3GO5A

Crystal structure of a multidomain protein with nucleic acid binding domains (sp_0946) from streptococcus pneumoniae tigr4 at 1.40 a resolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
285
structure length
285
Chain Sequence
GMNTNLASFIVGLIIDENDRFYFVQKDGQTYALAKEEGQHTVGDTVKGFAYTDMKQKLRLTTLEVTATQDQFGWGRVTEVRKDLGVFVDTGLPDKEIVVSLDILPELKELWPKKGDQLYIRLEVDKKDRIWGLLAYQEDFQRLARPAYNNMQNQNWPAIVYRLKLSGTFVYLPENNMLGFIHPSERYAEPRLGQVLDARVIGFREVDRTLNLSLKPRSFEMLENDAQMILTYLESNGGFMTLNDKSSPDDIKATFGISKGQFKKALGGLMKAGKIKQDQFGTELI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a virulence regulatory factor CvfB reveals a novel winged helix RNA binding module.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Gene regulation
molecule keywords Multidomain protein with S1 RNA-binding domains
total genus 68
structure length 285
sequence length 285
ec nomenclature
pdb deposition date 2009-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13509 S1_2 S1 domain
A PF17783 CvfB_WH CvfB-like winged helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3go5A04
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3go5A02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3go5A03
2.40.50.330 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3go5A01
1YG2A 2GA1A 5ILVA 2VBZA 5FJ8G 5E8GA 1U5TC 3I0TA 4L5JA 5HLGA 1CGPA 4N9IA 2QBYB 1ZRDA 2ID0A 2JQOA 5K1YA 2QEXA 4DK6C 2EQSA 4K2EA 1KHIA 1HZBA 1XNQQ 2FNAA 3F8NA 2IRFG 4M9ZA 1VQDA 3TS0A 1R23A 5DUIA 5HY6A 3C1DA 1N36Q 3PO3H 1VTNC 3I4NH 2LDUA 4EV0A 4KT5C 4U0YA 4BAYA 4M73A 1LJ9A 3G71A 3CCLA 1P6RA 3HSFA 4XLPF 4BXUA 3S1QH 1V43A 1K73C 2YX4A 4TV7A 1GVJA 3SQNA 2D62A 3E9IA 5DD8A 2L3DA 5GADC 3BY6A 3N4MA 1IRFA 2Q2IA 2VW9A 5L3EA 5AIPA 1AWCA 5D5VB 5C0XI 2ZJPA 4JI7Q 5LMUL 1HSJA 1LEBA 2EFQA 4HF2A 2RQPA 3KP3A 2BH2A 3SZTA 1S72A 2VN2A 1TW2A 1PVOA 1BC8C 5JEAJ 5FO5A 2NVXH 1EV7A 3L2CA 1XTDA 3F8FA 1WQ2A 2R7FA 3GXOA 3FMQA 4A3JH 4TQUS 3DEUA 1T6SA 1ULYA 2LXKA 2F4VL 2IP2A 2BA0A 1KU3A 3HOZH 5JI6A 5D4SA 2AHOB 2CGPA 3FHZA 1QVFA 2VBWA 2VOPA 4HOBA 3HOWH 2F3IA 2NNYA 4R79A 1CKNB 5CYVA 1J5EL 1TQIA 4O3MA 1HNWQ 4A3IH 1O3QA 4NB3A 3ULQB 3I56A 4L9TA 3WE3A 1D3YA 3S17H 1O3RA 4OIRF 3A5ZB 1K8AC 3FXRA 2RKHA 1XGSA 3PV0A 1HKQA 2G9WA 3NBHB 1GD7A 2NNNA 5C4XG 1XSDA 2WB1E 2A19A 3K0XA 2P6SA 3HHHA 3RKXA 2K52A 4RAZA 1XPUA 4UP8A 4IFDJ 3SXYA 2HYFA 3QAHA 5L3DA 3ULJA 4BNCA 3IWZA 4KHPQ 3H92A 1YJNA 4EVIA 4B3SQ 2A68F 2PI2A 4EJOA 4HV5A 4X65L 4HLYA 4P9UA 3M9BA 5IT9c 2STTA 1P2FA 5IE8A 1U0LA 1VQAA 3F8CA 1LDJA 3V7RA 4Z2YA 1I27A 2LF8A 4YFXF 2FOKA 3EDPA 4AD9A 2RHQB 1QVCA 4DUZL 3PO3G 1N9WA 2HQNA 5L3GA 1J7KA 2H6BA 2RNJA 1IBML 1STZA 1RIOH 4YHHQ 4BBSG 2GQQA 3E6MA 5LGTA 4R4CA 4BY7H 1SE8A 1BBWA 4A3GH 3M8EA 4HZFA 2F5DA 3TEHB 3JAMc 3U4ZA 2OTJA 1Z1DA 5DV5A 3K81C 2EWNA 3ULPA 1ZRFA 3JC66 2Q0OA 2FF4A 2L4AA 3KP6A 3DKWA 1EIYB 3WGGA 3FP9A 4L5QA 1HJPA 4O2DA 4KFCA 2ZKZA 2IX1A 1VQBA 1ZG1A 4AH6A 2LF7A 2VXZA 1EFWA 4GLAC 4MZ9A 3GTMH 1N32Q 3JAMZ 3DV8A 4ZZLA 2O03A 1HZCA 4APVA 1ZN2A 4LLLA 3LGJA 2WP8J 3WGIA 2FMLA 4GS3A 4MNUA 4YIIA 4UV8A 3CCUA 2O6GE 3S2HH 4LFAL 3U9GA 2G7HA 4JOIC 2KCTA 1VQ6A 3STBC 2GVAA 1SFUA 1IXSB 1E24A 1KQSA 2ZJQA 1N36L 4IJAA 1YTYA 1XMKA 2OA4A 1KL9A 3AEVA 3V4GA 4A3MG 1N32L 2JA7H 1OYYA 3DPLC 2DT5A 4ENJA 1U3EM 3HTSB 4U88A 1FOKA 4IPGA 1JJCB 4HF1A 1TQPA 2HKOA 2V1XA 4E70A 3RI4A 4PZ6A 5IYBG 1HQCA 2EIFA 2R7ZH 1NMFA 1J2XA 3F21A 4A0ZA 4A4IA 2JSCA 5DD4A 3MAJA 1I94Q 3WTVC 3BPVA 4DQ2A 4MTDA 4Y52H 3KJOA 1Y1WG 4JI7L 4Y7NH 3CD6A 2FBHA 2XAJA 4A12A 2VQFL 3E0EA 1OXVA 2HGCA 5EEHA 5FGMA 4Y13A 4PGHA 4KICA 1HBXG 1G4DA 4I0BA 1AE3A 5C44H 2K4BA 2EFPA 4A3KH 4AVPA 2VZAA 1KYZA 1LDKB 4MHGA 4EQ5A 2BEOA 3C7JA 1YO5C 2F4VQ 3S14H 3QU3A 3BJ6A 2W57A 1T2KA 1Z9CA 3I4MH 3J7AO 4WJ4A 4YWLA 2UXNA 4EX5A 2N49A 4WJ3M 4A93G 1PYSB 3GO5A 3IKVA 2WFWA 4UPAA 4HJ7A 1BI0A 1W5TA 3KJPA 1ASZA 1FX7A 2GN5A 2ZMEB 3E5QA 3GTLH 1ZYRF 1C7YA 1IN5A 2P5LC 1X9NA 4BBSH 3NENA 4GCVA 3A5UA 4JI6L 1XMAA 4DV1Q 3M7GA 2DK5A 5CVRA 3M7NA 1FBQA 5ERIA 2ZJRA 4WXCA 1HNZL 3TRZA 3CF5A 5ED4A 4RB2C 2QWWA 2CFMA 1IN4A 4N0BA 1S6LA 5C44G 4X66L 2EV6A 4JG2A 2P6TA 1G51A 3LQRA 3KYHC 3K1NA 3H3ZA 1UHMA 4ASNA 2W25A 2RVCA 3C3WA 2FBIA 4A5NA 4OMYA 4ZYHA 3FWEA 1I94L 2EFNA 2QA4A 1MZBA 2EXDA 5K5OA 2GWRA 4MEXF 1OYIA 4JI4Q 4L0ZB 4DPGA 2I5MX 4LF9L 4P73A 2XUBA 3O2PE 1YIJA 2N8NA 1VQKA 2MA3A 2YTYA 2JJQA 3DFGA 3WTWC 3LAPA 2STWA 1G3TA 4BH9A 3CLOA 1CKMA 2ACJA 2CG4A 2L4MA 2MH9A 1J59A 2ZTDA 3VDYA 2Y75A 2ZM6L 3CCRA 4Q5SF 4IPDA 3R60A 4KYWA 4JI3Q 2ALYB 2HFHA 4FHTA 4WX9A 4LF9Q 5IP9H 4IPAA 4DR3L 1PH3A 4Q4ZF 2PMZE 4CHUA 1BI1A 3D0FA 2OCEA 2F52A 5D8LB 3KP4A 3ZMVA 4B8XA 1IBKQ 1YVCA 1EQRA 2EJRA 3H15A 4R8HA 4CXFA 4GN5A 5LMNW 2Q2TA 1E2XA 3PSIA 4DR7Q 1YIOA 1IZ1A 2GXGA 2X4HA 2IT0A 3CUQC 4IFDG 4L0YB 2YR2A 3HUGA 4B3ML 4QWQA 3J7ZC 3M1EA 3WU0A 3WTTC 1HW2A 3DP7A 4DV7Q 4LFCQ 4PG3A 3FHWA 3DXJF 3CMEA 2JZYA 2EFOA 3EQLF 2DQLA 1UHWA 4J15A 2E2IH 3HOYG 4OX9L 4A3GG 4DR6Q 4X66Q 4DR5L 4KIFA 2MNAA 4DR7L 3WTUC 4A3EG 1VQ5A 2PG4A 2Z0SA 2WWYA 4GLVB 5HDNA 3HOVH 3PO2H 1KRSA 2H27A 1QPMA 4QGUA 3J80Z 1VS0A 1LDDA 4LK0F 4DV4L 3MFKA 5FFZA 2E2JH 1E3PA 1O57A 1IN6A 3F72A 4YHHL 3KLOA 4EJVA 1SFOH 2NZHA 1DUXC 2JA6H 