA 2FPDA 4FL6A 3FLGA 2RD1A 4ELZC 4HVUA 3MEVA 2JW4A 1IHWA 2ED0A 4E2FB 3FJ5A 4JJNK 2VUBA 2DILA 5KYUB 4F16A 2DL3A 1IXDA 1FX7A 3LGFA 2KBTA 1VQMT 3QBYA 4F04B 3G6ET 1BB9A 3M53A 1RAHB 2MWPA 1VQ4T 2LZ6B 1RACB 2ED1A 2AZVA 2JUFA 4FT4A 4JJBA 2NLUA 2YUOA 2CZ6B 4XK8E 5D7UA 2HL5C 1QLYA 4WTOB 1TUDA 2PUKB 2LQ8A 3QZ5B 3LLRA 1K8AU 5GAN5 3CC4Q 2DL4A 1JRIA 4HKEA 1Y57A 4JRIA 2K2VA 4J9GA 2RHZA 4KH1B 4PJOA 4GY5A 2JOYA 2V8KA 2E6ZA 2L3PA 2CH4A 2HEQA 3OYMA 1WHJA 2AHJB 4PJOB 1NEBA 2CS7A 2X3XD 1ZHIA 3RDVA 3RKYA 2EJ9A 2QAZA 4OGEA 1YP5A 1ZBJA 1W2BS 3PFSA 4BY6B 3R6NA 2YT6A 3X28B 5GMKj 3CCVA 5LJ3e 1YJ9Q 4JZ4A 1QWFA 4R55A 1AWWA 5HK0A 4BI3A 3EG1A 3M57A 5LJ5f 4FU6A 1FMVA 2KT1A 1KG1A 3A8MB 4JRPA 3VS7A 1NYFA 2KE9A 3SWNC 4O5VA 4DBFA 1JJ2A 4M77C 1Y07A 2H8HA 3MJXA 5I2SA 1K76A 4BUGA 5GAMe 2ZPHB 4JDSA 5GANf 2J06A 2DA9A 3J80E 3OB9A 2XKOC 2B86A 1RLPC 4XTXA 3CCJT 1G3WA 4BE2A 2OTJA 3P8BB 2F5KA 2COYA 3L2RA 1RAGB 2DEUA 2RQVA 4LD6A 2M0YA 3KBGA 4XTUA 4RTWA 3HL8A 4PLLA 3CMET 1PNJA 4PFOA 2LRQA 1QCNA 1GFDA 5KYWA 1VQ7Q 5IHIA 2AKKA 3FB9A 2MMPA 1QCOA 1SEMA 5KYWB 3A98A 1VQKT 4BD3A 2JTFA 5GAN7 1BYMA 2EQIA 4CRIA 1H3HA 4IKFA 4EMKA 1LOJA 3UDCA 1R0CB 1RUWA 4EMKB 4EDUA 4PLIA 3I55T 3G71Q 3OBYA 3GOXA 2QASA 1I0CA 4O6JA 3KUFA 3CPWP 5FU7C 5FROA 2VVKA 4M7DF 2DD5A 3E2UA 4M7AE 1YJNA 1QVGA 2DPPB 4JLIA 1M2OA 1Y71A 4II1A 1PSEA 1R0BG 1NM7A 2XICA 1Z9ZA 1BI1A 3CC4A 4A4KA 1UGVA 2C0OA 4XAXB 4EMGA 1YN8A 4JUVA 3MO8A 3SD4A 4M75A 1I5OB 4AFUC 3PVQA 1OV3A 4M75B 1MMNA 5CKFA 2CP3A 2BKDN 4C92D 1D1BA 4B6MA 2MAMA 1YHQQ 1NZ9A 3JB9I 3CCRQ 4LDXA 3JCMd 3CMAQ 2L5QA 3T9NA 2FB7A 2YDLA 5HCKA 1E6GA 4UC4A 5CR2A 3PGGA 2HBPA 3OYHA 3VS0A 1OX8A 2GF7A 1ZQ1A 1ARKA 3H8ZA 1JJ2S 1WPYA 4RTXA 2FL7A 3ME9A 1JQQA 1G83A 2K5LA 3GF5A 1RAAB 3CXCA 2LT4A 2PQWA 5DM7R 4E7LA 4E7KA 3M59A 2L3QA 1Z9QA 2QEXQ 3RIRA 4NL3A 1BK2A 1VYVA 4ZTJA 2LTOA 3RERA 4M7DD 2EAYA 4Y91A 4JZ3A 4J7IA 3M0TA 3WVDB 2O2OA 1VQLT 1PM3A 3O8VA 2X35A 1JBMA 1KSWA 3REBB 4BE0A 4DEXA 1Q86C 1OQKA 3GNFB 3EH2A 3CCQT 4EPCA 2D9TA 3L2WA 1M9SA 4FYWB 4ATOA 1K9MU 1VQ8T 1S1NA 2I0NA 1X69A 3OW2A 1C0MA 1TOVA 1WA7A 2EVRA 5GAN3 2A3LA 3HFNA 2X4WA 1KD1C 3DB4A 2ZPFB 2LCSA 5GAOm 4KGXB 5GAMg 4CC7A 1NEGA 1TU0B 2YUNA 2Y90A 3G71A 5CCAA 5C0MA 1Y0MA 2JM8A 3HTRA 2CZ0B 2QQ9A 3REAB 1FMWA 2A7YA 1AWXA 7AT1B 2X9HA 2FZCB 3RR6A 4ELYC 1KQSP 4Y28E 3OYYA 2PTKA 3HRTA 4BI8B 1WHKA 3ZFJA 3QDRB 4EMHA 1OPLA 3EGDA 1WHLA 1YITT 1ZLMA 2FHDA 1D0XA 1KQ1A 1RI9A 3EGDB 4M78D 1BKBA 2CP6A 1YCYA 3M4YA 4LUDA 1QP2A 2EKOA 3V8LA 3CCRA 2P0QA 3CMAA 4M77E 2DF6A 3JSCA 1U3OA 3A5ZB 3A8LB 1Q81U 1X6BA 2DIQA 4DBQA 3JCMQ 1KIKA 4HCZA 1ZSGA 2HNIA 3CC7Q 1K0SA 5I2MA 1X43A 2KSSA 1VQ9Q 1IGUA 1QQJA 1YIJT 2E5QA 3M9QA 5DLOA 4J8OA 3CXCS 6AT1B 2LT1A 2GQVA 2L3RA 1ZA1B 3CCMQ 1WHGA 3H0FA 3CD6T 4QVCA 2ROLA 1BCMA 4IUPA 3META 1Y7XA 1QVGP 4PJOC 3PTAA 1C6VX 3CCST 4WF2A 4BY6C 4C5GA 2EW3A 1K0XA 1ZA2B 2D1XA 2ZGWA 4K11A 5J39A 3E1SA 4ZN1A 2RA2A 1PG5B 2OI3A 1FXXA 4IIOA 1RAFB 4J83A 5GMKi 1QP3A 3LWHA 5IHNA 3LH0A 2YUQA 1KHCA 3G7ZA 3QPHA 2X4YA 4IUUA 3JRZA 3OW2S 3A8OB 3QWXX 1VQNT 2RMOA 3MEAA 5FU7B 1HJDA 2DTHA 1S72T 2MI6A 2K5FA 5LJ5e 4GLMA 4XU2A 1KJWA 3JCMh 3INZA 1IREB 2KK4A 3DB3A 5CAIA 2FPFA 3C0CA 2RK1A 1U06A 1IHVA 2MK5A 5FU6B 4M7AG 4E6RA 2VWFA 5CO7A 2ZPGB 1G8XA 1AZGB 2VXEA 2DRMA 3OYEA 1JXMA 2HD0A 2W10A 2Y4XA 2C0IA 4C0ZA 1G2BA 3PE0A 1VQ5T 3M58A 1I1JA 1PSFA 1YJWT 2DLPA 1OZ2A 2K6DA 2YUPA 2F2XA 2J7IA 4GBQA 5FWCA 1YI2T 2R57A 3VS5A 2M1HA 1VQOT 2D6FA 2LJ3A 1G3TA 3VS1A 4EMKC 4JRQA 4IUVA 2K3YA 3HRUA 1I4K1 2CZ1B 4HCCA 3I35A 1OULA 1KQ2A 2X3WD 2BE7D 5CIUA 1M2VA 1M2VB 8ATCB 2K57A 1WXBA 1IGQA 1Q82U 1WQ7A 3H6ZA 4AG1C 2XHCA 1NPRA 1VQ9A 3QWYA 4HCKA 1O75A 1HSQA 2D0NA 4A54A 4ME7A 4E47A 3UPUA 3CCMA 2Z0WA 1WI7A 1WQWA 4Z8AA 4C92A 2WACA 4C92B 4M75C 4CC4B 1UHCA 2M9UA 1NPPA 2XDDA 4RTTA 1HK9A 4IUTA 2QQBA 5FW9A 4KUDK 2FEIA 3JCMb 3WXMB 2RQRA 2HBWA 5KE3A 3CC2T 3CPWA 4F7UE 1X2KA 2RI5A 2E5KA 4OB2B 2GGRA 4HVVA 3ZEHA 1AWJA 3TU4K 4M77F 1TWBA 5GMKe 4PK4A 2KYMA 3D7SB 4JS5A 2HKQB 3I56A 1XOVA 1V1CA 2GTOA 4AFQC 5EC7A 1G3YA
chains in the Genus database with same CATH topology
3HFOA 1Y96A 2E64A 3JCMV 1VQ6A 1X01A 3L2RA 3CBOA 1Y96B 4MZMA 3LYIA 4X9DA 4A53A 4LD6A 3KBGA 4XTUA 3TCJA 3EAEA 3V8JA 3HL8A 4PLLA 3CMET 2DXBA 5HK3A 2CZ7B 3A8HB 2VXFA 3X20B 3KXTA 4M7DA 2LRQA 3RMQA 4MZPA 2DZCA 4A4EA 5A0LA 3E9FA 5GMKh 4M7DB 1VQ7A 4NL2A 2OAUA 4DOVA 3FB9A 2MMPA 3F70A 3L2ZA 3SFMA 4OVAA 3V7RA 1KHIA 2MWOA 2E65A 3QJ6A 3RUXA 1VQKT 4YTLA 4BD3A 2JTFA 2X4JA 5GAN7 2EQUA 1BYMA 3OYGA 2YHTA 4CRIA 3HPWA 5KCOA 4OB3B 4IKFA 4Q5WA 4EMKA 4M7AD 1LOJA 3UDCA 1K9MC 4QW2A 4EMKB 4EDUA 2DK3A 4PLIA 3FIFA 3GIBA 3I55T 3OBYA 3HSBA 5A0GA 3GOXA 2VV5A 3C12A 4O6JA 3JCMP 1VQ9T 2YLCA 4VUBA 3KUFA 5FU7C 3OYJA 5FROA 3OYNA 4M7DF 1VQLA 4LD9K 3CCMT 2DD5A 4M7AE 5LJ3f 2QA4T 1QVFS 3CCVT 1YJNA 3OSSC 1QVGA 1YJ9T 2DPPB 4JLIA 2KY9A 3PT9A 5IAYA 3X26B 1Y71A 4XU0A 4II1A 1PSEA 3CCLA 3ASKA 2XICA 3CCQA 1BIAA 2PUOB 3A8GB 3OYAA 4X34A 2BUDA 3PMTA 2DTIA 2FYKA 2YLBA 5LJ3d 4PJOD 4M77G 4N0AA 2LNVA 1VQ8A 1BI1A 3M55A 3CC4A 3VV0A 4A4KA 2QXFA 2E41A 4M78G 