3GO5A

Crystal structure of a multidomain protein with nucleic acid binding domains (sp_0946) from streptococcus pneumoniae tigr4 at 1.40 a resolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
285
structure length
285
Chain Sequence
b'GMNTNLASFIVGLIIDENDRFYFVQKDGQTYALAKEEGQHTVGDTVKGFAYTDMKQKLRLTTLEVTATQDQFGWGRVTEVRKDLGVFVDTGLPDKEIVVSLDILPELKELWPKKGDQLYIRLEVDKKDRIWGLLAYQEDFQRLARPAYNNMQNQNWPAIVYRLKLSGTFVYLPENNMLGFIHPSERYAEPRLGQVLDARVIGFREVDRTLNLSLKPRSFEMLENDAQMILTYLESNGGFMTLNDKSSPDDIKATFGISKGQFKKALGGLMKAGKIKQDQFGTELI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multidomain protein with S1 RNA-binding domains
publication title Structure of a virulence regulatory factor CvfB reveals a novel winged helix RNA binding module.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Gene regulation
total genus 68
structure length 285
sequence length 285
ec nomenclature
pdb deposition date 2009-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13509 S1_2 S1 domain
A PF17783 CvfB_WH CvfB-like winged helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3go5A04
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3go5A02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3go5A03
2.40.50.330 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3go5A01
2FBIA 4A3DG 4NXNQ 4G7OF 3J7AO 2DK8A 1K78B 3GTKH 4BHBA 1U8RA 3DV8A 5IY0A 1FBSA 2VC1A 5GQOA 4BA1I 2F4VQ 2G9WA 2ZNYA 5FO5A 3CAMA 4JV5L 3WU0A 4ZYGA 2STTA 2L01A 1NY4A 4G6DA 2E2JH 2HS5A 4HBLA 4EM1A 5HLIA 2PI2E 4P74A 1VQAA 2MA3A 3GD7A 1VQMA 1SLJA 2E2HH 1HZAA 2P4WA 2EK5A 5E20A 4OO1I 1R1UA 2CSOA 4RAYA 4UP7A 2GA1A 1ZLJA 4R4QA 4DR1L 3TS2A 1T98A 2W24A 3U58A 2IHEA 1IW7F 4HJAA 3U4ZA 2E5LQ 1J59A 3PUVA 1TQPA 4LMYA 3R0AA 4HIMA 1VQHA 4IPCA 4QLCU 3I59A 3CCLA 4M71A 3DPLC 1RUOA 2PBIA 1TXYA 3NENA 1YJWA 3S15H 2PEXA 4A3JH 3HIFA 1YITA 2EFNA 1JGSA 1PFSA 3WTWC 1D5VA 1Y1WH 5LRRA 3K9TA 1S3JA 4BAYA 2HOEA 1S7OA 2EV5A 3BZKA 1EFWA 3HHHA 4X66Q 1R00A 1O7LA 2NVQH 5HS7A 3AEVA 2HTJA 2WAQG 1ZRFA 1HR0W 5LGUA 3GTGH 3L09A 3GTPH 2RF4A 4KT5C 4GN3B 4JBWA 1PH4A 1HKQA 2UUCQ 2UU9L 2XRNA 4KMFA 3M4OH 1U2WA 3VFZA 4DQ2A 4IJAA 3BDDA 2GA2A 2AMCB 2D0OA 3SFZA 1MJ9A 4DUZL 2JK8A 4JCVE 4LLNA 4LLLA 4DR3Q 4JOIA 4GKJQ 4M9SA 2HDCA 4LFUA 2PMUA 1NMGA 4A5MA 3RZDH 3PF5A 4YWKA 4P55A 4GXOA 1KQ8A 2DPDA 2PFBA 1HJPA 2O0YA 4CXFA 2EV0A 2A61A 4XLPF 2Y0SG 1BIAA 2FXAA 3IRBA 2ZTDA 4M6XA 5LHIA 4DR4Q 1BBYA 5JFRA 2FE3A 4KHPQ 4DV1L 1L2FA 5K5QA 1KYWA 3O3KA 2OQKA 1VQCA 1ZRCA 4POFA 1STZA 2K27A 2KBNA 4AD9A 2HKOA 3S2DH 3U50C 5GAHC 5JJIA 5H1SE 4BQAA 2FOKA 3HOZH 5M3FH 3AYHB 3E5UA 4YCWA 2F2EA 1D3YA 2UUAQ 4L5IA 1MJBA 1A0IA 4LF8Q 2RHSB 5F1RA 3A5UA 1BC8C 2C6YA 3K7AH 3RLNA 1YTYA 1FWZA 1BI3A 2XGTA 4IO9A 4OONA 2VQFQ 1N34L 1KU9A 3DFGA 2VOPA 1YIJA 1Z1DA 3KFUA 1Z91A 3ULLA 4A3JG 4OX9L 2D1VA 1QQIA 5IYBH 4GNXA 4HDUA 1G51A 2ID0A 2MC3A 1Y1WG 3KP4A 4RGUA 1OMIA 2JE6I 1GXQA 1TTYA 2COMA 3ZMDA 2A5YB 3BY6A 2ELHA 3KYHC 4LUOA 1C0WA 4BBSH 1WKMA 1SD4A 2Y48A 2JEAI 1FX7A 2G7UA 1RZ4A 3K1PA 4I98B 3WTSC 1NJIC 1XD7A 5AONA 2M45A 2DQLA 2QBYA 1VQDA 3PIPA 4HIKA 2JJQA 1I94L 3QPTA 2WAQE 1DP7P 4NXML 4EVIA 1ZGAA 3VB2A 1V1QA 3FXRA 3L00A 3BP8A 1Y0UA 1K83H 4HX8A 4LNQA 5C4JH 3ERED 3IKVA 4AIHA 2QM3A 5DDGA 1WCMH 1E17A 1XSXA 4OIOF 1YEZA 2MLGA 1UCRA 3AFPA 2ZNZA 4BY7H 1OPCA 3PUYA 1ZLKA 3FZVA 2NN6G 4YCUA 1TQIA 4R1HA 5ICCA 1L0WA 3QP6A 3QOPA 1NE3A 1SMTA 1TWAH 2H6BA 3OOPA 2OCEA 4A76A 2MBFA 3HOZG 4LG0B 1VQ6A 2KIMA 5E17F 3G6EA 3HOUG 2Y0SE 1IN6A 1OKRA 1QBJA 1IUYA 2LDUA 3CC4A 4DV2Q 4IPHA 3OTOQ 1VQLA 1ON2A 5D5UB 2ZO4A 1X55A 1N33L 4JI8L 3JW4A 1OXUA 2LSSA 1BBWA 5ELOA 5J6XA 4PGHA 4L0ZB 5IYBG 4IHSA 3KP2A 4HJ5A 1N36Q 1YJ9A 4DR6L 3I4NH 2O3FA 2ZCWA 2O8XA 5EEHA 2R7DA 4M74A 1O3QA 1VS0A 4DAYB 1ONVA 2BE5F 1XSDA 3CQZH 4LW1A 3PO3G 3RI4A 1W4MA 1EQQA 4G7ZF 2DI3A 2LKPA 4A3FH 2FRHA 4JV5Q 5LHHA 1QUQB 1GM5A 3U4VA 3W1GA 4FHTA 3G3ZA 1IBML 5HS8A 5J8CA 4CYDA 4S05A 2A3SA 2NRAC 2K75A 2HYGD 1P92A 3K7UC 3D5LA 4UPAA 2ZJ2A 3WTUC 3KFWX 2KRFA 1FNNA 2PMHA 5F64A 1PH5A 2VBWA 2PN6A 3FXUA 3F2CA 1FP1D 1CKOA 2QEXA 4HIDA 3NEUA 4HLYA 1V4RA 4GOPC 1B9NA 1TWFH 1WCMG 2Q8KA 1K3RA 2VZAA 4ESJA 3RLOA 1VQKA 1IZ1A 3IHUA 3K81C 1C9OA 5C4XH 1IXRA 2OZUA 2XROA 1FYKA 2KCMA 5CJ9A 2GXBA 2C35B 1K7AA 4R1JA 4JI4L 5K1YA 4EV0A 3E9HA 3PSIA 2DU9A 5D4SA 4A3MG 4Y13A 1PYBA 4UVAA 1Y1VH 2M8EA 2XAFA 1VQBA 5GROA 3Q9VA 5C44H 4U0YA 1D8JA 4B8XA 4A4IA 5BS6A 4G6QA 4MTEA 4FX4A 2B63H 3HYIA 2UU9Q 4RMFA 4N0BA 1VQ7A 3FXQA 3B02A 2RDPA 1U5KA 2K4KA 3CCQA 2CWEA 3E6DA 3GW2A 3CCEA 1R22A 1VQJA 1ZG1A 4DUZQ 2FBHA 1EYGA 3CUQA 3HSRA 2ISZA 2LF7A 3GWZA 3TO9A 1KL9A 5D8KB 4BXUA 4A3FG 4BHCA 5DCMA 1UEBA 1HR0Q 3WTTC 3HOWH 1ZH5A 4I02A 1KGSA 1T9HA 4UVCA 2NS0A 2CG4A 4YHHL 1B1BA 4PMWA 4L5SA 3GYHX 1YVCA 3FKIH 3HKSA 3LQRA 4DV1Q 4RAZA 3GTQH 1IYJB 3CC2A 5IT9K 2PG4A 3S2WA 2OU2A 1KQ9A 4F7ZA 6PAXA 3HFZB 3F8FA 1U78A 2B0LA 4JBJA 2KIUA 2MO0A 3D0SA 3J7ZC 4DV7L 4MZ9A 3ZQ7A 3LA7A 3I4MH 1R9TH 3ZMZA 4U88A 4P9UA 4JI2L 1ZREA 1N34Q 3HRSA 1HSTA 1Q1HA 5C4XG 4OX9Q 3D31A 1LTLA 3NELA 1YHAA 2P6SA 2JPBA 4WCGA 1IXSB 2BV6A 3MZYA 2CWPA 4DV3L 3CCJA 1VQNA 3CCRA 4LLGF 1Y1VG 3LAPA 5J3BA 5E8GA 1H95A 1HNZQ 2YR2A 4R79A 5C44G 3M85A 3CP0A 