3GO5A

Crystal structure of a multidomain protein with nucleic acid binding domains (sp_0946) from streptococcus pneumoniae tigr4 at 1.40 a resolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
285
structure length
285
Chain Sequence
GMNTNLASFIVGLIIDENDRFYFVQKDGQTYALAKEEGQHTVGDTVKGFAYTDMKQKLRLTTLEVTATQDQFGWGRVTEVRKDLGVFVDTGLPDKEIVVSLDILPELKELWPKKGDQLYIRLEVDKKDRIWGLLAYQEDFQRLARPAYNNMQNQNWPAIVYRLKLSGTFVYLPENNMLGFIHPSERYAEPRLGQVLDARVIGFREVDRTLNLSLKPRSFEMLENDAQMILTYLESNGGFMTLNDKSSPDDIKATFGISKGQFKKALGGLMKAGKIKQDQFGTELI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multidomain protein with S1 RNA-binding domains
publication title Structure of a virulence regulatory factor CvfB reveals a novel winged helix RNA binding module.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Gene regulation
total genus 68
structure length 285
sequence length 285
ec nomenclature
pdb deposition date 2009-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13509 S1_2 S1 domain
A PF17783 CvfB_WH CvfB-like winged helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3go5A04
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3go5A02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3go5A03
2.40.50.330 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3go5A01
4P5OA 3J81j 4A3FH 1KD1C 4G7OF 2H6BA 1XNRL 5D5VB 4A3IH 2JA6H 1HSJA 4PCQA 3OTOQ 3CAMA 2XKOA 4YG2F 3RPUA 3F6OA 5EEHA 2VZAA 3TDZC 4M6YA 5CVRA 3MEXA 2WTEA 2ZNZA 4BNCA 4H02A 3KP7A 1N36Q 2DQLA 3E6MA 1MZBA 4X66L 5HLGA 3T1YL 2IP2A 4N0BA 3KF6B 5C4XG 1X6OA 2G7HA 1T98A 4KNYA 1IBMQ 2B29A 4IFDI 2MC3A 3G4SA 1XD7A 2O3FA 1G3SA 1Y0UA 2CKZB 3PQJA 4JI2Q 4RAZA 2QENA 3DQVC 3VEPA 1XGNA 1EH8A 1HR0Q 2E8GA 1QZZA 1I1SA 2WB1E 1JE8A 4A0ZA 1X55A 3VOEA 2FE3A 3QPHA 4XBFA 1TWFH 4DV2L 4LF9L 3STBD 4IJHA 3BJOA 3TDUC 3I4MH 1FC3A 4GKKL 3PUWA 2OA4A 2QUFA 3UDFA 1YEZA 2K75A 4GCVA 4TV7A 2XIGA 1I6HH 3FKIG 1PYSB 1CF7A 4LLGF 3UDGA 2NNNA 4A3EG 4A3DG 5M3FG 1EV7A 5C3EH 1XSVA 3V7CA 1T6SA 4Q4ZF 1VQHA 1JGSA 2ZMEA 4DR1Q 2A1AA 2PI2A 3HTUA 4GLAC 3TS0A 2MH9A 3FWEA 2PMHA 3HRTA 2MBFA 3CD6A 3TO7A 4B3ML 2FNPA 2P7CB 3CCLA 2MO1A 1ZG3A 3RLFA 2Z9OA 1XPRA 2MNAA 4YFNF 3BWGA 3F23A 2M30A 4AQYL 3GZ6A 3C7JA 4DV0Q 3ERED 1MD0A 1NY4A 4BYYA 1OKRA 2FEZA 4TQUS 4HAMA 4OINF 1BC7C 1T0FA 1TNSA 3T1HQ 4KMUX 5JEAJ 2PNHA 4J15A 3UDXA 4A75A 3ZMDA 3K0LA 3WODF 1E17A 1YW7A 4JI8L 2UU9Q 4OWTB 3I0TA 2ATWA 1IBLL 3LA2A 1QPMA 3PO2G 4LFAL 4ENKA 1PP8F 3ZMVA 3GW2A 1USSA 4YIFA 4IPAA 4I98B 4GYGA 3RYPA 1GD7A 1XNRQ 1E1TA 2AS5F 1OXVA 1VQKA 4MGRA 2R3SA 1VQBA 1PYBA 4KHPL 1P92A 2RGVA 3BJ6A 4NXML 4X66Q 4DR3L 3T1YQ 4UV8A 4A2UA 2Z33A 2JQOA 5C4XH 1KIXA 3RLOA 4P96A 1KU7A 1G4DA 5CVIA 2ZJPA 3CUQA 5DUKA 3S1QH 2VBWA 1PH1A 2AXLA 2P5VA 1VQLA 1ON1A 2VOOA 3IHUA 2NS0A 2EIFA 2YV5A 1REPC 3D31A 1VQPA 2WV0A 1C7YA 3D0SA 3LQQA 5EEGA 1UB9A 1K83H 1QGPA 3I4PA 1FZPB 2E2IH 1ODDA 5ICCA 1L0OC 1B4AA 3LA7A 3PUVA 2ZO4A 4EX5A 2F2EA 4DV2Q 3Q5FA 3QP6A 4IPCA 4LF9Q 4WCGA 3LAJA 1VQJA 4P72A 4GKKQ 2CYYA 2VE8A 1VQMA 4JI4L 5FGMA 4L5SA 1Q1BA 4A3DH 2HEOA 2UXCL 1YHAA 4MTDA 5M3FH 3GTJH 5D5XB 4IVNA 3R61A 3ABTA 5D4SA 4WK8F 1XB4A 3CMEA 1IRGA 1KU2A 1IZ1A 4KICA 4MEYF 2HGCA 3JAMc 1VQOA 3REOA 3M8FA 3JW4A 5L3EA 2X4HA 4B3MQ 4IRGA 4NHJA 3GFMA 4IHTA 3PGZA 2CWEA 2ELHA 2YPRA 1P4WA 2RNJA 3FX3A 1YHQA 1X54A 4IPDA 4GNXA 5GAGC 3M7NA 4ASNA 3WE3A 2ZJQA 5L3CA 4AQYQ 4OIOF 3KP5A 1F4KA 4QQBX 4IO9A 2E5LL 3Q8DA 3H15A 4A3MG 2RN7A 5H6RA 4GN5A 2PQAB 2UXDL 1FNNA 2GIVA 4L9TA 1OTCA 1EWIA 2O03A 1PFSA 4ENMA 1Y1WG 2VUMH 2JA8H 3VFZA 3M1EA 5FB2A 1MJ9A 4JI8Q 5IT9c 1NMFA 2JPCA 1MKHA 2B3GA 1IBLQ 3K8AA 3FM3A 2BGCA 4LFAQ 1EQQA 3KZYA 4BHCA 1QUQB 5FO5A 4EJOA 1YS7A 1WQ2A 5JVTA 4OIQF 1XCVA 3H92A 1DPRA 1R9TH 1STZA 3L9FA 2ETHA 4HIMA 2D2WA 5L3DA 3EDPA 3V7RA 1Z05A 4LF4L 2ACJA 2O8XA 3F72A 4I01A 4DKAC 2UXXA 4P9UA 3S1MH 1BIBA 1SD7A 4KHPQ 4NB3A 1TNTA 1UWVA 3HSFA 2KIFA 4EJUA 1EH7A 4NXMQ 4DR3Q 2ZJRA 1IN7A 4Y17A 3CC2A 3IRBA 1UHMA 3ROUA 2O6GE 2TDXA 4LLLA 3O6BB 4LFCL 2EV6A 4KI0A 4PZ6A 4ESFA 1K78A 2LF8A 4HIOA 3ZMUA 4LB5A 4DV1L 1P6RA 4HX8A 3RTRA 1TXYA 4HJ8A 2QZ8A 4DV3L 2M5WA 1VQGA 2HS5A 5LMUL 1KYZA 1XPUA 4I0BA 3HKSA 4KMFA 5ELOA 1YFHA 3GYHX 2IW5A 1D8LA 2VT2A 2KCMA 2OWOA 3TGNA 4IFDJ 3CDHA 3FXUA 2WP8J 1ZG5A 4OX9L 4JI4Q 3HHHA 1YS6A 4HQMA 2O0YA 3DXJF 2UXCQ 5BOXA 1EYGA 2FNAA 4D0PA 2QYOA 4WJ3M 2BA0A 1WFQA 4NXNL 2P4WA 1R7JA 1KL9A 3J7ZC 1HW5A 5LMNW 2I5HA 1SRUA 1WI9A 1BOAA 5C0XI 1X56A 3PF4A 3M4OH 4IOCA 2BA1A 3K7AH 2HKXA 4P9FA 1I5FA 2PQ8A 3CC4A 3HIFA 2XVCA 1I6XA 4UXNA 3S14H 2F5EA 3V8KA 4JC0A 2E5LQ 4O0AA 3L7WA 3TREA 2D1HA 2K5NA 1FBQA 2WAQG 2NN6I 2UXDQ 2FMLA 4RGXA 3CCQA 1Y1WH 1BI3A 3N4MA 1GM5A 2PJPA 4HJ9A 2DO7A 4X62L 3CCMA 2EB7A 2COMA 3DP7A 1YIOA 4HF2A 1FLIA 1Y14B 1SE8A 1R1TA 1W7PB 4JBJA 1CKOA 1U5TB 5KVRA 3CO7C 3QU3A 2EFWA 2Z6KC 2EV0A 2K4JA 2OCEA 2A68F 3RZOH 3IKVA 1O7LA 2ZTDA 3G48A 4P71A 2NVQH 3WU1B 3MXNB 4M6XA 4LF4Q 5ICGA 5JR3A 4A4IA 4AIMA 1QVFA 1JHHA 3NBHB 2OQKA 1SMXA 1OXUA 4DK6C 1HNZL 5JFRA 4KFCA 2RV8A 2MH2A 1Z91A 3ABUA 4POGA 4LFCQ 2F5CA 5LLQA 3PUZA 1DPUA 3KEOA 2ZNYA 4A5MA 4DV1Q 4R1JA 1KU3A 3LA3A 4DR4L 4DV3Q 5LHIA 5LMUQ 1TW2A 1IN4A 2HTJA 5FFZA 3CW2C 4Q5SF 4RG1A 3P9IA 3M3YH 2HWVA 