4RCCA 4OP0A 4XAXB 2VGMA 4C8QE 3GLXA 4JUVA 4EMGA 1AHJB 5GAMf 3QYGB 3S3MA 4BI4A 3MO8A 3SD4A 3VYHB 4XTVA 4M75A 4QQGA 5GAN8 1KC8C 3OYKA 2K3XA 4IURA 1IZ6A 2JTMA 4HA8A 3JCMf 4ZN3A 2EYQA 4M75B 1MHNA 5CKFA 3SWNA 5GAMd 1I5LA 5GANg 3LGLA 3L2VA 2BKDN 4M77A 4C92D 4PJOE 4MDWA 1N27A 1YHQA 1P92A 2MAMA 2WSCE 3G4SA 2OTJT 1NZ9A 3JB9I 5CQYA 4M78A 3SWNB 3P8DA 2G3RA 2KQWA 3I56T 2KAFA 4M77B 4LDXA 1M5Q1 4N4IA 3VU3C 1G5VA 3JCMd 3MP8A 3SDZA 2L5QA 2PVOB 2EJGA 2FB7A 4M78B 3T9NA 3VUBA 1UEBA 4UC4A 3BDLA 4J5YA 5CVIA 2RM4A 3JCMX 1M8VA 5CR2A 2RK2A 2M16A 4LDYA 3L2QA 1M4ZA 1VQ6T 3JB9H 3PGGA 2HBPA 1D3BA 4BDYA 5GAN2 3OYHA 1VUBA 5HY6A 2GF7A 1ZQ1A 4L59A 4XTYA 4C92E 1WJQA 3LWIA 1DJ7B 1D3BB 3H8ZA 1JJ2S 1M1KC 3LX7A 2FVUA 4LDWA 1WPYA 3HHTB 1Q81C 3QSUA 3E19A 2BIVA 2FL7A 1VQ5A 1UGSB 2K4YA 3ME9A 4C8QC 4MMKA 3GPLA 3CPWS 2WSFE 2DTOA 1YITA 2DXCA 2RHIA 1VQ7T 2RHYA 4M75F 2C06A 1BI3A 1UB4A 4PNOA 3QHSA 3RKWA 3MP6A 4TVRA 2K5LA 3GF5A 3NTHA 3CXCA 4C5EA 2LT4A 2LVMA 2PQWA 5DM7R 2HQEA 4E7KA 4E7LA 5KE2A 3FDRA 3M54A 3M59A 5A0DA 3QJYA 1OZ3A 1VQPA 1KQSA 3CEYA 2QEXA 3HRSA 3RIRA 3OS1A 5IN1A 4NL3A 4ZGEB 2DO3A 3L1AA 4LDUA 2QQAA 1NJIU 1LNXA 4D6WA 1N9SA 2L8DA 2ZZDA 2DIGA 3J7AF 5CQXA 4F7UB 1X75C 3V7SA 5M9OA 1VIEA 2KVQG 2RJCA 4ZTJA 3OQ5A 1UGQB 2LTOA 3RERA 5L8RE 4M7DD 2EAYA 2P0KA 3P8HA 4Y91A 1G3SA 1NJIC 4J7IA 3QG1A 1M1FA 1Q86U 2DXTA 1XTDA 4JRKA 3VYGA 3WVDB 1N8RC 1U1TA 1VQLT 3O8VA 2X35A 1YIJA 3C94A 3OYFA 1JBMA 4B9XA 3OYBA 4BE0A 2ZPEB 1UGPB 3QO3A 2JN0A 2OTLA 2DD4A 5GANj 1Q86C 4DA4A 4E7JA 2V8IA 3CCLT 3GNFB 4M7DE 3CBMA 4CI0C 3CCQT 3CD6A 2DEQA 2D9TA 5D6WA 1M9SA 4EPCA 3L2WA 1W4SA 4ATOA 5DY9A 3R6OA 3UT1A 3DLLA 4FSXA 2E70A 2EIFA 3E9GA 4KULA 1K9MU 1VQ8T 4GLKA 4XTZA 5IT9E 3OW2A 4MMLA 3CC4T 1Q7YC 3OBWA 4F7UF 5GAN3 3QXEB 2A3LA 2B8AA 3VUZA 3HFNA 2E12A 1RL2A 2X4WA 3CCSA 4A4GA 1KD1C 4HT9A 3DB4A 2ZPFB 5GAOm 3OMGA 1V29B 5GAMg 1QVPA 3PIPA 2Y90A 4MZTA 3JB9F 3G71A 1HXDA 5CCAA 3JCMW 5C0MA 2F69A 2H3JA 3N5BB 4E7HA 2XG8D 2CZ0B 2QQ9A 2XI9A 2E1HA 3M56A 3S6WA 3G4ST 2GFAA 3JCMg 5GANe 4KUDK 2P4TA 2RI3A 1K73C 2A7YA 3S3OA 1X6OA 2RH2A 2VYTA 4C0DC 3OYLA 3FJPA 1WNLA 2RJFA 4ELYC 3CCUA 2GCXA 2R58A 4NOYA 4Y28E 3L2UA 4BACA 3OYYA 1BI2A 4M75G 2R5MA 3HRTA 5LJ5h 4BDZA 3CCEA 4QVDA 4JLGA 4QQDA 4BI8B 1H3ZA 4IUQA 3JB9J 4HT8A 3GP8A 4J7FA 3ZFJA 4M75D 1KC8U 3QDRB 5FU6C 3DLMA 1VQNA 4EMHA 5LJ5g 1S72A 2HAXA 1YITT 3HP9A 5GMKm 2FHDA 2D0QB 5GANh 1KQ1A 4M77D 4XQ3A 4RMOA 4P5NA 4R56A 1M90C 1N6AA 2LX9A 4M78D 2E6NA 1BKBA 1YCYA 3Q1JA 3M4YA 4OB0B 3OS2A 4FIBA 1VQPT 4X9CA 1QP2A 2EKOA 2LCCA 3QYHB 4LDVA 4B9WA 3CPFA 2QEXT 3X24B 4C8QA 1B34A 3V8LA 3EFSA 3CCRA 2P0QA 4PL6A 2IVWA 4M7AC 4C8QB 3CMAA 4M77E 1B34B 5DLQE 3JSCA 4XU3A 3FC3A 2DKGA 3A5ZB 1M1KU 3A8LB 4M78E 1Q81U 2QDYB 5LL6S 2IG0A 5C6SA 3M4GA 3UWNA 2DIQA 5CKHA 4OGCA 3JCMQ 2DZ9A 5FRNA 3MEWA 4QQ6A 1K8AC 4HCZA 3G6EA 1VQMA 2QI2A 5FLXE 2HNIA 1UGRB 2HQXA 3CC7A 5I2MA 3OMCA 1WGSA 2CKKA 2KSSA 2XK0A 5GAMj 1VQ4A 1YIJT 2E5QA 3SB2A 3M9QA 5DLOA 4J8OA 4F7UG 1YJWA 3J81E 2OTLT 2M0OA 4KT0E 3CXCS 1Q82C 2LT1A 1OYXA 2GQVA 2L3RA 2RI2A 3L42A 3MCAB 1YI2A 2K5IA 2V8JA 4QVCA 1W2BA 4IUPA 3CD6T 2RO0A 5EG2A 1JB0E 1VIFA 3META 3ZBDA 1VQOA 3JB9G 1Y7XA 2DAQA 3MEUA 4BE1A 4C8QF 3CBPA 4PJOC 3JAME 4J6XA 5HKCA 4RG8A 2JZ2A 3PTAA 5I21A 4ZGDB 3QUIA 1XQHA 3JB9D 4MDXA 1EIFA 3PIOA 3CCST 1SSFA 2DJZA 4F7UA 1U8RA 2DXUA 1R8OB 4WF2A 3BDUA 3BY7A 3DKMA 4BY6C 5D6XA 2VC8A 3RESA 1N8RU 1ZBXA 4C5GA 3G71T 2Y4YA 1WJRA 2EQKA 5CKEA 3BFMA 3URGA 5CK9A 2ZGWA 5J39A 1OI1A 3E1SA 5LJ5j 4ZN1A 1TH7A 4C92C 3EFRA 4C5IA 2RA2A 5GAN4 3OS0A 4FM4B 2LDMA 1XNIA 3PMIA 2I2LA 4DQ2A 5LJ3h 2JVVA 1FXXA 3QZ9B 5GAOp 4J83A 4HCBA 2LQKA 5GMKi 1QP3A 3X25B 1YJNT 2PU9B 2PVDB 5GANd 3LWHA 4C0FA 3LH0A 3AHUA 2X4XA 1Q7YU 3G7ZA 1KHCA 4C92F 5LJ3g 3HKSA 3CCET 3QPHA 2XD0A 2X4YA 2KMTA 1BIBA 1KD1U 4IUUA 2CGHA 3JRZA 4C5HA 4OB1B 3OYIA 3OW2S 3A8OB 3QKJA 1QW1A 3JCMJ 2XDBA 5GAMh 1VQNT 3FRNA 3MEAA 5FU7B 2DTHA 4KBMB 4ZTFA 1S72T 2O4XA 4A4HA 3NFCA 2MI6A 4E7IA 3TREA 2K5FA 2LC4A 2RB6A 2QQSA 5LJ5e 3OA6A 2QQRA 2EQJA 4KUIA 4RG2A 4C0DB 2O4XB 5FRMA 3VKIA 4RKUE 2EWNA 2JNGA 2WSEE 4XU2A 3C4SA 1I81A 3INZA 5J3BA 1H641 1IREB 3JCMh 5CKDA 2KK4A 1K73U 4C0GA 3CC2A 4V2SA 3DB3A 5CAIA 4NS5A 4FL6A 2F5TX 5CKBA 3FLGA 2RD1A 1YHQT 2RK1A 2E10A 2ZCFB 4ELZC 5KCHA 5FU6B 3CCRT 4M7AG 3MEVA 2XU8A 3CMAT 2CYZB 1QVGS 2RJDA 3GNGA 2DVEA 4JJNK 2VUBA 3CCJA 5CO7A 2ZPBB 2ZPGB 1LJOA 2VXEA 3QIIA 3OYEA 3VJPA 4M7DC 1FX7A 3MHXA 3LGFA 1VQMT 2HD0A 2Y4XA 3QBYA 3G6ET 3ER0A 4C0ZA 3M53A 2XIDA 3OS5A 4L6V5 3CC7T 5GAN6 1M90U 4N4GA 2MWPA 4M7AA 1VQ4T 1VQ5T 2EJFA 4C8QG 3M58A 3JCMc 1PSFA 1YJWT 4M7AB 2JUFA 4FT4A 3CMEA 2NLUA 5GAOn 5GAOl 1OZ2A 4FT2A 3LW5E 2CZ6B 4XK8E 4C8QD 1YI2T 2R57A 1VQOT 2M1HA 2D6FA 1G3TA 4XU1A 1QVFA 4EMKC 3WVEB 4JRQA 4PJOG 1U1SA 2PUKB 4IUVA 4J6WA 3V7CA 2K3YA 2LQ8A 3HRUA 4M75E 1I4K1 2CZ1B 3PNWC 4HCCA 1GXIE 2P0PA 3QZ5B 3LLRA 1KQ2A 1NE8A 1VQKA 5LJ3j 2QTXA 1K8AU 5CIUA 5GAN5 3NTKA 1WJSA 1JRIA 4N4HA 4XTWA 4HKEA 4Z02A 5A2QE 4RCBA 4JRIA 2K2VA 1BI0A 2K57A 2RHZA 4PJOA 4L5GA 4GY5A 4C92G 3C95A 1YBYA 2JOYA 2V8KA 2E6ZA 3I55A 