5FLMH 2JA5H 2ZJ2A 1S8NA 3F1ZA 3KETA 4A3LG 2DUDA 5HDGA 4ON0A 2VT2A 4L5IA 1PFSA 4B3RQ 5BMZA 4X65Q 5FJ8H 3ZMDA 1ONVA 4BY1G 3GFLA 4PMWA 1UB9A 4LF4Q 3V7CA 2B29A 3A74A 3HOYH 2R93G 2XTIA 1XMOQ 4IF4A 3O3KA 3BOQA 4YIFA 1O3SA 1E1OA 2ZNYA 4M6XA 3HSEA 4G6QA 4MEYF 3HRMA 2PI2E 2V1CC 2CCZA 1XGMA 2UXBL 2J5PA 3K69A 1P4AA 1BBUA 1Q82C 1Q1BA 4NXNL 1PHJA 3R61A 4DV5Q 4U0WA 3IWFA 3OTOL 1FSEA 2PN6A 4LUZA 2IPQX 1KXLA 3ZP5A 2AXLA 3FKIG 1PH8A 1QUQB 5H1SE 2LNBA 3VFZA 3CCMA 1D7QA 2K4KA 2YYZA 2JPBA 4LFBQ 1B9NA 1G6NA 5LMUQ 4CZZA 1Q12A 1O7IA 2COMA 1HZ9A 5IWAL 2BGCA 4DUYQ 1EWIA 2QUFA 1JGSA 3F22A 5IYBH 4JI0L 1EH7A 3PIOA 2D0OA 2ZM6Q 1X55A 3ER0A 4DV0Q 1G3YA 3LQQA 3NRVA 4B3SL 5D5WB 1XPRA 4HV6A 1FWZA 4OWXB 4X6AH 3J80c 3OYYA 2KENA 2V79A 2DTRA 3E6DA 4AYBG 3WWVA 2JPCA 1IBKL 2Q2HA 4FX4A 2D0PA 4LJZF 5AONA 1N8RC 4UUVA 5AJ3L 1SD5A 2PQAA 5TJJA 4UVAA 1K0RA 4R1HA 3W1GA 4GKKL 4GKJL 2AWOA 1XMQL 2QVOA 3FF5A 1WFQA 1H9TA 2IVMA 1PA6A 2A1AA 3I5UA 2FBKA 4A3FH 4L9VA 3S1MH 1TWGH 5M5WH 1KU2A 4AIJA 1FZPB 4PDKA 2XKOA 4L5TA 4MTNA 1R58A 3ZJYC 2R93H 4HX8A 1Q81C 4NXNQ 4JOIA 4A76A 1Z91A 4HW0A 3G4SA 3JSPA 4O0AA 4YCVA 4DV4Q 2OAZA 3Q5FA 2VL6A 2K27A 2OWOA 5IYDH 2RCNA 1TWHH 1SMYF 5FLMG 1W5SA 3ECHA 1UEBA 3WODF 4HQEA 3CXCA 2RV8A 3GW2A 2CQKA 2C6YA 1YW7A 1EYGA 4HQMA 1ON1A 5ICEA 2WAQG 4S05A 4CDGA 1PH1A 2K5NA 4JI2L 2IT1A 1CKNA 2OZ6A 3BROA 2M45A 1UCRA 4IRHA 3F2DA 4A75A 2EV0A 4O6JA 3TREA 3E5XA 5HVQC 1SN8A 2Z6KA 2PMHA 5J8CA 2VS1A 5LRRA 4DV0L 2FNPA 4JBJA 3ZMTA 4XTCS 4UP7A 2QM3A 1B4AA 3UE1A 3P9KA 5DCMB 3F2BA 2VUMG 1USTA 4EQQA 1K9MC 4BBRH 2YPRA 5E1ZB 4C3HH 1IBLL 4GLXA 3BJAA 2MLKA 1O7FA 4P74A 2XAGA 4LB5A 1ZHFA 1YQAA 3PQKA 4AYBE 1JMCA 4BQAA 3MQ0A 3JAMi 3LA2A 4LMYA 4LG0A 2E5LQ 4GKKQ 5D8KB 3QOPA 1OXTA 2JA7G 1YI2A 4A3MH 2NYXA 3GZ5A 1Z6RA 2Z99A 1NHAA 1IZ6A 3LFKA 5IP9G 4DR3Q 3HSRA 3SHFA 3PUZA 5LHGA 3F8TA 3S24A 1YEZA 2EA4A 3T1HQ 1YNXA 1I5ZA 2YTVA 1DPUA 4O5VA 1S29A 4HBLA 2BE5F 2DQRA 5LMNL 2E2HH 4IJHA 1YW9A 3HYIA 3W6JB 3NQOA 3GTOH 3HOUH 4LUVA 2P4WA 3JAMK 1N34Q 5F1RA 3H3UA 1HW5A 1RIPA 2VBYA 3E97A 4M71A 2DK8A 2DPUA 1BOAA 1FYKA 2A07F 3NEUA 4IRGA 1PH5A 1RL2A 2BYVE 1NJIC 1AE2A 1WWXA 4X62Q 4CGZA 4DV6L 2HKXA 2QQBA 1UE7A 1N34L 1FP1D 3GTGH 1L3LA 4EM1A 1X3EA 1S40A 2K02A 2VQFQ 2PMUA 2WAQE 1USSA 3U50C 5M5YH 2UXXA 4XSXF 1U5TB 2QQAA 3P7NA 2NZOA 4LW1A 3GX4X 3ECOA 4HIOA 5IP7H 2RHSB 4EGYA 5DCMA 3BZCA 1S3OA 1P4XA 3K80C 1RUOA 1XJVA 4IPCA 1TWAH 3EBEA 1N33L 4HJ8A 3WG9A 4C3IH 4DV7L 4HJAA 1FT9A 5IYDG 2KJCA 4DR2Q 1XMOL 3M3YH 1R7JA 4UVCA 4IRIA 3KFWX 5AJ3Q 4AQYL 1QO0D 1PH7A 2ZO4A 4UV9A 4IPHA 2ADUA 4B09A 5JJLA 1YHAA 1WI9A 1BN5A 2CFXA 4JV5L 4A3BG 2R7DA 1KIXA 4OINF 5CVVA 1TBXA 1N33Q 2HOEA 5ELOA 3D0SA 4HA8A 1VQEA 2YTXA 2ZTEA 4A3FG 3PUWA 4YY3L 1OMIA 4A3KG 4U0VA 1WYDA 2M30A 1LQ1A 1YZ6A 3UDGA 4EM2A 3F23A 1K79A 4P71A 4ZYGA 3FXQA 2RC4A 3LA3A 1RZ4A 3ABUA 2NVTH 1WRJA 5E20A 2QBYA 2RF4A 1KU9A 3GFMA 4GO1A 3GVAA 5GROA 2H5XA 4A3DH 5E7NA 3I58A 1NBWA 3QRFF 5HS8A 1DGSA 3STBD 2B63H 4KIBA 1ZARA 4YFKF 2L01A 4LF5L 2ISZA 3TKYA 3TQNA 1L0WA 4RGUA 2UUBQ 1D8LA 4HIDA 2V9VA 1EIFA 2WB1G 1KQ9A 4BBRG 3O6BB 1BVSA 4OOIA 2VUMH 2V1UA 3OV8A 4Q48A 2GXBA 4GNXB 5IT9K 4IOCA 1HNXQ 1Y14B 2JA9A 3MZYA 1IBLQ 3CW2C 4YFNF 4M74A 3HOTA 3J81c 5GAGC 3RN5A 5D5XB 4ALPA 4BXXH 4JCVE 2G7UA 1LUZA 1S7OA 3AYHB 3KDFA 3AFPA 4EJTA 1G6PA 4KA4A 4RS8A 2BBYA 3K1PA 4KHZA 1SR3A 4ENNA 5DUKA 3HKZE 1K78A 1W4MA 2NRAC 1KAWA 2PQ8A 1I1SA 3G3ZA 2CW0F 4KN4X 1L1OB 4L5SA 1Q1EA 4LF8Q 4L9NA 4AIHA 1YYVA 1T9HA 1RUNA 3M85A 2FQ3A 4P72A 3QPTA 5LMNQ 3T8TA 2DO7A 3HIFA 4Y17A 4L5RC 1LEAA 1R22A 1Q86C 4UVBA 1F4KA 1L0OC 1IW7F 2XAFA 3SZPA 3HOSA 3SGIA 3KP7A 1PYBA 3FMSA 4PZ7A 5LLQA 2IHEA 1TWCH 3GFIA 2PI0A 4JC0A 2B3GA 5H6QA 1Z05A 1KRTA 2K5HA 2IA1A 4ESBA 4LLGF 3CCVA 1BIAA 5DLQE 4B3RL 5BPIA 4DV3Q 4NXMQ 5GAHC 3TGNA 1FPQA 1GO3E 1UFMA 1MDMB 4DR4L 3M9AA 4LFAQ 4MTEA 2UWMA 4UP9A 5BOXA 3RPUA 2GIVA 3V8KA 3CUQB 5BR8L 4HDVA 3B02A 3RPQA 2DW4A 4IHSA 1LNWA 4DK3C 2CQOA 3DM3A 3I2ZA 5LEJA 4YCWA 2VE9A 1R1UA 1OTCA 5M3FG 4U7DA 5D4RA 2B63G 4N9HA 1PH9A 3EN2A 4G8XA 4POFA 2PFBA 3R0JA 1EOVA 4OX9Q 1M90C 1ON2A 1XD7A 1YW8A 2CSOA 4PZJA 3J81K 1LM0A 2JEBI 4G7OF 2QGQA 4M72A 2Q2UA 3HOXG 1B59A 3D5LA 3S2WA 1H95A 5LHHA 3J81i 1ZREA 1I1GA 1Z9FA 2XIGA 3MWMA 5ELNA 3HOZG 3GTQH 1EH6A 4I2OA 3S16H 1HXDA 1HNWL 1FGUA 3BJOA 3L7WA 3NELA 3PIPA 3WE2A 1BBYA 1FSHA 3BZKA 2PJPA 1OXSC 1HR0L 1O7LA 2JE6I 4XBFA 2PLYA 4DUZQ 3L7ZC 4OXPA 1RI7A 1SLJA 5M5XH 4JI5Q 3CDHA 2DPDA 2VNUD 5IT3A 3ZN1A 4G94A 1KQ0A 4A3BH 2YSRA 1NE3A 2DAOA 3T1HL 4L9JA 3MEFA 1IXRC 4WXDA 4QIWE 5GAEC 2I5LX 1MGTA 3WTXC 4DR6L 2Q2EA 3KP2A 4GN4B 1ZAOA 3H3VH 3RNUA 2FA5A 3TQYA 2HT1A 2E7WA 4A0XA 3IKTA 1X3GA 3T8RA 3OTOQ 4PCQA 3P9IA 2MO0A 3IHUA 1WSUA 2Y0SE 4LF6L 1VQLA 1XNRQ 1XGOA 5HLHA 5ILUA 2Q8KA 1FNNA 2EFWA 3L2PA 1XSXA 5BR8Q 3FX3A 2VODA 1CKOA 1Y1VH 4R4OA 1R36A 4JI8L 1BKBA 3M4OH 5CVIA 1W3SA 4LFBL 3A0JA 3R0AA 3RR5A 4KN7X 2VBXA 1SAXA 1LB2A 4EM0B 1IN8A 1ZH5A 1PH6A 2DI3A 1V4RA 2RDPA 4A93H 1J5EQ 3BZ6A 2HWVA 1B7YB 3HKSA 4JBMA 3KEQA 3I4OA 1U6GA 1HKSA 4KNYA 4ETSA 2F2EA 4X64Q 4LF7Q 1MKHA 4JI4L 2E1NA 4I0AA 3CAMA 3NEMA 1J0RA 4GYGA 3RIRA 3JSOA 1X56A 1CSPA 1OKRA 3L0OA 5M3MH 1WKMA 5E8IA 2OQKA 2VQEL 1SRUA 2ZBKA 2IA2A 2R6GA 2QYOA 4UNOA 