2R7ZH 3BPXA 2YR2A 1BI2A 5J6XA 4BA2I 3F22A 3K1MA 1D8KA 5IP9H 4A3CH 2FQ3A 4G94A 4DNCA 1ZH5A 4CXFA 2LNBA 4OX9Q 4BBSG 1QVGA 1MJAA 5FJ8G 5A2QK 2R92G 1BN5A 1VQDA 5CYVA 4EGZA 3JTGA 3P7NA 3W1GA 1I94L 2Z3YA 4IJAA 1J0RA 4NXNQ 2F5DA 3E6BA 5IP7G 2HDCA 1S3OA 1B9NA 1U0LA 1U5KA 3U1DA 1HH2P 1T2KA 1EIFA 4YIIA 1L0WA 1B6AA 1BI0A 2DTRA 3EIVA 1L1OA 4C3JH 1EUJA 4ESBA 2P6SA 3S15H 1OXXK 4DUZL 2KHIA 3CCRA 4EM2A 1W4MA 2Q2IA 1ZARA 1Z6TA 2XKPA 1IXRC 4JOIC 4X62Q 1W7PD 2Q2UA 3BY6A 2DFIA 3F8BA 4LG0A 4C3HH 1FPQA 4HV6A 2A19A 1YW8A 5FD5A 3KP4A 1S72A 3T8RA 5JJLA 2HT1A 3BROA 1YTYA 2C6YA 4B3RL 1WCMG 1E3PA 1BBUA 3L2CA 1V3FA 4JQFA 2NRAC 2ZJ2A 1ZG1A 2W84A 2HYFA 3GD7A 1FT9A 4DR5L 5GROA 5LMNL 4IHSA 1MKMA 2D0OA 1HNZQ 4N9IA 4Q47A 2XHKA 2FXQA 1FGUA 2E7XA 4HW0A 2GWRA 2WWYA 1WYDA 5K36G 3I64A 1XNQL 2BH2A 2JPBA 3OW2A 2VBXA 5M5WH 2E1CA 2V1UA 4K0KL 2JA7G 2HZTA 4M72A 2CWAA 4DR4Q 3JAMi 3B6YA 3BU2A 4EMSA 1VQ9A 4DK3C 2JK8A 3W6JB 2VC0A 2Q8KA 4B09A 2QBYA 4M9SA 1OYYA 4KIFA 2DAOA 4A6EA 5DEQA 3ZMTA 1XTDA 1LEBA 1SAXA 1N33L 1SD5A 4PZJA 3KFUA 3HOYG 2EK5A 2P6TA 3FMQA 3WTTC 2N78A 4ZYGA 1Q81C 2DK8A 2ZMEB 5FJ8H 4UV9A 2R92H 5D5UB 4U7DA 1P4AA 3I4NG 1GXPA 4KHZA 3H3VI 1YITA 3H3ZA 1I94Q 1LTLA 2AKWB 1J59A 3F21A 1DP7P 2KIUA 1FYLA 1CKNA 1KRTA 4WF2A 3QPTA 5DV5A 1IXRA 3A0JA 2QQBA 4IRHA 3WGGA 3I2ZA 3F2BA 1G3TA 2MLKA 4JOIA 3K80C 2JA5G 1TLHB 1B8AA 4XLPF 2E7WA 3CPFA 2F4VL 1XSXA 3PO3H 1XGMA 1QZYA 2W25A 3K9TA 4MNOA 2K14A 3J80i 1XCBA 3IWFA 4EQQA 1KGSA 1R5HA 4R4OA 4DUZQ 2HHHL 1TWHH 1YJNA 1QZHA 2DUDA 3E0EA 2M87A 4HIDA 3BZ6A 4DUYL 5C0XJ 3H0GG 1DDNA 1TQPA 1UE7A 3HOVG 3NQOA 1M1KC 4Q48A 4DR7L 5FD6A 2YYZA 3HOWG 2FMYA 1BIAA 1OPCA 4HOBA 4HLXA 5F64A 1IUYA 2ZM6L 2XRNA 3KLNA 4LF6L 1X9NA 2OZUA 3COAC 3KDFA 4RB3C 4Z2YA 3GO5A 4YCWA 4B3RQ 1YNXA 2QVOA 4A3BH 2XV4S 4RS8A 4HYEA 4DR5Q 4G9YA 5F6FA 5LMNQ 3K1NA 4MQ9F 2JJQA 2STWA 5H6QA 2FBKA 1F5TA 3AFQA 4A76A 2D1VA 4DV5L 1K8AC 5M5XH 3IC7A 3KF8B 2OTJA 1SN8A 3CUQC 2YU3A 1XNQQ 2VE9A 2PG4A 2JTVA 3JTHA 1ZLKA 4ZYEA 5D4RA 4QY7A 4HX4A 4K0KQ 2DQRA 3BJAA 4HBLA 4AD9A 2E2JH 2JE6I 4JYAL 3RI4A 4HF1A 2N8NA 1HXDA 1RNLA 4OMZA 1CUKA 1SLJA 2IHFA 1JT8A 3CPWA 1FWZA 1V1QA 4AVPA 1SMTA 1G3YA 3GZ5A 5CLSA 3E9IA 1H9GA 1N33Q 4RGRA 5L3GA 1KAWA 2LXKA 3BZCA 1ZAOA 3FXRA 3HOYH 2QM3A 1KQ0A 1LVAA 5HOOA 3GTKH 2CO5A 4LK0F 3QRFF 5IYDG 3NENA 1PA6A 4POFA 2XAFA 3O3KA 2L3DA 4OWWB 3LWFA 3DEUA 1HZCA 1XJVA 5KK1A 3F8TA 4QWQA 2B63G 5LGTA 2JA5H 1UE1A 1GXQA 3K81C 2EA4A 3WGIA 1EIYB 4YFXF 2IJLA 4I7HA 5LGUA 1PVOA 5HS9A 2P8TA 3RKWA 1S6LA 3OV8A 3AFPA 5H20A 4R4TA 5LEKA 3HHGA 4GNXC 4XTCS 2F4VQ 3JAMZ 4TVAB 2FSWA 5IY0A 2HHHQ 2EFQA 3V7SA 4IRIA 2OQGA 3MQ0A 2Y0SG 3RYRA 4IPGA 1XDUA 4DUYQ 5E8IA 2KENA 2Q2EA 2D45A 4AYBE 3H3VH 2V79A 4HF0A 1CSQA 3WTXC 5IYCG 3HOVH 4U7BA 3DKWA 2ZXJA 4X65L 2D0PA 3HOWH 5DCMA 4DR7Q 4NQWA 3BP8A 3GWZA 1U8RA 2ZM6Q 4OOIA 1N32L 1UE5A 3L09A 4LF6Q 1GVPA 5IT9Z 2VY3A 2NZOA 4HX7A 3EN2A 1YJ9A 2ISZA 3V8LA 3JSPA 2Z5UA 3I59A 2DBBA 1YI2A 2A07F 4BHBA 5LHGA 4GS3A 3CJNA 1K78B 4JBAA 1G6PA 1QZGA 4DV5Q 3P9CA 4U0WA 3FKIH 2Q2TA 4A3EH 2HYGD 2V9VA 2ES2A 1K9MC 2WFWA 5DUIA 3Q9VA 1VQEA 2XGTA 3RR5A 4EM0B 1YBYA 3MZYA 3NELA 1HKSA 4JYAQ 2G7UA 1OYIA 4B3TL 3G6EA 4KA4A 1XGSA 3KP6A 2XGXA 3JAMK 2YX4A 1PUEE 4GN4B 4A3LG 2JEAI 2MO0A 1TWGH 2KHJA 1HZAA 2XAJA 1IZ6A 1X3GA 5C4JH 1PH3A 4JK1X 2HQNA 3GF2A 5FFXA 4H0EA 4OXPA 4JV5L 3RZDH 2DI3A 3OYYA 5IYDH 1RIOH 4G7ZF 4OWXB 1DUXC 4EJTA 1D3YA 2Q2HA 3F8NA 3DPTA 1VQ7A 5L3FA 1S8NA 2XROA 3W1BA 4MTEA 3CUOA 1CSPA 2L4AA 2OD5A 2B63H 3H3UA 2YTXA 4YHHL 4XSXF 3F2DA 2VNUD 2H09A 5IT9K 5K5QA 3KP3A 3CLOA 3PO2H 1X3FA 1L3LA 2H27A 5J8CA 2LKPA 3WU0A 1P16A 3GVAA 3J81i 5EAYA 4JI6L 2RKHA 5E18F 1Q12A 3J80c 4AWXB 1NJIC 1KQ8A 3FMSA 4APVA 2BEOA 3BPVA 1VQAA 4LWCA 1P8LA 3HOXG 2UUAL 1AOYA 4X65Q 1CGPA 2YU9H 1G6NA 1Z7UA 5E17F 2HQRA 2GA1A 1N32Q 3HKZG 3NRVA 4A6DA 4ALPA 4CO8A 3I53A 2NVTH 2J5PA 3GTLH 4DAYB 4L5RC 4S05A 3TS2A 2FXAA 3J7AO 4GOPC 1R36A 1AWCA 4A12A 2PI2E 4LF5L 1I5ZA 1MDMA 1O3RA 1HKTA 2OTLA 5E8GA 4YWKA 3K2ZA 4CYDA 2JSCA 4G8XA 1HKQA 2R7FA 1KHIA 5HLIA 1IN6A 3MEFA 1WI5A 4DNIA 5BQTA 5FLMG 3E6CC 5HY6A 2RCNA 4RGUA 1HJPA 1LNWA 2GA2A 1JB7A 4B3TQ 1ONVA 4GLVB 4JBWA 4KIGA 2N49A 4A3LH 1IAWA 1B59A 2KJCA 4ZH4F 1B1BA 1OXSC 2AHOB 3HYIA 2E1NA 4B3SL 3GDEA 2L4MA 3A74A 5E1ZB 4JV5Q 3DLLA 4FX4A 3E5UA 2BH8A 4ZZLA 3TOBA 3S24A 3MFKA 5J8FA 4LUZA 1D8JA 1GO3E 4A3MH 1VQCA 3SHFA 4HIKA 3RDIA 1L1OB 5LBQA 5A2QZ 3CCVA 2LF7A 3PIPA 3ULJA 1N8RC 3ZPLA 2MQHA 4YHHQ 3ELKA 1J7KA 3PUYA 1GHCA 3DFGA 1SFUA 1G3WA 2EFOA 4KDPA 5TJJA 4PG3A 3M7GA 5D5WB 1L1OC 4IPHA 2XAHA 1X3UA 1WKMA 3P9KA 4RB0A 1YVCA 4WXDA 3S1RH 2QWWA 1JXSA 1K8GA 1F1ZA 4BBRG 3JC66 4JI6Q 1JHFA 1PH5A 3CMAA 1FJGL 1QO0D 1FP1D 2KJBA 1SFEA 4A93G 4DQ2A 4GOPA 1IBKL 2WAQE 4LG0B 2O61A 1KC8C 2EXDA 1LJ9A 1T39A 2IT0A 4LJZF 3ULLA 4F7ZA 1MJCA 3K0XA 4R79A 3HOXH 3K69A 3QOPA 3HTSB 2UUAQ 4Y15A 1MJBA 4HLYA 1U3EM 1BKBA 2HFHA 1E2XA 4ETSA 1PH9A 2NYXA 1YO5C 1BVSA 2A6EF 5CVUA 5GQOA 4OIRF 3KJPA 2P7VB 5FLXc 1T38A 1J9IA 5D8KB 3KZZA 2FRHA 1LDKB 2IX0A 1SR3A 2STTA 4LF5Q 4BQAA 1IXCA 2GAUA 4GKJL 1LDDA 4FX0A 5IYBG 3GFLA 5E20A 4EGYA 2B0LA 2P5KA 3PSIA 4L9JA 4YFKF 3F3XA 2HIXA 5ICFA 2QBYB 3U58A 2VL6A 1YG2A 4ENNA 2MLGA 2JEBI 2K5HA 3HRSA 1HQCA 1EH6A 