3OYCA 1Q82U 1WQ7A 4M7AF 3OYMA 1I8FA 2AHJB 3H6ZA 3MP1A 2CS7A 2XHCA 4PJOB 1ZHIA 2LCLA 1NPRA 3RKYA 4J6YA 2MF2A 2RHUA 4JS4A 1VQ9A 2RJEA 2EJ9A 1O75A 5GMKl 1FWZA 4OGEA 4A54A 4ME7A 3V8KA 3OYDA 4E47A 4OMFB 1W2BS 2XDPA 3PFSA 4N0AC 4BY6B 3UPUA 3X28B 3CCMA 5AYFA 4BB7A 2EFIA 2PVGB 1WQWA 3M5AA 4DOWA 5GMKj 4C92A 3CCVA 2QA4A 5LJ3e 1YJ9A 4R55A 2GFUA 2KDSA 1KQSS 2WACA 2R5AA 4C92B 4M75C 5HK0A 4BI3A 2RHXA 2YRVA 2M9UA 4QVZA 1NPPA 3M57A 3FEOA 3NTIA 3BW1A 1RI0A 4FU6A 5LJ5f 2XDDA 4OF1A 1KG1A 3A8MB 4JRPA 3OSVA 3S3NA 1HK9A 3SWNC 3TEEA 4IUTA 2EQMA 1N9RA 2QQBA 4O5VA 4M77C 3WXMB 3JCMb 3OY9A 1JJ2A 1Y07A 2VGNA 5KE3A 5I2SA 3CC2T 4M78C 1M1GA 3CPWA 4PJOF 4BUGA 5GAMe 4F7UE 5LJ5d 2ZPHB 2RI5A 4JDSA 4OB2B 5GANf 5GAOr 1MGQA 3J80E 3OB9A 3ZEHA 2XKOC 2L89A 3TU4K 4M77F 4XTXA 3RKXA 5GAOq 4PKCC 5GMKe 4ZGJB 3JCMe 4M78F 4JS5A 2ZPIB 3CCJT 1G3WA 4BE2A 2OTJA 3P8BB 3RMSA 2O01E 3CCUT 3I56A 1O9SA 1XOVA 5D6YA 4M7DG 2F5KA 5KH6A 5J26A 1G3YA 4A4FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GNG A;  3GF5 A;  1Y7X A;  3GNF B; 
#chains in the Genus database with same CATH topology
 3HFO A;  1AD5 A;  3VS4 A;  1NYG A;  2DFU A;  1UJ0 A;  1X01 A;  1QMC A;  4MZM A;  4X9D A;  1AT1 B;  2CRE A;  3V8J A;  4F17 A;  1SRM A;  2CZ7 B;  3X20 B;  2OAW A;  2VXF A;  4M7D A;  4MZP A;  4A4E A;  1OEB A;  2OTL Q;  4M7D B;  4NL2 A;  4DOV A;  1IRX A;  2W0Z A;  3SEM A;  3L2Z A;  3SFM A;  2FO0 A;  1UTI A;  1KHI A;  2HL3 A;  2E65 A;  2EGC A;  5KYU A;  1EZZ B;  5KCO A;  4Q5W A;  1UHF A;  3UA7 A;  1BCO A;  3FIF A;  2KI7 A;  2YRD A;  3HSB A;  3H0H A;  2VV5 A;  3OYJ A;  2ESW A;  1WHM A;  4KGZ B;  3OYN A;  2C0T A;  4LD9 K;  2EYZ A;  2QA4 T;  1QCF A;  3OSS C;  1YJN Q;  1YJ9 T;  2MCN A;  2RF0 A;  3PT9 A;  1PCX A;  2PUO B;  4R0K A;  3OYA A;  4X34 A;  2BUD A;  3PMT A;  2DTI A;  2YLB A;  4N0A A;  1TSF A;  2DL7 A;  4M77 G;  4RTZ A;  1VYU A;  2G6F X;  3VV0 A;  2QXF A;  2E41 A;  4OP0 A;  4C8Q E;  2HQH A;  1X2Q A;  1XJW B;  3RNJ A;  4QQG A;  1KC8 C;  4FW1 A;  1WZO A;  1IZ6 A;  2JTM A;  2AKL A;  2QTV A;  3JCM f;  4ZN3 A;  1I5L A;  3JB9 H;  5GAN g;  1M1K R;  4PJO E;  1N27 A;  1P92 A;  2WSC E;  1RAI B;  5CQY A;  4M78 A;  2DRK A;  2RQT A;  4N4I A;  3VU3 C;  3SDZ A;  4M78 B;  3VUB A;  5CVI A;  3BDL A;  2RM4 A;  1VQ6 T;  4LDY A;  1M4Z A;  4BDY A;  5GAN 2;  5HY6 A;  3BE3 A;  3G6E Q;  1VQM Q;  1DJ7 B;  4KGV B;  2FVU A;  2RN8 A;  4LDW A;  3HHT B;  1K4U S;  4QT7 A;  4CC2 A;  1VQ4 Q;  1VQ5 A;  2K4Y A;  3CPW S;  2WSF E;  4IIM A;  2DXC A;  2J05 A;  3TVT A;  1VQ7 T;  1BI3 A;  2J6K A;  3QHS A;  4TVR A;  2BE9 B;  2OJ2 A;  4C5E A;  4KRT A;  1W1F A;  5KE2 A;  3FDR A;  1OZ3 A;  1VQP A;  1KQS A;  2DVJ A;  4LNP A;  3HRS A;  2LJ1 A;  2PNI A;  4ZGE B;  2DO3 A;  4D6W A;  1E6H A;  2L8D A;  2DIG A;  1X75 C;  3I5S A;  3VRY A;  5GJV B;  5L8R E;  4AFZ C;  1QKX A;  3P8H A;  1NJI C;  2A37 A;  1T0J A;  1M1F A;  2O9S A;  1Q86 U;  1GCQ A;  2DXT A;  1N8R C;  3VYG A;  1U1T A;  5L23 A;  3C94 A;  4B9X A;  3OYB A;  2OTL A;  2NUP A;  2DD4 A;  2EGE A;  4E7J A;  4A63 B;  3CCL T;  2DEQ A;  5D6W A;  2NUP B;  1AOJ A;  1TXQ A;  4FSX A;  5GJW B;  2DX1 A;  2JMC A;  4GLK A;  1ZSZ A;  4XTZ A;  2M51 A;  1Q7Y C;  2JS0 A;  3OBW A;  2EYW A;  4F7U F;  2B8A A;  1ZSZ B;  1M30 A;  4HT9 A;  4ANJ A;  3OMG A;  3PIP A;  4MZT A;  1HXD A;  4PJJ A;  1H8K A;  2H3J A;  3G4S T;  2GFA A;  1K73 C;  5IXF A;  1M90 R;  2KRO A;  4NOY A;  1BI2 A;  4BDZ A;  1M3A A;  3AT1 B;  4QQD A;  2K7A A;  1D1C A;  5FU6 C;  2L2P A;  5GMK m;  4D8D A;  4XQ3 A;  1N6A A;  1VA7 A;  2DJQ A;  2CDT A;  3OS2 A;  4FIB A;  1N5Z A;  2QEX T;  1D0Y A;  2CT3 A;  3X24 B;  3M0Q A;  4PL6 A;  1VQK Q;  2MIO A;  2IVW A;  1UG1 A;  3MKD A;  4XU3 A;  1M1K U;  1AZE A;  1SKU B;  1AVZ C;  3M4G A;  1KK7 A;  2DZ9 A;  1K8A C;  1VQM A;  3G6E A;  2M02 A;  2QI2 A;  3EGX B;  2JMA A;  1SG5 A;  3OMC A;  1PKT A;  2CKK A;  1RAE B;  5GAM j;  1VQ4 A;  2DBK A;  4F7U G;  2HSE B;  2EBP A;  2RO0 A;  1JB0 E;  1VIF A;  2L3S A;  2DET A;  2DAQ A;  4HVW A;  3CBP A;  4C8Q F;  3JAM E;  4J6X A;  2JZ2 A;  5I21 A;  4ZGD B;  1UJY A;  1SSF A;  2DJZ A;  1U8R A;  2DXU A;  1R8O B;  3BDU A;  3RES A;  2DM1 A;  1OU9 A;  2EQK A;  1YNZ A;  2BTT A;  2LQN A;  4C92 C;  3EFR A;  3OS0 A;  4X1V A;  2LDM A;  2I2L A;  1ABO A;  1SHG A;  2GQI A;  5KYY A;  2PU9 B;  2F2V A;  5GAN d;  1MNE A;  4C0F A;  2X4X A;  5KYY B;  5LJ3 g;  3CCE T;  2XD0 A;  1IO6 A;  2MYS A;  2KMT A;  1BIB A;  1LCK A;  3OYI A;  2KT8 A;  2OX7 A;  3QKJ A;  3JCM J;  2XDB A;  4PFZ A;  1AWO A;  2DYI A;  3OA6 A;  2QQR A;  4KUI A;  4C0D B;  5J3B A;  1H64 1;  4C0G A;  4V2S A;  4Y92 A;  5CKB A;  1RAB B;  2ZCF B;  5KCH A;  2V1R A;  1SRL A;  2XU8 A;  2CYZ B;  1QVG S;  2RJD A;  1LVK A;  4FYX B;  3GNG A;  2DVE A;  3CCJ A;  2CP5 A;  1T3S A;  1SSH A;  1D1A A;  3QII A;  3SHW A;  4M7D C;  2RNA A;  2QG9 B;  3MHX A;  4EIK A;  3ER0 A;  2O31 A;  4L6V 5;  3CC7 T;  5GAN 6;  1M90 U;  4N4G A;  2EJF A;  4C8Q G;  1GCP A;  5I22 A;  3CME A;  1NG2 A;  3UAT A;  3TSW A;  5GAO l;  2EKH A;  4C8Q