2JEBI 2OTJA 4MQVA 1ZARA 5AIPA 1CUKA 3F2BA 2B63G 1P4AA 4LD5A 3DLLA 2P7VB 1JE5A 1SRUA 5E7NA 1RI7A 2PNHA 4MHGA 1CKMA 5CVJA 4TQUS 3PQJA 4LF7L 2V1XA 5DEQA 1I94Q 4NXMQ 2H5XA 4IPAA 1UE6A 1G3SA 5FLMH 2N8NA 4LFCL 3J80Z 4P96A 1VQIA 4X6AH 4Q4ZF 4EGYA 1IZ6A 3V8KA 4WJ3M 1I1GA 3HOWG 2HEOA 4LFAL 2R92H 4JI3L 2Z9OA 3IKTA 1H9TA 3ECOA 3CMAA 2IJLA 4WXHA 3R6SA 3VEPA 3RN2A 3QRFF 3RJPA 4Y15A 5M3MH 1XGSA 1MJAA 1LUZA 3U9GA 1YFHA 2HR3A 1U5TC 1KD1C 4P73A 2IT0A 5D8LB 4CO8A 1MJEA 2X4HA 3VODA 2OQGA 5E1XA 2UZKA 2PI2A 1N33Q 3WGIA 4BA2I 5LMUL 3F3XA 3NQOA 5TJJA 4A3DH 1JJGA 1XGOA 4P5OA 4O0AA 3TOBA 3KF6B 3S1QH 3J80K 2ZFWA 5LEKA 3HKZG 4R4TA 4DR6Q 3DKWA 4E70A 3VOEA 4CGZA 3LA2A 3KE2A 3FM5A 2XAQA 4I0AA 2L02A 3PV0A 4HF1A 3KETA 3RIRA 4GOPB 4L5TA 1I27A 2R3SA 3E6BA 3JTGA 2NZOA 2X0LA 3RKWA 1XB4A 1GO3E 3GO5A 3H92A 2WP8J 4IRGA 1A8VA 1IBMQ 4ZZLA 1Q12A 5L3BA 1PH8A 5C3EG 2AXLA 3RKYA 4U0WA 1SAXA 5HLGA 3RR5A 1PV4A 3RYPA 2B29A 3JAMZ 3BZCA 1GVJA 1FC3A 3GLXA 3L0OA 2ATWA 2QUFA 3GFJA 3M7NA 2BGCA 1FSEA 2ZTCA 1TQMA 4A6DA 3ZMUA 1IRGA 3K8AA 4GN4B 1JT8A 3REOA 1L0OC 2EJRA 1OTCA 1MDMA 1QGPA 1SMYF 5JR3A 2Y0MA 1SMXA 1HW1A 3GXOA 1L3LA 2Z99A 3DXJF 4NB5A 2AHOB 4KIFA 1YYVA 3L2PA 4BXXH 2NN6I 1EWIA 1YBYA 5JJLA 3J81c 1XPOA 3F8CA 2L3DA 1VTNC 3NRVA 1HH2P 3I2ZA 4UXNA 5M3MG 5JEAJ 3TO6A 4JI4Q 4GLVB 2KCTA 2HKXA 5CLSA 2WB1E 2HWVA 2HQLA 5CVVA 3O6BB 1H9GA 3LAJA 2A1AA 1PH2A 5JI6A 5HDKA 1KXLA 3ZP5A 5H20A 1YZ6A 2FXQA 5DUIA 2RVCA 3BPXA 3KJOA 1WYDA 4JI6L 3HRMA 4A3GH 1TLHB 4A0ZA 3JAMK 1JXSA 4UNOA 3RNUA 2VBZA 3DEUA 2ASBA 3G73A 4CHUA 1G3WA 4DK6C 1M90C 3GTLH 5L3EA 2KENA 4BHPA 2L54A 4WK8F 2V79A 3R4KA 5FLXc 2YU3A 1X65A 2OA4A 3WTXC 1WOCA 4BYYA 2BH8A 1WJJA 5BR8L 5AJ3L 2MLKA 1WRJA 2VS1A 2K4BA 3BJ6A 1T2KA 1ASZA 3TREA 4AIJA 2ZMEA 4XLNF 2BH2A 3HOYH 1S29A 4YHHQ 4YFKF 3EIVA 4KHZA 1AE3A 1LJ9A 1MGTA 1VCIA 5GADC 4MEYF 1L1OA 1G3TA 2Z33A 2R6GA 1I6HH 1FL0A 3DP7A 3T5XA 3CUQB 2HIXA 3T8TA 4XRFA 1HXDA 2PMZE 1X3EA 3IRQA 3S2HH 4DV7Q 2VN2A 3M9AA 4WJ4A 5DCMB 1XNRL 2M5WA 3KJPA 3S17H 3MEFA 3TRZA 2UUBL 3V4GA 3JSPA 4JI2Q 5FLXK 1ODDA 1SFEA 3E6CC 2JA5G 3H3ZA 4BXXG 4JK1X 2IT1A 1MJCA 3KOJA 5KK1A 2CGPA 2DQRA 4YIFA 1IRFA 4JBAA 2I5MX 1H0MA 5JHUA 3T1HL 1YW9A 4B3ML 4YFNF 4DV3Q 3KZYA 1FY7A 1YQAA 3PUWA 1A62A 1J75A 5IYCH 1QZGA 2WFWA 4HV6A 4PDKA 5CVUA 2R7FA 1X3FA 4A0YA 1EQRA 4JI7L 4A3GG 4AH6A 5C0XJ 3WE3A 4GS3A 2DO7A 4HX4A 1HZBA 2PQ8A 3HOTA 2ZXJA 4HV5A 4I09A 3M1EA 2VQEL 2F52A 4J15A 3R0JA 2L4MA 1CGPA 4KICA 1U5TB 4LFCQ 4OOIA 1GD7A 4P75A 2QA4A 2GAUA 1KYZA 1ZHFA 2EFQA 1JHFA 2VONA 3I4PA 3MWMA 3J7A5 5LHGA 4LFAQ 3HOYG 4JI3Q 1P2FA 2YX7A 4U7DA 4B3SL 3Q8DA 5HY6A 3KEQA 1XGNA 2ES2A 5FFXA 3H3VH 3HOUH 1UE1A 3F8NA 1BI2A 4YG2F 1P6RA 2XUBA 4UP9A 4A75A 4LF4L 4PCQA 3F1ZA 3C3WA 1IN5A 4BBRH 3FWEA 3NBHB 1QNTA 4IRHA 4YWMA 3PQKA 3ZN1A 4LF5L 2ACJA 2ISYA 5LMUQ 3T1YL 3H0GH 1QVFA 2HGCA 2IA2A 2VY3A 1TWHH 1HBXG 1G3YA 1NMFA 4OIRF 4JOIC 2O61A 1GXPA 4LUZA 4RB0A 3PO3H 2WWYA 4LB5A 1Z6TA 3KDFB 3OYYA 4IXAA 2K5NA 2OWOA 1QZZA 3EQLF 3MAJA 3ICEA 1SD5A 3FHWA 5LEJA 1FYLA 3BOQA 1JMCA 3GEZA 1N32L 4R4CA 3RTRA 1B8AA 5IYCG 5BPIA 2FQ3A 5ICFA 1CKNB 4FT8A 2YU9H 3SHFA 1K6OA 2ZJPA 2XHKA 4LUVA 1OR7A 1SROA 4UP8A 3CCMA 5IYDH 4HJ9A 2A07F 3N97A 3T1BA 4LB6B 3F2DA 4EM0B 4YCVA 2XKOA 2ETHA 3L2CA 2K86A 4HJ8A 2YTYA 1J5EL 2V6CA 4O3MA 1UB9A 3EYYA 3QP5A 3IL2A 3AFQA 3K1MA 2HTSA 3G4SA 1J7KA 2NVXH 2RHQB 3RDIA 1MKMA 4G7HF 2MQHA 2F5FA 4JI1L 1VQEA 2XAGA 2DTRA 1XNQL 2VE9A 1KC8C 4HZFA 4ON0A 2A19A 3JSOA 2P7CB 4JBKA 3GDEA 3UDFA 4EMSA 1V9PA 4A3MH 2LF8A 1Z9CA 2FA5A 1YS7A 1E22A 4M6YA 1S7AA 2VOOA 4EJVA 3V7CA 4RB1A 4X62L 1UHWA 5E1WA 3V8JA 4L0YB 2MD5A 4K0KL 4AIMA 4GO1A 1LVAA 4BBRG 1BM9A 3I71A 4IFDJ 3ML6A 2FBKA 4L5JA 1K8AC 4Y17A 2PQAA 2GIVA 3H0GG 1S3OA 4JI6Q 4LFBL 2QQAA 2UXNA 1VQ9A 2K14A 4WF2A 4QL5A 3DF8A 4OWTB 1W5SA 2FNAA 3KCCA 3B6YA 2CO5A 4U0VA 5CYVA 1LDDA 2GVBA 4AQYL 4A3IH 2UXCL 4DNCA 4Y52H 2GQQA 5BR8Q 5AJ3Q 1XMKA 3ELKA 3UDXA 1D8LA 2QWWA 1E7ZA 3PUXA 3J81i 1E1OA 2Z6KA 1N9WA 3PCOB 2QZ8A 5IYDG 1ASYA 2Q2HA 1I5ZA 3FX3A 1SD6A 1AWCA 4DR1Q 4A3CG 1QZYA 3S24A 1CSPA 1IF1A 1EH8A 4B09A 5CVRA 1XN7A 3SQNA 4O5VA 2N78A 3GTMH 2ZBKA 5C0XG 1PDNC 3E5QA 3GTJH 4ALPA 2VUMH 4JQFA 3G48A 1SFOH 3DM3A 3WWVA 4ENKA 1W3SA 1XNRQ 2E7XA 1XCBA 1D8KA 2ALYB 2JA7G 5FGMA 2UUBQ 1KQSA 2ZMEB 3J81j 2FEZA 2EA4A 3M9BA 4KMUX 1OXTA 1R58A 2N3SA 1IAWA 5IT9Z 3P7NA 4DV5L 2Z0SA 1XGMA 4HDVA 2VC0A 1B4AA 2ESHA 5KVRA 3MCZA 3GTOH 2RNJA 2A8VA 1O7IA 3V7RA 5HLHA 4POGA 2QVOA 4O2DA 3T1HQ 3I0TA 4X64L 4B3MQ 1ZYRF 3I59B 2AWNA 3KP5A 4DUYL 4JG2A 1VQ4A 2P5KA 5FJ8G 1KHIA 1J0RA 4PZJA 1JJCB 4DV6L 4JI7Q 4DKAC 4DR2L 3HRUA 2ADUA 2LSOA 1IN8A 2YPRA 5FB2A 1QVGA 1Q1BA 4IJLA 5BMZA 1HNWL 1IXCA 5LMNL 1O57A 1W5TA 1R7JA 1HQCA 2VQEQ 1KA8A 1GVPA 4A3IG 4QIWE 2JA9A 2RC4A 1BBUA 5D6FA 1WFQA 1DPUA 5IT3A 4AYBG 1FT9A 1B70B 5M5WH 2VT2A 1N8RC 1BI0A 4OMZA 4B3SQ 3MXNB 3U1DA 3CCVA 2O6GE 3HOSA 1E2XA 5ILUA 2NZHA 2RV8A 1P4WA 3CF5A 4LF4Q 1UWVA 3C18A 2E7WA 5LBQA 2VUMG 1TW2A 2JT1A 3I64A 4XSZF 2XAHA 1O3TA 1LQ1A 2XTIA 1EV7A 2IP2A 1WI9A 3S1RH 3IRRA 4N9IA 2ESNA 4GGGA 4LF5Q 3T1YQ 1JHHA 4A3BH 3ZMSA 1I5FA 4H02A 2P5LC 1MZBA 3I4OA 3W1BA 3CUQC 5L3CA 2IW5A 1TWGH 4A93H 3W6JB 2ZM6L 4LWCA 1TNSA 4QY7A 4G94A 2XV4S 3ISPA 1RL2A 4MNOA 2R93H 