3MWMA 4ENJA 3TQNA 3EYIA 3HUGA 3KEQA 1Z1DA 3PQKA 3BDDA 3NEUA 2RQPA 2ESHA 3PV0A 5GAEC 3E97A 1C0WA 1CKMA 3C1DA 5D8LB 2Z0SA 2AWNA 4B3SQ 3V4GA 4BY7G 1BBYA 1CKNB 4L0ZB 2XASA 2VBYA 4O6JA 4JG2A 1W2BA 2IY5B 1VQ8A 4Y52H 1KXLA 4A5NA 1J2XA 1A04A 3GTPH 2JRTA 1K3RA 2IPQX 4EJVA 2L15A 5LRRA 1S29A 4UHTA 1YIJA 1JJ2A 1ON2A 1K6OA 4UNOA 1E22A 1G51A 2JA6G 3WTVC 3CXCA 4YWLA 1VQ5A 4YWMA 4MQVA 2VN2A 1I3QH 2NZHA 3LGJA 4CGZA 4R4CA 4BBRH 1V9PA 1PH2A 4RB1A 5C44G 1ZRCA 1FJGQ 4A93H 2VXZA 1P4XA 3J81c 2EWNA 2VT3A 1IBKQ 3ZP5A 4K2EA 4DPGA 5E1XA 4HDUA 5AJ3L 2UUBL 4PGGA 3HSEA 4LFBL 2K5VA 1Z9FA 3U4ZA 2MA3A 4XSZF 1HNWL 1UCRA 3ECOA 1DGSA 4PGHA 1BC8C 3PUXA 1Z6RA 1TBXA 4EQ5A 1ZN2A 3WTWC 3KFWX 1HBXG 2UXBL 1S3JA 1WSUA 1TTYA 5BPIA 2A69F 5BMZA 1FYKA 3KLOA 4RMFA 3I54A 2PFBA 2CWPA 3IKTA 2IRFG 2IT1A 4HQEA 3I4MG 4LF7L 1PV4A 1MIUA 5AIQA 4I02A 2XTIA 1CF7B 1OXTA 4GKJQ 1YW9A 1LEAA 4OMYA 4LD5A 1XMQL 3GLXA 1VQIA 1R1VA 4HJAA 4GGGA 4R1HA 3GUDA 5J3BA 1O7FA 1U78A 2XUBA 2W24A 4BBSH 3RLNA 5C3EG 3STBC 3A5UA 2ALYB 1U6GA 3TQYA 3R6SA 1QQIA 1S7OA 2BYVE 4KN4X 1UE6A 5IP7H 1QVCA 5LGNA 3I7FA 3T5XA 2PN6A 3ZMZA 4L5QA 1ZGJA 1MGTA 3IWZA 3K1PA 3N97A 4L5JA 4C3IH 4ESJA 3M85A 3GTQH 4QL5A 3PCOB 4HV5A 3S2DH 3SZPA 3WTZA 4BY7H 2BE5F 5LRSA 1O57A 4OIPF 3GTOH 3KP2A 1NE3A 3AEVA 1RL2A 4QIWE 1EQRA 4CICA 3M8EA 5CJ9A 3HRMA 4BY1G 3RN5A 2W57A 4OU0A 3M4PA 3RNUA 4UVCA 1KRSA 1SFOH 2F3IA 1FL0A 2RC4A 4L18B 5HGQA 1AE2A 1SD6A 1JMCA 1VTNC 1PH7A 2V1CC 2VBZA 2F5FA 4QLCU 3DM3A 3F1ZA 4M73A 4LW1A 2CFXA 1IRFA 5HS7A 3V8JA 1YLFA 1ZHFA 4ZYHA 3GX4X 2BBYA 2WB1G 2CG4A 2K7LA 5C44H 1WCMH 3WG9A 2K4BA 3SXYA 2MFIA 1LQ1A 2PLYA 5DCMB 1FSHA 3I58A 1K7AA 2EFNA 4XIGS 4AIJA 3CUQB 4L9VA 1TW3A 3KOJA 5AJ3Q 2K86A 2UUBQ 2L02A 4MTNA 4LFBQ 2OQRA 2I5LX 3ZQ7A 3FZVA 2QQAA 1HNWQ 1X3EA 2QEXA 3I59B 4UUVA 1BBWA 1B7YB 3KE2A 4I0AA 2JA7H 5K5OA 4JI0L 4S04A 2UXBQ 4OONA 3GFIA 2KBNA 5GADC 2NAZA 1ZLJA 5E7NA 1Q82C 4LF7Q 2I5MX 3Q9SA 4O3MA 1IYJB 4U88A 3AAFA 1XMQQ 1XN7A 2DGYA 2FBHA 3U9GA 3CCJA 3R4KA 2X0LA 2RDPA 3CO6C 4IFDG 3JSOA 1R00A 4JI3L 2ZBKA 2QLZA 3I4NH 3E9HA 2ZKZA 2VODA 4MZ9A 3M9AA 2GXBA 3RN2A 3E5XA 4JCVE 1KU9A 3W6KB 4UY8C 4R8HA 4GNXB 3DPLC 2YTVA 3TO9A 4GO1A 3EYYA 3L00A 3U2RA 3HOTA 1UFMA 3WTUC 2KCTA 3A5ZB 1E24A 1XPOA 3KJOA 3CC7A 4UP8A 3F8MA 5HDNA 2PMUA 1ZGAA 1VQNA 2FBIA 1TWCH 1O3SA 4A3JG 3ZMSA 4P55A 3ERSX 1GKHA 4AYBG 4FHTA 4JBKA 5DD8A 2GVBA 4KYWA 3BJUA 4LK1F 2VUMG 2HTSA 4UP7A 2JA8G 2GN5A 4BY1H 3VB2A 1PDNC 3H0GH 4DV6L 4G6DA 2VQFQ 2DW4A 3FMRA 1FSEA 2CFMA 3UDIA 4YY3L 4X6AH 4UVBA 2G9WA 5JHUA 2ESNA 4FT8A 1FBSA 5BR8L 1OR7A 2L01A 4HJ5A 1T9HA 1XMAA 5AIPA 2UXNA 3KF6A 1H95A 4ZYDA 3ECHA 1I50H 1UHWA 5M3MG 3E5QA 3IRRA 3FXQA 3KLWA 3MZHA 1XMOL 3F8CA 2NVXH 5ILUA 1HW1A 2FU4A 4QJFA 4BAYA 2N3SA 3FF5A 1XDSA 2H6CA 4EJWA 2Y0SE 4JI1L 2H5XA 4WXHA 4RGSA 4DV4L 5IE8A 3NEMA 1TQIA 5JJIA 3VODA 5HVQC 1WOCA 1K73C 3J80Z 4DR6L 4EM1A 4L0YB 1ZRDA 2HQLA 4G6QA 4ON0A 1XMKA 4UVAA 3PF5A 4HA8A 3WWVA 1OYWA 2KIMA 2GVAA 1HSTA 3MCZA 1O3QA 1MDMB 2AWOA 2ZTCA 3WTYC 1ASYA 4HDVA 3QP5A 4ME3A 3T1BA 3ZJYC 3I55A 2ASBA 4JI0Q 4BXUA 4R4QA 3PFIA 4A3KG 2OBPA 3GEZA 3CF5A 4IJLA 3CCSA 4A0XA 2DK5A 3G73A 2P5LC 4A3GG 1Q7YC 2FF4A 3L7ZC 3HOUG 4GXOA 2RHQB 1WRJA 3ZN1A 3LSTA 3SFZA 1RI7A 3S17H 2K50A 2DT5A 4M9XA 2CQKA 4AH6A 3M4QA 4JI5L 1SFXA 3RIRA 1JJCB 4JI3Q 1LDJA 2CCZA 1BM9A 3C18A 4P75A 1B9MA 3S2WA 3L0OA 4UPAA 2GZWA 3CQZH 2OU2A 1Z9CA 1VQFA 5IWAL 2C35B 1QBJA 1W5TA 3K7UC 2HIVA 2A3SA 4M74A 3CTAA 4DV7L 5F1RA 3I4OA 2LDUA 2V1XA 4A0YA 3S2HH 1YYVA 4LLNA 2YSRA 1A0IA 1A62A 4A3JH 1G291 3HSRA 1B70B 3WTSC 2JT1A 1FY7A 1HZ9A 1IW7F 1L2FA 2R93G 4YCUA 2VC1A 1J6QA 3GTGH 5LHHA 2EQSA 3J80K 2ISYA 4MEXF 1KYWA 4DV6Q 3M9BA 1YHBA 4L5IA 1YJWA 5IYCH 2PMZE 1RUNA 4YY3Q 2QQ9A 3F2CA 3BOQA 5DDGA 5BR8Q 1N34L 3VDYA 1FBUA 1SMYF 2UZKA 4GOPB 5M3MH 3TRZA 3TEHB 1FOKA 2ZTEA 4MHGA 4LF8L 1Y1VG 1XMOQ 2EV5A 3HFZB 1YZ6A 5E1WA 4L5TA 2E2HH 4QGUA 1C9OA 4LUVA 2F52A 2EFPA 1FP2A 1VQ6A 4JI1Q 4WX9A 4OO1I 1PHJA 4CHUA 2I0QA 4DV4Q 3TKYA 5D6EA 3GTMH 4PDKA 2YX7A 4CDGA 2HKOA 1O7IA 4DR6Q 6PAXA 5JI6A 1HZBA 4KN7X 2OAZA 1FVIA 2Y48A 1C0AA 3ML6A 5HS8A 2JA9A 2YTYA 2M1BA 3S16H 1ZRFA 2GQQA 3HKZE 1R22A 4N9HA 1WWXA 2PI0A 3I56A 4PMWA 2D62A 4KT5C 4AIKA 3LQRA 3KETA 2R7ZG 1KQ9A 4A3KH 2ZCWA 1AE3A 2GXGA 5ILSA 4X64L 4Y7NH 2A61A 4A3GH 5IP9G 1Q86C 1WJJA 4A3CG 1IN5A 3FHZA 3HOUH 4RB2C 2EJRA 4G7HF 1IN8A 4OO1G 5FLXZ 1USTA 2A6HF 4JI5Q 1U2WA 1EFWA 5LEJA 2RVCA 2IA2A 1HR0W 2M8EA 4L9NA 1SD4A 1NBWA 2QGQA 3EETA 4EV0A 1RZ4A 4GYIA 1PH4A 3ULPA 4I09A 4M71A 5D6FA 5IWAQ 2FA5A 5ERIA 2K02A 3L2PA 2UUCL 1V43A 1FYMA 2PQAA 4DV7Q 3OOPA 3QU6A 3SZTA 4LUOA 3PIOA 1Z47A 1ZREA 4LMYA 1F9NA 2A5YB 3RJPA 4IF4A 5DYMA 1NMGA 4BXXG 3CP0A 1QUQA 1HNXL 3TO6A 3RKXA 2KKOA 2R93H 2IA0A 3LAPA 3BZKA 1E7ZA 4WXCA 3SGIA 3I5UA 1W3SA 2ID0A 4P74A 4KUMA 1UEBA 4JI7L 2VOPA 4IOAA 3U4VA 1Q1EA 5HDKA 2R6GA 2V6CA 3I71A 4LB6B 4M9ZA 1Q8KA 1FX7A 5C0XG 1HW2A 1N34Q 2ADUA 5TRDA 1N9WA 2VS1A 2VQEL 2KRFA 4O5VA 3IL2A 1BI1A 4E70A 2LXJA 3GFJA 2JZYA 2R7DA 1Y1VH 4O2DA 4LF8Q 1U5TC 2Z99A 5HLHA 3UE1A 1MJEA 1JE5A 1SROA 3DV8A 2AMCB 1P2FA 5FLXK 2NN6G 4EVIA 1VS0A 1ASZA 2CGPA 2L54A 2VONA 3ER0A 2ZFWA 1X65A 1VCIA 5DLQE 4PZ7A 2PBIA 3J81Z 2MD5A 1E1OA 1J5YA 2IA1A 3RKYA 3ZN0A 3AYHB 3C3WA 