4LG0B 1UE1A 4NPSA 1UE5A 3E9HA 3HFZB 2XHKA 5E17F 2E7XA 2TDXA 3KE2A 4UXNA 4X64L 4A3IG 2ZMEA 1T38A 3M8FA 2FXQA 2ATWA 3F3XA 2AMCB 1JB7A 4JV5Q 3RN2A 3HOWG 5ICCA 3K7AH 2N78A 2AKWB 4AIMA 4FX0A 1MJBA 1MJEA 2YV5A 2AWNA 2XRNA 4CICA 1CF7A 5M3FH 3PUYA 4XLNF 4RGRA 1Z47A 1YHBA 1SD4A 2UUCQ 4K0KL 1I50H 4BA1I 1Q46A 5LRSA 1PDNC 1Q7YC 2FMYA 1Q1HA 5J6XA 3J80K 3PQJA 4JBKA 4IHTA 3HRUA 3I53A 4GXOA 1IBMQ 2F5FA 3C18A 4NHJA 1GXQA 1R9TH 1TQMA 4LGWA 1DPRA 1H9GA 3J81Z 1P92A 2O61A 2Y0SG 4QJFA 3OW2A 2VT3A 1OXXK 3M4PA 2MC3A 3CCJA 1WI5A 2LKPA 4Y15A 1FBSA 2NAZA 1I5FA 4DV1L 4JYAQ 2FRHA 1PUEE 2BA1A 4G6DA 5JFRA 1FY7A 4D0PA 3RTRA 1Z7UA 3TOAA 1JXSA 1E22A 3DF8A 1A8VA 3GTKH 3ZQ7A 2QQ9A 1XN7A 2JA8G 4A3CH 3GF2A 5HS7A 3S15H 2VY3A 3UDXA 2I5HA 3WTSC 1XCVA 3JTHA 2IY5B 3CMAA 2XVCA 2KKOA 1ZG5A 4ESFA 1A62A 2LSOA 3ABTA 2UU9Q 3TDUC 1VQPA 2CWPA 2PEXA 3HTUA 4P75A 2P7VB 1XPOA 1KA8A 1V3FA 4ESJA 4DR5Q 1QZYA 3RKYA 4ENMA 5C3EG 1EQQA 1MDMA 4IFDI 4IJLA 5E1XA 2XAHA 1OR7A 4BXXG 5DDGA 4HJ5A 3K0LA 4G7HF 4A3EH 2ZCWA 4P9FA 4DAYB 1HNZQ 4JK1X 1TXYA 5L3BA 1Q8KA 4XIGS 1FL0A 3DPTA 2ASBA 4LF7L 2OQRA 2Y0MA 2UUCL 4K0KQ 2Z6KC 3GYHX 4DR1L 1ZGAA 1FYLA 4OO1I 2BH8A 1Y0UA 4A0YA 2V1DA 4TVAB 2FU4A 4LFUA 3I64A 4H02A 4EMSA 1B70B 1XSVA 1CUKA 4GOPB 1FC3A 4C3JH 1Z6TA 4JI8Q 4LLNA 2VC1A 3RLFA 1FP2A 1I6HH 1DP7P 1U5TA 4MQ9F 5BPDA 1QZGA 1XB4A 3I7FA 4OIQF 4L18B 3TOBA 2KCMA 3MXNB 1T98A 1REPC 2YU9H 2ZFWA 4NQWA 5F6FA 2XASA 3CJNA 2ZTCA 4RG1A 4IOAA 2NS0A 3CC2A 4I09A 1M1KC 5FLXc 1PP7U 2EK5A 4A3DG 2C35B 3Q8DA 5JEAG 2HHHL 4F7ZA 3L9FA 4LF5Q 5M3MG 2VQEQ 2X0LA 4JBAA 4OWTB 3ELKA 1T0FA 2OQGA 2ESNA 3ROUA 4RGXA 1X3UA 1TW3A 4X62L 3KFUA 1E7ZA 4BHPA 1WCMG 3SFZA 5DEQA 1NMGA 3W1BA 1XDSA 3WGHA 4I7HA 2MD5A 3CPFA 5K5RA 4HJ9A 1XDUA 4LF6Q 2VC0A 2ELHA 5IYCH 4R4TA 1D8JA 3ERSX 2JA5G 1VQJA 3ZPLA 2QZ8A 4U7BA 5CLSA 1X54A 3RYPA 4OU0A 3AFQA 4DV3L 1PP8F 2AS5F 1FYMA 5JR3A 5IYCG 2EV5A 2K5VA 1YJWA 2UXDL 3KEOA 4LF8L 4DR4Q 3AAFA 2E1CA 1J75A 2H94A 2LSSA 3F6OA 2VE8A 3QU6A 4WK8F 4YG2F 2K75A 3CTAA 2FXAA 3RLNA 5K5QA 4G7ZF 1I6XA 2UUBL 3I4PA 4GYIA 4JI1L 1P8LA 2JK8A 3K9TA 2OD5A 3D31A 2A61A 4GNXC 1JE8A 3DLLA 5D5UB 3RKWA 2KBNA 1G3SA 2L54A 4RB1A 1LTLA 2HS5A 1A04A 4I98B 3GTJH 3KF8B 4C2MH 4B3MQ 3L00A 4XRFA 1WOCA 2M8EA 2L15A 2HQLA 5CJ9A 1QZHA 1QQIA 5ICFA 3CP0A 3IL2A 1UWVA 1BM9A 4R4QA 5LGNA 1Y1WH 3LAJA 3I59A 4CYDA 4PZ8A 2UXCQ 1VQ4A 2A6HF 3RZOH 2P5KA 3KDFB 4YWKA 2XGXA 2J5OA 4RAYA 1JJ2A 1FVIA 2H6CA 1ZRCA 1HZAA 3HRSA 1X3FA 1VQ9A 1K8GA 1TNTA 2K4JA 1U5KA 2XV4S 1C0AA 3GWZA 2ETHA 4DKAC 1L1OC 2D2WA 4P55A 3CCQA 5TRDA 1HR0W 4ZH4F 1O3TA 3ZMUA 2P5VA 1S7AA 1NTGA 4HIMA 3K8AA 3AQQA 3HRTA 1PH4A 1R00A 3ICEA 1BI3A 2A69F 1SD6A 3T1YQ 4JYAL 2N3SA 4EJWA 4M6YA 2W24A 1FLIA 3HHGA 4LD5A 3I55A 3BPXA 3FKIH 3G6EA 4YWMA 2ES2A 5JHUA 3B6YA 4MQVA 2HDCA 1VQHA 1WJJA 4GGGA 2PNHA 2A6EF 4I02A 3K1MA 2JRTA 2Z3YA 4P96A 5J8FA 3T5XA 3IC7A 1JE5A 5K36G 3I4NG 3VB2A 4NXML 3I71A 2HZTA 2A3SA 3OOPA 5C0XG 4CO8A 2BV6A 2MQHA 3KOJA 4BY7G 1FJGQ 4A2UA 1QZZA 4JBWA 1Y1VG 1A63A 3CCEA 1JHHA 3U4VA 4AQYQ 2RN7A 5F64A 3IRBA 3F2CA 4GOPC 3H3VI 4HIKA 1U78A 4WF2A 4ENKA 4RMFA 2CWEA 5LBQA 4GOPA 1H0MA 4LF4L 1KYWA 1MJAA 1JT8A 1K83H 2FSWA 1BIBA 4Q47A 5A2QZ 5HGQA 5EEGA 3KP5A 1K6OA 4KDPA 1AH9A 5J3BA 3RDIA 2OU2A 3JW4A 2W85A 3VOEA 1IN7A 2JT1A 2M1BA 1XMQQ 2QENA 3TO9A 2EB7A 1J9IA 4XSZF 3G48A 1MJCA 1MIUA 2HTSA 1V1QA 2F5EA 5CVJA 3QP6A 4DR2L 1I3QH 2LXJA 1XCBA 1XNQL 5JJKA 4R1JA 4DNIA 1IL2A 2NVYH 1YITA 5AIQA 4GKJQ 1HW1A 2HEOA 4OWWB 4AIKA 5IWAQ 1G291 3ERED 3K7UC 4HX7A 3H0GG 4LNQA 2UXCL 1U2WA 2MO1A 1TLHB 2L02A 3EYYA 3BDDA 4RGSA 3W6KB 3I59B 1YS7A 1GVPA 2MLGA 2HR3A 2PBIA 4DV6Q 1K78B 2HIXA 2R7ZG 3H0GH 5L3FA 3S1RH 3VODA 2HHHQ 3PF5A 4DV5L 2O8XA 2NN6I 4KMFA 1VQOA 3V7SA 1VQ8A 5JVTA 1YS6A 3PFIA 3DQVC 3KF6A 3GUDA 1W7PA 3M4QA 1FJGL 3EUHA 5HS9A 3BU2A 2O0YA 3KZYA 3ISPA 1IRGA 1CSQA 4DAMA 5LHIA 2NVQH 1HSTA 2OQ0A 6PAXA 5C4JH 3FM3A 1MKMA 1YLFA 2YU3A 2K50A 1OYWA 2XAQA 4NB5A 2HQRA 2D45A 3BP8A 4MGRA 4POGA 2MBFA 3Q9VA 3KZZA 5IY0A 4WXHA 2GZWA 5H6RA 3WTZA 4KIGA 1BJAA 2VOOA 2RGVA 4R4IA 4OIPF 1LYLA 4FT8A 4I01A 2CO5A 5C3EH 3LA7A 1IXRA 4LUOA 3PF4A 3WU1B 3TS2A 2XGTA 3MEXA 2QLZA 3E6CC 4IVNA 1KU7A 3FM5A 1YJ9A 1ASYA 2JA6G 4LFCL 1ZG3A 1SMTA 4DNCA 1XNRL 2Z5UA 4BY1H 2V6CA 2D1VA 2XKPA 2YX7A 3ULLA 3J7A5 1VQGA 2E5LL 2KIUA 2IX0A 3HOVG 3PO2G 4KHPL 4DV2Q 4A6DA 5FLXZ 4M9SA 1VQIA 1KC8C 3TO7A 4A3CG 3L09A 3GEZA 1L2FA 1P16A 1FBUA 2NN6G 1J6QA 3KCCA 3GD7A 3IRRA 4UY8C 3EETA 1YFHA 3ML6A 3CUOA 5CVUA 5IP7G 2I0QA 1VQFA 4BYYA 4OONA 1GM5A 2UU9L 2A5YB 1P4WA 4KLKA 1EH8A 3U58A 1HKTA 1G3WA 3COAC 2DU9A 2FE3A 1S3JA 4KUMA 2A8VA 2IW5A 4QY7A 2KHJA 2DLLA 3CC4A 4EGZA 5HDKA 1F1ZA 4UHTA 3MZHA 3KF6B 3GTPH 1TTYA 3HKZG 5BS6A 2HTJA 1C0WA 4JI0Q 3F8BA 4HAMA 3KLWA 3HOUG 4YY3Q 1BC7C 1PV4A 1IYJB 4HLXA 5DCFA 1TWFH 2MH2A 2JEAI 1UE6A 1AOYA 4HDUA 3LSTA 1R5GA 1F9NA 4QLCU 5FLXK 3HOXH 1D8KA 4LB6B 2HYGD 1SFXA 2B0LA 1D5VA 1X65A 4G9YA 2IHFA 1U8RA 2K86A 1ODDA 1NY4A 3RZDH 4WWCA 1B6AA 3TDZC 2IJLA 1QUQA 4A3JG 2K7LA 3T1BA 2XROA 2OTLA 1SD7A 5FB2A 1E17A 1MD0A 1L1OA 2W84A 2OZUA 4FDBA 4JI5L 5HOOA 1K7AA 3CO7C 3LWFA 4DUYL 1E1TA 1OXUA 1BI2A 2UUAQ 2H09A 3PUXA 3J81j 4WCGA 3IRQA 2O3FA 3N97A 1TNSA 3PUVA 1B8AA 2KHIA 4HF0A 3PCOB 5L3CA 2WV0A 