D;  1X6G A;  1KC8 R;  1WIE A;  3WVE B;  4PJO G;  1U1S A;  3V7C A;  2COW A;  4PJM A;  1GRI A;  2PZ1 A;  1BBZ A;  3CCQ Q;  1PWT A;  2AT1 B;  2A0F B;  1VQK A;  2HKN A;  2VB6 A;  3NTK A;  4N4H A;  3LH5 A;  4XTW A;  2JS2 A;  4RCB A;  3VS2 A;  1BI0 A;  3C95 A;  2E3H A;  1IB8 A;  2CUD A;  3I55 A;  2GTJ A;  4M7A F;  1I8F A;  2LCL A;  2V1Q A;  4J6Y A;  2RHU A;  2RJE A;  1PD0 A;  1FWZ A;  1JO8 A;  2EYX A;  4N0A C;  5AYF A;  4BB7 A;  2PVG B;  3ZL7 C;  2GFU A;  1PRL C;  4E7S A;  2RHX A;  2NYS A;  4QVZ A;  4RUG A;  2DBM A;  1R77 A;  2YWW A;  3FEO A;  1RI0 A;  1GBR A;  3OSV A;  3S3N A;  1UE9 A;  3TEE A;  2EQM A;  3OY9 A;  2VGN A;  4M78 C;  1M1G A;  1GL5 A;  2IIM A;  3NGP A;  1MGQ A;  1NJI R;  4PKC C;  4ZGJ B;  3JCM e;  1N8R R;  2P84 A;  1QVF P;  2LX7 A;  3RMS A;  1NLO C;  2O01 E;  4LXC A;  3CCU T;  2CT4 A;  1O9S A;  3I56 Q;  1Q86 R;  5J26 A;  1M3C A;  3H0I A;  2K2M A;  2E64 A;  2V26 A;  1OX9 A;  3LYI A;  1UUE A;  2K79 A;  3TCJ A;  1TUC A;  5AT1 B;  5A0L A;  3E9F A;  2GNC A;  1SPK A;  1TUG B;  3NPF A;  3EHR A;  3F70 A;  3CD6 Q;  1M3B A;  4OVA A;  3V7R A;  3RUX A;  4YTL A;  1K73 R;  2AK5 A;  2HMA A;  2X4J A;  2EQU A;  3OYG A;  2YHT A;  2LP5 A;  4OB3 B;  1GCQ C;  4M7A D;  5FWB A;  1K9M C;  4QW2 A;  2COZ A;  2A28 A;  5I11 A;  1WHH A;  1VQL A;  1T0H A;  1ZSZ C;  1WYX A;  3CCV T;  2QK0 A;  1RLQ C;  2FG0 A;  2KY9 A;  5IAY A;  3X26 B;  2CUB A;  4XU0 A;  4DBH A;  4OMO A;  3CCQ A;  3EGU A;  2FYK A;  5LJ3 d;  2IPO B;  2KNB B;  1VQ8 A;  1TTH B;  1MND A;  1VQN Q;  1S72 Q;  2CP2 A;  1AHJ B;  4BI4 A;  1T3L A;  3VYH B;  5GAN 8;  3OYK A;  2K3X A;  4IUR A;  1K8A R;  2EYQ A;  5GAM d;  3LGL A;  2O9V A;  2OTJ T;  4RTU A;  3P8D A;  1D09 B;  2G3R A;  4J9D A;  1M8V A;  3JCM X;  1UEB A;  4J5Y A;  2M16 A;  3L2Q A;  1D3B A;  1VUB A;  2KR3 A;  1FMK A;  1F1B B;  4XTY A;  4C92 E;  4OMQ A;  1D3B B;  1Q81 C;  3NHN A;  3E19 A;  1JXO A;  4FYY B;  1VQ5 Q;  2KEA A;  3GPL A;  1FYN A;  2BZ8 A;  2DTO A;  1YIT A;  1YJW Q;  2RHY A;  3QDF A;  2O88 A;  4PNO A;  3RKW A;  3MP6 A;  1YI2 Q;  3NTH A;  3O5Z A;  2LVM A;  1ABQ A;  3M54 A;  5A0D A;  3QJY A;  4WCI A;  3CEY A;  1VQP Q;  8AT1 B;  4LUE A;  2QQA A;  1NJI U;  1N9S A;  3J7A F;  5CQX A;  4F7U B;  1VIE A;  2KVQ G;  2RJC A;  3OQ5 A;  2JXB A;  1OPK A;  4ZNX A;  3QG1 A;  4JRK A;  2KXC A;  4KH0 B;  3UA6 A;  1KD1 R;  1YIJ A;  3U23 A;  3QO3 A;  1UGP B;  5GAN j;  2DER A;  4DA4 A;  3TQ7 P;  2V8I A;  4M7D E;  3CBM A;  2EYY A;  4CI0 C;  3CD6 A;  1W4S A;  3R6O A;  3DLL A;  2EIF A;  4KUL A;  4MML A;  3CC4 T;  1WXT A;  1SHF A;  3VUZ A;  1RL2 A;  3CCS A;  2QGG A;  1PHT A;  1V29 B;  1QVP A;  2X51 A;  1JEG A;  2CP7 A;  3N5B B;  2CH4 W;  2XG8 D;  3M56 A;  2XI9 A;  2E1H A;  3JCM g;  1ZUY A;  3S3O A;  2RH2 A;  2VYT A;  4C0D C;  3OYL A;  2FRW A;  3VS6 A;  3MPU B;  3CCU A;  2GCX A;  4BAC A;  2R5M A;  3H41 A;  4QVD A;  3JB9 J;  4ORZ A;  3GP8 A;  2MOX A;  2LQW A;  1OU8 A;  1VQN A;  2LMJ A;  5KYN A;  5LJ5 g;  1S72 A;  3HP9 A;  2D0Q B;  4J9I A;  3I5R A;  4M77 D;  4OMM A;  3EFO A;  2ABL A;  2A08 A;  4OB0 B;  3EFO B;  1NLP C;  4X9C A;  2LCC A;  4LDV A;  3CPF A;  3PVL A;  4C8Q A;  4JJC A;  1B34 A;  3VS3 A;  3EFS A;  3EH1 A;  4C8Q B;  1B34 B;  4DEY A;  2QGF B;  3FC3 A;  4M78 E;  2FZG B;  5C6S A;  5FRN A;  4OGC A;  3MEW A;  4QQ6 A;  1W70 A;  2SEM A;  1YJW A;  3J81 E;  4KT0 E;  1Q82 C;  3MCA B;  2RI2 A;  3L42 A;  1YI2 A;  2V8J A;  1UDL A;  4J9H A;  2QA4 Q;  1VQO A;  5EG2 A;  1VOM A;  3ZBD A;  2DMO A;  3G1J A;  4RG8 A;  4MDX A;  5ECA A;  1ZUU A;  3DKM A;  5D6X A;  2VC8 A;  1WFW A;  1ZBX A;  2NUZ A;  3G71 T;  1WJR A;  1UFF A;  2D8H A;  1OI1 A;  3RBB B;  1TH7 A;  2HCK A;  4FM4 B;  4J9C A;  5LJ3 h;  1LPL A;  2JVV A;  3QZ9 B;  3H9N A;  5GAO p;  3VRZ A;  2LQK A;  1A0N B;  2PVD B;  4FYV B;  4C92 F;  2E3I A;  1K1Z A;  1KD1 U;  2CGH A;  1VQ6 Q;  1QW1 A;  5GAM h;  3FRN A;  1WLP B;  3JV3 A;  4A4H A;  4E7I A;  3JCM P;  2QQS A;  3EG2 A;  4RG2 A;  3VKI A;  4JJD A;  2EWN A;  2JNG A;  2ENM A;  1B07 A;  1I81 A;  2WSE E;  1K9M R;  2BZX A;  3CC2 A;  2QDL A;  4NS5 A;  4AG2 C;  2F5T X;  1YHQ T;  2E10 A;  4RTV A;  3CCR T;  1W2B P;  3CMA T;  2NWM A;  3CCJ Q;  2ZPB B;  1LJO A;  3VJP A;  2DNU A;  3OS5 A;  2XID A;  4M7A A;  2KYB A;  3JCM c;  1ACM B;  2EGA A;  3A1P A;  4M7A B;  4HXJ A;  1QWE A;  5GAO n;  4FT2 A;  3CME Q;  3LW5 E;  2F2W A;  2KRM A;  2ATC B;  4XU1 A;  1QVF A;  1H92 A;  1YWO A;  3UF4 A;  4J6W A;  3CCL Q;  4M75 E;  3PNW C;  1GXI E;  2P0P A;  1NE8 A;  2J6O A;  2QTX A;  5LJ3 j;  1WJS A;  2HZY A;  4Z02 A;  5IH2 A;  5A2Q E;  2A36 A;  3EGX A;  2JM9 A;  4L5G A;  4C92 G;  1YBY A;  1WDX A;  2JJ9 A;  3OYC A;  3I55 Q;  4J9F A;  3MP1 A;  1B7T A;  2GBQ A;  4JS4 A;  2MF2 A;  1Q81 R;  5GMK l;  3G4S Q;  1PRM C;  3V8K A;  3OYD A;  4OMF B;  2XDP A;  1CKB A;  2FPE A;  2EFI A;  3M0U A;  3M5A A;  4DOW A;  2SRC A;  2QA4 A;  1JU5 C;  1YJ9 A;  1KQS S;  2KDS A;  2R5A A;  1B3Q A;  2YRV A;  3NTI A;  3BW1 A;  4OF1 A;  2ECZ A;  5IXB A;  1N9R A;  2MPX C;  