3F6VA 1J75A 2XAGA 4Y13A 4UP9A 3WGHA 4BA1I 3D0FA 3AQQA 1A8VA 3FP9A 1LM0A 5FLMH 1J5EL 4IXAA 1I27A 3U50C 2PEXA 1M90C 4DR2L 5ICEA 4X64Q 3B73A 1R23A 3E6DA 2XAQA 3R0JA 4ZZDA 5K1YA 3QAHA 5K5RA 1D5VA 3T8TA 4CZZA 3TOAA 1IXSB 3EUHA 1H9TA 2HR3A 5CVVA 1PP7U 4KIBA 1NTGA 1D7QA 3S1NH 4BH9A 2DPDA 1GVJA 2CSOA 5AONA 1Q1HA 4AIHA 1VQ4A 4C2MH 4LGWA 4NB5A 2UUCQ 4NPSA 1K0RA 2J5OA 3SQNA 1IF1A 1W5SA 3HOSA 3CCEA 4KLKA 2LSOA 2A8VA 1RUOA 5JEAG 3WE2A 3HOZG 1BJAA 3ICEA 3UE0A 3PO3G 1A63A 4A3FG 2Z6KA 1LYLA 5JJKA 2HOEA 4A3IG 1IL2A 3OTOL 3W5OA 4BXXH 1Q46A 4MNUA 3R0AA 1V4RA 4LFUA 1PH8A 2OQ0A 1W7PA 4B8XA 1HNXQ 3E3VA 1U5TA 2RHSB 4RAYA 3F8FA 1N36L 1KA8A 1R58A 2EA2A 3J81K 4JI7Q 4XLNF 2W85A 1LB2A 2DU9A 1EOVA 1S40A 4BHPA 1JJGA 5IT3A 2Y0MA 3B02A 5BPDA 5HDGA 1K79A 4P73A 1KQSA 1IBML 3KDFB 1OMIA 3GXOA 2UWMA 3ULQB 2NVYH 4GLXA 1NHAA 3ISPA 5M5YH 2VQEQ 2NNYA 2K4KA 3FHWA 4JI2L 3G3ZA 2DPUA 1LUZA 2LSSA 3FM5A 2WC2A 1HR0L 4FDBA 3R60A 4A3BG 4HJ7A 3G71A 3D5LA 2DLLA 1O3TA 2K27A 3LFKA 1PH6A 2RF4A 3CCUA 1R1UA 1ULYA 5GAHC 5CVJA 1S7AA 3EQLF 2BV6A 1XSDA 4WJ4A 4U0YA 3MAJA 3KYHC 3DF8A 4GN3B 5DCFA 5IYBH 2V1DA 1YQAA 3RPQA 5BS6A 1H0MA 2K52A 2Y75A 2IHEA 2IX1A 5L3BA 2QA4A 1TQMA 1J5EQ 4DR1L 5ELNA 4YCVA 5ED4A 5H1SE 4I2OA 1XGOA 3J7A5 4DR2Q 1I1GA 2FOKA 1TWAH 3EBEA 4WWCA 5ILVA 4U0VA 1ZYRF 2CQOA 4DV0L 2CW0F 4PZ8A 4XRFA 3T0YA 2H94A 4JBMA 3T1HL 1R5GA 4R4IA 4LNQA 5DD4A 4HZFA 2M45A 2IVMA 3IRQA 3HRUA 1QNTA 2UU9L 2VQFL 4DAMA 3KCCA 2OZ6A 2VW9A 1RIPA 3O2PE 2Q0OA 3HOZH 1AH9A
chains in the Genus database with same CATH superfamily
2XIWA 3NUCA 3A0BC 1HSJA 1XC5A 5EEHA 4M6YA 3MEXA 4BNCA 1A3TA 1VFCA 1N36Q 3CCEI 2O4XA 4X66L 5ELBA 2R7QA 1OLTA 3KF6B 1NUCA 3L1PA 2WY7Q 2G7HA 1QA6A 3S1NB 4CGYB 4Y3OA 1Y0UA 3PQJA 3QB3A 4JI2Q 1A6XA 4RAZA 2KPMA 1EH8A 3WG7H 3K5MA 3I70A 3VOEA 4UUSB 2JQ7A 1FC3A 3PUWA 3MWYW 3UDFA 1YEZA 1CF7A 2NNNA 3HZXA 4A3EG 4A3DG 5F08A 5M3FG 1QILA 3V7CA 1VQHA 4W1UA 1N25A 1XPXA 2LC2A 2A1AA 4UDUC 2PI2A 4KKTA 3TO7A 2NVYB 5M5YB 3OYMA 2Z9OA 3CMYA 5EPLA 4AQYL 3ERED 1MD0A 1NY4A 4II2A 3SVMA 4OINF 1BC7C 2IS4A 4KMUX 1C48A 3HOZJ 2PNHA 4A3FJ 2LMDA 3FXLA 1X19A 1EY0A 3WODF 1E17A 1LT6D 2OPTA 3PO2G 2XDVA 4LFAL 1HA6A 4ENKA 3ZMVA 1FIPA 4I98B 1TS5A 4HNTA 2FD5A 4MGRA 2R3SA 2OXPA 1PYBA 4KHPL 2F3WA 5A2QE 2RGVA 4NXML 3T1YQ 2Z33A 5T1IA 2ZJPA 3CUQA 5DUKA 4TKOB 2VBWA 1ON1A 2GM4A 2ICWG 3IHUA 3FXOA 2NS0A 2YV5A 3D31A 4JX6A 5EG0A 1C7YA 3KF8A 3IH4A 1UB9A 1QGPA 3I4PA 1FZPB 1I6HJ 2ZO4A 4DV2Q 3QP6A 2Q8IB 5CGKA 3W2DA 3QJYA 2MABA 2JA6B 3FEWX 4GKKQ 1JT0A 3D4WA 1T5XD 3ASNH 4JI4L 1QHHD 1Z7LA 2HEOA 4BXFA 1YHAA 3GTJH 3R61A 1IW7C 1KU2A 5B3SH 4NC7A 4KICA 3JAMc 3REOA 3JW4A 5L3EA 2E75C 4B3MQ 2TCTA 2ZJRF 3GFMA 2J7ZA 4IPDA 5GAGC 3WE3A 4OIOF 2E5LL 3Q8DA 1TWFB 3H15A 4A3MG 2RN7A 5H6RA 1FNNA 2GIVA 1H9MA 3I4MB 2V6EA 5FKKA 1Y1WG 4ENMA 2VUMH 1NMFA 4UAIA 1MKHA 2BGCA 4BHCA 2B8GA 4EJOA 1YS7A 1WQ2A 4XKCA 2OT2A 3L9FA 4PJNA 4HIMA 5C4XJ 3EDPA 1Z05A 4W97A 4P2CB 1BIBA 1SD7A 4FETA 5GPAA 5IOZA 1TNTA 4EJUA 3UI2A 1EY4A 4DR3Q 2ZJRA 1IN7A 2SNSA 1IJWC 3PSFA 5IT9L 4MIUA 4G7HC 2TDXA 2A6HC 2Q1ZB 2NB0A 5ELOA 1OCOH 1D8LA 4IFDJ 1MIJA 3FXUA 2XSCA 1JKOC 1YS6A 2O0YA 5I2XA 5BOXA 4CDDC 1CZWA 2FNAA 3BLYA 3JR9A 3NHHA 4NXNL 1NAPA 3H3VC 1HW5A 3S1QB 2I5HA 2AQ3B 3PF4A 4IOCA 2QKMB 1MNDA 2HKXA 1ICFB 3CC4A 1JQYD 3S14H 4UXNA 3L7WA 2D1HA 2E36A 3QYFA 1I4PA 2FMLA 3SDGA 2F0OA 2B2UC 3N4MA 5DEHA 4X62L 1R9TJ 3OSOA 4A3DB 1APLC 5M3FB 1Y14B 1R1TA 3TBIA 1W7PB 5KYIA 4C3HG 4JBJA 1BR9A 3VYSA 1U5TB 3S1MJ 2K5DA 5KVRA 3TMOA 5ELCA 2A68F 3IKVA 4P71A 2ZTDA 2O5IC 5ICGA 3H9QA 2RV8A 4V19K 2PYKA 3HB9A 3ABUA 4POGA 4LFCQ 3PUZA 1DPUA 4A5MA 1KU3A 4DR4L 5LHIA 5LMUQ 4R8NA 2C5CA 2HTJA 4Q5SF 2WIIB 2YR2A 1AZPA 2FQ3A 4XL9A 5M3MB 2LOOA 1QNKA 1NR2A 3P7NA 1I94L 2Z3YA 4IUPA 4RHRA 1S3OA 1B9NA 1HOMA 1U5KA 3OWFA 2A6ED 1SYBA 1BI0A 2HVSA 1L1OA 2P6SA 1SNCA 4JK1C 3IAS2 4IHWA 3B6AA 4Y7NB 4B3AA 3HOUB 1CZGA 4JOIC 3CC4I 2Q2UA 2NVQJ 1S9HA 2CQQA 3KLSA 2DFIA 3F8BA 4LG0A 4HV6A 2RDHA 3T8RA 5B1AH 2HXOA 2HT1A 2I8DA 1YTYA 1E0EA 1WCMG 4F7XA 4JQFA 4ZKCB 3M4OB 2LRDA 1MKMA 2KZVA 4IUVA 4Q47A 2FXQA 4K14A 3K10A 2XWBB 5K36G 3I64A 1XNQL 2BH2A 2JPBA 5E3OA 2V1UA 1ZYRC 1Y1WB 5IP9J 3QYEA 3SK8A 2DA6A 4EMSA 3GQBA 2VC0A 4IURA 4B09A 1UELB 3RQIA 3OYAA 3ZMTA 1XTDA 1SD5A 4EQNA 4PZJA 2P6TA 1Q81C 2ZMEB 2R92H 3M4YA 3H3VI 2K5QA 3H3ZA 1LTLA 1J59A 4C3JJ 1DP7P 4KKSA 1CKNA 2F0HA 2QQBA 4X0GA 3F2BA 3S15J 2MLKA 1VF7A 4JOIA 3O8GA 2VB2X 2MGQA 2E7WA 1XGMA 2K14A 2EPFA 4AU7A 3QR8A 1TWHH 4CYCB 3E0EA 2M87A 3ABKH 3H0GG 4U87A 3JRHA 1O4XA 1DDNA 2IGMA 1GJXA 1QZEA 3A56A 1TQPA 4ZJZA 1BQQT 1EIHA 3KYLA 4Q48A 3FXMA 4IUTA 1WJDA 1J9OA 5CR3A 2XRNA 4S3SA 3KLNA 2KCCA 4HPQA 1PJRA 4RS8A 3J7AV 4HYEA 4G9YA 4E7HA 2PMZA 3K1NA 4MQ9F 2Y30A 2JJQA 5H6QA 4A76A 3K4CA 2D1VA 4DV5L 1K8AC 2XF5A 1SN8A 1ZR2A 3RMHA 3VWBA 2JTVA 4K0KQ 3BJAA 2L9RA 1A3UA 1RNLA 5FJ8J 1HCZA 3CMMA 1V1QA 3A1YA 2ENBA 3GZ5A 3AG1H 3E5SA 3BZCA 1P7JA 3TDQA 3GTKH 5L37A 3TP3A 5IYDG 3HKZA 2RBMA 2WAEA 1G59A 3GTQJ 3K5NA 2YS9A 5KK1A 3TP0A 2Q8RE 3F8TA 1XX5A 4QWQA 1EU4A 4OIJA 5LL6S 3WGIA 1EYDA 5LGUA 2PJRB 1QVUA 5H20A 1FTZA 2DFEA 3HHGA 5IY0A 1UJ8A 2PW7A 2OQGA 2MUYA 2TMPA 4JPBW 4IPGA 1XDUA 2D45A 3H3VH 4CA0A 2R5YB 1I4QA 2E2DC 3DKWA 2L12A 3HOWH 