3GO5A

Crystal structure of a multidomain protein with nucleic acid binding domains (sp_0946) from streptococcus pneumoniae tigr4 at 1.40 a resolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
285
structure length
285
Chain Sequence
GMNTNLASFIVGLIIDENDRFYFVQKDGQTYALAKEEGQHTVGDTVKGFAYTDMKQKLRLTTLEVTATQDQFGWGRVTEVRKDLGVFVDTGLPDKEIVVSLDILPELKELWPKKGDQLYIRLEVDKKDRIWGLLAYQEDFQRLARPAYNNMQNQNWPAIVYRLKLSGTFVYLPENNMLGFIHPSERYAEPRLGQVLDARVIGFREVDRTLNLSLKPRSFEMLENDAQMILTYLESNGGFMTLNDKSSPDDIKATFGISKGQFKKALGGLMKAGKIKQDQFGTELI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a virulence regulatory factor CvfB reveals a novel winged helix RNA binding module.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Gene regulation
molecule keywords Multidomain protein with S1 RNA-binding domains
total genus 68
structure length 285
sequence length 285
ec nomenclature
pdb deposition date 2009-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13509 S1_2 S1 domain
A PF17783 CvfB_WH CvfB-like winged helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3go5A04
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3go5A02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3go5A03
2.40.50.330 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3go5A01
5A2QK 1IUYA 1PH7A 4LF4Q 5IWAL 2O03A 3HRTA 3J80K 3U4ZA 1S7AA 1K7AA 4K0KQ 2D0PA 1K73C 1N8RC 3GDEA 2BV6A 2JQOA 1R36A 1DPUA 3M1EA 3TDZC 1QBJA 4P73A 3BJUA 4EGZA 4ENJA 1GHCA 1VQOA 3RR5A 1MZBA 4IOCA 3GTKH 4MQVA 1MJBA 3Q5FA 3FM5A 3KLOA 3L7ZC 4A5MA 2UWMA 2M1BA 1ASZA 1IBKQ 4JI3L 3ZMTA 4YHHQ 4BH9A 4UP7A 3WGIA 5DV5A 3A0JA 2MBFA 2M8EA 2OA4A 1TBXA 2IX1A 4KHZA 4XSXF 4P74A 3S17H 1XN7A 1XGSA 2FBIA 3RKYA 1P2FA 5L3DA 5DD4A 4IJLA 1AH9A 1KIXA 3QAHA 3WE2A 1FGUA 2RQPA 4HQEA 5DCMA 4JQFA 1PH3A 3FWEA 3J7ZC 3HOZH 2VW9A 3K8AA 4EJOA 2VOOA 3FF5A 4DV0Q 1R7JA 5ERIA 2E5LQ 4A3LH 2DW4A 4PZJA 1IXCA 1KC8C 1I27A 4MQ9F 5FFZA 3WTYC 3WU0A 2VNUD 1W7PB 1SFUA 2M30A 4LNQA 1IRFA 2GA1A 3IKTA 2PFBA 2LF8A 3HOUH 2I5MX 3RPQA 2IHEA 4LK1F 1E1TA 4UHTA 3G6EA 1Q1HA 4A3EG 3F6OA 2CWPA 2BEOA 5HS8A 3FXRA 3ULPA 2PBIA 3C7JA 2L4MA 2PG4A 2B63H 1N32L 