2CYYA 2KIMA 3P9CA 1VCIA 3T0YA 3Q9SA 3GLXA 1PH2A 4LWCA 1VQNA 2OBPA 4OIOF 4JQFA 5A2QK 3F6VA 4RB3C 3K2ZA 1F5TA 5IT9Z 3GDEA 3R6SA 2P8TA 1W2BA 1QBJA 3UDIA 2ZXJA 5KVRA 4ZYEA 3EYIA 4DR1Q 4OMZA 3T1YL 1HH2P 4JI2Q 1VQMA 3FMRA 1SFEA 2Y48A 5GQOA 5E1WA 3CPWA 4LK1F 2ESHA 4PGGA 1KQ8A 1GXPA 3E6BA 4MNOA 2P7CB 3QP5A 3E5UA 3UE0A 3MCZA 3ZMZA 3G73A 2DGYA 3EIVA 3VEPA 3I4MG 1T39A 5LEKA 4A6EA 5FD6A 3RLOA 3BWGA 3U2RA 2DFIA 1EUJA 2CKZB 2FEZA 4KMUX 4M9XA 2UZKA 1CF7B 1VQCA 3ZMSA 1R1TA 3ZN0A 4QQBX 1ZGJA 5LGUA 1WCMH 3CUQA 2UXDQ 3JTGA 1YHQA 2JA8H 2DBBA 2CWAA 1ZLKA 2VONA 1SMXA 2R92H 5JJIA 2GA2A 5FFXA 1IXCA 5DYMA 3RYRA 1KGSA 3CC7A 3E3VA 1C9OA 1YBYA 4A5MA 4OO1G 5D6FA 3TO6A 4RB0A 4QL5A 3V8JA 1GKHA 3U1DA 2PQAB 4P5OA 5BQTA 2K14A 4HX4A 3S2DH 3REOA 3CO6C 1X6OA 1OPCA 2Z33A 3PGZA 4GN3B 4JI1Q 5C4XH 1VQ7A 2JTVA 5EAYA 3BJUA 5FD5A 3GFJA 1SROA 1HR0Q 4JI3L 1JHFA 3KLNA 4DV2L 5ICGA 2HIVA 2WTEA 1K3RA 3V8LA 4BHBA 4B3TL 1IF1A 4AWXB 3CQZH 3S1NH 1W7PB 4ZYDA 5D6EA 5H20A 5KK1A 2Z9OA 1KD1C 1MJ9A 1GHCA 3I54A 1R5HA 3FXUA 3J80i 2R3SA 1LVAA 3W5OA 3B73A 1B1BA 1IUYA 4IXAA 2UXBQ 2M87A 4B3TQ 1HNXL 2KRFA 3WTYC 1B9MA 1QVGA 1JJGA 5ILSA 2IA0A 4BHCA 2ZNZA 3F8MA 2UUAL 1RNLA 4BA2I 5HLIA 2MFIA 2GAUA 4S04A 1W7PD 3UDFA 4YCUA 1XGNA 2GVBA 3RJPA 1IAWA 4JI6Q 1QGPA 3CCSA 4EJUA 3FZVA 3R4KA 1A0IA 2KIFA 2EA2A 1J5YA 1V9PA 4HYEA 4GNXA 1R1VA 2WC2A 2D1HA 1DDNA 5E18F 4KI0A 3GZ6A 4H0EA 4A3LH 4IO9A 1ZLJA 4ME3A 2M5WA 2F5CA 2R92G 5C0XJ 2KJBA 4ZZDA 2ISYA 1QNTA 3QPHA 2E8GA
chains in the Genus database with same CATH superfamily
4I99C 3HRZC 1ITYA 4L5JA 1CGPA 4N9IA 1ZRDA 5K1YA 4DK6C 1D1KA 1KHIA 4XYOA 1XNQQ 2IRFG 1WJEA 4JW0A 3TS0A 1R23A 5DUIA 5IP7J 3I4NH 3DLLF 4EV0A 4KT5C 4BAYA 1LJ9A 5KRUA 2E1MC 1P6RA 4A3JB 4XLPF 3S1QH 2YX4A 1WH7A 5GADC 5EJWA 3BY6A 5AIPA 1AWCA 5D5VB 4KHVA 4X3KA 1LEBA 1PUFB 2EFQA 1QB5D 1POGA 1BC8C 4QPQA 2NVXH 3W2AA 3L2CA 3H36A 3GV6A 2Q1ZB 5LFAA 1X4PA 2K85A 5IIFA 2LXKA 1BQQT 3VYTA 2IP2A 2BA0A 2CQ7A 5M5WB 2NTSA 2VOPA 4HOBA 3HOWH 1J5EL 3IKJA 4A3IH 3KX2A 5C3EB 2Y0SB 1D3YA 3N05A 1O3RA 3NARA 1K8AC 3QPSA 1GOZA 1AP0A 2G9WA 1FR3A 1Y1WJ 2QEXI 1XSDA 2WB1E 2P6SA 2WKCA 4IFDJ 3SXYA 1X1DA 3QAHA 2DA6A 4K14A 5C6AA 4EVIA 4ID6A 2CUEA 4G4KA 3CCQI 2YUSA 3BCAA 1M8AA 1U0LA 1LDJA 3V7RA 1Z6HA 3AFHA 3FKJA 1FYCA 4S0HB 1QVCA 4FF2A 3ND8A 1AA7A 5L3GA 4BBSB 2RNJA 3OMYA 2H8WA 3CP2A 3E6MA 1J9OA 1SE8A 2F5DA 1FTTA 2EWNA 5FKLA 3ULPA 1ZRFA 3JC66 2L4AA 2FJ2A 3LL7A 3WGGA 4L5QA 3I56I 3K4MA 2LF7A 1GUTA 4M1UB 1EFWA 1N77A 3GTMH 1HC8A 4G12A 3DV8A 4ZZLA 5CV6A 2WP8J 5KYIA 2K04A 2O6GE 3U9GA 3A7LA 1VQ6A 1KQSA 1BO0A 2OA4A 4F3QA 3V4GA 1WVLA 1OYYA 2JP1A 3ONQA 3HTSB 2OXPA 2VB3X 2ICIA 2V1XA 4PZ6A 3JCUC 5IYBG 4CCKA 2R7ZH 1FNVA 3R2TA 4WFN3 3F21A 4A4IA 4MO7A 3BPVA 4B44A 3GP7A 1WTOA 2F0PA 2MHVA 4RGNA 1Y1WG 1ML0D 1ILQA 2XRSD 1JKRC 4DJAA 3E0EA 4PJNA 4FXGC 3NBHA 2F48A 2HGCA 4KICA 1RCVD 4A3KH 4AVPA 1MI2A 3PJRA 2KCCA 3OYJA 3C7JA 3BJ6A 1BF4A 4EX5A 3CCJI 3IKVA 4UPAA 4ZRZA 1ZYRF 3H5RA 4KN4C 1X2MA 4BBSH 3NENA 1TWCJ 3A5UA 4JI6L 1XMAA 2I46A 2K5DA 5ERIA 2ZJRA 1OR7C 1JWSD 2A6HD 4KK7A 5ED4A 4RB2C 3CC4I 3Q24A 2DA7A 4N0BA 1WJCA 5C44G 1G51A 1GUGA 1TVXA 2RDGA 3TN2A 1UHMA 2W25A 2RVCA 4A5NA 4OMYA 3S3MA 1I94L 2QA4A 1Q1VA 2VJ4A 4MEXF 1OYIA 2IS4A 1G6ZA 4L0ZB 2I5MX 4LF9L 4P73A 3R8BA 3C46A 1VQKA 2MA3A 4AVZA 2DFFA 3WTWC 4TRDA 2Y75A 4Q5SF 4R9WA 4KYWA 4FHTA 5EKLA 5IP9H 4Q4ZF 2KEEA 2PMZE 1BI1A 3D0FA 5D8LB 1U9NA 4B8XA 1YVCA 1NUCA 2N88A 4RH6A 3MZ8A 2Q2TA 4N4OB 1YIOA 1EQTA 2ZSHB 2YR2A 2L4NA 4OIJA 3J7ZC 3NP8A 4DV7Q 4XLHA 4PG3A 4A3CJ 3FHWA 1CQFA 2JZYA 2K9MA 3V05A 1UHWA 3F9KA 4XM3A 4DR7L 3WTUC 4A3EG 1VQ5A 4HMJA 1E3OC 1XWEA 4CHTB 4DV4L 3MFKA 2BE5C 2E5NA 1E3PA 3F72A 4U673 4EJVA 1IC8A 4FO2A 1DUXC 1OCTC 5FLMH 3KETA 2DUDA 2RA4A 2W00A 3S1MJ 1PFSA 1PLFA 5FJ8H 4LF4Q 3V7CA 2B29A 3A74A 2DODA 1XMOQ 3SJMA 1TWAJ 1E1OA 2NYZD 4XKBA 2CCZA 1XGMA 2UXBL 4XL9A 1Q82C 1Q1BA 4NXNL 5BNGA 3R61A 3RQIA 1EY0A 4CKBA 3FKIG 3AB9A 5H1SE 2LNBA 4Y7NJ 3JAML 2FJ1A 2JPBA 5LMUQ 3ZGKA 4BU2A 2COMA 4EQOA 5IWAL 4DUYQ 1EWIA 3S14B 1JGSA 3F22A 5D14A 3PIOA 2LG4A 5KGUA 4KV6A 2R5YB 4B3SL 4HV6A 2RQQA 4X6AH 3J80c 2KENA 4NC7A 2F0FA 3TP6A 2DTRA 2JPCA 1IBKL 2Q2HA 4FX4A 1N8RC 5AJ3L 2WV6D 4ZDPA 3W1GA 4GKKL 3E6ZX 4GKJL 2E75C 3RZOJ 2NTTA 3K59A 5M9OA 2FBKA 2O5JC 1IJWC 2IWHA 4PDKA 3SEBA 2XKOA 3W2WA 4MTNA 1JJ6C 2R93H 1ZQ3P 4JOIA 1PRTD 2LVSA 2F0OA 3JSPA 3J80E 4J6HA 1AHDP 4P2CB 2VL6A 5FKKA 2OWOA 1Y56A 1UEBA 3GW2A 2CMPA 4HQMA 1ON1A 5ICEA 2WAQG 2IPKD 2LY2A 4FQGA 4CDGA 2K5NA 5IY5H 3JRAA 4JI2L 5CKTA 1ZYRD 3F2DA 2EV0A 5DEHA 3TREA 3E5XA 5HVQC 1SN8A 2Z6KA 2PMHA 5J8CA 3FVQA 5LRRA 4DV0L 5FKNA 3DWQA 5DCMB 3F2BA 2VUMG 5E1ZB 3K5LA 3RD4A 1IBLL 2MJ8A 4QUFA 3DTIA 2MLKA 1QG7A 1CHPD 1ZHFA 2C5CA 1JMCA 2DA1A 1U8BA 3FDYA 2JA7G 2YU9J 3GZ5A 5IP9G 3PUZA 3GTGB 5LHGA 3S24A 1YEZA 3URYA 1YNXA 2VJ5A 1A3UA 2DQRA 5LMNL 2E2HH 4IJHA 5KYLA 3HOUH 4H44C 4LUVA 1N34Q 5F1RA 3L2QA 3WG7H 3I72A 1VF5C 1HW5A 4XK4A 2VBYA 5IGBA 5EG0B 2DPUA 2A07F 4XONA 3NTHA 2DOAA 2ZC2A 4CGZA 3PUBA 1L3LA 4HSTA 3U50C 2OF1A 5M5YH 4X3UA 2E2IB 3C3LA 2WY8Q 3BZCA 1P4XA 3QJYA 4C3IH 1FTZA 4DV7L 3T51B 2W4SA 2LYCA 4DR2Q 1XMOL 1R7JA 1YJ9I 5JLXA 3PIPF 1QO0D 3EVQA 2XRLA 4UV9A 1EWHA 1EEID 4JV5L 4A3BG 2R7DA 1KIXA 