4DR7Q 3AG2H 3MHBA 4QCLA 4OOIA 1N32L 1IV8A 1XG1A 2F0DA 1RKWA 5IT9Z 2W7NA 3E0JB 1YJ9A 3ZQLA 3BR2A 1V1OA 3JSPA 3I59A 2DBBA 1X1PA 5LHGA 4GS3A 4JBAA 3J7AY 2E2JJ 3Q0UA 4BJ6C 3P9CA 2F0JA 1JICA 3FKIH 2HYGD 2V9VA 2M9HA 5DUIA 5IOCA 2EY5A 1LTID 5FO9B 2VPRA 4GFBA 3HOYJ 4JYAQ 2G7UA 4U68A 1OYIA 3BTJA 4QPOA 4E7ZA 3H5NA 1S5BD 1QG7A 3X3MA 1TWGH 2KHJA 3MVVA 3TN2A 4JK1X 2F0EA 5CYUA 2DI3A 2XPUA 2WINB 4OWXB 4XKBA 2X6OA 4H13C 2F0UA 3VYTA 3DPTA 2XROA 1I6VC 3BTIA 2OD5A 2YTXA 3CRKC 2H09A 3KP3A 2K40A 3AL0C 2H27A 5J8CA 1V55H 3J81i 3OWEB 3HOVJ 5E18F 3J80c 1NJIC 3JRDA 1KQ8A 3FMSA 4BE2A 3BPVA 1WJAA 4LWCA 2NVXJ 3HOXG 3KEYA 1AOYA 1KABA 1B53A 2MHVA 2J4XA 2YU9H 1G6NA 3PUBA 2HQRA 4CSWA 4ALPA 3I53A 4X3KA 2J5PA 3DBLB 4L5RC 3TS2A 4A12A 2DA5A 1I5ZA 1MDMA 4A3EJ 3PIPF 1HKTA 3K2ZA 4Y33A 2NTTA 4CYDA 3OY9A 3C2BA 5KRUA 1YJ9I 2Z4HA 3MEFA 5DS9A 2MP1A 1WI5A 2MJ8A 4KKUA 3TW6A 3LNNA 1JJ8C 4XMYA 3S17J 4RGUA 1BL0A 2GA2A 1KLUD 4XORA 5ISRA 4GLVB 4E7SA 2MD0A 1GLNA 1AA7A 1OXSC 4E7IA 3BDCA 3D5SC 3UR3C 1MNEA 3DLLA 1S5LC 4FX4A 2B63J 3NSWA 3Q24A 4KD4A 1W0UA 4HIKA 4XIDA 2L7ZA 3RDIA 2BVMA 1NCVA 3PIPA 4UUTA 2EBIA 2MQHA 4YHHQ 1J7KA 3DFGA 3HM5A 1G3WA 4KDPA 4F3QA 5D5WB 3EVQA 3S8PA 1FMWA 1YVCA 3LL7A 1E3OC 4D9JA 1JXSA 5GAEJ 4XN0A 1K8GA 1F1ZA 1MSEC 3JC66 4DOZA 1QO0D 2WAQE 2O61A 2IT0A 4LJZF 1SFKA 3ULLA 5C4JB 3K69A 3HTSB 2UUAQ 4Y15A 2L7KA 2HFHA 1PH9A 4S0HB 4G4KA 1J9IA 2K9MA 1F9QA 4FX0A 4EGYA 3PSIA 4DGWB 2F0FA 3CF2A 4XR6A 3F3XA 2V4DA 2QBYB 4F8MA 4A3LJ 1VQ6I 2JEBI 2WB1A 5J3LA 2K5HA 1QHGA 4ENJA 3MWMA 3H91A 2LD5A 3NPPA 3TQNA 2A68D 3OMYA 1RKNA 2L7MP 3KEQA 1Z1DA 3PQKA 4BE1A 3LSGA 3I56I 4K6DA 4B3SQ 3V4GA 2BY3A 4Y52H 1KXLA 2DOFA 2OEOA 3OYHA 2R0QC 1LE8A 4BJTA 1LTSD 5LRRA 3EA6A 4UHTA 2B7EA 2BZTA 2FX0A 3AG3H 1E22A 2KQ3A 1VMPA 3HBLA 3HEJA 3A4CA 4RGNA 4BBRH 1V9PA 1FJGQ 1AHDP 4KHVA 3A2KA 2VT3A 4K2EA 2WY8Q 3I8ZA 4M8AA 4XSZF 1HNWL 1DGSA 3SE0A 2AUKA 3PUXA 2QW7A 1ZN2A 2FFKB 1C4QA 4AYBN 5BPIA 4XKVA 5BMZA 1FR3A 1FYKA 1TT2A 3PMFA 4C1NI 3BYTB 4WJWA 4HJAA 2DMQA 1M1EB 4CCMA 1Z77A 2XUBA 2NZ1D 2K03A 1S7OA 3DHQA 2RQQA 4KN4X 5E3LA 3HOXB 3OR1C 1QVCA 5IP7H 1MGTA 4C3IH 3VYRB 2X6GA 5KCMA 3H0DA 3WTZA 3VSLA 1S5CD 1NE3A 5CV5A 4XRMA 3RN5A 3RNUA 3BC8A 1JGGA 2F3IA 3Q3SA 1ETXA 4DBRA 1DZ1A 2V1CC 5KEEA 2EZIA 3DM3A 5BN5A 2WAFA 4M73A 4FTHA 3F1ZA 4QPQA 2CFXA 2CG4A 3WG9A 4CUGA 3LNQA 2MFIA 1X3ZB 5DCMB 4OWRB 1SSOA 1FSHA 3I58A 3BZDB 2DNEA 4XIGS 2K86A 2UUBQ 2L02A 2G5DA 1BOBA 2XB5A 1X3EA 2EY2A 2QEXA 4UUVA 3GTPB 2QKLB 4F91B 2UXBQ 4OONA 1ETQA 3DEPA 3HGBA 5GADC 4TRDA 2I5MX 1PVEA 4DIQA 3Q9SA 1F2YA 2R7TA 1XMQQ 2FBHA 2JSPA 4IUUA 2RDPA 3JSOA 3I4NH 3E5XA 3FXJA 4BY7J 1D5XC 4R8HA 3W3AA 1M4VA 3DPLC 1E2WA 4DXGA 2YTVA 3EYYA 3RSNA 3KJOA 3CC7A 4UP8A 3MXUA 2PMUA 3X2QH 1TWCH 1O3SA 2EZVA 2E34A 4AYBG 4JBKA 4O42A 2VUMG 4UP7A 4BY1H 3VB2A 4G6DA 4J8QA 2VQFQ 1FSEA 2CFMA 4YY3L 4BBSB 2ZT9C 4UVBA 5CV7A 4FT8A 1FBSA 4XRSA 2L01A 4N8FA 5AIPA 3KF6A 1H95A 3ECHA 1UHWA 3MZHA 4M1UB 1XMOL 2KVMA 2SDFA 4BAYA 2N3SA 3P75A 2Y0SE 4EJWA 3GTQB 2H5XA 4J19A 4RGSA 3S2DB 4QUCA 2VB6A 4L0YB 4UUSA 3GTOB 2ZJQF 4G6QA 1AN8A 3R93A 1XMKA 4HA8A 2I5UA 4IO9F 1ET9A 2L5TA 4G7ZC 2R7XA 4R9WA 2LP0A 1SFOB 2KZGA 2F0VA 2ASBA 4JI0Q 3A54A 3GEZA 3CF5A 5C3EJ 3T4AC 2DYSH 4XXEA 5K5PA 2QEXI 1WRJA 3LSTA 5KGUA 3A7AB 1U9RA 4HSTA 3ERQA 4Z9CB 1SFXA 1DOLA 1BM9A 1LT3D 2GZWA 3CQZH 2L2OA 1LT5D 1Z9CA 4DNTB 2C35B 1OISA 2X6LA 1W5TA 3I4OA 5JPNC 4A0YA 2YSRA 1A62A 1FY7A 4YCUA 2VC1A 2VKVA 5LHHA 1HLVA 4AIDA 4MEXF 3CC7I 3M9BA 1YHBA 5IYCH 3HOYB 1NNXA 1TIID 1SVLA 1N34L 1FBUA 2VQGA 3MKLA 1JE4A 1Y1VG 3HFZB 3FISA 4L5TA 2F4MB 5J39A 2EFPA 5J1ZA 4BQNA 1FP2A 2VI6A 1PHJA 2X1CA 1K83J 5D6EA 2E2IJ 3GTMH 2HKOA 4DR6Q 4PK4A 1HZBA 3Q0WA 1FVIA 1C0AA 3ML6A 5HS8A 2JA9A 2M1BA 3S16H 1RR7A 4H0LC 2PI0A 3SK5A 3KETA 4ZRZA 3HOVB 4A3KH 1AE3A 2GXGA 4X64L 2A61A 2DODA 1WJJA 1W5CC 1QJOA 4DXFA 4KY5A 1I50B 2EJRA 1X2MA 4IZZA 4OO1G 3ZGKA 2PW5A 3FPUB 2NVXB 3OL3A 1JJ6C 3CDLA 5LEJA 4RGTA 2G9DA 3EETA 2H4OA 2FOWA 1PH4A 4RWSC 2FA5A 5ERIA 2K02A 1HA5A 3L2PA 1FYMA 4ABZA 3OOPA 3QU6A 3SZTA 3GTGJ 2B2TC 1BBXC 2NBFA 4XNFA 1Y8PB 4KY7A 3E1SA 3EUAA 4H7BA 5DYMA 2XGDA 4BXXG 5EBDA 3RKXA 2KKOA 2R93H 3BZKA 1E7ZA 4WXCA 2HCIA 3ITPA 4JI7L 1JUSA 2VOPA 3S17B 2ELKA 3U4VA 5HDKA 1FEXA 2ID3A 1Q8KA 1PLFA 2ADUA 2KRFA 2A6TA 4O5VA 3IL2A 3NQIA 3GFJA 1U5TC 4QIWN 1JE5A 1VF9A 5FLXK 2CW8A 1VS0A 1RDPD 2F0PA 5DLQE 5JHFA 2XRLA 3F6VA 1J75A 4A3GJ 4Y13A 3K57A 5IGEA 1QPIA 5FLMH 1J5EL 4IXAA 5E3MA 3PFYA 4ZUIA 3U50C 2PEXA 2EJGC 5ICEA 1RTOA 3QAHA 5K5RA 1IG7A 1OJLA 4BDZA 5GAHJ 2MFZA 2R4GA 1H9TA 3S1NH 5E79C 5DAUA 1GVJA 1EY5A 3R3OA 3TL4X 2J5OA 5EQ0A 1RUOA 2MPMA 3UE0A 1A63A 2Z6KA 2BDOA 4A3IG 3W6VA 1Q46A 4MNUA 4B08A 1V4RA 2OQ0A 3H94A 1W7PA 1U5TA 4CKBA 3F8FA 1KA8A 2EA2A 2A69C 3J81K 2ID6A 1LB2A 3VR3A 4XQQA 3KX2A 1EOVA 1JJGA 4P73A 2DMNA 1LKXA 2F0MA 3KDFB 2DJGC 1ZTRA 1TS4A 2NVYH 1EY9A 5M5YH 2NNYA 2K4KA 4CKCA 3SDBA 2WC2A 1SVOA 4FDBA 3D5LA 1Z3XA 2DLLA 2K27A 3CCUA 3K4MA 1JR0D 3EQLF 2IS2A 2X6WA 3MAJA 3KYHC 3DF8A 4GRIA 3RPQA 1H0MA 1O78A 4ZDOA 4CJ1B 2LMCB 2BE5C 3FDYA 2IX1A 2XAUA 5D14A 4DR1L 3W2WA 5ED4A 5H1SE 4I2OA 4ME5A 1F2MA 1IC8A 4FE4A 4CH7A 4DV0L 4PZ8A 2F0LA 2GIZA 3EPZA 4JBMA 2ZMEC 2B39A 2V9KA 2M45A 1ZGWA 1QNTA 2VQFL 