1B6AA 1X54A 2H27A 1N32Q 4KNYA 5EAYA 3GF2A 5C3EH 3L9FA 4GNXB 1OYIA 1FVIA 2FMYA 4B3TL 1HZ9A 4ETSA 4P72A 1XPUA 4RGXA 5FFZA 4IFDG 1C0AA 1R5GA 4Q47A 5A2QZ 2KHJA 3HSFA 1AE2A 3ULQB 1J5EQ 1U0LA 4ENMA 2OQ0A 3BU2A 4LK0F 1BVSA 2QBYB 4DPGA 5L3FA 3ZMTA 4HQEA 1B7YB 3PIOA 3CLOA 2DBBA 2Q2IA 4RS8A 1LM0A 4JI1Q 5K5OA 1ZN2A 4I2OA 1XNQQ 3N4MA 4UV9A 1VQPA 2IA0A 2BEOA 4JI0L 4QWQA 2E1CA 3EBEA 4I0BA 3WU1B 1HKSA 3LFKA 3F22A 1YW8A 1WSUA 4X62Q 3MQ0A 5LGTA 4JI8Q 4K0KQ 5LLQA 4M72A 3COAC 3LQQA 2EXDA 4RGSA 1S6LA 1Q46A 3L7ZC 3CPFA 1X3UA 4EJUA 4ESFA 1A63A 4WWCA 2D1HA 4UHTA 4GLXA 4LFBQ 4HF2A 2A6HF 4A3BG 2QQBA 3ROUA 3C1DA 3KLNA 1R5HA 4NPSA 5A2QK 5LRSA 4A93G 1JE8A 1R36A 4EJWA 4JI5L 2DUDA 5CVIA 5AIQA 1SFXA 3JTHA 4EQQA 2R93G 1EOVA 2OAZA 4GLAC 3R61A 3PGZA 4AQYQ 4LGWA 3I5UA 2E8GA 3LWFA 2UXCQ 5EEGA 4KIGA 2UXBL 4C3IH 3WTZA 4LK1F 4QGUA 2QENA 3F6OA 2E2IH 1C7YA 2A68F 1I1SA 2K50A 4C3JH 1YW7A 3L7WA 4MGRA 3FMSA 4L18B 3PF4A 2IHFA 4WXDA 3HOXH 2H94A 1OXXK 1F4KA 3SZTA 2K7LA 2NVYH 2TDXA 2A69F 4XTCS 4LG0A 4ME3A 2L15A 2G7HA 1MKHA 2JA5H 3GZ5A 2ZTEA 1P4XA 1SFUA 4KI0A 4KFCA 4DR5L 2JRTA 4I01A 1IBKL 2GWRA 2VODA 4Q5SF 3ULPA 4DR7L 3RZOH 3TKYA 2VXZA 3H3VI 3CW2C 1FJGL 4DV5Q 3I58A 4A3LH 1RNLA 3DQVC 1X6OA 2PI0A 2K4JA 1V3FA 4A3EG 5DD4A 5H6QA 4X64Q 1FBUA 4NHJA 1VQOA 3E5XA 3M8FA 1IBLL 3TO7A 1G6PA 4DUYQ 2JQOA 3CCSA 1G6NA 3F8MA 2P6TA 3FMQA 3AAFA 4MTNA 5FLXZ 2NVTH 2CW0F 3FF5A 2W25A 4H0EA 4S04A 4DV6Q 3DPTA 4DR2Q 1ZGJA 2STWA 2M1BA 3HOVH 1E1TA 2K5VA 3EUHA 2AKWB 4FDBA 3ULJA 2XKPA 3F8TA 1HNWQ 2HZTA 2Z3YA 5LMNQ 2HYFA 3J81K 4KIBA 4ZYHA 2BA0A 1LEAA 3TS0A 1S72A 4ZZDA 3HKZE 4OXPA 1TWCH 5HGQA 2I0QA 1ZG3A 2Z5UA 1GKHA 4OIPF 3BJOA 4HQMA 1IN7A 1BIBA 3BPVA 3CTAA 3Q9SA 5JJKA 2DPUA 3HOXG 1K79A 1PH9A 2V9VA 3KP7A 1Z9FA 1XJVA 1CF7A 4M9XA 2M87A 1LEBA 3EYIA 1EIYB 4KA4A 2GVAA 2PLYA 2P8TA 1IL2A 5C0XI 1Q1EA 2EWNA 5GAGC 4GKKL 4ZYDA 3TQYA 4G8XA 2LNBA 5F6FA 2Q2UA 1UHMA 4WX9A 1U3EM 2HT1A 4UV8A 3OW2A 3VDYA 1ON1A 1T6SA 1JB7A 2RQPA 4L9JA 3U2RA 4JYAL 2EA2A 5M5XH 4ENJA 3LSTA 4OIQF 3I55A 1XDSA 4A3LG 2EB7A 2ZM6Q 4JBMA 4DK3C 4OINF 2N49A 1AH9A 4GN5A 1PH3A 5IP9H 2JA8H 3C7JA 3M7GA 5L3DA 1W2BA 3K2ZA 1FZPB 3STBD 1QZHA 1FGUA 4L9TA 3CO7C 3TDZC 4BY1H 2IX0A 4ESBA 1BOAA 3RPQA 1I6XA 1L1OC 2AS5F 3E0EA 2FNPA 2OBPA 3IC7A 2D0PA 4LF7Q 2XVCA 4R4OA 3HOVG 4B3TQ 2RCNA 1F5TA 3ZJYC 2OQRA 2ZJRA 4HF0A 4LF6L 4HX7A 1BI1A 3I56A 5E8IA 5ICGA 1G291 4ZYEA 5E18F 2JPCA 4KYWA 4YWLA 2YSRA 4DV4L 4OWWB 3BJAA 3E97A 3E9IA 1HR0L 3F72A 5BQTA 4C2MH 1VQ8A 2IPQX 3W5OA 5M5YH 4A2UA 2GN5A 4PG3A 4IPDA 1XMAA 1YS6A 2JA6H 1VQ5A 1OYYA 3K69A 4IF4A 3UDIA 1Q82C 4LF9L 1Z6RA 3G71A 1REPC 4JI0Q 2W84A 2MH2A 4MQ9F 2CQKA 2W57A 5ED4A 2YX4A 1OXVA 1K8GA 2VE8A 1B9MA 1CSQA 5K36G 3EDPA 3BWGA 1XPRA 3HTUA 1ZAOA 1T38A 2D45A 1YO5C 2LXJA 2IY5B 4NB3A 2YTXA 4BH9A 1Z05A 2KJCA 4L5RC 3EETA 2XGXA 2GXGA 1EUJA 1R1VA 3CO6C 4JI5Q 4C3HH 4WXCA 4QJFA 2JSCA 2JA8G 3IWFA 5IP9G 3CMEA 1Z7UA 2Q0OA 1KIXA 3B73A 5JEAG 1WWXA 1XTDA 2UXBQ 4XSXF 4PZ7A 3TOAA 3KP6A 4BY1G 2BBYA 1R23A 2M30A 2UWMA 1HNZL 5HDGA 1DPRA 3WE2A 3ABTA 4CZZA 4EJOA 1Q81C 4A3CH 5TRDA 2KKOA 3J80i 3P9IA 4OU0A 2R7ZH 1D7QA 2EFOA 4A0XA 4A6EA 4EJTA 2K5HA 4LJZF 3HRTA 3S14H 1O3SA 4ZH4F 1WQ2A 3GFMA 4HOBA 5D4RA 3KLWA 2VW9A 1PA6A 4IFDI 1TW3A 3K0XA 4DV0L 4APVA 4RB2C 3K80C 2JA7H 4U7BA 1W7PA 1KU2A 1FYMA 4GNXC 1KAWA 4G9YA 1QVCA 1XMQL 1Q7YC 2ZKZA 4KN4X 4PZ8A 4DR5Q 3ZPLA 5DUKA 3I53A 3HTSB 1IBKQ 1O7FA 2OZ6A 4DR7Q 5LGNA 2JA6G 1LB2A 4AVPA 2K52A 3V7SA 3A5ZB 3RYRA 1FJGQ 4UY8C 3KF6A 1M1KC 1KU3A 3WODF 5FJ8H 4NQWA 4A5NA 1OYWA 2VBXA 3FM3A 5JVTA 1MDMB 2RN7A 3JC66 2FU4A 1EH7A 2JZYA 5M3FG 1IBLQ 4GOPA 4M9ZA 4A12A 3MFKA 1KU7A 3CD6A 1NHAA 5IE8A 1F9NA 5IP7H 2LXKA 1LNWA 2CKZB 4TVAB 1I3QH 2QGQA 2IX1A 3RKXA 2WC2A 3PUZA 4M73A 2CCZA 3CC7A 2F3IA 1PH1A 3SGIA 4IRIA 3P9KA 4CICA 2KJBA 3GFLA 1JJ2A 5DV5A 2EIFA 3F23A 5DD8A 2MFIA 2EFPA 3MEXA 1RIPA 4EQ5A 3JAMi 3UE0A 4MTDA 2I5LX 4L5QA 1YHQA 4BBSG 3A74A 2WV0A 3TDUC 3M3YH 1TNTA 1YLFA 2UXDL 4OO1G 3ABUA 3CJNA 4KN7X 3CPWA 2EQSA 2R7ZG 1USSA 5K5RA 2IVMA 4YY3L 3T8RA 1PVOA 5D6EA 1AOYA 1KRSA 2MH9A 1A04A 5ELNA 3HUGA 5H6RA 3F6VA 1Q86C 1KRTA 2H6CA 4GKKQ 1TBXA 2YYZA 4A3KH 1XMOL 1PP7U 1L1OB 3WTVC 2O03A 5LMNW 1K73C 4PGGA 2OTLA 4BY7G 5IWAL 4QQBX 1SE8A 3WG9A 1HNXL 5DCFA 4JYAQ 3IWZA 4HAMA 2HHHL 3SXYA 4B3RL 2VNUD 1K78A 1YNXA 4YFXF 3KP3A 5J8FA 1CF7B 1PYSB 1RIOH 3TQNA 3ERSX 4Q48A 1XSVA 2VT3A 3MZHA 4X65L 2VL6A 1J2XA 4KLKA 5IP7G 1OXSC 2Z6KC 5IT9c 2RGVA 1K9MC 4AIKA 5ILVA 2BA1A 3WGGA 1IN4A 3NEMA 4OWXB 1YJNA 1ZRDA 4IHTA 3H3UA 1FPQA 2BYVE 4DAMA 5ILSA 1ZG5A 4NXNL 1HKTA 2DT5A 3M4QA 4LF6Q 2NNNA 3WTYC 1FSHA 2YV5A 5HS9A 1ULYA 3I4NG 3GX4X 2F4VL 1T0FA 2UXXA 1S8NA 2EFWA 4K2EA 2IRFG 1IXRC 3P9CA 2Q2TA 3W6KB 4RG1A 2IA1A 4DV4Q 1Z47A 4HYEA 3RN5A 3PO2H 1K0RA 2DLLA 2V1UA 1BN5A 4EM2A 4MEXF 1VQGA 2V1DA 1SD7A 2DW4A 1P16A 2QLZA 4HIOA 3PFIA 2CYYA 1HW2A 2P5VA 3BROA 4LF9Q 3QU3A 1HSJA 1BC7C 1PH7A 2Y75A 4IOCA 1XCVA 1HZCA 3QAHA 2J5OA 2E5LL 4RGRA 1QPMA 4IVNA 4EGZA 3S16H 4A3KG 5D5XB 2EV6A 4GYIA 1YIOA 4ASNA 4Y7NH 1PUEE 2F5EA 1PH6A 2DAOA 4XIGS 2RKHA 5D5VB 2H09A 2DFIA 3WGHA 2KHIA 1HW5A 3K1NA 4KDPA 3D0FA 3TEHB 1LDJA 4X66L 2I5HA 3E6MA 4L9NA 2NAZA 1U5TA 2CFXA 1PHJA 3FHZA 3KEOA 4IOAA 4HLXA 1W7PD 2UUCL 3AQQA 