3ECHA 3NRVA 2JE6I 2ASBA 3COAC 3LSTA 1OYWA 1HNZL 5LBQA 5JEAJ 4DV3L 3IWZA 2A6HF 2ACJA 2OTLA 2CQOA 1BOAA 4JI1Q 1O7FA 2MH9A 3JSOA 2P5KA 2VQEQ 5LLQA 3BDDA 1IL2A 5M5YH 1MDMB 3CUQA 1CSPA 2G7UA 2ZBKA 2XKPA 1R23A 4MNUA 2NNYA 1CF7B 1YVCA 1SRUA 1YZ6A 2HQNA 5JVTA 3P9CA 4JYAL 5AONA 3FMQA 3JTGA 1FPQA 1HBXG 1YI2A 2K14A 4N0BA 2B0LA 3TQYA 3P9KA 3FZVA 3GEZA 2R92G 4BAYA 2BA1A 4X65L 3RLFA 3RDIA 4L5SA 2ZMEB 3IRBA 5D5VB 4NPSA 4A3DG 1TWGH 1RUOA 3GWZA 3I53A 5E1XA 3PIPA 1OXVA 1BM9A 2HGCA 4LUVA 1FP2A 5IYDG 4LFCL 1LQ1A 1C7YA 5K5QA 2LDUA 1G291 1B4AA 2GAUA 3I4NH 2XKOA 3HRUA 4EVIA 4JOIC 1N32Q 4MEXF 4L5RC 1IN8A 4LK0F 1OXTA 4ZZDA 4ZZLA 4G6DA 3O2PE 2K86A 3ZPLA 2IRFG 1OXUA 2LXJA 4EX5A 2AXLA 2K4BA 1S3JA 4DR2Q 1IBKL 2HWVA 5DUKA 3LQQA 4XSZF 1PH9A 2PQAA 1R1UA 3OW2A 3LA7A 2DFIA 2MLKA 4GXOA 5GAHC 3D5LA 3JSPA 2YTXA 5JFRA 3K7AH 1H95A 5HLGA 1HR0Q 2FEZA 3S1RH 3F2CA 3D0SA 1IRGA 1R9TH 1EIYB 1EOVA 3PIOA 2DK8A 5L3EA 2JK8A 5LEKA 2HR3A 1XGMA 2QM3A 4LGWA 1ZRFA 4BY7G 2H09A 2X0LA 4AYBG 2DPDA 3KOJA 1BIAA 4R1HA 2R7FA 4HX4A 1SE8A 3HSFA 5DEQA 1XCBA 4RB1A 3RLOA 3GLXA 1YW9A 2JZYA 3RKWA 4UXNA 1VQLA 2CO5A 3L00A 2D45A 3E5UA 1AWCA 1L3LA 4NB5A 3HSEA 3CD6A 1JHFA 5FD5A 1L0OC 2GVAA 5F64A 3R0AA 3KZZA 3BZCA 3GXOA 5CVRA 4PGGA 4RGUA 3QU6A 2ISYA 1U2WA 6PAXA 4CYDA 1BVSA 2HTSA 4Y7NH 4A0ZA 5IE8A 1R5HA 1PH1A 2NN6I 5ILSA 2VC0A 4R4IA 1HZAA 4UP8A 3R61A 1V4RA 4JI2Q 1PH2A 4YIFA 3TEHB 1HW1A 4LLGF 3DV8A 3D0FA 4LF9Q 1J5YA 1XGNA 4MGRA 3ERED 3HUGA 2CWEA 4OOIA 2Z6KC 2JA5H 4B09A 1GVJA 4LLNA 1XPRA 3B6YA 1FJGQ 2NAZA 3RN2A 1NBWA 3I58A 2PNHA 1LEBA 1G3WA 2VBYA 2VBXA 4HJ5A 2W84A 3TKYA 3J7A5 2PN6A 3TQNA 1XB4A 3F1ZA 3EUHA 2GXBA 4IHTA 4F7ZA 3M9BA 2OBPA 1PP8F 1HNWQ 5D4SA 1KU7A 2E7WA 2ZTDA 5LMNW 3I4MG 4D0PA 2H27A 3KP7A 2VOPA 4A2UA 1OXXK 5ILUA 5TJJA 1PV4A 3M4QA 1WYDA 5KVRA 4GNXA 3CMEA 1PFSA 4QY7A 5E1WA 3KFUA 1EFWA 2UXBQ 4JI7L 4QWQA 1BBUA 1G3TA 4EQQA 5M3FH 3J81K 2DTRA 5IYBG 4DV5L 4DV6L 1MDMA 1F5TA 1HKQA 3V4GA 2IHFA 4LF9L 1PVOA 4GN5A 4HV6A 1K8GA 2HZTA 1CF7A 3J81Z 4A3LG 3DLLA 4HLYA 3MQ0A 4YIIA 1DP7P 3KYHC 3SXYA 4YWMA 3ER0A 1A63A 1ZRDA 1CUKA 1X54A 1JJGA 4IF4A 3AQQA 3S1QH 4KHPL 2NRAC 1JE5A 1PH6A 1PP7U 4UPAA 4A3KH 3PF4A 4YFNF 