4DAMA 2DOEA 1RIPA 3O2PE 4HCSA 2Q0OA 5JEAH 4P5OA 4G7OF 2H6BA 4KJOA 1XNRL 2JA6H 4F52A 3OTOQ 3CAMA 3F6OA 3KUPA 1ACIA 1D5ZC 2WTEA 3LX0A 4H02A 3M07A 1Y8RB 2DT7B 5BNGA 2VASA 5HLGA 3DLAA 3I90A 1OFCX 3CU7A 1IBMQ 1DGWY 4XM3A 2B29A 1G3SA 5LL6X 3TZDA 1HR0Q 2E8GA 3E3XA 2DCEA 1I1SA 4A0ZA 4DJAA 1TWFH 2E19A 3BJOA 3TDUC 2PMZN 3I4MH 2OA4A 2QUFA 4X3TA 4TV7A 3FKIG 3UDGA 2VQHA 2DJNA 1EV7A 1A6IA 1XSVA 2R3ZA 5ELDA 1IO2A 3CCUI 4KK7A 2ZMEA 3GBGA 3HTUA 4GLAC 1E3HA 2PMHA 3HRTA 2MBFA 3CD6A 2JA2A 2MO1A 5J1UA 1XPRA 2MNAA 1FOYA 1X4OA 1MMSA 1WVLA 1NTCA 3BWGA 2M30A 3LFUA 3GZ6A 4BYYA 1OKRA 1V5FA 2DA4A 1TNSA 3T1HQ 2QEJC 3UDXA 5LFAA 5J4VA 1YW7A 2LK2A 4CYCA 2UU9Q 2EZLA 3I0TA 2ATWA 1IBLL 3LA2A 1D0ZA 4YIFA 3RYPA 1GD7A 1GUGA 3IH2A 1E1TA 2AS5F 4I7AA 1VQBA 1B72B 1TWAB 2JQOA 4A2UA 1WH7A 1KU7A 1G4DA 5CVIA 2DFHA 3I3CA 1UG2A 4FF2A 3S1QH 4LIVA 1ENHA 4DZPA 3BVGA 5EEGA 4P1WA 1B4AA 3LA7A 3PUVA 3Q5FA 4IPCA 4LF9Q 1Q8IA 4A3IB 4KTAA 3VDXA 5FGMA 4A3DH 5M3FH 3OWTA 4FXKC 1SVMA 1Z7TA 2OTJI 1VQOA 1EEFD 4Q5VA 2O2LD 3M8FA 1X1DA 4IRGA 1PZJD 4NHJA 3AB9A 4IHTA 1FNWA 3PGZA 1ESFA 2YPRA 2RNJA 2LBFB 4GNXA 3M7NA 4ASNA 2XC7A 5L3CA 4QQBX 2PJRA 2M7BA 1IRZA 1OTCA 2O03A 1JTYA 4G6TB 2Z1DA 1J8IA 4JI8Q 5IT9c 2B3GA 3FM3A 3KZYA 5C3EB 5FO5A 1EYAA 3CP8A 2R5YA 4OIQF 2D2WA 3S9WA 3V7RA 2O8XA 3LSJA 2SEBD 2UXXA 5EPJA 4MIMA 2XNAC 3E0JA 2GBYA 3IAYA 2RDGA 3CC2A 3IRBA 2O6GE 2EV6A 3GMEA 4PZ6A 4ESFA 2LF8A 4DV1L 4HX8A 3OYJA 1TXYA 4DV3L 1XPUA 4I0BA 1MSGA 5C3WA 3GTJJ 3V05A 2KCMA 2OWOA 3TGNA 2K04A 1ZG5A 4HQMA 2E35A 3DXJF 2UXCQ 3R2TA 2HOTA 1K4TA 2QYOA 3H3VK 2BA0A 1WFQA 3HL2A 1XXGA 1FTTA 5C0XI 4LOCA 3M4OH 4XK4A 3D3RA 1K83B 1WFXA 2E2IB 1I6XA 2F5EA 1D5MC 1VQOI 4QSHA 3DM1A 1FBQA 3L2QA 1SYCA 2UXDQ 1Y1WH 2DO7A 2COMA 2K33A 1YIOA 4JVZA 1SYFA 4M6VA 1ETOA 3MKYB 2EFWA 2CV0A 2EV0A 2OCEA 5EKIA 1KNAA 3WU1B 3MXNB 4M6XA 4LF4Q 4A4IA 1JTXA 4AIMA 1JHHA 2OQKA 1TR5A 1BOSA 1HNZL 2DDAA 2P5ZX 3ND8A 1Z91A 2F5CA 3KEOA 1PMRA 1OCRH 2JA8B 2HZDA 3LA3A 2H1EA 1J09A 4RG1A 3QYBA 4RLQA 1PRTF 1KNEA 2HWVA 3CC2I 5JJZA 4BA2I 3F22A 3K1MA 1D8KA 2JK3A 4A3CH 2JN4A 4DNCA 2DFFA 1ZH5A 1WTRA 4OX9Q 5A2QK 1VQDA 2W4SA 2Z2SB 2X6YA 2A5WA 3C1EA 1J0RA 3JCUC 5IP7G 2HDCA 1PXUA 3S14J 2VIXA 4BU2A 1EIFA 4YIIA 2DTRA 2IL8A 1EUJA 4C30A 1K8MA 2M8GX 5IGDA 2FINB 1OXXK 4DUZL 2KHIA 3CCRA 4EM2A 5A2QL 1W4MA 1ZARA 4A3GB 1Z6TA 1MD2D 1W7PD 3BY6A 1TY2A 4C3HH 5C0XH 5CKTA 5HNFA 2DN8A 5EF6A 5F04A 1E3PA 1MHWC 2ZXPA 1F9SA 1FGUA 3SYTA 2E7XA 1WYDA 4HAEA 1WTVA 3JRBA 4M72A 3BU2A 1ZR4A 4DK3C 2JK8A 5DM7F 2QBYA 4DYQA 1JORA 4GZYC 2DDBA 3TZUA 2UUZA 4B44A 1SNMA 1ET6A 1SAXA 3RZOB 2M4GA 3FMQA 2N78A 4ZYGA 3I4NG 3ZQHA 1GXPA 4NNJA 5K7HA 5BN4A 1FYLA 1KRTA 4WF2A 3QPTA 4IRHA 3I2ZA 1G3TA 1RD9D 2JA5G 2I07B 1B8AA 2F4VL 1XSXA 1QZYA 4MNOA 3J80i 1XCBA 3M3YB 3LSRA 1KGSA 3MZ8A 4R4OA 2HHHL 1F2LA 1YJNA 2DUDA 1RKTA 1T0FC 3BZ6A 1SAUA 2V26A 1Y8QB 5D3DA 4ABNA 1M1KC 3PIO3 2HOSA 2XGCA 5FD6A 2YYZA 1OPCA 4HOBA 4HLXA 2ZM6L 3COAC 2QQ8A 4Z2YA 4B3RQ 1YNXA 2QVOA 2CUEA 4DR5Q 3K6OA 5LMNQ 3ABMH 2BE5D 3AFQA 2FBKA 5F0HA 1JKRC 4IEJA 1B1ZA 1A15A 5BN3A 2PG4A 1GUUA 4X3UA 4ZYEA 4ZLTF 4AD9A 4HBLA 1HXDA 4OMZA 2R92J 2IHFA 1JT8A 1SMTA 3E9IA 1MBFA 4EGVA 1XYIA 5EZGA 1JI8A 1N33Q 2LXKA 5HOOA 2X48A 1HRJA 3LSHA 3QRFF 2EYJA 2HQEA 3VYRA 2DN0A 2XAFA 3SEBA 2MYSA 3DEUA 3LSPA 1HZCA 5CBEE 1AZQA 5LGTA 1GXQA 2FJ2A 3K81C 5M5WB 1EIYB 3QOJA 4CCNA 5FLXE 3AFPA 3OV8A 5LEKA 1A2UA 2LKVA 3L2RA 3BR1A 3V7SA 3Q0VA 4DUYQ 5GAGJ 4AYBE 2V79A 1MGSA 5IYCG 4FF1A 3ZQIA 1I3AA 2D0PA 5DCMA 2QILA 3BP8A 1U8RA 4J00A 2ZSIB 5LHY1 4LF6Q 3EN2A 2H1LA 3V8LA 2Z5UA 1V54H 2IBDA 3DTKA 2A07F 2DY8A 1CT1D 1K78B 3BR3A 2GLOA 4L6TB 2Q2TA 2ES2A 2WFWA 3Q9VA 3DWPA 2HVRA 4EM0B 4RGMA 1HKSA 4HCEA 4B3TL 3G6EA 3GTKJ 4BDYA 3JAMK 1XX8A 1JWUD 2JEAI 5KHDA 3J81E 5C4JH 1PH3A 4A3BB 4OXPA 5FFXA 3K4LA 4M3FA 4H0EA 4JV5L 5IYDH 1B8IB 4EJTA 2Q2HA 3F8NA 4ZDLA 1S8NA 2EYHA 3K4KA 1R4PB 5M5XB 1OCTC 3H3UA 2IEKA 4XSXF 5K5QA 4K5XA 1L3LA 5J22A 4TSSA 1S5ED 1WJEA 3DU5A 5IGCA 4JI6L 2RKHA 1E2ZA 3HOWJ 4AWXB 2LKXA 3C2HA 4APVA 3QIAA 4PQXA 4X65Q 1WJ5A 3X3NA 1Z7UA 4MFDA 4CO8A 2NVTH 4DAYB 4CBVA 4BUPA 1R36A 3FKIJ 2PI2E 5JLWA 4LF5L 2OTLA 5E8GA 4YWKA 4C1NK 2JSCA 3PIOF 4K8JA 5HLIA 4DNIA 5BQTA 1R6RA 5FLMG 1TWGJ 1W1WE 3ZR8X 4IOAF 4JBWA 1IAWA 2KIQA 4XRSG 1B59A 2KJCA 1B1BA 2AHOB 2E1NA 2L4MA 5CMDA 5C5MA 2LVSA 3E5UA 2BH8A 4UY8I 3TOBA 3S24A 5J8FA 1D8JA 3L2WA 2KHSA 5A2QZ 3CCVA 2KECA 2LF7A 1U4RA 3CRLC 3ULJA 4DBQA 3CJTB 3O8HA 1SFUA 2NS8A 3M7GA 5FRMA 2D5DA 4WXDA 3GCMA 4XT1B 1V1PB 3OMGA 5T1GA 1PH5A 3C46A 4A93G 1IBKL 1T39A 1UG0A 4F7ZA 4R79A 3HOXH 2E2HJ 3OIPA 1MJBA 4HLYA 3NBIA 3FPPA 2A6EF 2HDMA 5KIXA 4OIRF 1U4PA 1STNA 2VQLA 1R5ID 3KZZA 1D0YA 3P7JA 1X2NA 1IXCA 2GAUA 3GFLA 2B0LA 2P5KA 4L9JA 3ERMA 3U58A 4ENNA 3FK7A 2OTLI 1EH6A 4XOPA 1H88C 3R8BA 5HGTA 3PV0A 5GAEC 1CKMA 2Z0SA 2AWNA 5I6YA 3GTLB 4CHTB 3ZQFA 4L0ZB 2VBYA 1W2BA 4KJNA 2M00A 3Q0AA 4A5NA 1J2XA 3W2VA 3GTPH 1GUWA 2IPQX 2LTPA 2VXDA 2NTSA 1ETKA 1ON2A 1G51A 4NMZA 2LKSA 2JA6G 3WTVC 3CXCA 1SE2A 2NZHA 4MFEA 4R4CA 5C44G 1ZRCA 2VXZA 1WTWA 4DPGA 1PYVA 1F9RA 4HDUA 1U4LA 5AJ3L 3T51B 3HSEA 2K5VA 3ECOA 1L0YB 2F0QA 1BC8C 2N88A 1UHSA 1RESA 5FKOA 2K85A 1UUPA 2PO4A 1S3JA 1IL8A 4RMFA 3I54A 4B4CA 4C2TA 2E5ZA 2K32A 