2X6OA 2HOEA 2WB1N 2KHSA 4HA8A 2OF7A 1FIPA 2B2WC 1G8XA 4A3KG 1SMYD 2O4XA 1YZ6A 1IV8A 2MYSA 1F43A 2F0WA 4LJZC 3Q3SA 2QSHX 5F0FA 4WRDA 2A05A 3S8PA 1RZ4A 2K5CA 3ABUA 3WOEA 4C1NI 1V5EA 5HS8A 2CW0C 1SVMA 4C3JG 3OPOA 2JN6A 4HIDA 3OYGA 4E7ZA 3O6BB 2V1UA 2GM4A 2BXYA 5IT9K 1HNXQ 3DMUA 1Y14B 1FEXA 1SJED 3RN5A 3IAYA 4ALPA 2G7UA 3AG3H 1LUZA 2Y31A 2BBYA 5DUKA 2LMDA 2NRAC 2PQ8A 4KN4X 4L5SA 1Q1EA 4LF8Q 5IT9E 4L9NA 4AIHA 4P72A 3RMHA 1WH5A 4L5RC 2B2VA 1ZXTA 3A8KE 1DYQA 1L0OC 1QHHD 2XAFA 3SZPA 3KBXA 2HUGA 2XVSA 4PZ7A 4AYBA 3GFIA 1MSGA 2B3GA 1Z05A 1WTVA 3TP7A 1KRTA 3CCYA 4ESBA 2K5HA 5F0CA 3JRFA 4B3RL 1U9OA 4DV3Q 4LFAQ 4MTEA 5BOXA 4C30A 2E76C 3B02A 3CCEI 4YRVA 1LNWA 5JVG3 4GRIA 2B63G 1YJWI 3EN2A 2PFBA 4OX9Q 2F0LA 4MFDA 1UMQA 1LTRD 3DU6A 4FYDA 3GTJB 4G7OF 2QGQA 5C44B 4M72A 4BQOA 1B59A 1MBFA 4YEJA 4CDCC 1I1GA 3DKXA 1BNZA 3HOZG 3D4DA 3S16H 5C5MA 4LIUA 1XG1A 1FSHA 2ELJA 4XBFA 2PLYA 4OXPA 1RI7A 5M5XH 4JI5Q 5E3FA 1V5FA 1KQ0A 1X2NA 4A3BH 2DAOA 3PIP3 4QIWE 3D6WA 3BG5A 1VI0A 1ZAOA 3RNUA 2E7WA 4A0XA 3IFTA 2KISA 4N8X1 4LMQD 2MO0A 1XNRQ 1XGOA 3T13A 1MSHA 1TQOA 3HGYA 1Y1VH 3M4OH 5CVIA 4LFBL 4K5XA 3OOUA 4II2A 2VBXA 2K3PA 5B1BH 4XQFA 1V4RA 2RDPA 2HWVA 1SNPA 3KEQA 1YRNB 1DP3A 3I4OA 4FXDA 2F2EA 4X64Q 4JI4L 1AFPA 2EYJA 4I0AA 3CAMA 2NXNB 4EQPA 5M3MH 3AL0B 4MIMA 2HDDA 2CV0A 4NPSA 3EUAA 3OYEA 1UE5A 2RSNA 3KE2A 4UXNA 4BXXJ 3M8FA 4GFBA 4JV5Q 1JB7A 1EQVA 1MD2D 2DT7B 1NSNS 1K83B 1WJBA 2AWNA 1DOLA 3MXPA 3OYDA 3A01A 1CF7A 5M3FH 4FISA 4XLNF 2WADA 1K6YA 2VI6A 5FO9B 1MIJA 5FKMA 3J80K 3A56A 4IHTA 1EU4A 4NHJA 1IW7C 1B44D 1LVKA 5F0HA 3OW2A 2XF7A 4IQJA 3CCJA 1WI5A 1FBSA 4BEHB 2RAEA 4JYAQ 2FRHA 2F0UA 4G6DA 4BQQA 3N52A 3OYFA 3RTRA 1JXSA 1Z3YA 3DF8A 3SK4A 4XN0A 3I55I 3M4OJ 3BTLA 2CHBD 3S15H 3S15B 4AU7A 3UDXA 3WTSC 2LOOA 1KNEA 2IY5B 2Z4HA 2KKOA 2P0WA 1VQPA 2PEXA 1XPOA 2AQ1B 1V3FA 2HXIA 4DR5Q 1HFNA 2Y69H 4Y3OA 2WB1A 3AL0C 1JGGA 1B72A 5E1XA 1SE2A 3U9OA 3W6VA 4XIGS 2LKXA 2UUCL 4ITVA 1CHQD 3GYHX 1ZGAA 1MBJA 4OO1I 1Y0UA 4H02A 4EMSA 1B70B 3SK5A 3BR3A 1I6VC 4C3JH 4DBQA 2KL4A 2NBFA 2QILA 2B63B 2JXMB 1QZGA 5GTHC 1XB4A 2E35A 2KCMA 3MXNB 1REPC 2BZTA 1SYGA 5F6FA 3CJNA 2ZTCA 4RG1A 3GTQB 2NS0A 3CC2A 2K32A 5IYBJ 4IUUA 3CMEI 4KT6A 4F7ZA 3L9FA 2KA7A 4E7LA 1AU7A 4XKCA 1S72I 3ELKA 5KNCA 3PIOF 3S17B 1TW3A 3JRDA 3S15J 1SFKA 1QRYA 4X62L 2EXZA 1WCMG 1TT5B 5DEQA 1XDSA 4I7HA 2JUGA 3CPFA 4C2MB 2ELHA 5FRNA 2FD5A 3RYPA 3NQIA 3O8GA 1YRNA 5IYCG 1ETYA 2H94A 3F6OA 3LOCA 3QOEA 3M3YJ 3QU6A 1RHPA 1BCPD 3CTAA 1A6QA 4IL6C 5IOYA 5TISC 3RLNA 2VB6A 3H0DA 4N9PA 1HF0A 3CCMI 3SEQA 3GTPB 3D4RA 1I6XA 3FIWA 3V96A 4GYIA 1H9MA 4C2UA 3FRPB 2OD5A 3D31A 4GNXC 3PL8A 2KBNA 2KP6A 4RB1A 2HS5A 3SK6A 2HQEA 3L00A 1WOCA 4AM3A 4RLQA 1HTLD 2L7MP 4FETA 2CW7A 4R4QA 5LGNA 3LAJA 3CP8A 2NVTB 2XGXA 1RKWA 2J5OA 3HRSA 5TSSA 2VIXA 1K8GA 2K4JA 2XV4S 3GWZA 3I8ZA 5CV4A 1WTRA 2L7FP 3A03A 5TRDA 3H3VK 2ZXWH 2L7ZA 3ICEA 2SOBA 2LC2A 4JYAL 4CJ0B 4MLOA 4EJWA 1AW7A 3HHGA 1HTPA 4MQVA 4NC6A 4NDXA 1WJJA 1S9HA 3K1MA 2JRTA 1MBYA 5K36G 5F27A 1JKOC 2KDZA 3BZDB 2BV6A 1YNJD 4BY7G 4QTRA 3S14J 4JBWA 2PPBC 3U4VA 2RN7A 4C3HJ 5F64A 3GTOB 5LHY1 1U78A 3OW7A 2G5DA 2CWEA 5LBQA 1MNEA 1VF7A 3MKWB 3A1YA 4GOPA 4FF1A 1EYAA 2K9QA 3QOLA 4XRSG 5EEGA 4KDPA 1IDYA 4QUCA 2N8GA 1IN7A 2JT1A 2E5ZA 1RPWA 3TO9A 4PV1C 3L2WA 5C4ZA 3GTKJ 1JE4A 3SFIA 1XNQL 1EZ6A 1TU2B 4DNIA 1YITA 2PW7A 2QDBA 2K3FA 5AIQA 1G91A 1HW1A 4CCNA 4CCLA 2HEOA 4OWWB 4AIKA 1DM0B 2NVQB 3H0GG 4LNQA 1TLHB 2L02A 3EYYA 4HAEA 4RGSA 4IHYA 1GVPA 2MLGA 3D6CA 3H9JA 5CGKA 3H0GH 5L3FA 3S1RH 1D1CA 2NN6I 4IOCF 3CQZJ 3PFIA 1W7PA 1WJDA 3KZIC 3J7AY 2L5TA 3S9WA 3BU2A 1STAA 3KZYA 1BXTA 3ISPA 5LHIA 4NUBA 2OQ0A 2F0TA 6PAXA 5BN4A 1LV9A 4BUPA 2XAUA 2K50A 2XAQA 2D45A 4KTAA 2B2WA 3WTZA 2ZXHA 4KIGA 2VOOA 3DPUA 5A2QL 3MEXA 3VYSB 1ASYA 3G6JB 4LFCL 1SMTA 3OS2A 2E74C 4DNCA 2L1BA 1OQYA 2D1VA 2XKPA 3J7A5 1VQGA 2E5LL 2KIUA 5CV8A 4M9SA 1GV5A 3C2GA 3L09A 3GEZA 1J6QA 3KCCA 2ID3A 3EETA 3ML6A 2F0EA 3CC7I 3RSNA 4V2FA 1XMXA 1HKTA 2GA4B 3Q0WA 4XR6A 1PZJD 4HN7A 2BHZA 4XNFA 1H8AC 2BVLA 2IW5A 5HDKA 3KF6B 2VPLA 5FK9C 3NXWA 1IYUA 4JI0Q 3F8BA 3KLWA 2LK2A 2BW3A 5J1UA 2VUMB 4HLXA 2MH2A 2XSDC 2VUMJ 1AOYA 4HDUA 3LSTA 1F9NA 2LH9A 3HOXH 2Z2SB 2HYGD 2B0LA 1D5VA 4G9YA 4DOZA 1F9QA 1B6AA 1YIJI 1DOKA 3TDZC 1QUQA 1ETWA 2OTLA 3RZDJ 2W84A 3LSPA 2DA4A 3IL8A 1K7AA 2R7QA 3LMMA 3PSFA 1BI2A 1K8MA 4UUSB 2H09A 3EFXD 3IRQA 2O3FA 5KNBA 3N97A 1STGA 4YIRX 5L3CA 2KIMA 3P9CA 2OCCH 3GLXA 1PH2A 2QEJC 4II3A 5K7FA 3Q0AA 1H9SA 3TP0A 2VKHA 3ZOBA 4OMZA 3NTIA 3BG3A 1SXTA 1VQMA 3FBIB 1SFEA 2KRCA 4IUPA 5GQOA 3CPWA 2NVYJ 3MN2A 1KQ8A 1HLVA 4MNOA 3QP5A 3K7AB 3ZMZA 2DGYA 3VEPA 1AN8A 1T39A 5FD6A 3I4MB 2FEZA 4KMUX 2UZKA 3ZN0A 5ELCA 4DFAA 5LGUA 1WCMH 1X19A 2R92J 4IHWA 2XNAC 1QILA 5KAIC 1MHWC 3Q23A 4A5MA 5D6FA 4IQZA 4EQNA 3V8JA 3U1DA 3ZQCA 2PQAB 4P5OA 1VQ6I 3PGZA 2Z33A 4QMGA 4JI1Q 2DA3A 2ENBA 3HPGA 5M3FJ 3BJUA 3R2IA 5FD5A 4XKWA 3ZQQA 4B47A 1JHFA 1K3RA 3V8LA 5EYRA 2KPMA 4AWXB 2N55A 3TDQA 1W7PB 2A73B 1IO2A 5D6EA 3BDCA 5KK1A 1MJ9A 3S1NJ 1R5HA 4K6LA 2R3SA 1SYDA 2RSOA 3PQIA 3MHBA 3X3MA 1W36D 3VR6A 3B73A 1B1BA 4NNJA 4B3TQ 2QSFX 1F2ZA 1ZELA 1B9MA 4OO1H 2ZNZA 3F8MA 3AG2H 1VQPI 2UV1A 2XC7A 3UDFA 1EKEA 4Z6YA 