1UFMA 2QQ9A 3CUOA 4O6JA 3K0LA 1NTGA 3HSEA 1YI2A 4HJ7A 3BZ6A 4RB3C 4HA8A 2FMLA 1E3PA 2J5PA 1WI5A 3SZPA 1RUNA 5E1ZB 4BNCA 3OV8A 4DR3L 1X9NA 4I7HA 3EN2A 4GKJL 3TGNA 2W85A 1Q8KA 1YHBA 3S1NH 2XIGA 3FP9A 3CCUA 4UUVA 1DGSA 4DV0Q 3RPUA 4P71A 4IJHA 2GZWA 1NBWA 3S1MH 4HW0A 4GYGA 1QO0D 1DUXC 3M4PA 5ICEA 1P8LA 1O3RA 4DNIA 4MNUA 1XMQQ 2A6EF 1E24A 4KUMA 2MNAA 4DR4L 2DK5A 3PO2G 4KHPL 1EH6A 1FBQA 5HOOA 3J80c 2WB1G 4IPGA 1LDKB 4XBFA 3LA3A 1XDUA 3FKIG 4A3EH 2NNYA 4AYBE 1SR3A 4GCVA 1B59A 3GZ6A 3GFIA 2OD5A 2XASA 3BJUA 2UUAL 5HVQC 2CQOA 3RLFA 3KDFA 4LF8L 3M8EA 4P9FA 2ZJQA 2HQNA 1PP8F 1W7PB 5HDNA 5ERIA 1G4DA 5DYMA 2VQFL 4TV7A 3GUDA 2DGYA 1FP2A 3F21A 3KLOA 1YG2A 3ZMVA 3I4MG 1CKNA 3T0YA 3F8BA 1U6GA 4AWXB 1I50H 1USTA 5GAEC 2B3GA 2WTEA 2K02A 3STBC 4N9HA 1EIFA 4UVBA 3I54A 4Z2YA 2CWAA 5FD6A 1J6QA 2QYOA 2PQAB 2L4AA 3KZZA 2F5DA 1BJAA 2F5CA 1BKBA 4PZ6A 1S40A 3LGJA 2FSWA 5D5WB 4EX5A 3HHGA 3A0JA 3O2PE 1SN8A 2UXDQ 2Q2EA 4JC0A 3UDGA 5BOXA 1FLIA 4R4IA 3H15A 2MO1A 2V1CC 3J81Z 4YIIA 4YY3Q 3QPHA 3KF8B 4L9VA 5DLQE 1T39A 3CDHA 3Q5FA 5FLMG 1GHCA 5FD5A 3R60A 3JAMc 2AWOA 2HIVA 3CXCA 2HFHA 1XMOQ 1MIUA 2KIFA 1LYLA 1X56A 1J9IA 1F1ZA 2R92G 2NYXA 2FF4A 3E3VA 2E1NA 5BPDA 3V8LA 5IWAQ 4ENNA 1HNXQ 3ECHA 3UE1A 2VBYA 2HHHQ 4B3RQ 1UE5A 4FX0A 1DDNA 3FMRA 3GVAA 2YTVA 1FOKA 4DV2L 3OTOL 2D2WA 1KQ0A 1QUQA 4D0PA 2PJPA 2XAJA 4OMYA 1J5YA 2CFMA 1UE7A 3ZN0A 4X65Q 1MD0A 3I7FA 5L3GA 1V43A 1VQFA 3ER0A 3QU6A 1Y14B 4R8HA 2D62A 2HQRA 4CDGA 1R1TA 1N36L 1X3GA 2JTVA
chains in the Genus database with same CATH superfamily
2FBIA 3J7AO 2IW3A 3QWLA 5J22A 1LV9A 2F4VQ 5FO5A 2ZNYA 3CAMA 4ZYGA 2L01A 4CJ0B 4HBLA 3HOUJ 4FF1A 4P74A 2MA3A 3FPPA 3GD7A 1SLJA 4BXFA 1PTOH 2CSOA 2F0HA 4UP7A 1MGSA 3FDYA 2IXSA 3TBIB 1JJ6C 4JVZA 2Y0SN 3U58A 1I4XA 1MBFA 2IHEA 3U4ZA 2E5LQ 1J59A 3R0AA 3WHBA 1PUFA 4G12A 4N4OB 2V9PA 1YE9A 5IGFA 1TL8A 4A3JH 3OMGA 1D5VA 1S3JA 3GTMB 4BAYA 2HOEA 5C4XB 3AEVA 2HTJA 1HR0W 2CFOA 1WD1A 4XXEA 4GN3B 4Q0FA 1EZ6A 4KMFA 3VFZA 1UZCA 2LVSA 5IP6A 4RDUA 1WCMJ 2D0OA 2JK8A 5CV5A 3MXNA 4DR3Q 4A5MA 3OYIA 2XSCA 5IOZA 2KRHA 3OYKA 4GXOA 1TWAJ 1SEUA 5E3FA 2O0YA 4XLPF 2Y0SG 2AQEA 1BIAA 1TS5A 3IRBA 1F9PA 5LHIA 5JFRA 4DV1L 5K5QA 1PDQA 5CYUA 2KUMA 1VQCA 1MIJA 2K27A 4XL9A 3OHXC 4JW0A 5GAHC 3DU6A 5JJIA 2PNRC 5M3FH 4RM2A 1AKHB 1I4GA 2F2EA 1X2MA 2UUAQ 1RPWA 4XICA 3CC2I 2RHSB 3GZNB 2RQQA 4NUBA 5CORA 1RODA 2M34A 2NS8A 4D7NA 3MN2A 4B47A 3DFGA 1YIJA 1Z1DA 4A3FJ 4A3JG 1QQIA 4GNXA 3EUAA 4FXGC 1OMIA 1GXQA 1TTYA 2AQ2B 2NBFA 1K3BC 3ZMDA 3BY6A 4RLFA 1WKMA 4LIUA 2JEAI 1RZ4A 4I98B 1XD7A 2M45A 3CCRI 2LH9A 1VQDA 3V2TA 3QPTA 2WAQE 3GTJJ 3VB2A 2PMZB 1V1QA 1XPXA 3ZXSA 3OSFA 3L00A 2JQ7A 5C3EB 1T8IA 2MUYA 3BCAA 4AIHA 2QM3A 3K4KA 1WCMH 2HOSA 1W6JA 3AFPA 4BY7H 3GTOJ 3FZVA 1TQIA 4R1HA 1TWAH 2B63J 1OQYA 3HOUG 5E17F 3VPRA 1EEFD 1G91A 2Y30A 4IPHA 5A35A 1OR7C 3KPHA 1ON2A 2DA3A 2ZC2A 4JI8L 3CJTB 2EY5A 4ZYAA 5ELOA 5KNBA 4N9TA 4YEJA 2KZVA 1APLC 1VF7A 3HBLA 1YJ9A 4BS9A 1MI2A 1O3QA 5DS9A 3BDLA 3RUZA 3RI4A 4G7ZF 4A3FH 3OSOA 4DIQA 1ILPA 2A3SA 2NRAC 1P92A 4UPAA 3WTUC 1SEBD 3KFWX 1R9TJ 1FNNA 1V5FA 1CKOA 1RR8C 2E2IB 1MMDA 2BE5D 4PFPA 4GOPC 1WCMG 2Q8KA 3RLOA 2X1DA 3IHUA 1F2YA 3HP3A 2IGMA 4V190 4RBOA 1IXRA 2OZUA 1K7AA 1EY6A 3KZIC 2JA5B 3A1YA 2ENBA 1PYBA 2FQ4A 1D8JA 2LC2A 3ND8A 2R0QC 4B8XA 5BS6A 4G6QA 4X6AJ 2B63H 3U9OA 3B02A 3S3OA 2RDPA 2R5YB 2CWEA 3HSRA 3RCOA 4BXUA 4A3FG 1ZH5A 2NS0A 4YHHL 3SEBA 1LTBD 4PMWA 2K3FA 3HKSA 3GLLA 2HXIA 2PG4A 1KQ9A 1TWCB 3F8FA 2WB1N 3HS0C 2K40A 3J7ZC 3LA7A 3AFHA 1R9TH 4P9UA 4JI2L 5I4DA 3HRSA 1Q1HA 2E76C 3MXGA 3D31A 4XONA 2G9HD 2P6SA 4HSRA 4WCGA 2L9NA 3K5NA 4LLGF 1WFXA 1N77A 3K5OA 4R79A 3M85A 3CP0A 2NWGA 1CUKA 5M5XB 1A15A 2B63G 4GFBA 2NVYJ 3MZ8A 2PNHA 1L0YB 3MVPA 4TQUS 3PQJA 4CYCB 1UE6A 1G3SA 4NBQA 2LG4A 1VZ0A 1J8IA 4P96A 3J80Z 4X6AH 2OJED 2AXTC 2R92H 4N4NB 2QA4I 3J80E 1OCRH 4ZTJA 1RTNA 2JXMB 1FJLA 4A3GJ 1L0XB 4KJNA 3LL7A 3S32A 1KD1C 3BG3A 2IT0A 5D8LB 3GTLJ 4A69C 2IPKD 3A8KE 5E1XA 3VA7A 5LMUL 1P9QC 3OS0A 4O0AA 3HOYJ 3NP8A 3J80K 5LEKA 4E7JA 4E70A 3VOEA 3K58A 3NUCA 4HF1A 3RIRA 3CDIA 4GOPB 3E6BA 2X0LA 1WPKA 4MIMA 5L3BA 1SAXA 1PV4A 1KONA 3RYPA 1GVJA 2QUFA 1TQMA 3SDGA 1UMQA 4RLQA 3MVVA 2FMCA 2EJRA 3VSLA 1S7EA 3BYTB 1SMXA 1HW1A 3GXOA 1B44D 2Z99A 3DXJF 1FOWA 2ZSHB 3H36A 1ETVA 5JJLA 2AHQA 1WI3A 1EJ9A 3J81c 2L3DA 3NRVA 2JA7B 3TO6A 3ONAB 1H9RA 2AUKA 2HKXA 3ITPA 3O6BB 2VJJA 2B2WC 2A1AA 3ZP5A 5DUIA 4A3GH 2VBZA 3DEUA 3GTLH 1XTCD 4B08A 2W00A 3H9QA 2K5WA 1W1WE 2L54A 4WK8F 5TISC 4BYYA 1K4TA 1WJJA 5AJ3L 2VS1A 3TMEA 3HOYH 4XLNF 3EIVA 1VCIA 1MMSA 4HN7A 4RGNA 2R6GA 3IV5A 4AYBB 1I6HH 2BDNA 4MO7A 1U4RA 2HIXA 1IV8A 1NK3P 4XRFA 3UR3C 1Y69U 1X3EA 1EYDA 3EQLC 1Q1VA 5DCMB 1XNRL 3TRZA 2UUBL 5I6WA 3V4GA 1ODDA 3E6CC 4DNTB 1SFOB 1MJCA 2VB6A 3GMEA 3KBXA 4O42A 3WOEA 4JBAA 2I5MX 3I73A 1S5FD 4YFNF 4DV3Q 3LX0A 4FNFA 3MTSA 1AA7A 2O5IC 1WTXA 3HGYA 1WJCA 2L7KA 4BDYA 3P5JA 4JI7L 1TS4A 4A3GG 4FVMA 3Q3SA 5GTHC 1HZBA 1VQ4I 3HOTA 4I09A 4UDUC 1EQTA 3M1CA 2HQAA 3KX2A 4P75A 5K7FA 1HDDC 4JK1C 2EFQA 3I4PA 3J7A5 3HOYG 1GUOA 2DOEA 5EBCA 4B3SL 4Q5VA 3BG5A 3KEQA 3D5SC 5FFXA 2VJIA 3H3VH 2DTZA 4B48A 1UE1A 5HODA 1LTRD 1P6RA 4G7ZC 4LF4L 3CCVI 4KY6A 3C3WA 1IN5A 1RRJA 4LMQD 