2HSP A;  3M0P A;  4PJO F;  5LJ5 d;  2JTE A;  5GAO r;  4Z89 A;  2L89 A;  3RKX A;  5GAO q;  1AEY A;  3IQL A;  4M78 F;  2ZPI B;  2K3B A;  5D6Y A;  4M7D G;  4QKU A;  5KH6 A;  4E7Z A;  4A4F A;  1Y96 A;  3JCM V;  4OMN A;  5IHK A;  1VQ6 A;  4FW2 A;  3CBO A;  1Y96 B;  3I9Q A;  1QKW A;  4A53 A;  4FSS A;  3EAE A;  2H3E B;  2DXB A;  4DBR A;  4Z88 A;  3THK A;  5HK3 A;  3EG9 A;  1J3T A;  3KXT A;  1UEC A;  3A8H B;  3RMQ A;  4F14 A;  2DZC A;  3EG9 B;  1V76 A;  1VQ7 A;  2OAU A;  2KRS A;  1GFC A;  1SF9 A;  3QJ6 A;  2MWO A;  1WXU A;  1PD1 A;  3HPW A;  2CSQ A;  2KGT A;  3GIB A;  2DK3 A;  2HDA A;  1JJ2 P;  5A0G A;  3C12 A;  1VQ9 T;  4AT1 B;  2L0A A;  2YLC A;  1YFN A;  9ATC B;  2DE0 X;  4VUB A;  1CKA A;  1YWP A;  2DL8 A;  4PJN A;  3CCM T;  1VQL Q;  5LJ3 f;  1QVF S;  2FZK B;  2VAS A;  1M8M A;  3EG0 A;  1EX4 A;  3CCE Q;  3CCL A;  3ASK A;  1BIA A;  3A8G B;  4ESR A;  4PJO D;  1MMG A;  2LNV A;  3M55 A;  1VQ8 Q;  4OMP A;  1HYO A;  1OOT A;  1MV3 A;  1PC0 A;  4M78 G;  4RCC A;  5GAM f;  2VGM A;  3GLX A;  3S3M A;  3QYG B;  3CQT A;  4XTV A;  3M0S A;  2BZY A;  1K9A A;  4HA8 A;  1MHN A;  3SWN A;  3L2V A;  4M77 A;  2AIR B;  4MDW A;  1YHQ A;  3G4S A;  5KYX A;  2YXY A;  3SWN B;  2KQW A;  3I56 T;  2KAF A;  4M77 B;  1M5Q 1;  1G5V A;  5KYX B;  2K9G A;  3MP8 A;  1Q82 R;  4M4Z A;  2PVO B;  2EJG A;  2E4H A;  1EFN A;  2RK2 A;  1TS9 A;  4L59 A;  1WJQ A;  3ULR B;  3LWI A;  1BU1 A;  2AZS A;  1MMD A;  2LNH B;  1M1K C;  2VKN A;  3LX7 A;  3QSU A;  2BIV A;  1UGS B;  2ROT A;  4C8Q C;  4MMK A;  2JT4 A;  1NBE B;  1YCS B;  1YIT Q;  2RHI A;  2C06 A;  4M75 F;  1UB4 A;  2DL5 A;  2HQE A;  2NUT A;  2QYZ A;  2QEX A;  3M0R A;  2NUT B;  3OS1 A;  5IN1 A;  4CC3 A;  2FRY A;  3L1A A;  4LDU A;  1LNX A;  2P4R A;  2ZZD A;  2J6F A;  3V7S A;  5M9O A;  1UGQ B;  2P0K A;  1G3S A;  1I07 A;  1Q7Y R;  1XTD A;  3EG3 A;  1YIJ Q;  3OYF A;  2CSI A;  2ZPE B;  2JN0 A;  4LE9 A;  5DY9 A;  3UT1 A;  2E70 A;  3E9G A;  5IT9 E;  3QXE B;  2YRC A;  2E12 A;  4A4G A;  3CCS Q;  4J9B A;  3JB9 F;  3JCM W;  2F69 A;  4E7H A;  2DYB A;  2RPN A;  3S6W A;  5GAN e;  2P4T A;  2RI3 A;  1X6O A;  3CXC P;  3FJP A;  1WNL A;  2RJF A;  3TSZ A;  2R58 A;  3L2U A;  3CCU Q;  1C1A A;  4M75 G;  1WX6 A;  5LJ5 h;  4AFS C;  3CCE A;  4JLG A;  1H3Z A;  4OML A;  4IUQ A;  4HT8 A;  1X27 A;  4J7F A;  4M75 D;  1KC8 U;  3DLM A;  2ZAE A;  2HAX A;  4PFP A;  5GAN h;  4AMC A;  4RMO A;  4P5N A;  4R56 A;  1M90 C;  2LX9 A;  2E6N A;  2RQU A;  2LJ0 A;  3NMZ C;  4RTY A;  2XMF A;  3Q1J A;  1VQP T;  3QYH B;  4B9W A;  1Q95 G;  4J9E A;  1CSK A;  1PKS A;  4M7A C;  3GBQ A;  5DLQ E;  2DKG A;  2KXD A;  3OW2 P;  2EPD A;  2QDY B;  5LL6 S;  2IG0 A;  1W6X A;  3UWN A;  5CKH A;  5FLX E;  1UGR B;  2HQX A;  3CC7 A;  4FCY A;  1WGS A;  2XK0 A;  2D8J A;  3SB2 A;  1TG0 A;  4JPB W;  2OTL T;  2M0O A;  1OYX A;  1W2B A;  2K5I A;  3CCV Q;  1RAD B;  1VQO Q;  3JB9 G;  2F1L A;  3MEU A;  4BE1 A;  1ZUK A;  2RQW A;  3EHQ A;  1M27 C;  5HKC A;  3QUI A;  1XQH A;  4LN2 A;  3JB9 D;  1EIF A;  3PIO A;  4F7U A;  3BY7 A;  1N8R U;  2Y4Y A;  5CKE A;  3BFM A;  3URG A;  4D8K A;  5CK9 A;  5LJ5 j;  1HD3 A;  1MMA A;  4C5I A;  5GAN 4;  1E7O A;  1XNI A;  3PMI A;  4DQ2 A;  4HCB A;  1YJN T;  3X25 B;  2OTJ Q;  1MUZ A;  3AHU A;  1MV0 B;  1ZX6 A;  1Q7Y U;  1D0Z A;  3HKS A;  3KFV A;  4PJL A;  4C5H A;  4OB1 B;  1KFZ A;  1VYT A;  4ZTF A;  1U5S A;  4KBM B;  2O4X A;  3NFC A;  3TRE A;  2LC4 A;  2RB6 A;  2EQJ A;  5FRM A;  2O4X B;  5GMK h;  4RKU E;  5CKD A;  3C4S A;  2KRN A;  1K73 U;  2YSQ A;  2CP0 A;  3CC2 Q;  1GBQ A;  2FPD A;  4FL6 A;  3FLG A;  2RD1 A;  4ELZ C;  4HVU A;  3MEV A;  2JW4 A;  1IHW A;  2ED0 A;  4E2F B;  3FJ5 A;  4JJN K;  2VUB A;  2DIL A;  5KYU B;  4F16 A;  2DL3 A;  1IXD A;  1FX7 A;  3LGF A;  2KBT A;  1VQM T;  3QBY A;  4F04 B;  3G6E T;  1BB9 A;  3M53 A;  1RAH B;  2MWP A;  1VQ4 T;  2LZ6 B;  1RAC B;  2ED1 A;  2AZV A;  2JUF A;  4FT4 A;  4JJB A;  2NLU A;  2YUO A;  2CZ6 B;  4XK8 E;  5D7U A;  2HL5 C;  1QLY A;  4WTO B;  1TUD A;  2PUK B;  2LQ8 A;  3QZ5 B;  3LLR A;  1K8A U;  5GAN 5;  3CC4 Q;  2DL4 A;  1JRI A;  4HKE A;  1Y57 A;  4JRI A;  2K2V A;  4J9G A;  2RHZ A;  4KH1 B;  4PJO A;  4GY5 A;  2JOY A;  2V8K A;  2E6Z A;  2L3P A;  2CH4 A;  2HEQ A;  3OYM A;  1WHJ A;  2AHJ B;  4PJO B;  1NEB A;  2CS7 A;  2X3X D;  1ZHI A;  3RDV A;  3RKY A;  2EJ9 A;  2QAZ A;  4OGE A;  1YP5 A;  1ZBJ A;  1W2B S;  3PFS A;  4BY6 B;  3R6N A;  2YT6 A;  3X28 B;  5GMK j;  3CCV A;  5LJ3 e;  1YJ9 Q;  4JZ4 A;  1QWF A;  4R55 A;  1AWW A;  5HK0 A;  4BI3 A;  3EG1 A;  3M57 A;  5LJ5 f;  4FU6 A;  1FMV A;  2KT1 A;  1KG1 A;  3A8M B;  4JRP A;  3VS7 A;  1NYF A;  2KE9 A;  3SWN C;  4O5V A;  4DBF A;  1JJ2 A;  4M77 C;  1Y07 A;  2H8H A;  3MJX A;  5I2S A;  1K76 A;  4BUG A;  5GAM e;  2ZPH B;  4JDS A;  5GAN f;  2J06 A;  2DA9 A;  3J80 E;  3OB9 A;  2XKO C;  2B86 A;  1RLP C;  4XTX A;  3CCJ T;  1G3W A;  4BE2 A;  2OTJ A;  3P8B B;  2F5K A;  2COY A;  3L2R A;  1RAG B;  2DEU A;  2RQV A;  4LD6 A;  2M0Y A;  3KBG A;  4XTU A;  4RTW A;  3HL8 