3EQLF 1OYIA 4DR4Q 2STWA 1X3GA 1XCVA 4U88A 3GZ5A 2DBBA 3GFLA 4QLCU 2F5DA 2HQRA 5E7NA 5E8IA 1R58A 2XGTA 1N33Q 2A69F 5FO5A 3JAMc 4A93G 4GCVA 3ICEA 4HOBA 5IP9H 2FNAA 1ZREA 5FLXc 2UUAL 4CZZA 1G3YA 1D8JA 1T0FA 1YW8A 1CKMA 1K0RA 4NXML 1FBUA 4EM1A 2F2EA 1MIUA 4HV5A 3EDPA 1VQHA 4HIMA 3KJPA 3J80c 3HHGA 3T1YL 1XNQL 3DFGA 4N9HA 2KIUA 3Q8DA 3T1HQ 5D5XB 1QVCA 2EXDA 3IL2A 1A8VA 5D5UB 2WWYA 3E5XA 2HT1A 5K5RA 3I64A 3RZDH 1FBSA 3P9IA 2ZKZA 3VFZA 2FRHA 1USSA 3SZPA 3J80i 2YTVA 4HZFA 3K1MA 2E1NA 4A3EH 1VTNC 4AIHA 2FE3A 1R22A 4KHPQ 1G6PA 2UXNA 4CDGA 3K2ZA 2GZWA 3F6VA 4PZ6A 1ZAOA 1SROA 2JEAI 5F6FA 1HNXL 3U1DA 4JI6Q 3GTOH 1RIOH 1U5KA 1N33L 1U0LA 4NB3A 4A3IH 1B70B 5LRSA 2MLGA 4DKAC 2BE5F 3EIVA 1T98A 3M7GA 4H02A 1Z9CA 3F23A 5LGNA 1O3TA 4LFAQ 4UVCA 2PMHA 1WCMG 1N36Q 1E7ZA 1EH8A 4QL5A 4OX9Q 2QZ8A 1IXSB 4HLXA 5F1RA 3T8RA 5TRDA 1QUQA 3CQZH 3PO3G 1HZ9A 4JK1X 2OQRA 1VQAA 2VS1A 2ZTEA 5DCFA 1X65A 2PMUA 4HJ7A 1PH5A 3AEVA 3HTUA 1YS7A 3FHWA 3MFKA 1OTCA 1VQDA 4GLVB 1Z1DA 5CJ9A 3M85A 4B8XA 4M73A 2K75A 2R7ZH 2CG4A 1XDUA 4C2MH 1AE3A 4DV0L 3TO6A 3O3KA 1VQGA 1LM0A 3S16H 4AH6A 2E1CA 1MKMA 2QVOA 2E2HH 1IN6A 1I94L 4DR5L 3TO7A 4OONA 5C4XH 2XAJA 1YITA 1TTYA 2Q0OA 3KLNA 1YEZA 4XLPF 1BIBA 3BJ6A 1J9IA 5HVQC 4JI0L 3CCSA 1SMXA 1CKNA 2VQEL 4PGHA 3PF5A 1Q7YC 2KKOA 1RL2A 4LB6B 1KQ8A 4ESBA 3REOA 4IPCA 3CJNA 1FLIA 3J81c 4LFAL 4M6XA 2MNAA 4LUZA 2Q2HA 3FP9A 2OQ0A 3B73A 4JCVE 4DUYL 2HIXA 3GTJH 1I6XA 3UDFA 3ZN0A 2A61A 3ZMZA 1JMCA 5J6XA 2QBYA 4RG1A 3EN2A 3CPWA 4DV1Q 1KQSA 1XNRQ 1XMKA 4L5QA 1BJAA 1X3UA 2HHHQ 5LMUL 4PZ7A 3S14H 3MCZA 4OIRF 4UUVA 4PMWA 3ZMDA 5FLXZ 3K0LA 1WRJA 1VQ4A 2NN6G 4IJAA 5L3BA 2RHSB 2KIFA 3QP6A 3BJOA 5M3MH 2H5XA 3RJPA 5M5XH 2K27A 4O5VA 4GGGA 3E3VA 3JAMZ 4LJZF 2PI2A 4DR5Q 4DPGA 1HXDA 3Q9SA 1HNXQ 1Z47A 3K1NA 1XSDA 3PO3H 3OTOQ 3CDHA 2NVYH 4HQMA 4YCUA 2WV0A 3O6BB 1JE8A 1FY7A 2QEXA 3K7UC 5CVIA 1J75A 4BHCA 2VBWA 3RN5A 5DLQE 2VUMH 2OZ6A 1OXSC 4WK8F 4KIBA 1UE1A 3W1GA 1EYGA 3GD7A 1IXRA 5D4RA 4LB5A 4DAMA 4OO1G 4XTCS 1VQKA 3GW2A 2WC2A 4ZYDA 3KLWA 4WX9A 2YR2A 4HF0A 5E17F 4P72A 3K9TA 1XMOL 2FNPA 1QUQB 3H3VI 4I2OA 4HX8A 5C4XG 3TO9A 1S72A 4ESJA 2KJBA 1ASYA 4GYIA 4WXDA 2RCNA 4AIKA 