4CCJA 1PZKD 1STGA 2OV7A 1HBXG 4YRVA 3EROA 1Z6TA 3KDFB 2JUCA 1R71A 1BR2A 5LEJA 1FYLA 4R4CA 2WV6D 3NAUA 4M3GA 4FT8A 3GTMJ 1F9QA 2JUGA 1PRTD 1G6ZA 2EILH 2ZJPA 1LTGD 2XRSD 2VXWA 4UP8A 2GBYA 3N97A 3F2DA 4LB6B 4LG3A 1D1IA 5NUCA 4XKVA 4DYRA 1J5EL 2JK3A 1ZYRC 3AFQA 4CKCA 4BU2A 1J7KA 5JJZA 1XX5A 2NVXH 3HZJA 1MKMA 2K01A 2MQHA 2Q2EB 2F5FA 1XNQL 2VE9A 2FFKB 4ON0A 1EU4A 2R7RA 4CDDC 2VQHA 1E22A 1UJ8A 1CA5A 1DM0B 5CV6A 4EJVA 4RB1A 2CQAA 5E1WA 2IWHA 5FKMA 4L0YB 4K0KL 1VQPI 4IFDJ 3Q23A 2VL8A 2E1MB 2G9DA 4Y17A 2PQAA 1QJOA 2UXNA 4DK1A 4WF2A 1IKLA 3KCCA 2FMMA 3B6YA 2CO5A 4U0VA 2GVBA 4AQYL 1KZHA 2UXCL 4XK4A 3ELKA 3D3RA 1D8LA 1TU2B 2KLOA 1RC9A 2LKSA 3MFYA 2EJGC 1BJZA 4ZDPA 1N9WA 2Z6KA 2QZ8A 1ASYA 2Q2HA 1I5ZA 1SD6A 4A3BJ 4C3JB 3GTMH 2SDFA 1AEXA 3D1NI 1VF9A 2ZMEB 1QPIA 2K9QA 4KMUX 1MMAA 4S0HB 3P7NA 2ESHA 3V7RA 4O2DA 4B3MQ 1SVOA 1CFMA 2L4NA 1PUFB 2AWNA 1BO0A 1O7YA 2JYOA 4JX5A 3P75A 2HVSA 5C6AA 1JJCB 4DV6L 2BDOA 4DKAC 4DR2L 2ADUA 1QVGA 1Q1BA 3CCSI 2WAQB 3S1MJ 1O57A 1CHQD 1W5TA 3PJRA 1R7JA 5EG0A 4IFDH 3HOVB 2JA9A 1HF0A 4O1NA 1WFQA 3QOJA 5ELBA 4E6IA 4XNFA 3SVMA 1N8RC 4OMZA 2E1OA 3MXNB 3GTKB 2CVRA 1OLTA 1I4PA 5CBEE 1GT0C 3I3CA 1P4WA 2PCFB 2HXOA 5LBQA 3K4MA 3I64A 2E2HB 2XAHA 4A3BH 2P5LC 2C5CA 1QNKA 3I4OA 2IW5A 1SE2A 4LWCA 1TNSA 2QKMB 5KNDA 1SAUA 1X54A 3OYHA 3I55I 2QSFX 3JR9A 3DXJC 3GF2A 5C3EH 1TS2A 3L9FA 4GNXB 2ZSIB 2NTSA 4I7ZC 4B3TL 2K3PA 2NVQB 2A5WA 4BY1B 4P72A 2PMZN 3GTGB 4IFDG 1UAPA 2V4JC 2KHJA 2TSSA 2EYJA 1AE2A 4HMJA 1Q90A 1U0LA 3M4OB 3QB3A 4A3LJ 1BVSA 3CLOA 1LTTD 4XT1B 3I56I 4IUPA 4ZDOA 5K5OA 4XT3B 2D2CC 2XDVA 4QWQA 5M5YB 4I0BA 1HKSA 5J3LA 1YW8A 1WSUA 4X62Q 5LGTA 4JI8Q 5LHY1 1C8CA 4M72A 2O9LA 3L7ZC 3G71I 1KLUD 4BEHB 1VNDA 4A3BG 3ROUA 1TWCJ 1R5HA 4QMGA 5LRSA 4JI5L 1U8BA 5AIQA 2OCCH 1SE3A 2ME0A 2OAZA 3R61A 3PGZA 1U9NA 4C2TA 4IUUA 3BG7A 4TRDA 4QGUA 1M8AA 3F6OA 2E2IH 3NQIA 4M6VA 1SYCA 1YW7A 4BJ5C 3K10A 2IHFA 3LSIA 4I99C 2L7ZA 2JWTA 1WTQA 3CJQB 4BBSB 3VDXA 2K7LA 2TDXA 3S15J 4XTCS 4ME3A 2VQCA 4D1QA 1B1ZA 2JA5H 2ZTEA 1SFUA 4PJMA 4KFCA 4DR5L 5F08A 3CESA 2HOTA 4A3LH 1X6OA 2PI0A 3Q0AA 5CC4A 5J40A 4UHVA 4X64Q 3E5XA 1X1DA 1VMPA 4RGMA 3F8MA 3FMQA 1PLFA 3AAFA 1GXDC 1JUSA 2CW0F 4S04A 3DPTA 2NOGA 3TZUA 1ZGJA 3RZDJ 2Y9YA 3G7LA 5CV7A 4KIBA 1DYQA 2BA0A 3C3LA 1R49A 4ZZDA 1TWCH 9ANTA 3DLLF 2I0QA 1IL8A 1I4QA 3HEFA 2DA6A 1NK2P 3CQZB 4HQMA 1YOVB 5JJKA 2LY7A 2G0EA 3IP4B 2V9VA 1Z9FA 1XJVA 1YHQI 3FXJA 2SNMA 2GVAA 1AFPA 2DA2A 5KRUA 1Q1EA 5FKOA 4GKKL 4ZYDA 3AL0C 1EY9A 4C3HJ 4UV8A 5K36H 1SE4A 1ON1A 2WA0A 2KVMA 4L9JA 5M5XH 3E3XA 4A3KB 4OIQF 2Z9HA 3ZOBA 1E2ZA 4A3LG 2EB7A 2M9VA 3C7JA 3K2ZA 2MGQA 1FZPB 1FGUA 2HDMA 3V42A 2MC4A 4ESBA 1WH5A 4X1EA 4R4OA 1F5TA 3ZJYC 4PSWA 4LF6L 1WTWA 1BI1A 5E8IA 1XTAA 1YJNI 5FO8B 5E18F 4YWLA 1O78A 3E97A 1HR0L 2LKVA 3ONQA 1TZLA 5BQTA 4E7HA 3MWYW 3A54A 1VQ5A 1OYYA 3K69A 4WJWA 5JPMC 4IF4A 3ZGKA 4IHYA 1Q82C 4LF9L 1Z6RA 1REPC 4JI0Q 2Z4IA 1Z67A 1RESA 2LMDA 2W57A 4BDZA 2EZKA 3GTQB 5K36G 3EDPA 3BWGA 3KLSX 2X6LA 2LXJA 3GV6A 4BH9A 2RDHA 2KJCA 3EETA 2XGXA 2GXGA 1YX3A 1EL0A 4EEFG 1ZXTA 4C3HH 4WXCA 2B8GA 3MKZA 1STBA 4BE0A 2UXBQ 2SNSA 2EXZA 2UWMA 1R23A 1FNUA 5HDGA 1Q81C 2QCOA 4EJTA 3BQYA 1UG2A 3HRTA 1O3SA 3T16A 1WQ2A 1ETXA 4HOBA 2KIQA 3PQIA 4APVA 3K80C 2JA7H 3IAS2 4U7BA 4FE7A 1FYMA 1KAWA 1H9KA 1XMQL 2LKXA 3BVGA 3J80L 5DUKA 3BG6A 1IJWC 4AVPA 3RYRA 1FJGQ 4UY8C 2X48A 4HMIA 4NQWA 3FM3A 3K6GA 3HGGA 4RH6A 1ZELA 3MXPA 3CD6A 1F9NA 1ENHA 4RCOA 4M73A 2DOAA 3CC7A 1PH1A 1A6XA 3P9KA 4C3HG 1JJ2A 5DV5A 5GAEJ 4KN4C 5EZHA 3FKIJ 3C2BA 2MFIA 3MEXA 3S1QB 1A36A 3A74A 2A74C 5K5RA 4AYBN 1BDOA 4PV1C 4YY3L 1TP4A 3FXKA 5D6EA 3FK6A 3OWEB 3HUGA 1Q86C 1ZEQX 4C9YA 4FXKC 2O03A 5LMNW 4PGGA 2OTLA 5IWAL 3WG9A 4HAMA 4B3RL 3SXYA 2VNUD 2DT6A 1K78A 3AG4H 3D5RC 2FJ2A 1PXUA 3R3OA 4CJ2C 5IGGA 3BQZA 4Q48A 3MZHA 3S1NJ 3HRZC 4CJ1B 3HJEA 2VL6A 2Z6KC 3NTHA 2DA5A 3WGGA 1ZRDA 5FOBB 3OYGA 4IHTA 5ELDA 4DAMA 2O5RA 5E3LA 1HKTA 2NNNA 2YV5A 2R61A 1T0FA 2UXXA 1S8NA 2EFWA 3P9CA 1WTVA 2EZVA 1Z47A 2DJIA 3FXMA 1B50A 4MEXF 2CUEA 2F3VA 2QLZA 1HW2A 4UAIA 1H9MA 3AG3H 4OEMB 2F0KA 2Y75A 3I91A 3QAHA 2J5OA 2WKDA 5EPJA 1Y8QB 4A3DJ 4XIDA 2B2YC 5D5XB 4DZPA 1F2MA 2QCPX 4KITB 3DWPA 2E71A 4AIDA 4BWGB 3K4JA 1FGBD 1PH6A 2DAOA 4XIGS 4CDEC 3ABKH 3D0FA 3LMMA 1YJWI 3TEHB 4P2CB 4X66L 1YITI 2I5HA 2AUJD 1U5TA 1W7PD 1UFMA 3DBHB 2JRMA 2JMWA 1YI2A 4HNVA 4RB3C 4HA8A 2FMLA 4RFBA 2J5PA 3W6VA 1RUNA 4BNCA 3OV8A 4I7HA 2RSNA 5J1RA 3P20A 1YHBA 5I6YA 3S1NH 1HPCA 4UUVA 1DGSA 5KAIC 2XPUA 4HW0A 4GYGA 1QO0D 5ICEA 1P8LA 2LMCB 2CW0C 2A6EF 3BG9A 4KUMA 3IAM2 4KHPL 2L11A 3W2VA 5HOOA 3J80c 4TKOB 3LA3A 3RD4A 1XDUA 3FKIG 2KDZA 1B59A 1VQ5I 3A8IE 2XASA 1V1OA 3LSHA 2F0IA 4TV7A 3GUDA 4CCNA 3KLOA 4F92B 1YG2A 3BTLA 3T0YA 1U6GA 4M1UB 1P7JA 4AWXB 3PM1A 5GAEC 2B3GA 4UVBA 3I54A 3H0GB 3ND9A 3SE0A 5KYLA 1S5LC 1TWHB 2PQAB 5FKNA 1BJAA 1S40A 1SNMA 3HHGA 2XAUA 3F0CA 1TKWB 3G1MA 1Z3XA 5BOXA 4FYDA 2KISA 2MO1A 3QPHA 1PYVA 5IGEA 1T39A 1Y1WJ 4L8JA 3CDHA 4DXGA 2OEOA 2HFHA 5C4ZA 1HUNA 2NVQJ 2XPWA 1F1ZA 1BCPC 3GTGJ 2FF4A 3GTPJ 1F77A 3SZGA 2BW3A 2N88A 2VBYA 1UE5A 1EIHA 2EQRA 2YTVA 1FOKA 4DV2L 3OTOL 1KQ0A 1QUQA 2PJPA 4RCNA 1UE7A 2BVLA 4G4KA 3SJMA 1V43A 1VQFA 3ER0A 4MN3A 1Y14B 1Z6HA 