A;  4PLL A;  3CME T;  1PNJ A;  4PFO A;  2LRQ A;  1QCN A;  1GFD A;  5KYW A;  1VQ7 Q;  5IHI A;  2AKK A;  3FB9 A;  2MMP A;  1QCO A;  1SEM A;  5KYW B;  3A98 A;  1VQK T;  4BD3 A;  2JTF A;  5GAN 7;  1BYM A;  2EQI A;  4CRI A;  1H3H A;  4IKF A;  4EMK A;  1LOJ A;  3UDC A;  1R0C B;  1RUW A;  4EMK B;  4EDU A;  4PLI A;  3I55 T;  3G71 Q;  3OBY A;  3GOX A;  2QAS A;  1I0C A;  4O6J A;  3KUF A;  3CPW P;  5FU7 C;  5FRO A;  2VVK A;  4M7D F;  2DD5 A;  3E2U A;  4M7A E;  1YJN A;  1QVG A;  2DPP B;  4JLI A;  1M2O A;  1Y71 A;  4II1 A;  1PSE A;  1R0B G;  1NM7 A;  2XIC A;  1Z9Z A;  1BI1 A;  3CC4 A;  4A4K A;  1UGV A;  2C0O A;  4XAX B;  4EMG A;  1YN8 A;  4JUV A;  3MO8 A;  3SD4 A;  4M75 A;  1I5O B;  4AFU C;  3PVQ A;  1OV3 A;  4M75 B;  1MMN A;  5CKF A;  2CP3 A;  2BKD N;  4C92 D;  1D1B A;  4B6M A;  2MAM A;  1YHQ Q;  1NZ9 A;  3JB9 I;  3CCR Q;  4LDX A;  3JCM d;  3CMA Q;  2L5Q A;  3T9N A;  2FB7 A;  2YDL A;  5HCK A;  1E6G A;  4UC4 A;  5CR2 A;  3PGG A;  2HBP A;  3OYH A;  3VS0 A;  1OX8 A;  2GF7 A;  1ZQ1 A;  1ARK A;  3H8Z A;  1JJ2 S;  1WPY A;  4RTX A;  2FL7 A;  3ME9 A;  1JQQ A;  1G83 A;  2K5L A;  3GF5 A;  1RAA B;  3CXC A;  2LT4 A;  2PQW A;  5DM7 R;  4E7L A;  4E7K A;  3M59 A;  2L3Q A;  1Z9Q A;  2QEX Q;  3RIR A;  4NL3 A;  1BK2 A;  1VYV A;  4ZTJ A;  2LTO A;  3RER A;  4M7D D;  2EAY A;  4Y91 A;  4JZ3 A;  4J7I A;  3M0T A;  3WVD B;  2O2O A;  1VQL T;  1PM3 A;  3O8V A;  2X35 A;  1JBM A;  1KSW A;  3REB B;  4BE0 A;  4DEX A;  1Q86 C;  1OQK A;  3GNF B;  3EH2 A;  3CCQ T;  4EPC A;  2D9T A;  3L2W A;  1M9S A;  4FYW B;  4ATO A;  1K9M U;  1VQ8 T;  1S1N A;  2I0N A;  1X69 A;  3OW2 A;  1C0M A;  1TOV A;  1WA7 A;  2EVR A;  5GAN 3;  2A3L A;  3HFN A;  2X4W A;  1KD1 C;  3DB4 A;  2ZPF B;  2LCS A;  5GAO m;  4KGX B;  5GAM g;  4CC7 A;  1NEG A;  1TU0 B;  2YUN A;  2Y90 A;  3G71 A;  5CCA A;  5C0M A;  1Y0M A;  2JM8 A;  3HTR A;  2CZ0 B;  2QQ9 A;  3REA B;  1FMW A;  2A7Y A;  1AWX A;  7AT1 B;  2X9H A;  2FZC B;  3RR6 A;  4ELY C;  1KQS P;  4Y28 E;  3OYY A;  2PTK A;  3HRT A;  4BI8 B;  1WHK A;  3ZFJ A;  3QDR B;  4EMH A;  1OPL A;  3EGD A;  1WHL A;  1YIT T;  1ZLM A;  2FHD A;  1D0X A;  1KQ1 A;  1RI9 A;  3EGD B;  4M78 D;  1BKB A;  2CP6 A;  1YCY A;  3M4Y A;  4LUD A;  1QP2 A;  2EKO A;  3V8L A;  3CCR A;  2P0Q A;  3CMA A;  4M77 E;  2DF6 A;  3JSC A;  1U3O A;  3A5Z B;  3A8L B;  1Q81 U;  1X6B A;  2DIQ A;  4DBQ A;  3JCM Q;  1KIK A;  4HCZ A;  1ZSG A;  2HNI A;  3CC7 Q;  1K0S A;  5I2M A;  1X43 A;  2KSS A;  1VQ9 Q;  1IGU A;  1QQJ A;  1YIJ T;  2E5Q A;  3M9Q A;  5DLO A;  4J8O A;  3CXC S;  6AT1 B;  2LT1 A;  2GQV A;  2L3R A;  1ZA1 B;  3CCM Q;  1WHG A;  3H0F A;  3CD6 T;  4QVC A;  2ROL A;  1BCM A;  4IUP A;  3MET A;  1Y7X A;  1QVG P;  4PJO C;  3PTA A;  1C6V X;  3CCS T;  4WF2 A;  4BY6 C;  4C5G A;  2EW3 A;  1K0X A;  1ZA2 B;  2D1X A;  2ZGW A;  4K11 A;  5J39 A;  3E1S A;  4ZN1 A;  2RA2 A;  1PG5 B;  2OI3 A;  1FXX A;  4IIO A;  1RAF B;  4J83 A;  5GMK i;  1QP3 A;  3LWH A;  5IHN A;  3LH0 A;  2YUQ A;  1KHC A;  3G7Z A;  3QPH A;  2X4Y A;  4IUU A;  3JRZ A;  3OW2 S;  3A8O B;  3QWX X;  1VQN T;  2RMO A;  3MEA A;  5FU7 B;  1HJD A;  2DTH A;  1S72 T;  2MI6 A;  2K5F A;  5LJ5 e;  4GLM A;  4XU2 A;  1KJW A;  3JCM h;  3INZ A;  1IRE B;  2KK4 A;  3DB3 A;  5CAI A;  2FPF A;  3C0C A;  2RK1 A;  1U06 A;  1IHV A;  2MK5 A;  5FU6 B;  4M7A G;  4E6R A;  2VWF A;  5CO7 A;  2ZPG B;  1G8X A;  1AZG B;  2VXE A;  2DRM A;  3OYE A;  1JXM A;  2HD0 A;  2W10 A;  2Y4X A;  2C0I A;  4C0Z A;  1G2B A;  3PE0 A;  1VQ5 T;  3M58 A;  1I1J A;  1PSF A;  1YJW T;  2DLP A;  1OZ2 A;  2K6D A;  2YUP A;  2F2X A;  2J7I A;  4GBQ A;  5FWC A;  1YI2 T;  2R57 A;  3VS5 A;  2M1H A;  1VQO T;  2D6F A;  2LJ3 A;  1G3T A;  3VS1 A;  4EMK C;  4JRQ A;  4IUV A;  2K3Y A;  3HRU A;  1I4K 1;  2CZ1 B;  4HCC A;  3I35 A;  1OUL A;  1KQ2 A;  2X3W D;  2BE7 D;  5CIU A;  1M2V A;  1M2V B;  8ATC B;  2K57 A;  1WXB A;  1IGQ A;  1Q82 U;  1WQ7 A;  3H6Z A;  4AG1 C;  2XHC A;  1NPR A;  1VQ9 A;  3QWY A;  4HCK A;  1O75 A;  1HSQ A;  2D0N A;  4A54 A;  4ME7 A;  4E47 A;  3UPU A;  3CCM A;  2Z0W A;  1WI7 A;  1WQW A;  4Z8A A;  4C92 A;  2WAC A;  4C92 B;  4M75 C;  4CC4 B;  1UHC A;  2M9U A;  1NPP A;  2XDD A;  4RTT A;  1HK9 A;  4IUT A;  2QQB A;  5FW9 A;  4KUD K;  2FEI A;  3JCM b;  3WXM B;  2RQR A;  2HBW A;  5KE3 A;  3CC2 T;  3CPW A;  4F7U E;  1X2K A;  2RI5 A;  2E5K A;  4OB2 B;  2GGR A;  4HVV A;  3ZEH A;  1AWJ A;  3TU4 K;  4M77 F;  1TWB A;  5GMK e;  4PK4 A;  2KYM A;  3D7S B;  4JS5 A;  2HKQ B;  3I56 A;  1XOV A;  1V1C A;  2GTO A;  4AFQ C;  5EC7 A;  1G3Y A; 
#chains in the Genus database with same CATH homology