1FJGL 3DPLC 1E3PA 5CVVA 3RNUA 3JAMi 4ASNA 2D1VA 2DU9A 2A8VA 3IRQA 2AS5F 4HF1A 4DR3L 1WOCA 2Y0SE 1MJCA 1FYKA 1TWHH 2JRTA 4UVAA 2Z9OA 4QJFA 1MD0A 1GD7A 1NMFA 3E9IA 3RPUA 4WXHA 1MJ9A 4A12A 4L0ZB 3KFWX 1ZHFA 2QUFA 1R5GA 2JA8H 1FX7A 2QENA 3KCCA 2QQ9A 1GM5A 3KP4A 4HJAA 5IT3A 4QIWE 2UUBQ 1NJIC 2XROA 1W7PD 4HAMA 1T2KA 4U7DA 3ELKA 4AWXB 4A6DA 4IOAA 5LMNQ 3CTAA 2M87A 3NELA 4BNCA 3DQVC 3CP0A 2F4VQ 3I2ZA 3HOYG 3M8EA 1PDNC 5C0XI 2WB1E 3QPTA 4IPGA 2UXDL 5AJ3Q 3FX3A 4HW0A 3QPHA 1KU9A 5AIQA 1BBWA 1MGTA 3EBEA 4GKJL 4KIGA 5M3FG 1T38A 3SZTA 3LA3A 2QWWA 1LJ9A 2LF7A 4DR7L 1U3EM 3I7FA 1BC8C 2HEOA 3KJOA 2X4HA 4RGXA 1UE6A 5KK1A 2B63G 5E18F 1T6SA 3ZMUA 4OWWB 2FBKA 1BI1A 1XGOA 2A3SA 2HTJA 2KCTA 3TS0A 4GNXC 3JTHA 2JPBA 3C1DA 1T39A 1FC3A 5JI6A 3PUZA 2R93H 1TWCH 3GTLH 2OTJA 1RNLA 1A04A 3WTUC 4PDKA 3SFZA 2JSCA 4JOIA 3JW4A 1P4AA 2DQLA 4IRHA 4Q5SF 1S8NA 3UDIA 2JA9A 1HW2A 3R4KA 2F4VL 1JB7A 3CCRA 4JBJA 4Q47A 4DV3Q 3J7AO 2K4KA 3M4PA 2ETHA 4NXNQ 4DR7Q 4RAZA 4I98B 1O3RA 2Q2TA 4P9UA 4PG3A 4EJTA 2QBYB 3RYRA 4LF8L 4JI0Q 4DV5Q 4AIJA 3F8BA 5LGTA 4S04A 3S2DH 4PZ8A 4L9VA 2BA0A 2R7ZG 3T1YQ 4YY3L 4S05A 4C3JH 1Y1WH 3CF5A 5E20A 2MO0A 1W4MA 3RYPA 3IHUA 3WU1B 3E6MA 4DR6Q 1IN7A 1G6NA 2E5LL 2KHIA 1UE7A 1VQ5A 3E97A 2P5VA 1SMYF 3H3VH 1VS0A 2P7CB 2I5HA 4DR2L 4ENNA 4KNYA 1OYYA 2K02A 2IT0A 5LMUQ 1X56A 3C18A 5E1ZB 3EETA 1KL9A 5J3BA 2RDPA 3WTXC 3L2PA 4B3TL 4UNOA 2K50A 2HQLA 3M8FA 4B3SQ 4WJ3M 2IX0A 2CW0F 1QVFA 3AFPA 1U5TB 1JT8A 1YJNA 1J5EQ 4L9NA 4L9JA 4X62Q 3DPTA 3W5OA 2H94A 4OINF 4U0YA 1ON1A 2ZNZA 1XD7A 4M72A 3E5QA 4P71A 2UU9L 1HSTA 3PUXA 3FKIG 3U2RA 2PI2E 5C3EG 3PO2G 1Z91A 2LXKA 1S40A 4ZH4F 3EYIA 2F5CA 4DNIA 1VQ8A 2P7VB 3G71A 3BOQA 4KICA 3ML6A 1I1GA 5FD6A 5HDNA 3ZN1A 1FYMA 1V43A 1KAWA 1QZGA 3GTPH 4CO8A 3M3YH 2N49A 5LHHA 4DV7L 4HJ9A 1BC7C 1TNSA 3CC4A 2UUCL 3TGNA 4JI2L 4JBWA 4LMYA 3FMRA 1BI0A 4I02A 2VL6A 3CUQC 1L0WA 5FJ8G 1ZG3A 4O6JA 1UE5A 2AWOA 4HYEA 1FOKA 2ID0A 4DUZQ 1JGSA 1XSVA 1LVAA 3HOXH 2DGYA 1ONVA 5K5OA 1TWAH 2UXXA 4KIFA 4DR3Q 1FP1D 4IFDI 3E6BA 3I4MH 4OX9L 2FXAA 1N9WA 1GXPA 1HNZQ 4U7BA 3UDXA 1HZBA 3I56A 2UU9Q 2DI3A 4KN7X 4GOPA 3BP8A 3NEUA 4MHGA 2HDCA 3UDGA 1Q82C 2P4WA 3F21A 