4EJUA 3FZVA 2EA2A 4HYEA 4B08A 1FD7D 3NTKA 2EH3A 5E18F 3GZ6A 4A3MB 4A3LH 4K8IA 5C0XJ 4KY6A 2JWTA 5IGEA 1I39A 1TWGJ 2EY6A 5DTDA 3I0TA 2QBYB 2JQOA 4FF4A 3IH4A 3O8HA 5CBAE 3NWSA 2EQSA 4K2EA 2LD5A 2FNAA 4XQNA 4M9ZA 1VQDA 1Y6IA 1TIID 1VTNC 2SEBD 4M73A 3G71A 1MBHA 3HSFA 3OYAA 1FOYA 4W97A 4TV7A 1GVJA 2K03A 3HKZN 4ABZA 2VKDA 5FROA 3N6RA 2Q2IA 4RKLA 4JI7Q 5LMUL 1HSJA 2A69D 1S72A 1PVOA 2L9HA 3V2TA 1MW7A 1XTDA 2BDOA 1O80A 4M3DA 3DEUA 1TWGB 4XKVA 2F3IA 3NK9A 2VQHA 3G7LA 3FISA 4YELA 1TQIA 1HNWQ 1IUFA 4NB3A 2HVRA 4E4HA 3S17H 3QIAA 4KD3A 5EEAA 4RGMA 3H6MA 2NNNA 5C4XG 3FXJA 1OJLA 3C1FA 2K52A 3RKXA 4KN7C 3IWZA 2LLKA 3H92A 4B3SQ 2A68F 4EJOA 3B6AA 4HV5A 1R49A 1FGBD 3EA6A 1D0ZA 4DAVA 4P9UA 3M9BA 3HUGB 5IT9c 4F91B 2PMZB 2FOKA 1SYFA 4FTHA 3FK6A 3P7JA 3BDLA 2ECBA 1HCZA 5C3EJ 1HFGA 2V4JC 4YHHQ 4BBSG 2GQQA 5LGTA 4BY7H 3C1EA 1KLGD 1SVOA 5DV5A 4BY1J 3MXNA 1DU6A 1I4QA 4QSHA 3U1KA 2RDFA 2FF4A 1TY2A 2IX1A 1VQBA 3IH2A 1ZG1A 2DJIA 2LTPA 1LLRD 4H7BA 1WPKA 4GLAC 4MZ9A 1N32Q 2O03A 1ZN2A 1HDPA 2NVYB 4MNUA 4D7MA 2JK3A 2R0QC 1HUMA 2Y30A 4JOIC 1PXUA 2M9VA 1ERDA 3STBC 3VYUB 1E24A 2ZJQA 4IJAA 1EJ9A 2JA7H 1TC3C 4U88A 4PJJA 1LACA 3VSKA 2HKOA 2AXTC 2EYFA 1TWCB 3K4BA 1J2XA 2IS2A 4A0ZA 5CPRB 3MAJA 4Y52H 3KJOA 1JJ8C 2FBHA 1I3AA 4A12A 4V190 3OMGA 1I50B 5FGMA 4PGHA 1HBXG 1AE3A 3FK7A 2F3WA 2EFPA 3OYIA 3DHQA 1KYZA 3H5NA 4EQ5A 5I6WA 3QU3A 4HNTA 3EROA 5JVH3 4WJ4A 4YWLA 4TSSA 2QKIC 4BJ5C 3A02A 5E4WC 3GO5A 2WFWA 4HJ7A 3KEYA 1BI0A 1E2VA 1ASZA 2P5LC 2LREA 1BR9A 4GCVA 2R7RA 3DUZA 2PMZA 2PJRA 3M7GA 5CVRA 2EZHA 4OAZA 4X3TA 2LFNA 2GOXB 1HNZL 2QWWA 2EV6A 2P6TA 3K1NA 5J40A 3JRHA 3BLYA 2DMNA 4ZYHA 2CQAA 2EFNA 1ZR2A 2EXDA 2Z9HA 5HLTA 5K5OA 4DPGA 3P75A 1PZKD 1YIJA 3O2PE 1X1PA 3OHXC 1DOMA 2JJQA 2STWA 4ZYSA 3OYBA 1LTSD 1CKMA 2ACJA 2CG4A 2MH9A 4XICA 3VDYA 2UUZA 3VYUA 1LT5D 4DR3L 2NS7A 5JJZA 2HXOA 1FOWA 2OCEA 3ZMVA 4CYCA 1EQRA 3VA7A 1Q3LA 2EJRA 4AUXA 3VSLA 4R8HA 4GN5A 5LMNW 1E2XA 1IZ1A 4IFDG 1SEUA 3HUGA 1EU3A 3HKZA 4QWQA 3M1EA 3WU0A 4ZYAA 3BVGA 1ET6A 3MFGA 3DXJF 1OFCX 3CJRB 3HOYG 3RQ4A 3TMEA 4KIFA 2MNAA 4GLVB 2WWYA 3HDDA 1KRSA 1UNSA 2FOWA 2R5YA 4QGUA 3J80Z 1VS0A 5F08A 4LK0F 3WOFA 1O57A 3JRBA 4YHHL 3L3OC 2VPRA 1S8NA 2EYLA 1SC7A 4BWGB 4A3LG 5HDGA 2VT2A 2MGQA 4B3RQ 4F87A 1Y8OB 3G1LA 1ONVA 1ONLA 3GFLA 1UB9A 4L5EA 4UHVA 2F0JA 4IF4A 3O3KA 3BOQA 1O3SA 1EY6A 1JICA 3HSEA 2AHQA 4MEYF 2V1CC 4J8QA 1P4AA 1BBUA 3S32A 1IGNA 3RCOA 4IQ4A 4LUZA 2IPQX 2AXLA 2RBMA 2PX9A 2M2EA 4C3HB 1S5BD 3BG6A 1T08B 1SEBD 2X85A 1I6HJ 5JPMC 1CTMA 1Q8IA 2QUFA 4ODGA 4DK1A 1FMVA 2NB0A 2IS1A 3ER0A 1H89C 3U9SA 4H4KC 3NRVA 3OIPA 5D5WB 3W2VA 3AG1H 2EY5A 1FWZA 2I10A 4DZJA 3E6DA 4AYBG 1VQOI 4LJZF 2D0PA 4UUVA 2LBFB 2DTZA 3EJIA 1K0RA 5LL6S 4R1HA 5IODA 3Q6SA 2IVMA 5GADJ 4HR7B 3S1MH 2D2CC 4GDFA 1ET9A 4AIJA 5EPJA 2NVTJ 4HX8A 4NXNQ 5FLXE 1Z0XA 4YCVA 4DV4Q 5HODA 1K61A 1TWHH 3ECHA 1F2LA 2V4DA 1YW7A 1EYGA 1O7YA 3M07A 3OS0A 1PH1A 4WJWA 4XORA 1ESFA 4BE1A 2OZ6A 2BCOA 3BROA 4IRHA 4OHJA 3SXHA 4JBJA 5C4JJ 2R5ZB 3C2PA 1B4AA 1F9PA 3P9KA 4EQQA 2DOFA 4BBRH 2YPRA 4C3HH 4GLXA 3S2DJ 5EGOA 5FO7B 4LB5A 1WTQA 3JAMi 3LA2A 1VQ8I 2E5LQ 4GKKQ 1OXTA 2NYXA 2CH4A 2CH0A 1Z6RA 3J81L 3LFKA 4RM2A 1EF4A 4DR3Q 3SHFA 2R7TA 4CA0A 1QHGA 5KHDA 1AEXA 4HBLA 4UDUC 2PMZN 1YW9A 3GTOH 2WAQB 2BDNA 3H3UA 3E97A 1K28A 4DGZA 3QWLA 4IRGA 1VDZA 2OTJI 1UELB 2BYVE 3G71I 4DV6L 3ERQA 1UE7A 3CF2A 2K7VA 4EM1A 1X3EA 2VQFQ 3MC0B 1RTNA 2UXXA 2QQAA 3P7NA 2NZOA 4LW1A 3ECOA 4HIOA 2RHSB 1S3OA 1RUOA 3VR5A 2EPBA 2B2VC 4K5VA 4IPCA 1N33L 1NTCA 2DNEA 3I91A 2KJCA 4ILWA 1QOHA 2WA0A 5AJ3Q 4XMYA 4AQYL 4N8FA 3GTKB 1YOVB 2ZO4A 4IPHA 1JOOA 1T0FC 4B09A 1YHAA 2ECCA 1EA3A 4KKUA 4XXEA 1VQEA 1EY4A 5KNDA 1GUSA 2M30A 4EM2A 3F23A 2AQ3B 2DDAA 4ZYGA 2VJJA 3E0JA 2NVTH 1WRJA 4BJTA 2W82A 2RF4A 4XIDA 1U0JA 3GVAA 5CV5A 3DBRB 1H88C 1IV6A 4A3DH 1FJLA 3VR3A 3I58A 3UR3C 1YJNI 1NBWA 3STBD 3H0GB 1MBGA 1ZARA 4PJ0C 1I3QB 1JQYD 4OGQC 4ULLA 5ELDA 3M1CA 1EIFA 5CV7A 4BBRG 1BVSA 3OV8A 4Q48A 2IGNA 3HB9A 2V26A 1ENHA 2JA9A 1ZEQX 1DCZA 2JVGA 1IBLQ 3CW2C 4JCVE 3AYHB 4QPOA 3M4YA 3BTIA 3DEPA 5E4XA 4F8MA 3K1PA 1SR3A 4ENNA 4OWRB 1WJAA 1RJTA 5CYUA 1YX3A 3ESWB 3X3NA 5LMNQ 3HZJA 2DNCA 1SYCA 4PFPA 2E2DC 1IW7F 1PYBA 3HP3A 2R93J 3ASNH 2KJXA 1II3A 1RODA 4ME5A 3CCVA 2IA1A 1A36A 1R9TJ 2OEOA 4NXMQ 5GAHC 1FPQA 1U4RA 1GO3E 2W7NA 4UP9A 1DJRD 2M3AA 3RPUA 2KQRA 2O2LD 2DW4A 2E2JB 4IHSA 4DK3C 3I2ZA 4YCWA 2VE9A 2JSOA 5M3FG 4U7DA 5D4RA 4KD4A 1M90C 3IV5A 1ON2A 1YW8A 4PZJA 1QCBD 2F0IA 3D5LA 3S2WA 1H95A 2G0EA 1ICFB 2XIGA 5ELNA 4A69C 2RKSA 3S1MB 2X6YA 4I2OA 1HNWL 3OYCA 4QIWB 3L7WA 3WE2A 1ACIA 4C3IB 2GXAA 5FOBB 1BBYA 2PJPA 1HR0L 1O7LA 2JN4A 2M9HA 3CDHA 1W0UA 2DPDA 9ANTA 2ICEC 1NE3A 3T56B 4PJLA 4RDUA 1IXRC 4WXDA 4DR6L 2Q2EA 2IEKA 3WHCA 2F0QA 2ZMEC 1ESRA 1X3GA 3OTOQ 4PCQA 3C2BA 2B2TC 3IHUA 1VQLA 2DN8A 5IGCA 1JB3A 3L2PA 2DJGC 3GTMB 5L37A 2VODA 4IUTA 1BKBA 4CUGA 5J4YA 3R0AA 3RUZA 3RR5A 4KN7X 5FLMJ 5ELEA 1LB2A 3HGGA 1ZH5A 4RKBA 1PH6A 1B7YB 3HKSA 3ABMH 1R6RA 2E1NA 3NEMA 1J0RA 3CRLC 1X56A 1OKRA 5E8IA 1SRUA 2L7KA 3BS1A 4UNOA 3E9HA 2XHKA 4D5CA 4RFBA 5E17F 2E7XA 4A3IG 1UEAB 2P5ZX 2MD0A 2AMCB 3HOWG 3A8IE 2K6AA 4FX0A 2XRNA 4CICA 3PUYA 1LTAD 1Z47A 4K0KL 1I50H 1Q46A 5LRSA 1Q7YC 