 3HFO A;  1Y96 A;  2E64 A;  3JCM V;  1VQ6 A;  1X01 A;  3L2R A;  3CBO A;  1Y96 B;  4MZM A;  3LYI A;  4X9D A;  4A53 A;  4LD6 A;  3KBG A;  4XTU A;  3TCJ A;  3EAE A;  3V8J A;  3HL8 A;  4PLL A;  3CME T;  2DXB A;  5HK3 A;  2CZ7 B;  3A8H B;  2VXF A;  3X20 B;  3KXT A;  4M7D A;  2LRQ A;  3RMQ A;  4MZP A;  2DZC A;  4A4E A;  5A0L A;  3E9F A;  5GMK h;  4M7D B;  1VQ7 A;  4NL2 A;  2OAU A;  4DOV A;  3FB9 A;  2MMP A;  3F70 A;  3L2Z A;  3SFM A;  4OVA A;  3V7R A;  1KHI A;  2MWO A;  2E65 A;  3QJ6 A;  3RUX A;  1VQK T;  4YTL A;  4BD3 A;  2JTF A;  2X4J A;  5GAN 7;  2EQU A;  1BYM A;  3OYG A;  2YHT A;  4CRI A;  3HPW A;  5KCO A;  4OB3 B;  4IKF A;  4Q5W A;  4EMK A;  4M7A D;  1LOJ A;  3UDC A;  1K9M C;  4QW2 A;  4EMK B;  4EDU A;  2DK3 A;  4PLI A;  3FIF A;  3GIB A;  3I55 T;  3OBY A;  3HSB A;  5A0G A;  3GOX A;  2VV5 A;  3C12 A;  4O6J A;  3JCM P;  1VQ9 T;  2YLC A;  4VUB A;  3KUF A;  5FU7 C;  3OYJ A;  5FRO A;  3OYN A;  4M7D F;  1VQL A;  4LD9 K;  3CCM T;  2DD5 A;  4M7A E;  5LJ3 f;  2QA4 T;  1QVF S;  3CCV T;  1YJN A;  3OSS C;  1QVG A;  1YJ9 T;  2DPP B;  4JLI A;  2KY9 A;  3PT9 A;  5IAY A;  3X26 B;  1Y71 A;  4XU0 A;  4II1 A;  1PSE A;  3CCL A;  3ASK A;  2XIC A;  3CCQ A;  1BIA A;  2PUO B;  3A8G B;  3OYA A;  4X34 A;  2BUD A;  3PMT A;  2DTI A;  2FYK A;  2YLB A;  5LJ3 d;  4PJO D;  4M77 G;  4N0A A;  2LNV A;  1VQ8 A;  1BI1 A;  3M55 A;  3CC4 A;  3VV0 A;  4A4K A;  2QXF A;  2E41 A;  4M78 G;  4RCC A;  4OP0 A;  4XAX B;  2VGM A;  4C8Q E;  3GLX A;  4JUV A;  4EMG A;  1AHJ B;  5GAM f;  3QYG B;  3S3M A;  4BI4 A;  3MO8 A;  3SD4 A;  3VYH B;  4XTV A;  4M75 A;  4QQG A;  5GAN 8;  1KC8 C;  3OYK A;  2K3X A;  4IUR A;  1IZ6 A;  2JTM A;  4HA8 A;  3JCM f;  4ZN3 A;  2EYQ A;  4M75 B;  1MHN A;  5CKF A;  3SWN A;  5GAM d;  1I5L A;  5GAN g;  3LGL A;  3L2V A;  2BKD N;  4M77 A;  4C92 D;  4PJO E;  4MDW A;  1N27 A;  1YHQ A;  1P92 A;  2MAM A;  2WSC E;  3G4S A;  2OTJ T;  1NZ9 A;  3JB9 I;  5CQY A;  4M78 A;  3SWN B;  3P8D A;  2G3R A;  2KQW A;  3I56 T;  2KAF A;  4M77 B;  4LDX A;  1M5Q 1;  4N4I A;  3VU3 C;  1G5V A;  3JCM d;  3MP8 A;  3SDZ A;  2L5Q A;  2PVO B;  2EJG A;  2FB7 A;  4M78 B;  3T9N A;  3VUB A;  1UEB A;  4UC4 A;  3BDL A;  4J5Y A;  5CVI A;  2RM4 A;  3JCM X;  1M8V A;  5CR2 A;  2RK2 A;  2M16 A;  4LDY A;  3L2Q A;  1M4Z A;  1VQ6 T;  3JB9 H;  3PGG A;  2HBP A;  1D3B A;  4BDY A;  5GAN 2;  3OYH A;  1VUB A;  5HY6 A;  2GF7 A;  1ZQ1 A;  4L59 A;  4XTY A;  4C92 E;  1WJQ A;  3LWI A;  1DJ7 B;  1D3B B;  3H8Z A;  1JJ2 S;  1M1K C;  3LX7 A;  2FVU A;  4LDW A;  1WPY A;  3HHT B;  1Q81 C;  3QSU A;  3E19 A;  2BIV A;  2FL7 A;  1VQ5 A;  1UGS B;  2K4Y A;  3ME9 A;  4C8Q C;  4MMK A;  3GPL A;  3CPW S;  2WSF E;  2DTO A;  1YIT A;  2DXC A;  2RHI A;  1VQ7 T;  2RHY A;  4M75 F;  2C06 A;  1BI3 A;  1UB4 A;  4PNO A;  3QHS A;  3RKW A;  3MP6 A;  4TVR A;  2K5L A;  3GF5 A;  3NTH A;  3CXC A;  4C5E A;  2LT4 A;  2LVM A;  2PQW A;  5DM7 R;  2HQE A;  4E7K A;  4E7L A;  5KE2 A;  3FDR A;  3M54 A;  3M59 A;  5A0D A;  3QJY A;  1OZ3 A;  1VQP A;  1KQS A;  3CEY A;  2QEX A;  3HRS A;  3RIR A;  3OS1 A;  5IN1 A;  4NL3 A;  4ZGE B;  2DO3 A;  3L1A A;  4LDU A;  2QQA A;  1NJI U;  1LNX A;  4D6W A;  1N9S A;  2L8D A;  2ZZD A;  2DIG A;  3J7A F;  5CQX A;  4F7U B;  1X75 C;  3V7S A;  5M9O A;  1VIE A;  2KVQ G;  2RJC A;  4ZTJ A;  3OQ5 A;  1UGQ B;  2LTO A;  3RER A;  5L8R E;  4M7D D;  2EAY A;  2P0K A;  3P8H A;  4Y91 A;  1G3S A;  1NJI C;  4J7I A;  3QG1 A;  1M1F A;  1Q86 U;  2DXT A;  1XTD A;  4JRK A;  3VYG A;  3WVD B;  1N8R C;  1U1T A;  1VQL T;  3O8V A;  2X35 A;  1YIJ A;  3C94 A;  3OYF A;  1JBM A;  4B9X A;  3OYB A;  4BE0 A;  2ZPE B;  1UGP B;  3QO3 A;  2JN0 A;  2OTL A;  2DD4 A;  5GAN j;  1Q86 C;  4DA4 A;  4E7J A;  2V8I A;  3CCL T;  3GNF B;  4M7D E;  3CBM A;  4CI0 C;  3CCQ T;  3CD6 A;  2DEQ A;  2D9T A;  5D6W A;  1M9S A;  4EPC A;  3L2W A;  1W4S A;  4ATO A;  5DY9 A;  3R6O A;  3UT1 A;  3DLL A;  4FSX A;  2E70 A;  2EIF A;  3E9G A;  4KUL A;  1K9M U;  1VQ8 T;  4GLK A;  4XTZ A;  5IT9 E;  3OW2 A;  4MML A;  3CC4 T;  1Q7Y C;  3OBW A;  4F7U F;  5GAN 3;  3QXE B;  2A3L A;  2B8A A;  3VUZ A;  3HFN A;  2E12 A;  1RL2 A;  2X4W A;  3CCS A;  4A4G A;  1KD1 C;  4HT9 A;  3DB4 A;  2ZPF B;  5GAO m;  3OMG A;  1V29 B;  5GAM g;  1QVP A;  3PIP A;  2Y90 A;  4MZT A;  3JB9 F;  3G71 A;  1HXD A;  5CCA A;  3JCM W;  5C0M A;  2F69 A;  2H3J A;  3N5B B;  4E7H A;  2XG8 D;  2CZ0 B;  2QQ9 A;  2XI9 A;  2E1H A;  3M56 A;  3S6W A;  3G4S T;  2GFA A;  3JCM g;  5GAN e;  4KUD K;  2P4T A;  2RI3 A;  1K73 C;  2A7Y A;  3S3O A;  1X6O A;  2RH2 A;  2VYT A;  4C0D C;  3OYL A;  3FJP A;  1WNL A;  2RJF A;  4ELY C;  3CCU A;  2GCX A;  2R58 A;  4NOY A;  4Y28 E;  3L2U A;  4BAC A;  3OYY A;  1BI2 A;  4M75 G;  2R5M A;  3HRT A;  5LJ5 h;  4BDZ A;  3CCE A;  4QVD A;  4JLG A;  4QQD A;  4BI8 B;  1H3Z A;  4IUQ A;  3JB9 J;  4HT8 A;  3GP8 A;  4J7F A;  3ZFJ A;  4M75 D;  1KC8 U;  3QDR B;  5FU6 C;  3DLM A;  1VQN A;  4EMH A;  5LJ5 g;  1S72 A;  2HAX A;  1YIT T;  3HP9 A;  5GMK m;  2FHD A;  2D0Q B;  5GAN h;  1KQ1 A;  4M77 D;  4XQ3 A;  4RMO A;  4P5N A;  4R56 A;  1M90 C;  1N6A A;  2LX9 A;  4M78 D;  2E6N A;  1BKB A;  1YCY A;  3Q1J A;  3M4Y A;  4OB0 B;  3OS2 A;  4FIB A;  1VQP T;  4X9C A;  1QP2 A;  2EKO A;  2LCC A;  3QYH B;  4LDV A;  4B9W A;  3CPF A;  2QEX T;  3X24 B;  4C8Q A;  1B34 A;  3V8L A;  3EFS A;  3CCR A;  2P0Q A;  4PL6 A;  2IVW A;  4M7A C;  4C8Q B;  3CMA A;  4M77 E;  1B34 B;  5DLQ E;  3JSC A;  