2V1UA 2O6GE 4JI4L 4P75A 1TW3A 4DUYQ 5M5WH 3I4PA 2E2JH 2RC4A 4LF7Q 1PHJA 2RN7A 1I3QH 1SD4A 2JEBI 2P5LC 3F8CA 3GZ6A 4LF4L 4B3TQ 3TRZA 5DYMA 1EH6A 1K8AC 3CCLA 5IP7G 1B59A 3T0YA 1VQEA 4LD5A 5C3EH 1RI7A 3F8NA 3ZMVA 4X62L 3J80Z 3HOYH 1P4XA 1O3SA 4ME3A 4DV4L 4H0EA 2D1HA 3DEUA 5HOOA 4UVBA 3QU3A 2JTVA 2I5LX 1PUEE 5DCMB 4EM2A 4HX7A 4I09A 4M74A 2M5WA 4YCWA 1WI9A 1YBYA 2CWAA 1O57A 4GLXA 1VQ7A 3S2HH 4FHTA 2CFXA 1ZLKA 3H15A 4OU0A 3MEXA 2W57A 2LSSA 5DUIA 4DV2Q 2CKZB 2RVCA 1B9MA 1YNXA 3WWVA 1XPOA 1W7PA 2ATWA 2N8NA 3HOWG 1U5TA 3JC66 4KFCA 1IZ1A 3PO2H 3FMSA 5H6QA 4I7HA 4GYGA 4A5NA 3G48A 3T8TA 1LB2A 4IRIA 1IF1A 3K69A 4R1JA 4A76A 4Z2YA 1LTLA 1KYWA 2Z99A 2H6BA 1LEAA 3MZYA 5FLMG 3ROUA 3E0EA 4A3CG 4A3DH 1TQPA 2VC1A 1PYSB 3WG9A 4R79A 4JC0A 3B02A 5JJIA 2PJPA 2ZJRA 2R92H 4G7OF 1Z9FA 2IY5B 4LFUA 1D8LA 1V1QA 1IXRC 1VQCA 4KMFA 4DUZL 4M6YA 1SFXA 1E22A 1TW2A 5DD8A 1ZARA 1FBQA 4UY8C 2JA8G 1Y14B 4OWXB 4EGYA 4A6EA 1HJPA 3BROA 1W3SA 4NXMQ 3A5UA 1O3QA 4UV9A 3K0XA 3OV8A 3U50C 3E6DA 3OTOL 5BQTA 4LG0B 2BGCA 2VONA 2EB7A 1QVGA 1XMQL 2NS0A 1ZGJA 3AFQA 5DDGA 1K83H 2Q2EA 4WXCA 4BY7H 4NQWA 2JT1A 3DP7A 3U9GA 5GQOA 4G7ZF 1ZN2A 2XV4S 2VZAA 2K5VA 2I0QA 4DAYB 4DQ2A 2EWNA 2IJLA 3ULJA 3MEFA 3BZ6A 5D5WB 5IT9c 2QGQA 2D2WA 3I5UA 1QZZA 3DF8A 1A62A 3E9HA 3V8JA 3L0OA 4QQBX 2HFHA 4GOPB 2WTEA 1X6OA 4RGSA 4IPHA 4WWCA 5BPDA 4JYAQ 4QGUA 1J5EL 5LHGA 1OMIA 5IP9G 4X65Q 3LAPA 3WODF 4BHBA 2PQAB 3GFIA 1B6AA 1I5ZA 3ZMSA 1IW7F 2YU9H 2BBYA 2L4AA 3ULQB 3HOTA 1QGPA 1Q12A 4EJUA 4A3BH 3KF6B 1BBYA 1Z05A 2JJQA 4X66L 2F5FA 2VE8A 1S6LA 3EYYA 3OOPA 2KBNA 1RIPA 1SFEA 5LMNL 2L15A 1K6OA 2IA1A 3GO5A 3RI4A 2NVTH 2VODA 2UXDQ 3V8LA 1W5SA 3FHZA 2XTIA 4R4CA 2UUBL 4BBRH 4JI1L 1WQ2A 4JI5Q 1KU3A 3GVAA 4OIOF 3PFIA 4BHPA 1UHMA 2G9WA 1EUJA 4CHUA 2QYOA 2QQBA 2B3GA 4YWLA 2STTA 4IO9A 3K1PA 2CSOA 1VQBA 1SD6A 5BS6A 4U0VA 1D5VA 2RNJA 3JAMK 1R1TA 4JG2A 5ICFA 3KEOA 3NQOA 2ZJQA 1Z6RA 5AJ3L 2BH8A 3L9FA 3GFJA 4G7HF 3VDYA 1NHAA 1E17A 1HH2P 3PCOB 3ULLA 3BJAA 2HIVA 2VQFQ 1L1OB 4KN4X 4RAYA 5HY6A 2VN2A 3S2WA 1DPRA 4YG2F 3ZQ7A 3HKSA 5JR3A 1FSHA 2Y0SG 4NXNL 4KA4A 3BZKA 2W25A 2VE9A 2FA5A 5FFXA 1HZCA 3CPFA 4KDPA 1SLJA 1XMQQ 4LF5L 1YIJA 