3PQJA 3HRUA 1GXQA 1R9TH 5JHFA 1W0TA 4LGWA 2ID6A 4XYQA 2MC3A 2JSPA 4Y15A 4C3HG 2FX0A 1FY7A 4D0PA 1X1AA 4ZCKA 1SYBA 3SHLA 2HCIA 1A8VA 3GTKH 4J00A 2DN0A 2JA8G 4A3CH 5HS7A 2VY3A 3A0BC 1VF9A 3JTHA 2KDOA 1ETOA 2XVCA 1TZLA 3E3XA 1ZG5A 4LITA 1A62A 3TDUC 2A69C 5IYDJ 3BR6A 3HTUA 1MSFC 2P7VB 4ESJA 2G9HD 1QZYA 5C3EG 5DM7F 1CA5A 4G7OC 2XAHA 1JUSA 1OR7A 4HJ5A 1BJZA 4A3EH 1WGXA 2HYJA 2F0DA 1HNZQ 4ZQ3A 1LTTD 1X3PA 1SNMA 3S1RB 3TW6A 2Z6KC 1FYLA 5KEEA 2V1DA 4ZDLA 2FU4A 5DM63 5JEAH 3I64A 2BY1A 1FC3A 2VC1A 1Z77A 4QF4A 4JPBW 2JA2A 1T5EA 2M4KA 1DP7P 2WKDA 4OIQF 2ZFWA 4NQWA 2XASA 4I09A 1W5CC 1PP7U 1JI8A 5FLXc 4HCEA 3Q8DA 5JEAG 4CCOA 2HHHL 1KDAA 4KY5A 4LF5Q 5M3MG 2X0LA 2DA2A 2OQGA 2ESNA 1PTOF 4DZPA 2VL8A 3KFUA 1E7ZA 3SFZA 4XN3A 1NMGA 3WGHA 2AO9A 2F0NA 4BEHA 4E6IA 4HJ9A 2JA8J 3GTGJ 4U7BA 1NK3P 1AKHA 2CQXA 1A15A 4OU0A 4I7AA 2A6HC 1YJWA 4DR4Q 4XOPA 2HD3A 2E1CA 1J75A 2LSSA 2Q8IB 3SZGA 1WVRA 5K5QA 2UUBL 4JI1L 1P8LA 3K9TA 1JTYA 2L54A 1KONA 3KF8B 2MSYA 4C2MH 2O9LA 1QQIA 3QYEA 5ICFA 3CP0A 1T8IA 2VQCA 3I59A 4CYDA 1VQ4A 2A6HF 4BQNA 2X6WA 4RAYA 1HZAA 1X3FA 3T53B 1VQ9A 1L1OC 2IAIA 4Z9CB 4LAAA 2COBA 3CCQA 1MNMC 4A3JJ 1BR4A 1PVEA 1O3TA 1DZ1A 2V6EA 3HRTA 1PH4A 3MMYB 4A3KB 2WV1A 1SD6A 4M6YA 2W24A 1FLIA 1R4QB 4LD5A 2L11A 2V9KA 3G6EA 3B6YA 2RVLA 5E1FA 2K5WA 1UG2A 2X1EA 1BCPF 3VB2A 4FASD 1SE4A 3S1QJ 3BTJA 1Y8NB 4ABNA 3OOPA 2K33A 3KOJA 1FJGQ 1LTBD 1A63A 1JHHA 4K2KA 3IRBA 4GOPC 2WAEA 4HIKA 4WF2A 4ENKA 1E3HA 1BOSA 2H1KA 1KYWA 1K83H 1HDDC 5HGQA 2FHTA 3KP5A 1AH9A 4CSWA 2HPMA 1ZGWA 3PO3B 3VOEA 3BR0A 2R7SA 1QVTA 2HQAA 4BE2A 1TWAB 2QENA 2EB7A 3ZQGA 1HA5A 4XSZF 4XLFA 3OL4A 2HTSA 2HI3A 3K4LA 4DR2L 2W48A 4F55A 2NVYH 1HOMA 1PYWD 5EZHA 3MKYB 1G291 4HX7A 3TSSA 1LO5D 2MO1A 3I59B 1YS7A 3S93A 4CGYB 2HR3A 2PBIA 4DV6Q 2HIXA 3VDXA 2HHHQ 3PF5A 4DV5L 2O8XA 3V7SA 2F0KA 5IT9L 3KF6A 3M4QA 4CDFC 3HOVB 3PO2B 2CUJA 1Z21A 1SE3A 1EY5A 1PYVA 4V19K 1OYWA 4HEA2 4IHVA 1P9QC 2HQRA 3BP8A 2MBFA 3D5SC 3J7AF 3HZXA 2LY7A 4FT8A 1G2HA 4DF7A 3TS2A 2QLZA 3E6CC 1ENFA 1YJ9A 3H9GA 3NSWA 5I2YA 4BY1H 1HQMC 2V6CA 4JX6A 4XQJA 3NBIA 1KDBA 2IX0A 2KCNA 4DV2Q 3ZRGA 1VQIA 2PNRC 1S4ZA 1L2FA 2OT2A 3ZYYX 2JA5J 3CUOA 1JUMA 1VQFA 4BYYA 2UU9L 1P4WA 1EH8A 3I70A 1G3WA 2FE3A 2VKVA 1PUFA 4KUMA 1ILPA 2E1OA 4QY7A 1HA6A 1MMDA 1WJFA 4EGZA 2KIQA 3HKZG 2HTJA 1C0WA 2NVXB 3MWYW 4HAMA 3HOUG 1IYJB 4ZKCB 1TWFH 3S16B 5K7HA 1UE6A 3D4WA 4J01A 1X3WB 1SFXA 3RKQA 2K86A 4K8JA 3RZDH 1ETXA 3KLSA 4A3IB 2K7LA 3S2DB 1SSOA 1MD0A 1B50A 1JUPA 2Y9YA 2AQ2B 2OZUA 4JI5L 5JOBA 3CO7C 4PMBA 1KDCA 2UUAQ 3PUXA 3J81j 2Y9ZA 2YS9A 2KEDA 5K7ZA 2WV0A 4CJ2C 1V1PB 2CYYA 5ELBA 3Q9SA 1VQNA 2NVUB 4JQFA 1BCPB 5A2QK 4DBRA 4RB3C 5IT9Z 2QDLA 1QBJA 5KVRA 1X4OA 1H9RA 3OYHA 4BY7J 4DR1Q 2QCOA 2KHMA 3FMRA 1I4RA 5F1JA 1JWUD 1GXPA 3E6BA 2P7CB 3UE0A 3MCZA 3NWTA 3EIVA 4CZCA 4ZC3A 3I4MG 5M5XB 3K6GA 4A6EA 1RETA 2DFIA 1VQCA 1R1TA 1ZGJA 1BDOA 5CORA 3CUQA 3JTGA 2IS6A 2JA8H 1EYCA 2CWAA 3OSOA 2GA2A 5FFXA 4ZLTF 2EZLA 2XIWA 4QL5A 1GKHA 1O7ZA 2H8RA 1RKNA 2K14A 4HX4A 3G4SI 2V9PA 3P5JA 1LT4D 5C4XH 1VQ7A 1OISA 3QYFA 5IOZA 3NUCA 3H0GJ 3GFJA 2B2TA 1SROA 1HR0Q 2HIVA 1OCZH 4ZYDA 1KD1C 1IRXA 1MMAA 2B2YC 2A5WA 4UB8C 1A3VA 1WTWA 3PMFA 3K4NA 2UXBQ 2KRFA 3BVZA 5ILSA 1LFPA 2IA0A 4BBRJ 4BA2I 4S04A 4YCUA 3OS1A 3RJPA 2WB1B 1IAWA 5EQ0A 5C4JB 1A0IA 2KIFA 1R1VA 2M00A 2CRGA 1YHQI 1DDNA 4KI0A 4A3EJ 1IRZA 4FXKC 4ZZDA 1HKSA 2E8GA 3QG1A 1YX5A 2DDBA 4C9YA 2VBZA 5M5WJ 5FJ8G 4A93J 4DYQA 5HLGA 2E34A 3B6CA 1ZK8A 3I4MJ 3MVVA 3F0CA 1HZBA 3F8NA 3LSRA 1JTXA 4A3DB 2IXSA 1N36Q 3C1DA 2LDUA 3CZ6A 4U0YA 2LY1A 4RGOS 3GMEA 2J4XA 1VMPA 3SQNA 4E7JA 3E9IA 1BUVT 3N4MA 4BBRB 2VW9A 5L3EA 1IG7A 1JC7A 5CR3A 1PRTF 4HF2A 2RQPA 3A7AB 2VN2A 3K6OA 3K5MA 5JEAJ 1EV7A 3F8FA 2R7FA 3GXOA 4A3JH 2F4VL 1ULYA 2KT0A 2AHOB 5D4SA 2CGPA 2VBWA 2JUCA 2R7ZJ 2NNYA 4R79A 1CKNB 4CYCB 3K5OA 4OAYA 2EDGA 5FRMA 3ULQB 4HNVA 3RZDB 4E7SA 4CDDC 4OIRF 3A5ZB 3FXRA 2LP0A 2RKHA 1HKQA 1PFNA 2RQXA 2A19A 1HPCA 3K0XA 2AQFA 4RAZA 4UP8A 4P1WA 2HYFA 1X1CA 1QWYA 5L3DA 1A2TA 3ULJA 3JREA 5IPAA 1H9KA 1JOQA 1YJNA 1SAUA 2PI2A 1TWHJ 5IP6A 2STTA 4JX4A 4RLFA 5IE8A 1VQAA 3OOCA 1HA8A 3JRCA 2R7WA 4RCOA 3K10A 4YFXF 4OL7A 3EDPA 4AD9A 2RHQB 1HUNA 3PO3G 3BR2A 1N9WA 2HQNA 3OY9A 3LSJA 2H6BA 3HC7A 3L2RA 2I07B 3BC8A 1STZA 1RIOH 3BR5A 3EUHC 3G1MA 1Y39A 2WINB 4A3GH 4HZFA 3TEHB 3TW7A 3NE5B 4QIWN 3KP6A 3DKWA 1HJPA 2MUYA 2OV7A 4KFCA 2Y0SA 2ZKZA 4AH6A 4B43A 1PJRA 2EE1A 3MAQA 2F03A 2F0SA 2BOSA 2DT6A 4DXFA 1T33A 3IP4B 3LSIA 3JAMZ 2HCCA 4APVA 3LGJA 3WGIA 2FMLA 4GS3A 4HCSA 4YIIA 4UV8A 2VQGA 3SEZA 3S2HH 4MIUA 4A3IJ 4HSVA 2EJFC 1SFUA 1IXSB 4HMIA 1YTYA 1XMKA 4A3MG 3DPLC 4ENJA 4X0GA 1STYA 2MW8A 1U3EM 3CQZB 1FOKA 2D9UA 4HF1A 4E70A 3RI4A 3K58A 1HQCA 1SANA 1NMFA 4C2TA 2JSCA 1XTCD 1EZ8A 4MTDA 2DFEA 1EY7A 1A6XA 1QNKA 4JI7L 2F3VA 4FE4A 2VQFL 5NUCA 1R5ID 4GZYC 1H9SB 3FXMA 4Y13A 2J0TD 1PTOB 2K4BA 2TMPA 5EGTA 1YO5C 1T2KA 1Z9CA 3J7AO 1CI3M 1PFMA 2E60A 4K2LA 1FX7A 2GN5A 2ZMEB 3E5QA 3GTLH 1C7YA 3GTLB 2DCEA 1IN5A 3VR4A 1X9NA 4XRMA 2R92B 2Z4IA 2CH4W 4DV1Q 3OYMA 2DK5A 3M7NA 4JX5A 4WXCA 3S3NA 3TRZA 1E2ZA 1PTOH 3DWPA 2CFMA 1IN4A 4X66L 4UAIA 4IHXA 5T1GA 3LQRA 3H3ZA 3C3WA 1WTPA 2FBIA 3L2VA 1E0BA 4YIJA 1VQLI 1MZBA 2R5ZA 