4XU3 A;  3FC3 A;  2DKG A;  3A5Z B;  1M1K U;  3A8L B;  4M78 E;  1Q81 U;  2QDY B;  5LL6 S;  2IG0 A;  5C6S A;  3M4G A;  3UWN A;  2DIQ A;  5CKH A;  4OGC A;  3JCM Q;  2DZ9 A;  5FRN A;  3MEW A;  4QQ6 A;  1K8A C;  4HCZ A;  3G6E A;  1VQM A;  2QI2 A;  5FLX E;  2HNI A;  1UGR B;  2HQX A;  3CC7 A;  5I2M A;  3OMC A;  1WGS A;  2CKK A;  2KSS A;  2XK0 A;  5GAM j;  1VQ4 A;  1YIJ T;  2E5Q A;  3SB2 A;  3M9Q A;  5DLO A;  4J8O A;  4F7U G;  1YJW A;  3J81 E;  2OTL T;  2M0O A;  4KT0 E;  3CXC S;  1Q82 C;  2LT1 A;  1OYX A;  2GQV A;  2L3R A;  2RI2 A;  3L42 A;  3MCA B;  1YI2 A;  2K5I A;  2V8J A;  4QVC A;  1W2B A;  4IUP A;  3CD6 T;  2RO0 A;  5EG2 A;  1JB0 E;  1VIF A;  3MET A;  3ZBD A;  1VQO A;  3JB9 G;  1Y7X A;  2DAQ A;  3MEU A;  4BE1 A;  4C8Q F;  3CBP A;  4PJO C;  3JAM E;  4J6X A;  5HKC A;  4RG8 A;  2JZ2 A;  3PTA A;  5I21 A;  4ZGD B;  3QUI A;  1XQH A;  3JB9 D;  4MDX A;  1EIF A;  3PIO A;  3CCS T;  1SSF A;  2DJZ A;  4F7U A;  1U8R A;  2DXU A;  1R8O B;  4WF2 A;  3BDU A;  3BY7 A;  3DKM A;  4BY6 C;  5D6X A;  2VC8 A;  3RES A;  1N8R U;  1ZBX A;  4C5G A;  3G71 T;  2Y4Y A;  1WJR A;  2EQK A;  5CKE A;  3BFM A;  3URG A;  5CK9 A;  2ZGW A;  5J39 A;  1OI1 A;  3E1S A;  5LJ5 j;  4ZN1 A;  1TH7 A;  4C92 C;  3EFR A;  4C5I A;  2RA2 A;  5GAN 4;  3OS0 A;  4FM4 B;  2LDM A;  1XNI A;  3PMI A;  2I2L A;  4DQ2 A;  5LJ3 h;  2JVV A;  1FXX A;  3QZ9 B;  5GAO p;  4J83 A;  4HCB A;  2LQK A;  5GMK i;  1QP3 A;  3X25 B;  1YJN T;  2PU9 B;  2PVD B;  5GAN d;  3LWH A;  4C0F A;  3LH0 A;  3AHU A;  2X4X A;  1Q7Y U;  3G7Z A;  1KHC A;  4C92 F;  5LJ3 g;  3HKS A;  3CCE T;  3QPH A;  2XD0 A;  2X4Y A;  2KMT A;  1BIB A;  1KD1 U;  4IUU A;  2CGH A;  3JRZ A;  4C5H A;  4OB1 B;  3OYI A;  3OW2 S;  3A8O B;  3QKJ A;  1QW1 A;  3JCM J;  2XDB A;  5GAM h;  1VQN T;  3FRN A;  3MEA A;  5FU7 B;  2DTH A;  4KBM B;  4ZTF A;  1S72 T;  2O4X A;  4A4H A;  3NFC A;  2MI6 A;  4E7I A;  3TRE A;  2K5F A;  2LC4 A;  2RB6 A;  2QQS A;  5LJ5 e;  3OA6 A;  2QQR A;  2EQJ A;  4KUI A;  4RG2 A;  4C0D B;  2O4X B;  5FRM A;  3VKI A;  4RKU E;  2EWN A;  2JNG A;  2WSE E;  4XU2 A;  3C4S A;  1I81 A;  3INZ A;  5J3B A;  1H64 1;  1IRE B;  3JCM h;  5CKD A;  2KK4 A;  1K73 U;  4C0G A;  3CC2 A;  4V2S A;  3DB3 A;  5CAI A;  4NS5 A;  4FL6 A;  2F5T X;  5CKB A;  3FLG A;  2RD1 A;  1YHQ T;  2RK1 A;  2E10 A;  2ZCF B;  4ELZ C;  5KCH A;  5FU6 B;  3CCR T;  4M7A G;  3MEV A;  2XU8 A;  3CMA T;  2CYZ B;  1QVG S;  2RJD A;  3GNG A;  2DVE A;  4JJN K;  2VUB A;  3CCJ A;  5CO7 A;  2ZPB B;  2ZPG B;  1LJO A;  2VXE A;  3QII A;  3OYE A;  3VJP A;  4M7D C;  1FX7 A;  3MHX A;  3LGF A;  1VQM T;  2HD0 A;  2Y4X A;  3QBY A;  3G6E T;  3ER0 A;  4C0Z A;  3M53 A;  2XID A;  3OS5 A;  4L6V 5;  3CC7 T;  5GAN 6;  1M90 U;  4N4G A;  2MWP A;  4M7A A;  1VQ4 T;  1VQ5 T;  2EJF A;  4C8Q G;  3M58 A;  3JCM c;  1PSF A;  1YJW T;  4M7A B;  2JUF A;  4FT4 A;  3CME A;  2NLU A;  5GAO n;  5GAO l;  1OZ2 A;  4FT2 A;  3LW5 E;  2CZ6 B;  4XK8 E;  4C8Q D;  1YI2 T;  2R57 A;  1VQO T;  2M1H A;  2D6F A;  1G3T A;  4XU1 A;  1QVF A;  4EMK C;  3WVE B;  4JRQ A;  4PJO G;  1U1S A;  2PUK B;  4IUV A;  4J6W A;  3V7C A;  2K3Y A;  2LQ8 A;  3HRU A;  4M75 E;  1I4K 1;  2CZ1 B;  3PNW C;  4HCC A;  1GXI E;  2P0P A;  3QZ5 B;  3LLR A;  1KQ2 A;  1NE8 A;  1VQK A;  5LJ3 j;  2QTX A;  1K8A U;  5CIU A;  5GAN 5;  3NTK A;  1WJS A;  1JRI A;  4N4H A;  4XTW A;  4HKE A;  4Z02 A;  5A2Q E;  4RCB A;  4JRI A;  2K2V A;  1BI0 A;  2K57 A;  2RHZ A;  4PJO A;  4L5G A;  4GY5 A;  4C92 G;  3C95 A;  1YBY A;  2JOY A;  2V8K A;  2E6Z A;  3I55 A;  3OYC A;  1Q82 U;  1WQ7 A;  4M7A F;  3OYM A;  1I8F A;  2AHJ B;  3H6Z A;  3MP1 A;  2CS7 A;  2XHC A;  4PJO B;  1ZHI A;  2LCL A;  1NPR A;  3RKY A;  4J6Y A;  2MF2 A;  2RHU A;  4JS4 A;  1VQ9 A;  2RJE A;  2EJ9 A;  1O75 A;  5GMK l;  1FWZ A;  4OGE A;  4A54 A;  4ME7 A;  3V8K A;  3OYD A;  4E47 A;  4OMF B;  1W2B S;  2XDP A;  3PFS A;  4N0A C;  4BY6 B;  3UPU A;  3X28 B;  3CCM A;  5AYF A;  4BB7 A;  2EFI A;  2PVG B;  1WQW A;  3M5A A;  4DOW A;  5GMK j;  4C92 A;  3CCV A;  2QA4 A;  5LJ3 e;  1YJ9 A;  4R55 A;  2GFU A;  2KDS A;  1KQS S;  2WAC A;  2R5A A;  4C92 B;  4M75 C;  5HK0 A;  4BI3 A;  2RHX A;  2YRV A;  2M9U A;  4QVZ A;  1NPP A;  3M57 A;  3FEO A;  3NTI A;  3BW1 A;  1RI0 A;  4FU6 A;  5LJ5 f;  2XDD A;  4OF1 A;  1KG1 A;  3A8M B;  4JRP A;  3OSV A;  3S3N A;  1HK9 A;  3SWN C;  3TEE A;  4IUT A;  2EQM A;  1N9R A;  2QQB A;  4O5V A;  4M77 C;  3WXM B;  3JCM b;  3OY9 A;  1JJ2 A;  1Y07 A;  2VGN A;  5KE3 A;  5I2S A;  3CC2 T;  4M78 C;  1M1G A;  3CPW A;  4PJO F;  4BUG A;  5GAM e;  4F7U E;  5LJ5 d;  2ZPH B;  2RI5 A;  4JDS A;  4OB2 B;  5GAN f;  5GAO r;  1MGQ A;  3J80 E;  3OB9 A;  3ZEH A;  2XKO C;  2L89 A;  3TU4 K;  4M77 F;  4XTX A;  3RKX A;  5GAO q;  4PKC C;  5GMK e;  4ZGJ B;  3JCM e;  4M78 F;  4JS5 A;  2ZPI B;  3CCJ T;  1G3W A;  4BE2 A;  2OTJ A;  3P8B B;  3RMS A;  2O01 E;  3CCU T;  3I56 A;  1O9S A;  1XOV A;  5D6Y A;  4M7D G;  2F5K A;  5KH6 A;  5J26 A;  1G3Y A;  4A4F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...