2HQRA 2WAQN 1R1TA 1XMXA 4A3DG 4NXNQ 2I8DA 2DK8A 3GTKH 3CC7I 3DV8A 1NTCA 1FBSA 2VC1A 1RR7A 4BA1I 2G9WA 5C3XA 1XWEA 2BOLA 4G6DA 3NSWA 2F4OB 1CT1D 1JQYD 2VQLA 2PI2E 2XWJB 2JA2A 1VQMA 2E2HH 2CU7A 2EK5A 4OO1I 1R1UA 5EG0B 1ZLJA 4R4QA 5IYBJ 3TS2A 1T98A 3OYBA 2X1EA 2KECA 4LMYA 5GPAA 1VQHA 1EY8A 3I59A 3W3CA 2IAIA 3DPLC 3PO3J 4DAVA 2PEXA 1XXGA 2EFNA 1JGSA 3WTWC 3Q0VA 1VQKI 1Y1WH 3LFUA 2CJJA 2EV5A 2R7SA 2DJGC 2F0NA 2ICIA 1R00A 2NVQH 5HS7A 5FO7B 2WAQG 1ZRFA 4ID6A 3GTGH 3L09A 3GTPH 1WTHA 4JBWA 2NS7A 3E5SA 2UU9L 2W7NA 2M7BA 3M4OH 2BVMA 2NXNB 1Y1VB 1MJ9A 4JCVE 1I39A 4M9SA 1NMGA 4LFUA 3CCYA 1VQ7I 4BE2A 4I76A 1SNQA 3L9AX 3CCEI 2DPDA 2PFBA 1RKWA 4CXFA 4X0GA 2FXAA 1QA6A 4A3MJ 4M6XA 4DR4Q 2FE3A 4HAEA 5GPCA 1L2FA 1FOXA 1ZRCA 1S9HA 4AD9A 1G59A 4ZJZA 2TRTA 5H1SE 1JT0A 1JC7A 4Z9CB 2K9SA 4ILWA 1D3YA 3CZ6A 2BE5C 4LF8Q 4XR6A 2XB0X 3NXWA 3RLNA 4WORA 1BI3A 2XGTA 4IO9A 2VQFQ 1N34L 1KU9A 2VOPA 3KFUA 3ULLA 4FE4A 1YRNA 2D1VA 5IYBH 2X69A 1G51A 2ID0A 2MC3A 1Y1WG 3KP4A 2M2EA 4RGUA 2JE6I 2COMA 4HRIA 4CKEA 2A5YB 4LUOA 1C0WA 4BBSH 2Y48A 2G7UA 3K1PA 2RREA 2NB0A 3CCJI 1MNEA 2QBYA 1VQNI 1TWGB 4XYOA 3PIPA 2RAEA 4HIKA 1TWFJ 1I94L 1SXTA 3OOUA 4J6HA 1ZGAA 1Y0UA 1D0ZA 3IKVA 2COBA 1XSXA 5LD2C 4OIOF 1JOOA 2V9KA 5C44J 3QP6A 2H6BA 2MBFA 4IURA 1UELB 3CMAI 1VQ6A 2KIMA 3G6EA 1SNPA 1IN6A 1OKRA 2KHSA 5FROA 1VQLA 2EDGA 2ZO4A 3CDLA 1OXUA 2LSSA 1BBWA 4PGHA 4XORA 5D3IB 5IYBG 4IHSA 3HOWJ 3KP2A 1KDBA 4DR6L 5EEHA 4DAYB 3CQZH 2QKLB 3PO3G 4HEA2 2LKPA 2FRHA 5IODA 4JV5Q 5LHHA 2HDWA 3G3ZA 3K5LA 5HS8A 4CYDA 2MYSA 3K7UC 3D5LA 4F8MA 2NOJB 2N8GA 2PMHA 1PH5A 2VBWA 3FXUA 1FP1D 2QEXA 2D5VA 5TSSA 1EU3A 1LFPA 1B9NA 1TWFH 2JVGA 1IZ1A 2X6WA 1MMNA 3K81C 3HOXB 1C9OA 3OWFA 3HZXA 2XROA 2GXBA 4R1JA 4JI4L 5K1YA 4CCMA 5D4SA 4A3MG 2KQRA 1VQBA 5C44H 4U0YA 3TP0A 4FX4A 3HYIA 3QO2A 2VI6A 4N0BA 4EQPA 1U5KA 1D1AA 3FXOA 3E6DA 3GW2A 4DUZQ 2FBHA 1EYGA 3F9KA 2CV2A 3P1HA 4UB6C 4BHCA 1UEBA 1X1CA 1HR0Q 5BN4A 3HOWH 2HZDA 4I02A 4AUXA 2VKHA 1HDPA 3IKJA 2EH3A 4UVCA 1B1BA 1Z0XA 2VPRA 1ZYRD 4BQOA 2XGEA 3GTQH 1IYJB 1B4OA 1SVLA 3W2WA 3PIO3 4KV6A 2ELJA 4JBJA 1WJAA 2WY8Q 4DV7L 1STNA 3MAQA 3ZMZA 1QVUA 2B2UA 1ZREA 1R4NB 2MD0A 4N8FA 1MSHA 4OX9Q 5ELFA 2IS1A 3NELA 1YHAA 1T0FC 2H8WA 3X3NA 1DCZA 3H5NA 1H95A 2YR2A 5C44G 4MQVA 2GM4A 1ZARA 1P4AA 4DGZA 3QPLA 2P7VB 3H0DA 2F0GA 5DEQA 4NXMQ 2H5XA 5FLMH 2N8NA 1VQIA 4CCLA 4FXDA 1IZ6A 3G6JB 4XKCA 3HOWG 4LFAL 1V8QA 3DEPA 2Z9OA 1RKTA 1H9TA 4HR7B 3FIWA 1NR4A 3ECOA 2DJNA 5EJCA 4WXHA 3A7AB 3RJPA 4J8QA 1X3QA 3L2QA 1U5TC 4P73A 4C2MB 3I8ZA 1MJEA 3VODA 2UZKA 1N33Q 3F3XA 2VKDA 3NQOA 3D4RA 1JE4A 1JJGA 2QILA 4P5OA 4BBRB 3S1QH 2ZFWA 3HKZG 4R4TA 3DKWA 2XRLA 4BKXA 1X2NA 2XSJC 4L5TA 3GO5A 3H92A 1IBMQ 3CU7A 3H91A 1G2TA 2F1MA 4BJTA 3S17J 5HLGA 1B3AA 2B29A 3Q6SA 1FC3A 3L0OA 5G3LF 1ENFA 3M7NA 3H9JA 1S5ED 4GN4B 3K8AA 4CCKA 3X3MA 1OTCA 2NYZD 1SMYF 2Y0MA 2QW7A 1L3LA 4NB5A 1KTKA 1YYVA 4DAPA 1JICA 1T5EA 3S14B 1EWIA 1YBYA 4PMBA 1XPOA 1VTNC 4UXNA 2FX0A 1QRYA 4KY5A 2KCTA 3GP7A 2HWVA 2UV1A 5CVVA 1H9GA 3LAJA 5HDKA 3JRBA 1FTZA 4MFEA 2FXQA 2RVCA 3KJOA 1WYDA 2R7TA 1BXTA 1JXSA 5K5PA 3A4CA 2KENA 4BHPA 4QTRA 4L63B 1A31A 5EGOB 1IG7A 4IOAF 2YU3A 1X65A 2OA4A 2GIZA 1VI0A 1WOCA 5BR8L 2K4BA 3BJ6A 1ASZA 3TREA 4AIJA 4IQZA 4YFKF 1PRTC 2TCTA 1AE3A 5E79C 3MA2B 4MEYF 2Z33A 4QF4A 2VKEA 1FL0A 3DP7A 3H0GJ 2F0TA 2J0TD 3CUQB 1TWHJ 3BR2A 2PMZE 2MW8A 2VN2A 3BZDB 4KJZA 2M5WA 3S17H 3EUHC 5IY5H 1SFEA 1OJLA 1A6QA 2VUMB 2IT1A 2L9SA 2CGPA 1SYEA 2DQRA 2YU9J 2ZJQF 3T1HL 3RPUD 1D5YA 3PUWA 3R2IA 1A62A 1GUUA 1QZGA 2WFWA 2KFDA 2R7FA 1X3FA 4A0YA 2EPBA 3BCBA 4GS3A 4HV5A 3A2KA 5C5MA 2VQEL 4XKWA 3R0JA 2L4MA 4KICA 1U5TB 4LFCQ 1FR3A 1KYZA 2FOWA 1ZHFA 2VONA 3MWMA 4JI3Q 1P2FA 4U7DA 2FINB 3CKIB 5JPNC 3F8NA 3LWEA 4YG2F 3K4CA 5M5WB 1HFNA 1SBBB 1DU6A 2BY3A 1K8OA 1HOMA 3BR5A 3H09A 3FWEA 1IO2A 2CH4W 1O80A 2ISYA 3T1YL 3H0GH 1QVFA 2HGCA 2IA2A 2VY3A 1TWHH 4LUZA 4LB5A 3FK7A 4IXAA 2K5NA 2OWOA 1QZZA 1Y0NA 3BOQA 1N32L 1B8AA 5I2YA 1TIID 5BPIA 5CV8A 2YU9H 1OR7A 4X3TA 1HHVA 1SROA 3CCMA 4HJ9A 3KEYA 3T1BA 2BCOA 2LR8A 3EYYA 3QP5A 2HTSA 3G4SA 4RAFA 2RHQB 3VYUA 4G7HF 2V7FA 4H0LC 4JI1L 2XAGA 1FIAA 2P7CB 4JBKA 1SNCA 4EMSA 1Z9CA 2MFZA 4M6YA 4HSTA 3W2DA 1S7AA 2VOOA 3V7CA 2P5ZX 3V8JA 4HCEA 1KNEA 3RMHA 1LVAA 2WINB 1BM9A 4XQJA 3NARA 2FBKA 3VYSA 2H8RA 1K8AC 5ELCA 3H0GG 2GIVA 4JI6Q 1S3OA 1ETYA 4LFBL 2QQAA 3SFIA 1PFNA 2K14A 2BW3B 1PZJD 4QL5A 3DF8A 4OWTB 4CDCC 1W5SA 4OGQC 5CYVA 3A0BC 1T33A 3NWSA 1JT6A 4XM3A 3OYFA 2ME6A 1EF4A 3WDNA 3S1RJ 1CSPA 5CVRA 3ZCOA 3SQNA 1B3QA 1MNMC 1PDNC 2IL8A 3E5QA 1SYFA 4Y7NJ 1TWGJ 4A93J 3DM3A 3VYRA 2A6TA 1D8KA 2R93J 1KQSA 2FEZA 2EA4A 2M00A 5IT9Z 3PNVA 1T56A 1QG7A 1UHSA 2A8VA 1O7IA 3ABLH 5HLHA 2QVOA 4QPQA 3NBIA 2CMPA 4E7IA 3I59B 3ZQHA 2HQ5A 4DUYL 3SK6A 4JG2A 5K7HA 1J0RA 4JYKA 1RF2D 1IN8A 2YPRA 2XF7A 3K70C 4IJLA 1IXCA 4KKSA 5LMNL 2DA7A 2LYCA 5BN3A 3TZDA 4KMUC 2OF1A 1BBUA 3AG2H 5D6FA 2CV1A 4E7KA 3KK7A 4A3EJ 5GADJ 1ET9A 5KGUA 1B70B 2VT2A 2Z1DA 1X3WB 3U1DA 1W0TA 4PUSA 3ABMH 5ILUA 2RV8A 2SOBA 2E2JB 1QCBD 3CF5A 4CCOA 1EV7A 1DP3A 1TC3C 3S1RH 4LF5Q 4LK1C 1JHHA 2A68C 4C3IJ 3IL8A 2JVHA 1I5FA 2E75C 3W1BA 5C5LA 1TWGH 4A93H 5JLWA 2R93H 1B6AA 1ITYA 2Q1ZB 2K9NA 2H27A 3HOXJ 