2IT1A 4HQEA 1ZELA 4LF7L 1PV4A 1MIUA 5AIQA 3I4MG 1CF7B 4GKJQ 1YW9A 1LEAA 4LD5A 5EBCA 4R1HA 3GUDA 5J3BA 1O7FA 4JP0A 1U78A 4BBSH 1BR1A 4NW2A 3TQYA 3R6SA 2WBMA 1OCCH 1KDCA 2QDBA 1UE6A 1V5GA 3T5XA 2DA2A 3H1CA 4ESJA 3NTKA 3CHBD 3VYUB 3GTQH 4HV5A 3S2DH 3SZPA 4D1QA 5LRSA 4I76A 5C4ZA 4DA2A 3GTOH 1FD7D 3AEVA 4QIWE 1EQRA 2W82A 4FISA 2M3AA 3M8EA 1SFOH 1STGA 3W3CA 2DA3A 1AE2A 4BBRJ 1FGBD 2VBZA 2M7AA 3FKJA 2Q2EB 4ZYHA 2CHBD 1ZHFA 2K7LA 2K4BA 2IW3A 1K7AA 1Y0NA 3CUQB 4QMGA 4LFBQ 2OQRA 3ZQ7A 4OEMB 3DBRB 2R7OA 1BBWA 4AVZA 3HG9A 4I0AA 3QPLA 5H2FC 2AUJD 5K5OA 1WTOA 3OSFA 1Q82C 4IQZA 1XN7A 2DGYA 1I3QB 2EJMA 1TL8A 3R4KA 2X0LA 4PSWA 4A93B 4FQGA 4JI3L 1WH5A 4IN3A 4C3IJ 4MZ9A 3NP8A 2A5HA 2NYZD 3MA2B 3D1NI 3W6KB 2L9SA 3U2RA 4GO1A 3L00A 3HOTA 3WTUC 2ZJPF 3A5ZB 1E24A 4E4HA 2ZXOA 1ONLA 1ZGAA 1VQNA 2FBIA 4A3JG 4P55A 1GKHA 4X3SA 5DD8A 1WJCA 4KYWA 3CJQB 3F2UA 4DV6L 2LS01 2BHYA 2Z1CA 3UDIA 4X6AH 1JT6A 3QO2A 1N77A 1D5YA 1HDPA 2ESNA 2HYJA 2KMUA 4HTHA 1XMAA 2DJFC 2CMPA 1I50H 5M3MG 3E5QA 1QOHA 3KLWA 2NVXH 1MMDA 5ILUA 1HW1A 4D7NA 3FF5A 1XDSA 2Y31A 2H6CA 4AM3A 4WXHA 5FKLA 1STEA 4DV4L 5JJIA 5HVQC 5HODA 1WOCA 3AU7A 2QSGX 4V0BA 2EVBA 3ONQA 3WWVA 2M0MA 2GVAA 1O3QA 3M1CA 1IYUA 2ZTCA 4B9WA 3WTYC 4HDVA 4ME3A 1O7YA 1B3QA 2L0KA 4IJLA 2Z16A 4A0XA 2FF4A 3HPHA 3L7ZC 3HOUG 4GXOA 3SFZA 5FO7B 3L2UA 3S17H 2K50A 2DT5A 4MLOA 5C44B 5CC4A 4H44C 3C18A 3EFXD 3OYBA 4F87A 5IGGA 4G12A 3H9GA 1QBJA 1TWCJ 4JW0A 4DV7L 3CTAA 2LDUA 3OOUA 1YYVA 4LLNA 3D5RC 4BY1J 1A0IA 4OELB 2JA7B 1SMYC 1G291 3HSRA 2BY2A 1HZ9A 1IW7F 1L2FA 1DOMA 1RETA 2EDGA 2EQSA 1Q3LA 1W36D 3J80K 2K1BA 4L5IA 4ZAIA 1VQNI 1B72A 2PMZE 1RUNA 4FF3A 2F0IA 2WKCA 1X1CA 4E6KG 3F2CA 5DDGA 3BQYA 5BR8Q 3I3LA 3VDYA 1A2TA 1SMYF 3TRZA 3MN2A 1FOKA 3V42A 4MHGA 1SEUA 2EV5A 1YZ6A 5E1WA 1Z0XA 2F52A 2VJ4A 4JI1Q 4WX9A 4OO1I 4IOCF 2L1BA 1Z67A 4PDKA 4CDGA 1O7IA 1VF5C 3D4DA 5JI6A 2YUSA 3BG6A 2OAZA 2Y48A 1D1IA 1BR4A 3LSKA 2BHZA 3HKZE 1WWXA 4AIKA 2F1MA 4MTKA 2J0TD 4A3CG 1IN5A 3KLRA 4C2UA 5IPAA 4G7HF 2G9HD 1USTA 3CQZJ 2A6HF 3A0HC 4JI5Q 1U2WA 3IP4B 1EFWA 4IALA 2RVCA 1F43A 2LBFA 2IA2A 4L9NA 2QGQA 2CH0A 4XLEA 1SNQA 1RZ4A 4GYIA 5E3NA 3RQ4A 4M71A 5IWAQ 3RCOA 3N6RA 1FIAA 3VSKA 3A03A 4JX4A 4LUOA 2KCNA 5C5LA 3FHNA 1ZREA 1F9NA 5JAVA 2E5NA 1HPCA 4NUBA 5FOBB 3CP0A 3K6GA 5IYCJ 1HNXL 2IA0A 2KRCA 1DU0A 5EGTA 3I5UA 3SHLA 2I10A 2HU9A 1Q1EA 2R6GA 2EYOA 3AMUA 2V6CA 3I71A 4LB6B 5ELEA 5C0XG 1MSHA 1MI2A 4RCNA 1N9WA 2VS1A 5EYRA 1MH3A 1BI1A 4E70A 3CLQA 2LXJA 3S93A 2JZYA 2R7DA 1Y1VH 4LF8Q 2IX3A 3GTMJ 4F55A 3DV8A 1P2FA 4FF4A 1ASZA 3S2HB 2CGPA 4A3JB 2IPKD 1EIGA 1E1OA 2IA1A 3RKYA 4A3KJ 1HUMA 2XN9C 2ECCA 3AQQA 2ZXRA 5FKMA 4XKWA 4B43A 3B73A 1PFBA 3D4RA 4OO1H 4BL0B 1IXSB 2HR3A 2JXMB 4QUFA 2E2HB 4KIBA 1NTGA 3MFYA 2DXIA 3HGGA 2D2CC 4BH9A 3K7AJ 2B2UA 2VKHA 2DPDA 2QSFX 2CSOA 4LGWA 2UUCQ 1K0RA 1IF1A 3HOSA 2R93J 2A8VA 3WE2A 3HOZG 3WDNA 4A3FG 1FJLA 1LYLA 1PZKD 4BXXH 4HNUA 3H36A 1ETVA 1JWSD 3E3VA 4K2LA 5EJWA 1N36L 5D65A 2PZWA 1S40A 3MXNA 3B02A 2RSNA 5HDGA 2F6CA 1KQSA 1OMIA 3GXOA 3VR5A 3JAME 2WV1A 1NHAA 3ISPA 2VQEQ 4JI2L 2X51A 1LUZA 2LSSA 2KEEA 3G71A 1O3TA 4BE0A 1R1UA 1ULYA 3WOEA 5GAHC 5CVJA 4V190 4ZCKA 3DEOA 2HCCA 5DCFA 5IYBH 1ORKA 2R7ZJ 2V1DA 4Z6YA 5BS6A 2K52A 2EQRA 1CA6A 2IHEA 2DMUA 3H09A 4DR2Q 3DWQA 4RAUC 3S1NJ 1TWAH 3EBEA 1HTPA 2EILH 4U0VA 1ZYRF 3CDIA 3T0YA 2H94A 4R4IA 1SAPA 2VKEA 4FE7A 2JVHA 4BJ5C 3IFDA 3T13A 2LY1A 3MKWB 4I65A 1AH9A 3J81j 2XWJB 5D5VB 4A3IH 2JP1A 2NS7A 2XKOA 4YG2F 4XOTA 2ZNZA 3KP7A 1ITYA 2DQLA 3E6MA 1MZBA 3PIP3 2NVYJ 3T1YL 5C4XG 1X6OA 1XD7A 4KISA 3N52A 1IKLA 2RREA 4ZTFA 2QENA 3VEPA 1IV6A 4C2MB 1FYCA 1QZZA 2WB1E 1FMVA 2BW3B 4DV2L 2FE3A 3QPHA 4XBFA 4IJHA 4OHJA 3S3MA 1DYQA 4GKKL 4GCVA 2XIGA 5JVG3 2M2LA 3GLLA 3G71I 1CQFA 5C3EH 4Q4ZF 2VJJA 1JGSA 4OAYA 1QU3A 3GZNB 4LK1C 2EY6A 2MH9A 3FWEA 3OIOA 4B3ML 1OCZH 3CCLA 3RLFA 2AQEA 3UNGC 3CP2A 4YFNF 3F23A 2MSYA 5B5EC 3C7JA 2X6XA 1LFUP 1P7IA 5AFWA 3J7YW 4HAMA 2L9HA 2DMPA 5JEAJ 4PFOA 3PO3J 2PQEA 4A75A 2JA6J 3EROA 4IQJA 5F0CA 1EEID 1PP8F 3DUZA 3GW2A 4GYGA 1YOVB 1OXVA 3KLSX 1P92A 4C3IB 4X66Q 4DR3L 3RLOA 4P96A 2P5VA 2VOOA 3E7LA 1TWFJ 2EIFA 3D0SA 3I4MJ 2L9NA 1G2HA 1K83H 2PZTA 3ONAB 2E2IH 4PSXA 2WAQN 4EX5A 3HOZB 1Y56A 4WCGA 4N4OB 4A3FB 5J1YA 1VQJA 4P72A 4DF7A 1SANA 2CYYA 5JOBA 1DU6A 2VE8A 1S4ZA 5D3IB 2NWGA 1W6JA 4M3BA 3OPOA 2KDZA 1BR2A 5D4SA 4XICA 4WK8F 1IZ1A 4MEYF 2HGCA 3U21A 3BDOA 1MBGA 2X4HA 4B1RA 3IFTA 2CWEA 2ELHA 1H9SB 1X54A 5E1FA 3PNYA 4AQYQ 3KP5A 2O5JC 3HRZC 4KJZA 4GN5A 1EWIA 4DW6A 1PFSA 3CCLI 2JA8H 3NAUA 1IHZA 1I6HB 3VFZA 1MJ9A 5E4XA 3K8AA 4LFAQ 1EQQA 1VDZA 1CK1A 3H92A 4RKBA 1STZA 2ETHA 3OS1A 2ACJA 2IS1A 1MSFC 3NE5B 4I01A 4P9UA 3S1QJ 1UZCA 4KHPQ 4NB3A 1EH7A 4NXMQ 4IHXA 3HGYA 1UHMA 4LLLA 2E1MC 3O6BB 4LFCL 3DLLF 1K78A 4HIOA 1I4XA 5EEAA 1P6RA 2AO9A 3RTRA 1DCZA 2QZ8A 2M5WA 5LMUL 1KYZA 4KMFA 4A3DJ 3TW7A 1SJED 2OV7A 2IW5A 3ZQCA 5M3FJ 1IW7D 2VKDA 3CDHA 4BQQA 1EY7A 4JI4Q 4YIRX 3PM1A 4WJ3M 3MVPA 5C4XB 1KL9A 1SYEA 1SMYD 3RZDJ 3J7ZC 3ZCOA 1B8IA 1WI9A 3MD2A 2PX9A 4ID6A 2IWHA 4C3JG 2XF7A 1SYDA 5JVGF 2BXZA 3EUHC 3V8KA 2E5LQ 3TREA 3PO2J 2XB0X 2WAQG 1LE8B 3HXLA 4RGXA 1GDTA 3CCQA 2RAEA 2R7WA 4HJ9A 1IGNA 4KMUC 3CCMA 2EB7A 2NOGA 4HF2A 