4LG0A 5JJLA 1Q1BA 2PMZE 4BA2I 1P6RA 2XHKA 1J2XA 1F1ZA 1LDKB 5H20A 3KP6A 2Z6KA 1MKHA 1NMGA 4CGZA 5CLSA 2LSOA 4EM0B 2KJCA 3T5XA 2FSWA 2CCZA 1X9NA 2YPRA 5HDGA 3GFMA 1I50H 4OO1I 1SMTA 2R3SA 3PV0A 1E24A 1L2FA 4KYWA 1QNTA 2A5YB 1DDNA 3UE1A 3I0TA 2IA2A 1YFHA 2UXCQ 5IWAQ 3N4MA 2V6CA 2EK5A 2P8TA 4L5IA 5LHIA 5EAYA 2OCEA 1RUNA 4L18B 4YY3Q 2DUDA 3I59A 3HOVG 4EQ5A 2FMYA 4RMFA 2TDXA 4I0AA 5HS9A 2F5EA 2P6SA 3MWMA 4HIDA 3RKXA 1WWXA 1WSUA 4P96A 4U0WA 3U58A 4JI5L 4FT8A 3SGIA 4A3BG 2EA4A 5HLHA 4ON0A 2PEXA 2XRNA 1LDJA 2EJRA 3L09A 4Y17A 2JA5G 4RB2C 3P7NA 4X66Q 3WTSC 1TWFH 1YO5C 5EEGA 3CAMA 3KF6A 4JI8L 2Z3YA 3ISPA 2MH2A 1H0MA 2CFMA 2E2IH 1WJJA 3VB2A 3KDFA 2XAQA 4Y13A 2CGPA 2K5HA 2EIFA 1GO3E 3KE2A 4BXXG 4TV7A 5IT9K 3F2DA 3PGZA 1VQMA 2A07F 3DKWA 3WTZA 3G3ZA 5GADC 1VQPA 1BI3A 1K3RA 3KP5A 1PH4A 3IC7A 2XVCA 3FXUA 1H9TA 2KIMA 2LNBA 1KQ0A 3WGHA 4NHJA 4MTEA 4DV1L 1XNRL 4AIMA 3HRMA 1K9MC 1Q1EA 3S1NH 2NVXH 3LWFA 1GVPA 4DR4L 2ESHA 1FWZA 3AYHB 2ZNYA 1QZYA 1KD1C 4A3IG 4CICA 2IA0A 1IN5A 1T9HA 5ELOA 3GX4X 4JI7Q 4DNCA 1GXQA 1IBLQ 2VT2A 1KXLA 1JXSA 3CMAA 4APVA 4GLAC 3VOEA 4BY1G 3SHFA 4N9IA 1XSXA 2EA2A 2E7XA 3RIRA 1DGSA 1AE2A 3PUVA 4XLNF 1M1KC 4KMUX 3QOPA 4M9XA 2XIGA 3J81i 4GKJQ 3LGJA 3W6KB 4A3FH 3VODA 4LF7L 2DPUA 4B3RQ 2JA6G 4GNXB 4YHHL 4JI3Q 2IVMA 2WAQG 5AIPA 1UEBA 3H0GG 4YFXF 4A4IA 3ERSX 2AHOB 2Z5UA 1F9NA 2RHQB 5K1YA 5ED4A 3IWFA 1CSQA 2O8XA 4OXPA 1D8KA 1LYLA 1HR0W 1EV7A 3R60A 5C0XJ 3W1BA 1QO0D 2JA7H 4JI4Q 2Q2IA 2ZM6L 3I55A 4KT5C 2FMLA 1V9PA 2HHHL 1BI2A 3HTSB 1L1OA 2IW5A 4LF6L 2L54A 2ESNA 3HIFA 2OAZA 2EQSA 2YU3A 4LWCA 4JI6L 2GQQA 4A3MH 1X3EA 2GWRA 3RTRA 5ICCA 1P4WA 2MC3A 2GVBA 1G3SA 1B8AA 3CO6C 4LLLA 4RB3C 1IBLL 4RS8A 5ILVA 4IJHA 4HIOA 2DQRA 1Z7UA 4MNOA 4HF2A 1EQQA 4KUMA 4ZYHA 1GKHA 1L1OC 4WJ4A 4LW1A 4X64Q 4IPAA 1Y1VH 4I01A 5ICEA 1KU2A 2QLZA 2OWOA 4GN4B 1YHBA 4DK3C 2DLLA 1VCIA 3W6JB 1UWVA 1OPCA 1VQ6A 1O7LA 5L3GA 3S15H 1E2XA 2OQGA 4B3RL 2NNNA 2XGXA 2ZFWA 3HOXG 1KRSA 2WFWA 1IYJB 1SN8A 3OYYA 2NZHA 1YJWA 4IRGA 1XNQQ 5HS7A 4EV0A 2GN5A 1I1SA 1IAWA 1B9NA 1R00A 3DM3A 4L0YB 2MD5A 1SD5A 2R7DA 1LUZA 5BMZA 1ULYA 1WCMH 2KHJA 4Q48A 3I4OA 3TS2A 2J5PA 1JJCB 2K52A 3GTGH 1ODDA 