2WKCA 3HDDA 5EAYA 4DFAA 3DWQA 3TL4X 1LFBA 2JA8B 2FMYA 1D5XC 4GRIA 3OW7A 2E35A 4RGXA 3OY9A 1OCTC 1R5GA 1MHWC 3RZOJ 2Y9ZA 2MJ8A 3VA5A 4ENMA 3NPPA 2OQ0A 2B2UC 1GVDA 2QBYB 4IHWA 2H1LA 4ZUJA 2DBBA 4RS8A 2EJFC 1ETOA 5F0HA 2CHBD 3JCUC 3N4MA 2E60A 2NVTJ 1ERDA 2E1CA 3WU1B 1BNZA 2BHYA 3OYNA 2M8GX 4ESFA 1A63A 4WWCA 4UHTA 3S8PA 2ZFUA 3KLNA 4ZKBB 4A93G 2GXAA 1R36A 3HPHA 1E3HA 1SFXA 2R93G 4LGWA 3MEHA 3FVQA 3I5UA 2E8GA 4C3IH 3WTZA 4C2UA 2ELKA 1TY0A 3L7WA 4MGRA 3FMSA 1LTID 1NAPA 3PF4A 1FNVA 3HOXH 3CCMI 1DZ1A 4NDLA 3GZ5A 1K61A 5IP9J 3SK5A 5H2FC 1HTLD 2GWRA 3G1LA 4Q5SF 3ULPA 3RZOH 1K83B 1V5EA 4ANJA 5C4JB 4DV5Q 1NUCA 3I58A 2K4JA 2DNCA 4A3EG 1FBUA 1VQOA 1IBLL 5FLXZ 2NVTH 4MHEA 1E0BA 1K4SA 2K5VA 4FDBA 3ULJA 2DMQA 2DDAA 1HNWQ 2HZTA 5F2DA 2Z3YA 5ISRA 1EEID 5FLXE 2JA6J 4ZYHA 4C3IG 1S72A 4II3A 1ZG3A 1GKHA 3I4NB 3OR1C 5T1IA 1FD7D 5M3FJ 2F4MB 4RWSC 2CW0D 1IN7A 3BPVA 3CTAA 3Q9SA 3HOXG 2M7AA 4K5WA 3M3YB 4M9XA 2M87A 1EIYB 3EYIA 3NHHA 1DOKA 4MTKA 1HTPA 5C0XI 3L1PA 5GAGC 1TT5B 2WY7Q 4V2GA 4G8XA 2LNBA 1EQVA 3VDYA 1T6SA 4JYAL 4ENJA 3ZR8X 5DAUA 1XDSA 2ZM6Q 3HG9A 4LJZC 1PFBA 4HCSA 4GN5A 5B3SH 5IP9H 5L3DA 5JEAH 3S14J 4G7HC 4BE1A 2IX0A 1BOAA 4RM3A 2QDLA 2D0PA 3BS1A 1MD2D 1Q3LA 3DEWA 3M07A 1SNDA 4BY7J 1G291 2JPCA 4KYWA 4DV4L 3JRFA 2QF7A 1NR2A 4C2MH 1VQ8A 4PG3A 4IPDA 1XMAA 2JA6H 4AM3A 4ITVA 1BCPD 4NP5A 1STYA 2V4DA 2W84A 4FASD 2Q8TA 2CQKA 4IX7A 4V0BA 2K03A 3LSGA 1CSQA 3J7YW 3NK9A 3JREA 2EY1A 2D45A 1YO5C 1RKNA 1DOMA 1CK1A 5IPAA 3M4YA 4NC8A 3CO6C 3I4MB 1AW7A 4QJFA 2JSCA 5IP9G 3CMEA 1ICFB 1PTOC 5JEAG 1RTOA 4CGYB 2B8FA 4PZ7A 3KP6A 2BBYA 2M30A 1HNZL 3ABTA 3NWTA 3GCMA 4A3CH 4OO1H 1S5CD 3J80i 3A01B 1X32A 2EFOA 2K5HA 3S14H 1HQMC 3KLWA 3GFMA 4HSVA 3K0XA 4RB2C 4F52A 1QVCA 3OPOA 1BR9A 3CCUI 4EQOA 1NH3A 2F0WA 1XX8A 3ZPLA 2AQ3B 2NTTA 3I53A 2CQXA 1IBKQ 1O7FA 2DY8A 1MH4A 3KIOA 1BF4A 2JA6G 4DR7Q 3V7SA 2QDBA 1M1KC 1KU3A 3OYMA 5FJ8H 1DGRM 2VBXA 3JC66 4F91B 2FU4A 3SYTA 3GV3A 5M3FG 3MFKA 2HQEA 1NHAA 1SSOA 2EY6A 2F3IA 4NDXA 3PO2J 3CF2A 3SGIA 4IRIA 3F23A 1YNND 2K5QA 4EQ5A 4MTDA 2I5LX 4L5QA 3TDUC 1YLFA 4OO1G 3CPWA 3OS2A 1A35A 1PVOA 1JORA 2L0KA 1KRSA 3JRGA 3CP8A 4FQGA 5H6RA 1ETQA 3A56A 1XMOL 1X1PA 5D65A 2PJRA 4LIVA 4CUGA 2X51A 1STHA 4FF2A 2K5DA 4BY7G 1HNXL 2HUGA 3D4WA 2DDBA 2HHHL 3DEOA 4AU7A 1VDZA 5D14A 1SVMA 5J8FA 1CF7B 1PYSB 2JSOA 3HGBA 1RIOH 3ERSX 1XSVA 2VT3A 2R3ZA 4X65L 4KLKA 1K9MC 1A2UA 3H3UA 2B2VC 1FPQA 2BYVE 1K0SA 3T53B 3M4QA 4YIJA 1Y39A 2R92J 1MW7A 3GX4X 2F4VL 2Y69H 1MBEA 2Q2TA 3W6KB 1CI3M 4E7SA 4HYEA 1S72I 2CS3A 3RN5A 3PO2H 3DTIA 2EPFA 2X9DA 1XCVA 1HZCA 4HTHA 2E5LL 1A2TA 3KBGA 1II3A 4GYIA 1YIOA 2LD5A 2M4GA 5D5VB 3WGHA 2DFIA 1WJBA 2KHIA 1HW5A 4KDPA 3TW7A 3S2HB 1DQUA 4A3JB 5I9PA 3E6MA 4JX4A 3KEOA 3AQQA 2EZIA 3HSEA 3I70A 3SZPA 2GOXB 5E1ZB 4DR3L 1X9NA 1UEAB 1Q8KA 3FP9A 2QSHX 2RVLA 3LSMA 2MG4A 4DV0Q 3RPUA 2GZWA 3PO2G 3NBHA 1EH6A 1FBQA 3R93A 2WB1G 4K2KA 4IPGA 4ABZA 3OL3A 1VF5C 2EIKH 1SR3A 1QILA 2OD5A 3OS1A 2UUAL 2CQOA 3M8EA 4P9FA 2HQNA 1PP8F 1W7PB 3VYUB 2XC7A 4MFDA 5DNFA 3HOUB 1FP2A 3F21A 3ZMVA 1BUVT 2A6ED 4KKTA 1CKNA 2PQEA 3F8BA 1HCZA 1ESFA 1USTA 4XYQA 1YIJI 2DT7B 2K02A 2CWAA 3VYSB 5FD6A 3PNYA 1X4PA 1J6QA 3FRPB 2L4AA 2F5CA 1BKBA 4CZCA 3LGJA 2ECBA 1I6HJ 2I07B 2PZWA 2Z4HA 1SN8A 2UXDQ 2OF7A 2R7WA 1FLIA 4R4IA 3H15A 2V1CC 3J81Z 1SJED 4H7BA 5JAVA 2KEEA 2KQ3A 2DMUA 1GHCA 3V05A 2AWOA 2WV1A 2KIFA 3J81E 2X6YA 1LYLA 1X56A 2R92G 2NYXA 2X6GA 2YS9A 2E1NA 1OISA 1SJHD 1BBXC 1WCMB 1MNDA 3UE1A 5KAFC 3FMRA 4BACA 2ICWG 1QWYA 1TWAB 3VYRB 3ZN0A 1IGNA 5L3GA 2BY0A 2JTVA 4G7OF 1HA5A 4BHBA 1U8RA 2K9LA 2R7QA 1R5ID 1YJ9I 2STTA 4FF3A 2E2JH 3HOZJ 2HS5A 2XPVA 2PW7A 5HLIA 1ZQ3P 4DN4M 2P4WA 4F3QA 2VQGA 4IQ4A 5AFWA 4RAYA 3GBGA 1YNJD 5EPLA 3P7JA 2VJ5A 2W24A 1IW7F 2KL4A 1GHJA 1I4RA 4E4HA 3PIOF 4HJAA 3PUVA 1RCVD 3SHLA 3ZRGA 2F4IA 3CCLA 1RUOA 2PBIA 3NENA 3E6ZX 3MKLA 1ENAA 5E3NA 3HIFA 5HLTA 3GTJB 1S7OA 3BZKA 1OCOH 2CUFA 1LO5D 4RA2A 4GDFA 1FNWA 1PH4A 2K5CA 2UUCQ 2XRNA 5C4JJ 3GTOB 4FTHA 4DQ2A 4IJAA 3OL4A 2GA2A 2AMCB 2OXPA 3RKQA 1BA5A 4LLLA 4JOIA 4M8AA 4GKJQ 2HDCA 2PMUA 2BHZA 2NVXJ 4YWKA 4P55A 1KQ8A 1HJPA 2QQ8A 3DKYA 5FK9C 2A61A 2ZTDA 2EBIA 1KYWA 2WADA 3O3KA 2OQKA 5JVG3 4POFA 1STZA 2KBNA 3U50C 1POGA 4BQAA 3HOZH 4RMNA 1MJBA 4FETA 4Y33A 3A5UA 2C6YA 1YTYA 1FWZA 1R6RA 4G6TB 2DN8A 3T13A 1Z91A 2IBDA 5EF6A 3DKXA 1GV5A 4GZYC 1ESRA 1F36A 4ABNA 1SAPA 1FX7A 3WTSC 1IYUA 2VKVA 2DQLA 3JRHA 3OYAA 2JJQA 1DP7P 4EVIA 3H94A 4I65A 3U21A 5C4XJ 2DOFA 3FXRA 4PJNA 4OAYA 1U9RA 3BP8A 1K83H 4LNQA 5C4JH 3ERED 3C2PA 2MLGA 1UCRA 4UUTA 2ZNZA 1OPCA 3PUYA 1ZLKA 4YCUA 5ICCA 1L0WA 1G8ZD 3QOPA 5F0FA 3VR5A 4ZDLA 3HOZG 2F0UA 2LDUA 3CC4A 5ELEA 5D5UB 2CW7A 4BQNA 2ID3A 2HDLA 4HJ5A 1N36Q 3I4NH 3IFDA 2ZCWA 2O8XA 2R7DA 1VS0A 1XSDA 1EKEA 1W4MA 5DM63 1GUGA 2DI3A 5F1JA 2ECCA 3H3VC 1GM5A 3W1GA 4FHTA 2HYGD 2VASA 2ZJRF 3DBLB 2KJXA 2L2OA 2RSOA 1JUMA 2PN6A 4XQQA 1JTXA 4HIDA 3NEUA 2K85A 1V4RA 5CQGA 4U68A 1X4OA 2HCCA 4ESJA 2KP6A 5C4XH 5CV9A 1JOQA 2NVYB 1FYKA 2KCMA 5CJ9A 2C35B 4EV0A 5C3EJ 4Y13A 4UVAA 2M8EA 2XAFA 5GROA 1E3OC 1GHKA 3BTIA 4RMFA 3VR2A 3WG7H 4DK0A 2B2YA 4NKLA 4OHJA 3CCQA 2L9RA 1ZG1A 4IN3A 1BW6A 5FLXL 4A3GB 1EY7A 4K5XA 5D8KB 1IDYA 3DLAA 3R8BA 3GTLB 5DCMA 