1FLIA 3BR5A 1SE8A 2QSHX 3KYDB 2VPLA 1CKOA 2K4JA 3RZOH 1O7LA 3G48A 2A6HD 2HOAA 5IGFA 1SMXA 4DK6C 1LTAD 5JFRA 5HLTA 2MH2A 3K2AA 1HCRA 4R1JA 1WVRA 1POGA 3M3YH 3BPXA 1EZ6A 5J6XA 1YE9A 4G94A 2Y9YA 4OGQC 1R9TB 2LNBA 4BBSG 1QVGA 2E74C 5FJ8G 5CYVA 1HFNA 4EGZA 3S1MB 3K0YA 4K5VA 1JOOA 1WTHA 4IJAA 3M4OJ 5B1BH 4NXNQ 4HMIA 2CUJA 1U9NA 3I91A 3U1DA 3GTMB 1L0WA 4A3MJ 4NKLA 1Y1WJ 2KJXA 1DONA 2WV6D 2Q2IA 3TP5A 2XKPA 3S1RJ 4QTRA 1V1PA 4X62Q 3IH3A 3E6ZX 4EQPA 2CS3A 3OYIA 4BS9A 1HF0A 1S72A 5JJLA 5KNDA 4KITB 3CCQI 2C6YA 4CJ2C 5EJCA 1XWEA 1TT5B 1BBUA 1V3FA 2NRAC 2ZJ2A 3GD7A 1FT9A 5GROA 1SNOA 3K7AB 3SZGA 3H35A 4N9IA 2ICEC 4E6IA 3ZRGA 5M5WH 2E1CA 2CW0C 4K0KL 1DOKA 4DR4Q 2L11A 1CHPD 3B6YA 2Q8TA 3W6JB 4LMQD 2Q8KA 2Y0SN 3KZIC 5DEQA 4F92B 3IV5A 1LEBA 1TS2A 3J80E 4K8IA 1WD0A 3HOYG 3WTTC 2NVQB 5D5UB 4U7DA 1HDDC 2ZB9A 2K5WA 4HG2A 3J7ZI 1YITA 5CV8A 1I94Q 3AKZA 2DA7A 3OL4A 1KTKA 3AG4H 3LWUA 5DV5A 2B8FA 1OO9B 1NG7A 3GP7A 3R2IA 2X1EA 3URYA 2FQ4A 4XLPF 3CPFA 3QPSA 3OYCA 1BJZA 4D7MA 3IWFA 4EQQA 1R5HA 4KV6A 2GOXB 2R7ZB 2LH9A 2N8GA 4N9TA 4C3HJ 5C0XJ 5I9PA 3HOVG 4L8JA 2V4JC 4DR7L 2HI3A 4V2GA 1O80A 1BIAA 5IP6A 4FP5D 2LFBA 1IUYA 2ZXIA 1X9NA 4IX7A 3GO5A 4YCWA 3A55A 4A3BH 2RA4A 1PUFB 1ZYRD 4C3JB 3BCBA 3NWTA 1S72I 1F5TA 3S15B 5M5XH 3IC7A 2E60A 3CUQC 2YU3A 2WAQB 1XNQQ 3AFHA 3JTHA 4QY7A 4HX4A 2DQRA 3PL8A 4MO7A 4MHEA 4LG3A 4JYAL 4HF1A 1CUKA 4AC0A 1YNNC 4AVPA 1G3YA 1H89C 1KAWA 3OS2A 2QM3A 4CCLA 1PA6A 4L5EA 3VYUA 2L3DA 4OWWB 1DM0B 2B2WC 4M3EA 4RLFA 4N8X1 1K6YA 2B63G 2X85A 2JA5H 5HURA 4YFXF 3DKXA 1PVOA 2P8TA 3D6WA 3RKWA 1YITI 3MXPA 2P0WA 4R4TA 4XTCS 4TVAB 2VL8A 1FNVA 2EFQA 5KYLA 2Y0SG 5COYA 3RYRA 5E8IA 3CF5F 1UMQA 2Q2EA 2KENA 4HF0A 3I4LA 1CSQA 3WTXC 1T56A 1HA8A 1WCMJ 2QDLA 2OJED 3GV3A 1UE5A 4UB6C 2VY3A 4HX7A 2ISZA 2RCFA 1F9PA 1QE6A 3GV6A 3P5JA 3PO3B 2BVLA 1G6PA 3K4JA 1QZGA 4DV5Q 1RHPA 2B2VC 3ZXSA 5E3FA 4LIUA 1MBYA 3A8JE 2XGTA 2SOBA 4RFBA 3MZYA 3NELA 3TMEA 3IL8A 4KA4A 2B2WA 2YX4A 4A3LG 2MO0A 4FVMA 1WTPA 4HNVA 3G2BA 1M8AA 2XAJA 2F4OB 4C56C 2HQNA 1PYWD 5DM6F 3OYYA 3BG9A 4G7ZF 2X1DA 1D3YA 3MTSA 2FJ1A 5L3FA 2L7FP 2JN6A 2L4AA 4NDXA 2B9SA 4YHHL 3F2DA 5IT9K 1X3FA 3FDTA 3H0GJ 2E2JB 2L4NA 1P16A 3GVAA 1ENAA 5EAYA 2EIJH 3T53B 1T5EA 1VQAA 2UUAL 3A01B 2IAIA 2B2VA 1LABA 1U8BA 5E17F 2GA1A 1N32Q 4ZUJA 1NG6A 4A6DA 3GTLH 1EU3A 2Y2ZA 2LLKA 4QB4A 1LTBD 4G8XA 1HKQA 1KHIA 1IN6A 1ESRA 1F36A 2EPBA 5HY6A 2K7VA 2RCNA 1HJPA 1LNWA 5C4JJ 1ONVA 5IYDJ 1DD2A 4KIGA 2N49A 2KEDA 1X32A 2F0WA 4OIKA 4ZH4F 3HYIA 2VQCA 4B3SL 3GDEA 2A68C 2AQFA 4ZZLA 4IUNA 3FIWA 2HDLA 4LUZA 1VQCA 3SHFA 2AQ2B 5ELFA 5LBQA 2EOTA 1Z3YA 1N8RC 1JOKA 3OOCA 1A5JA 4A3EB 2EFOA 4PG3A 1L1OC 4IPHA 2XAHA 5M9OA 1WKMA 3P9KA 4RB0A 4XN3A 1IKMA 4I6ZA 1FJGL 1FP1D 2X9DA 3TEDA 1EZ8A 1KC8C 3NARA 1MJCA 1LUJB 5EDNA 2NVTJ 3QOPA 2R5ZB 3RZDB 2IS6A 4BWGB 2NYXA 1BVSA 5CVUA 3KJPA 2E76C 2B63B 2CQNA 1SC7A 3QWNA 4DK0A 3PO2B 1SR3A 4BQAA 4M3GA 3WHBA 2XGEA 5IYBG 5E20A 1H9RA 2Y0SB 2HIXA 2VL6A 2CUFA 3M8JA 2K01A 3EYIA 1NR4A 5FLXL 2RQPA 2B2TA 3E97A 3EUKL 5GTHC 2EZKA 4PNYA 3HC7A 3MMYB 4BY7G 5KAFC 1BBYA 2XASA 4O6JA 4JG2A 2KFDA 1VQ8A 1D0XA 1BA5A 1A04A 3NQTA 4EJVA 1TVXA 2L0CA 4Y4RA 1K6OA 3QQAA 4YWLA 1VQ5A 3NTIA 1KDAA 1I3QH 3O13A 3S3OA 3LGJA 3WU2C 3HOXJ 5TISC 1SEBD 1PH2A 4RB1A 4A93H 1P4XA 2EWNA 3ZP5A 1MNMC 1A31A 2UUBL 4PGGA 3U4ZA 2KP6A 4CCJA 2IGNA 4M3DA 1YNJC 1PZID 4A3MB 2O9LA 3PQIA 1TBXA 1GOZA 1Y8OB 3SK6A 3KFWX 1HBXG 2UXBL 1BW6A 2A69F 4XDXA 3J81L 2XTIA 1OXTA 2VB3X 4IL6C 4OMYA 1XMQL 1VQIA 3S1RB 3G1LA 4L63B 1F77A 2W24A 1EQTA 3RLNA 5C3EG 3STBC 3A5UA 2ALYB 3BG7A 1QQIA 1YX5A 5LGNA 3I7FA 4L5QA 3C2PA 4I7ZC 5EKLA 3K1PA 4L5JA 1G2TA 4QL5A 2HQ5A 1HQRD 3HZJA 3GTPJ 2BE5F 1O57A 2ZFUA 1AP0A 3L3OC 4OIPF 2HPIA 4HR7B 4CICA 4RGOS 1TQOA 4XONA 3M4PA 3W2AA 2MW8A 1FL0A 2RC4A 2R7RA 3BR6A 1SD6A 1VTNC 5KNLA 1PH7A 3FK6A 1GVDA 1VQ8I 2OF1A 4JOMA 1GUSA 4ZK9B 3GX4X 4O1NA 5C44H 2F0KA 3SEQA 1LQ1A 4NQWB 2EFNA 4AIJA 2CW0D 1VQ5I 2AQ1B 5FO8B 4XQJA 2I5LX 2QQAA 1HNWQ 2HNHA 1AFPA 1OR7C 4ZQ3A 1TY0A 1B7YB 5CQEA 3Q23A 1Y8NB 2JA7H 4JI0L 4S04A 3IAM2 4BBSJ 2KBNA 3K5LA 1ZLJA 1JOQA 4HN7A 4C3HB 3OIQA 1AU7A 1Q90A 1IYJB 4ANJA 4CKEA 3DWLE 3CCJA 1R00A 2WADA 2ZBKA 3E9HA 2ZKZA 3M9AA 3EJIA 3RN2A 4JCVE 1KU9A 3S2DJ 3VA7A 1Y6IA 1D2BA 3IUOA 4GNXB 4R8IA 3TO9A 2M0CA 3GTOJ 1EOTA 5FRNA 5HDNA 4II3A 1SFOJ 4FHTA 2GVBA 4N4NB 3BJUA 1ZXTA 3ASOH 2HTSA 2JA8G 4KD3A 3FMRA 2CVRA 3TP7A 5JLXA 1UNSA 5F2DA 1A35A 1OR7A 1MBJA 4ZYDA 3KPHA 3IRRA 1U0JA 3FXQA 3F8CA 3NXWA 4G57A 1FOWA 2FU4A 4QJFA 2LY2A 1PFNA 4RBOA 3WHCA 5IE8A 4BY7B 2BW3A 4DR6L 1ZRDA 1SXTA 2HQLA 2CQXA 3PF5A 1E2VA 1YNND 2KIMA 1HSTA 2AWOA 3T1BA 4FCYA 1W0TA 1Q1VA 1GUOA 2DK5A 2P5LC 1K8OA 4A3GG 4MN3A 1Q7YC 4CDCC 4PV1C 3ZN1A 4WRDA 1R4NB 1VMCA 3KBGA 5IODA 3MEHA 3SJMA 1WCMB 4KY6A 3RIRA 1JJCB 2IXSA 4P75A 1B9MA 3G6JB 4UPAA 2OU2A 1VQFA 2W1OA 3CCJI 2HIVA 4KN4C 5CV4A 1K3BC 2V1XA 3S2HH 5K7FA 2JMWA 1HQMC 2C9OA 1EL0A 4A3JH 2MGSA 3K58A 4IQ4A 4A69C 3WTSC 2JT1A 1YRNB 3CD6I 4X6AJ 2D9UA 2ISYA 1KYWA 1I50J 1U4MA 1YJWA 1NK3P 4YY3Q 2UZKA 4XLHA 4GOPB 5M3MH 4GDFA 1XMOQ 5DM73 2E2HH 1C9OA 1VQ6A 4UB8C 2I0QA 1BCPB 4NP5A 4WORA 2YX7A 6PAXA 2F0SA 3QG1A 3MFGA 3RUZA 4E7LA 3H0GB 3I56A 4N9HA 4PJMA 2D5VA 1EWCA 2D62A 1KQ9A