3H92A 1U78A 1ON2A 1I94Q 2DK5A 4M9SA 2IT1A 4LFCQ 3Q9VA 2Y48A 2K5NA 3RLNA 2V79A 2Z33A 4M9ZA 5CYVA 1C0WA 4A3CH 4A93H 1KGSA 3KZYA 4JV5Q 4LFBL 4A3GG 4DV4Q 4M71A 2AMCB 3WTTC 5ICGA 4BQAA 2EFOA 3F8MA 1STZA 2BH2A 1ZGAA 4MTDA 2EV0A 1Q86C 4A3KG 2ADUA 3F2BA 1C0AA 3WE3A 1OKRA 2J5OA 2ZJ2A 4WCGA 4IHSA 3H0GH 2C35B 4BYYA 4GOPC 4R4TA 4IFDG 4DR1L 1VQ9A 2ISZA 3MXNB 4AQYL 2G7HA 2F52A 3ABUA 2HS5A 1ZRCA 3WGGA 4JI8Q 4TQUS 3F3XA 3R0JA 2QA4A 5IYBH 5LGUA 2ZM6Q 4EJWA 1H9GA 1U8RA 1REPC 4JBMA 4YCVA 2COMA 2EFPA 1YIOA 4IPDA 4BA1I 1W2BA 1YW7A 2UUCQ 4L5TA 2ZCWA 4BY1H 3CC2A 1QQIA 2NZOA 2XAGA 4I0BA 1KHIA 3KEQA 2EFQA 3G73A 1LNWA 1QZHA 3BPVA 3DXJF 2D62A 4K2EA 4AQYQ 4R4OA 4BBSG 4OIQF 2KCMA 3M9AA 4GKKQ 1I6HH 2VBZA 3TOAA 3K80C 1UCRA 4L9TA 3CUOA 1VQIA 2IP2A 4Y52H 2VY3A 1CKNB 2E8GA 1PA6A 3M4OH 1JJ2A 4HJ8A 1EWIA 3A74A 2PLYA 3G4SA 3V7RA 2A19A 5GAGC 3STBC 4HBLA 3V7CA 2RGVA 2MA3A 1V3FA 5D8LB 3IKVA 1P92A 1EH7A 1KA8A 2KENA 2MQHA 5J8FA 2UXCL 3CO7C 5L3FA 5D6FA 4FX0A 1B7YB 2ES2A 2EFWA 3HHHA 4BBRG 2D0OA 3CLOA 1XJVA 1HQCA 1E1OA 1NTGA 1N36L 3CCEA 5IYDH 1KRTA 2L3DA 5HLIA 2R93G 2QQAA 1DUXC 3PSIA 3HOVH 4MZ9A 2OD5A 4DR1Q 4C3HH 4HDVA 3BWGA 2UZKA 1ZH5A 2R6GA 3GTMH 4ENKA 1G4DA 3T1BA 4BXUA 4JBAA 3HFZB 2K4JA 2AWNA 1Y0UA 4GKKL 5IYCH 2O0YA 4KLKA 4HIKA 5EEHA 1VQNA 2YX4A 1XPUA 2GA2A 1XDSA 2OZUA 2DT5A 4AYBE 1HR0L 3IRRA 5IT9Z 4RGRA 1UFMA 5GROA 2PI0A 2VT3A 2WAQE 4XRFA 3HOZG 1K78B 3A5ZB 1NY4A 1B1BA 3ZP5A 2FF4A 1IBMQ 3PQJA 4OMYA 4B3MQ 2RF4A 4FDBA 1Z6TA 2XUBA 5JEAG 4A0YA 3HOSA 4PCQA 2Q8KA 3CCMA 2RKHA 3LA2A 2HYFA 3R6SA 1Q81C 1TLHB 1USTA 2ALYB 4G94A 2O3FA 1YS6A 3FM3A 1RZ4A 1TQIA 4MTNA 4BBSH 3S24A 1HKSA 4ENMA 1HSJA 5HGQA 3LQRA 2Q2UA 2FU4A 4O0AA 1ZG1A 2EFNA 4XIGS 1S7OA 4ZYEA 1ZYRF 2HKXA 1CKOA 2Y75A 1YHAA 1W5TA 1WKMA 3GF2A 2JPCA 2AKWB 3M7NA 3PQKA 3I54A 1IZ6A 2DO7A 4A3FG 4POFA 1BKBA 4P9FA 3HRSA 3HKZE 4EMSA 1S3OA 4KI0A 2N3SA 3TOBA 1TXYA 4LFBQ 4IXAA 1YG2A 2CYYA 1A0IA 1YQAA 3CW2C 3T1HL 4DR6L 3ECOA 3BPXA 2FXQA 4GN3B 1CGPA 1FT9A 1QPMA 2JA7G 1P8LA 3AAFA 4UP9A 3SQNA 3F8TA 5D8KB 1FYLA 4ETSA 4ALPA 2L02A 1J59A 3S1MH 2BYVE 2IPQX 4A3JH 4A3GH 5D6EA 4OIPF 2ZJPA 3KP2A 3I4NG 4L5JA 4WF2A 3KF8B 1G51A 1FNNA 1EIFA 4AVPA 