1KGSA 1T9HA 4L5SA 1MBKA 3HC7A 4PFOA 1E2VA 3LQRA 4DV1Q 5E4XA 3BDOA 3CC2A 1BL0A 1FMVA 3HOYB 3L2UA 5HGTA 4F7ZA 3LWUA 2O4XA 6PAXA 3HFZB 2M3AA 4D5CA 1U78A 4UUSA 1JKOC 1JB3A 3D0SA 2OPTA 3ZQ7A 5EYRA 4ZC3A 5JHFA 3I4MH 4U88A 4KD4A 1BOSA 4HPQA 5C4XG 2MSYA 1GLNA 2BV6A 3MZYA 2ZXHA 2CWPA 4DV3L 2PO4A 2E2IJ 3CCRA 3DUZA 1HNZQ 2OTJA 3JRIA 5AIPA 4LD5A 3DLLA 5F04A 1SRUA 5E7NA 4MHGA 1CKMA 3C46A 4LF7L 1LVKA 2V1XA 1GUNA 3SK4A 1H8AC 2QKIC 4IPAA 2JA5J 5EJWA 2KRCA 4HEDA 4WJ3M 1MBJA 2HEOA 1HXYD 2OC6A 3K57A 3A7LA 2NZ1D 3UI2A 2ZXRA 1NNXA 3I72A 1MBGA 3R6SA 3VEPA 3RN2A 3QRFF 5GAHJ 1IRZA 4ZK9B 2LFBA 4QUCA 3SDZA 1XGSA 1LUZA 4PJ0C 2IEKA 1IDZA 3AU7A 4CO8A 2X4HA 3B6CA 4L6TB 2Z1CA 3FBNB 4WFN3 4BA2I 4JOMA 2PPBC 2F0FA 2O5JC 3L2VA 3K70D 3FM5A 2XAQA 2L02A 3KETA 1I27A 3JTGA 2NZOA 2WP8J 3X2QH 1HA8A 1Q12A 3S2HJ 1PH8A 5C3EG 2AXLA 3RKYA 3RR5A 3JAMZ 3BZCA 1IUFA 3GLXA 3GFJA 1FSEA 1WJDA 2ZTCA 3CHBD 1HQRD 4A6DA 3ZMUA 1JT8A 3REOA 1L0OC 3JAME 5M5XJ 2AHOB 4KIFA 4ZRZA 2RDGA 2NVUB 2NN6I 2KOLA 4KK7A 3F8CA 4IOCF 1HH2P 3I2ZA 4FP5D 2A68D 4GLVB 5CLSA 5G3LD 2HQLA 3H35A 1PH2A 5F27A 5JI6A 3DPUA 1JOKA 4DBRA 1KXLA 1TVXA 5FRNA 1Y8NB 3HRMA 3V96A 1TLHB 4A0ZA 3JAMK 2L5TA 1ETKA 2ASBA 4C30A 1G3WA 4DK6C 5L3EA 2BZTA 4F88A 3JRCA 2H4OA 4IZ8A 3R4KA 5FLXc 1Z77A 5K7ZA 3WTXC 1U4LA 1WVLA 2BH8A 1WRJA 1T2KA 1I3QB 2ZMEA 2W48A 1S29A 4YHHQ 1JWSD 1LJ9A 1MGTA 3DTKA 4DYCA 2DNEA 4PNYA 1T08B 1HXDA 1Y56A 3S2HH 2M4KA 4WJ4A 3BR3A 2DJFC 3MEFA 3CRLC 4JI2Q 2EYHA 2WACA 3QJYA 2JA5G 2ID6A 3KOJA 2WAQA 2EYOA 5KK1A 1IYVA 1FOYA 1H0MA 4B3ML 3KZYA 1J75A 1QHHD 5T1GA 5KYIA 1RJTA 4PDKA 4NMZA 4AH6A 5C0XJ 4HX4A 3M1EA 2JA7J 1F9RA 2F52A 1CZWA 4J15A 3CCQI 1GDTA 1LT5D 3K59A 1CGPA 1Z7TA 2EYMA 3C1EA 2HNHA 2GOMA 4OOIA 1GD7A 1H89C 2QA4A 4RHSA 4M3DA 1JHFA 4N9PA 3OMCA 2YX7A 4F93B 1T95A 1WTOA 4NW2A 5CBAE 3OR2C 1XGNA 2ES2A 1EYAA 3HOUH 4KJOA 3G2BA 3A55A 2XUBA 4A75A 4HG2A 4PCQA 4RKLA 3NBHB 3PQKA 2ACJA 5LMUQ 1NCVA 1G8XA 4Y52J 1G3YA 1NMFA 3EVQA 4JOIC 3QG1A 3LSPA 1GXPA 3OYYA 1A6IA 4A3BB 3EQLF 3MAJA 3ICEA 1SD5A 3FHWA 3H6MA 1CKNB 2X1CA 3TDQA 3VR4A 3SHFA 2OTJI 4D5FA 1K6OA 4LUVA 2DYRH 1SFOJ 2LOOA 2LBFA 2A07F 2E36A 4YCVA 2XKOA 4I6ZA 4FISA 4HJ8A 3G1OA 5C0XH 4KTAA 4O3MA 2RQXA 3IL2A 1F2LA 3K1MA 3S93A 4M3EA 4BEHA 1QHGA 3BYYB 5J4YA 2DTRA 2A19A 3JSOA 2K1BA 4XRSA 2LF8A 3TP7A 1ET6A 2FA5A 3S1MB 1YS7A 5CMDA 4X62L 3VR6A 1UHWA 4MIUA 4AIMA 1JKQC 3I71A 3ML6A 4L5JA 1JCKB 2FD5A 4ZTFA 2VXDA 2K28A 1LDDA 3KF8A 4Y52H 5AJ3Q 2CV0A 2KPMA 1XMKA 1X3PA 3UDXA 3AL0B 3PUXA 3K4BA 3PCOB 1V54H 3FX3A 1AWCA 2L5QA 1IF1A 1EH8A 1WVRA 2F0MA 4LITA 4O5VA 2N78A 5C0XG 2X6XA 3GTJH 4ALPA 5DM7F 1D1BA 2GLOA 2EVBA 1SFOH 1N75A 2K33A 2JSPA 3WWVA 1W3SA 1XNRQ 2E7XA 3J81L 1XCBA 2JA7G 2ALYB 5FGMA 2UUBQ 1TS3A 3M9BA 1R58A 3HM5A 1IAWA 1W6KA 3OIPA 1XGMA 4HDVA 2VC0A 1B4AA 5CPRB 1H9SA 3GTOH 4POGA 1V1PA 4RAUC 4X64L 1ZYRF 2V1NA 1VQ4A 2P5KA 4X3SA 1KHIA 1PTOD 4PZJA 3O13A 4JI7Q 2LSOA 4HNTA 4RGOS 3VWBA 4K6DA 1FEXA 1HQCA 1GVPA 4M3FA 4B43A 4QIWE 2RC4A 1DPUA 2E74C 3FEWX 4AYBG 1FT9A 3PSFA 4B3SQ 2V26A 3CCVA 2E34A 2K9MA 3ASOH 1E2XA 2NZHA 5BNGA 2X6OA 2E2DC 2KA7A 4LF4Q 2E7WA 3ZQIA 1TW2A 2JT1A 5EKKA 1LQ1A 2XTIA 2IP2A 1CQTA 5HNHA 3IRRA 4N9IA 4ZLTF 3ZMSA 4H02A 4XQFA 2NUCA 2ICEC 3QOLA 4G94A 2XV4S 2L1BA 3ISPA 4B3XA 4C3JJ 1UNSA 3S15B 3C2GA 5EGTA 4DJAA 1OYIA 3RQ4A 1R4QB 2HI3A 5GP9A 4Q47A 5A2QZ 3HSFA 3QIAA 2ZXWH 3SR1A 1J5EQ 1SANA 3NTIA 3OOCA 2WBMA 3BU2A 3BDCA 3ZMTA 1WD0A 4XKBA 2Q2IA 5A2QE 3RZDB 1ZN2A 1HA6A 1XNQQ 4UV9A 1VQPA 2IA0A 2BEOA 4JI0L 3SDBA 3HOVJ 1RHPA 4BUPA 4XLAA 3LSJA 3DWLE 4K0KQ 2A05A 1HLVA 3TEDA 3S2DB 3CPFA 4EJUA 3HKZA 2K6AA 2D1HA 4GLXA 2A6HF 3GTKJ 2QQBA 3C1DA 4NPSA 5A2QK 2QEJC 4EJWA 5CVIA 3K7AB 1J9OA 3JTHA 4EQQA 1EOVA 4AQYQ 2UXCQ 3LWFA 2E2HJ 4KIGA 2UXBL 2DFHA 1R4PB 4LOCA 4C3HB 1C7YA 1I1SA 4C3JH 4KISA 4OIJA 4L18B 2OUMA 1DD2A 4XOPA 3SZTA 2NVYH 4R8NA 2CQQA 2A69F 4LG0A 2L12A 3EJIA 3T56B 2G7HA 2JN4A 1P4XA 3D6WA 3ZQGA 3TKYA 2VIXA 1I6VC 4BY1J 5IIFA 3CW2C 1FJGL 4ZQ3A 1RNLA 3DQVC 3DM1A 5DD4A 4NHJA 3H5AA 3M8FA 3M4OJ 4JX6A 3TO7A 1G6PA 2JQOA 3CCSA 1MSFC 3FF5A 2W25A 4DV6Q 4DR2Q 2STWA 2M1BA 3HOVH 1K28A 1EOTA 3EUHA 3CD6I 3F8TA 1KABA 2HYFA 1NG6A 1VFCA 5M5YJ 2E1MC 3TS0A 3HKZE 4OXPA 5HGQA 2Z5UA 4IKFA 4OIPF 2M0MA 1LKXA 3BTCA 4X3KA 2Y2ZA 3BJOA 1WTPA 4C3JG 1D5ZC 1UAAA 1BIBA 2DPUA 3KP7A 2O7OA 1LEBA 3ZYYX 2PLYA 2Z6BA 1IL2A 3KYCB 2F03A 5F6FA 3OYEA 2Q2UA 4WX9A 1SYGA 4J1MA 4MLOA 2RQPA 3DTEA 3U2RA 2EA2A 1UUPA 3LSTA 3I55A 4BBSJ 4UUSB 4B44A 1KDCA 4JBMA 1IV6A 4OINF 2DMPA 1PH3A 2OTLI 2HYJA 1LT6D 2ZMEC 2M0CA 4L9TA 3CO7C 1ZTRA 3TDZC 4BY1H 3RPQA 1QNUA 4B4CA 5E3MA 2VB2X 2PYKA 2FNPA 1WH7A 3IC7A 4LF7Q 2XVCA 3HOVG 4B3TQ 2RCNA 2OQRA 4WRDA 4HF0A 4HX7A 1QVTA 5EEAA 3I56A 5ICGA 1YNNC 3PIP3 4ZYSA 1B72A 3BJAA 3E9IA 1LFUP 1WJ5A 3F2UA 2LK2A 3IAYA 2H1EA 4DA2A 3J7YJ 5M5YH 4A2UA 2GN5A 2DMTA 2F0SA 3UDIA 5IP7J 2RBMA 3G71A 1V5GA 1I3QJ 2MH2A 2RA4A 3SXHA 3FKIB 5ED4A 3FISA 1OXVA 2VE8A 4CKBA 4RA8A 3URYA 3HTUA 1ZKOA 2G5DA 3CQZJ 1BOBA 2IY5B 5KHDA 4NB3A 2L0CA 2YTXA 4L5RC 1MBYA 3U1KA 1EUJA 4JI5Q 3IWFA 1AZQA 1Z7UA 1KIXA 1WWXA 1XTDA 4BY1G 3VSKA 1DPRA 4EJOA 2F0EA 5EPKA 3P9IA 4OU0A 4A3KJ 2X85A 4A0XA 1BCPB 2VW9A 4ZH4F 1YI2I 2XNAC 2WAFA 4GNXC 1Z3YA 1RETA 3S1NB 2K04A 1Q7YC