2N8NA 4PJMA 3LAPA 1HHVA 2L4MA 1J59A 2ZTDA 1EY8A 2ZM6L 3R60A 4JI3Q 1SYEA 2WACA 2DY7A 2ALYB 4LF9Q 3QB3A 4IPAA 1PH3A 4CHUA 4CCMA 3S1RJ 5C4XJ 3H15A 3UI2A 2AUJD 4DR7Q 2GXGA 1QZEA 2EIJH 3FEWX 1D1BA 2B39A 3DP7A 4LFCQ 2G9DA 2M0MA 2DQLA 2E2IH 4OX9L 2NVXJ 4A3GG 1VQMI 2YU9B 2PG4A 2Z0SA 1J8IA 5HDNA 3HOVH 3PO2H 1QPMA 5GAEJ 4R8IA 1LDDA 5FFZA 1XXGA 1IN6A 3ABLH 2XWJB 3KLOA 1SFOH 2JA6H 2JA5H 2ZJ2A 1F2YA 4BBSJ 4ON0A 1JR0D 4L5IA 4PUSA 1OCRH 2LY9A 5BMZA 2DYRH 3Q22A 4BY1G 2XTIA 4BL0B 2ZNYA 3DCFA 2K1BA 3K69A 3LWUA 1PHJA 4DV5Q 3IWFA 2PN6A 1DXMA 1KXLA 3CMAI 2IGOA 1PH8A 1QUQB 1JWMD 3VFZA 4DAYA 4LFBQ 1B9NA 1G6NA 3CCSI 4CZZA 1Q12A 1T5XD 3IH3A 2F6CA 1HZ9A 4OIKA 3T16A 2BGCA 1F36A 2GOMA 4W1UA 1Z7TA 1EOTA 4JI0L 1IYVA 1G3YA 2RDHA 1CQVA 3CKIB 2KVMA 3OYYA 5E3MA 3WWVA 1U4LA 3ONAB 1SJHD 4UVAA 1NK2P 4NMZA 1XMQL 1B1ZA 2QVOA 2R7XA 1PA6A 3BYYB 4A3FH 3SE0A 3CD6I 2VKEA 1ZR4A 4ZKBB 5M5WH 2EIMH 4B48A 1Q81C 4HSPA 4A76A 4NQWB 3G4SA 4O0AA 2OAZA 3Q5FA 2K27A 5IYDH 2J7ZA 1SMYF 2B2YA 3WODF 4HQEA 3CXCA 2CQKA 2C6YA 2ZFUA 1LABA 2L9RA 5EPLA 1FMWA 2IT1A 2Y0SN 1MNDA 1CKNA 1UCRA 1PMRA 5C0XH 1F9SA 3MXUA 1XTAA 2HOSA 2VS1A 3M3YB 2FNPA 1YNJC 1OCPA 4ZTFA 2ICWG 1ETKA 3H09A 1NH3A 2F0MA 4UB6C 1T95A 2L9VA 1RDPD 1O7FA 3LSMA 2R7ZB 4P74A 3SR1A 5J1ZA 1D1AA 3DXJC 2E19A 4BQAA 4LG0A 1YI2A 4NKLA 2Z99A 1NHAA 2F1MA 2DJFC 1KABA 1ORKA 3TZUA 2PYKA 4O1NA 2QW7A 4O5VA 3MKZA 3HYIA 4M3BA 3K4CA 2OTLI 1OO9B 1TY0A 5IGDA 1RIPA 2R4GA 4X6AJ 3WU2C 2DK8A 4K6DA 1G2TA 1BOAA 1FYKA 4B9XA 2BY0A 3NEUA 3GTQJ 1RL2A 1KZHA 4KJOA 1AE2A 1WWXA 4X62Q 2HKXA 2QQBA 3GTGH 5EKIA 1FP1D 1N34L 3LNQA 2A6TA 2X51A 2WAQE 1USSA 4XSXF 1TS4A 1U5TB 3OL3A 2H1EA 2L2OA 3GX4X 1RD9D 5IP7H 5A35A 4EGYA 5DCMA 3K80C 2NN6H 3EBEA 4HJ8A 4HJAA 1FT9A 3KYLA 1F9RA 2R7OA 3KFWX 1PH7A 5JJLA 2EYHA 2CFXA 4OINF 5CVVA 5ELOA 2YTXA 2ZTEA 3CU7A 3HOWJ 3PUWA 4YY3L 4I76A 1LQ1A 3UDGA 3NAUA 1K79A 5TGTA 1VZ0A 1MBEA 3W3CA 1Y8QB 4P71A 2RC4A 2KZVA 3CDIA 3HG9A 3GTOJ 4XQQA 3NQTA 2XGCA 4GO1A 4DA2A 5GROA 3OIQA 3A4CA 2H5XA 1D5ZC 5E7NA 1QPIA 1ETQA 3QRFF 2HOAA 3GZNB 1W1WE 4KIBA 4YFKF 4LF5L 3VYRB 2ISZA 3TKYA 3TQNA 3NPPA 1L0WA 4RGUA 2QKLB 1D8LA 1KQ9A 1U4MA 1NG7A 4QB4A 2LRDA 3MTSA 5F2DA 2GXBA 4IOCA 3MZYA 3V42A 3PO3J 4YFNF 4DYCA 5D5XB 1S7OA 3CCVI 4EJTA 4RS8A 4KHZA 1K78A 2CW0F 2MG4A 3JR9A 3TP3A 1T9HA 1RUNA 2FQ3A 2VASA 2F5VA 3T8TA 2DO7A 4Y17A 5JPNC 1LEAA 1R22A 4C3IG 3I4LA 1N78A 4UVBA 1F4KA 2XN9C 3LSKA 2OPTA 3KP7A 1QVUA 3BG7A 4BJ6C 5H6QA 4JK1C 2NS8A 4NDLA 4LLGF 3TGNA 1BR1A 4A3MJ 4DR4L 3M9AA 3VYSA 3S2HB 1B8IB 3V8KA 3CUQB 2EY1A 5BR8L 4HDVA 3BQZA 3ZR8X 3DM3A 4B3XA 2X48A 1U9RA 3NHHA 5EPKA 5JAVA 4D9JA 1PH9A 2QF7A 4POFA 1EOVA 5CV9A 4M3GA 1XD7A 1LM0A 4NW2A 3MD2A 3J81i 5J1RA 4O42A 3OIOA 1Z9FA 5J47A 1X58A 4Y33A 3BJOA 2SDFA 3PIPA 1Y1WB 3DLAA 3HPHA 1OXSC 1SBBB 1SLJA 2AUKA 2VNUD 5IT3A 2LKSA 2A5HA 4L9JA 5GAEC 3R93A 2FMMA 4GN4B 3H3VH 4IUQA 2FA5A 3TQYA 3T8RA 4LF6L 4J1MA 2L0CA 2Q8KA 2EFWA 1XSXA 1CKOA 4R4OA 5FJ8J 4JI8L 3A0JA 2L9SA 1IHZA 3HOUB 1IN8A 3QODA 2DI3A 3TP8A 4A93H 3BZ6A 1A31A 3S17J 1U6GA 4XT3B 3CMYA 4ETSA 2XPUA 4LF7Q 4UUSA 3JSOA 2XPWA 1B4OA 3L0OA 1WKMA 2OQKA 2VQEL 4H13C 2ZBKA 1IKLA 2R6GA 3Q0VA 3KBGA 2TDXA 4X64L 1T38A 4C1NK 2ATWA 3RN2A 1YNNC 5ICCA 3K7AH 3KLRA 2N78A 2AKWB 4AIMA 1LT3D 1MJBA 2YV5A 5CQEA 1UAAA 4RGRA 1YHBA 4A3GJ 4BA1I 3HKZB 3EPZA 5J6XA 4JBKA 3I53A 1IBMQ 2F5FA 3C18A 4V0BA 2BY2A 2LKVA 4KY7A 1H9GA 3J81Z 1E2WA 2Y0SG 5HURA 2XB5A 2VT3A 1OXXK 2NAZA 4DV1L 1PUEE 3GLLA 5JFRA 3K4JA 1SFOJ 1E22A 1MBKA 2KECA 1GJXA 1K83J 4J19A 2I5HA 2ZSIB 3OWFA 3CMAA 2C9OA 5GAGJ 4DU9A 2UU9Q 3FXKA 4EGVA 2SNSA 1X32A 3CJTB 3RKYA 1OCCH 3GV3A 1EQQA 4IFDI 1FIAA 4IJLA 4BXXG 2HDWA 4U68A 3K0LA 1T56A 4G7HF 4A3BJ 2ZCWA 3HOWB 4P9FA 4DAYB 4JK1X 4PQXA 5L3BA 1Y8RB 3DPTA 1Z3XA 2ASBA 2OQRA 2Y0MA 2EILH 4K0KQ 4A3KJ 3DTKA 2OC6A 2BH8A 4A0YA 4TVAB 4LFUA 4JYKA 1CUKA 1Z6TA 4FCYA 2EJGC 1TWFB 2E2HJ 1U5TA 4MQ9F 2R93B 3I7FA 1DGRM 1CK1A 2FUG2 4L18B 1T98A 5I6YA 4IOAA 2EK5A 3FPPA 5KAFC 1F2MA 5D3DA 3QYBA 4JBAA 4BE0A 2EJMA 1T0FA 3D3RA 3ROUA 4RGXA 1X3UA 1V55H 4MFEA 1GT0C 5JVGF 2CQQA 3M8JA 3VYTB 3W1BA 1V8QA 4MN3A 1SFOB 5K5RA 4LF6Q 2VC0A 4F52A 5IYCH 4R4TA 1D8JA 3ERSX 2JA5G 4KISA 1RESA 3ZPLA 2I8DA 5I2XA 3AFQA 1PP8F 2AS5F 2K5VA 4AYBB 3KEOA 5A2QE 3AAFA 1KAAA 5J22A 2VE8A 4WK8F 4A3GB 1I4GA 2K75A 2QCPX 1UHSA 3HXLA 1QNUA 1RR8C 2FXAA 5D3IB 3SYTA 4EEFG 4BDZA 3PFYA 4Y52J 3CCLI 2O8KA 3BVMA 5EGOB 5EZGA 1D2BA 1JE8A 3DLLA 3RKWA 1G3SA 1LTLA 1A04A 4I98B 3GTJH 4RAFA 4B3MQ 4XRFA 2M8EA 5CBEE 2HQLA 3K57A 4NP5A 3IL2A 1UWVA 1BM9A 1Y1WH 4PZ8A 2UXCQ 1RRJA 1QA6A 3FDTA 3KDFB 4MHEA 4YWKA 1RC9A 1JJ2A 2H6CA 1ZRCA 3A0HC 1TNTA 4DKAC 2QA4I 2D2WA 4CKCA 2O5IC 1PTOD 3HOUJ 3DEEA 4B4CA 3VWBA 1WCMJ 5J4VA 1MH4A 2RCFA 3ZMUA 2P5VA 1S7AA 1EY9A 3TEDA 1NTGA 4HIMA 3BQYA 3AQQA 2A69F 3T1YQ 1R9TB 2IBDA 4IURA 3TMOA 4Y4RA 3CC2I 5M3MB 3BPXA 3FKIH 2V7FA 3TBIA 4YWMA 2ES2A 1VQ5I 5IYCJ 2HDCA 2XWBB 2PNHA 4A3EB 1HQRD 2A6EF 3T5XA 2Z3YA 3IC7A 3I4NG 3I71A 1SNOA 2F0GA 2XB0X 5EKKA 4H0LC 3OSGA 5C0XG 2VJIA 2JA7B 2MQHA 2BOLA 4A2UA 4AQYQ 3F2CA 2SNMA 1SDFA 3H3VI 1I4XA 1W36C 4RMFA 1CQTA 3JAME 3K0YA 1H0MA 2KFDA 4ZTJA 1JT8A 1MGSA 2FSWA 1BIBA 3HL2A 1D5MC 4IKFA 3D1NI 3ZQLA 3MEHA 4ZK9B 1XX8A 1XMQQ 2A6EC 2BHYA 3G48A