1VQJA 1X3FA 2P6TA 3GUDA 2O61A 1MJEA 3C3WA 1UHWA 1YTYA 2WB1G 4BXXH 3HKZG 1D3YA 1N34Q 1D7QA 4C3IH 2W24A 3STBD 1BN5A 4B3SL 5A2QZ 1OR7A 1Q46A 2HYGD 3HYIA 2C6YA 3CXCA 5FLMH 5JJKA 5H1SE 5FJ8H 1SFOH 5M3MG 5CVJA 1M90C 4RB0A 3H3UA 3F8FA 5FGMA 3CCUA 3J81j 3RZOH 5IY0A 2YV5A 1J7KA 2RV8A 2YTYA 4OWTB 1J6QA 4G9YA 3PUWA 1FSEA 1U6GA 2KRFA 2PQ8A 3VEPA 4CXFA 2YYZA 4G8XA 3L2CA 2N78A 4LF8Q 3BY6A 3D31A 4YFKF 4J15A 4HDUA 4MEYF 4GS3A 4O3MA 4LF6Q 1SD7A 2K7LA 1K78A 2VQFL 3CCQA 4IVNA 1HW5A 1N34L 2FOKA 1JHHA 2HOEA 1IN4A 2XASA 4XBFA 4TVAB 2Z0SA 4GO1A 4Q4ZF 3L7WA 3LAJA 5ELNA 2GIVA 4A0XA 1PH8A 3WTWC 5LRRA 3ABTA 2A6EF 4LUOA 4G6QA 3KP3A 1J0RA 2UXBL 1TQMA 1P16A 4POGA 5BR8Q 4DV7Q 2EV5A 3NBHB 5H6RA 5E8GA 1O7IA 3BU2A 4DV6Q 2W85A 2Y0MA 2A1AA 4UV8A 2ZXJA 5BPIA 2MFIA 1K79A 3CCJA 2OU2A 2OQKA 4K0KL 1Q8KA 4P5OA 5JHUA 4DK6C 2B29A 3TREA 2EV6A 1WFQA 1XTDA 1YYVA 3CUQB 1WI5A 2ELHA 5FB2A 3KETA 4EJVA 3HOWH 3CCVA 1LDDA 1EQRA 1FL0A 2ZTCA 1FZPB 5IYCG 2M45A 4AD9A 4A3JG 4FX4A 1S29A 2V1CC 3H3ZA 2HKOA 2YSRA 3F72A 3K81C 1YHQA 1NE3A 5K36G 4R8HA 5C4JH 1Y1WG 1HNWL 4JV5L 5BR8L 1R1VA 5CVUA 2ZMEA 3V7SA 3MAJA 1Y1VG 3QRFF 5BOXA 5L3CA 3HOUG 3GTQH 1C9OA 3HSRA 1F4KA 4IFDJ 3CC7A 2LKPA 2YX7A 1HKTA 5IP7H 2MO1A 4X6AH 3N97A 2CQKA 3I59B 1IBML 4A3MG 4Y15A 1ZG5A 2UUAQ 4B3ML 3UE0A 2NVQH 4R4QA 4O2DA 2GXGA 1TNTA 3E6CC 2V9VA 2XAFA 2F3IA 1MJAA 4E70A 3NENA 2VXZA 3LFKA 3FXQA 1KQ9A 4DV2L 4HA8A 4YWKA 4X64L 1YLFA 3MZHA 1VQFA 5HDKA 1SR3A 1U5TC 3GYHX 1AOYA 5C44G 2XAHA 3FKIH 5J8CA 3WTVC 1FVIA 3ZJYC 3PUYA 4LF5Q 1SAXA 3V8KA 1ZLJA 2V1XA 3QP5A 2WP8J 1XMAA 2A68F 2FBHA 2ZO4A 1KYZA 4JBKA 1I5FA 5LEJA 5GAEC 2VUMG 2H6CA 1UB9A 4A75A 2L01A 3KDFB 2JA6H 4ZYGA 3F22A 1PYBA 3TDUC 2FQ3A 2V1DA 3U4VA 3NEMA 5FLXK 2NYXA 1XMOQ 4OMZA 4P55A 3I71A 5C0XG 5C44H 1X55A 2DAOA 1YJ9A 4ESFA
chains in the Genus database with same CATH superfamily
1PH7A 1YNJD 1TWHB 4B3XA 1K7AA 1X2NA 1I4GA 4UB6C 1DPUA 3M1EA 3TDZC 5GADJ 1QBJA 1EY6A 4XK4A 4ENJA 1VQ6I 1HTLD 3D4RA 1ZYRD 1VQOA 1MZBA 4IOCA 4HCSA 1WHUA 4MQVA 4A5MA 2M1BA 3LX0A 4BH9A 1BCPD 5DV5A 2M8EA 1TBXA 4XSXF 3S17H 1XGSA 1BOSA 3CMMA 2VKHA 1KIXA 3QAHA 2FJ1A 2ZJQF 1EF4A 3C1EA 2CQ7A 2G0EA 2RDGA 2VW9A 2FMMA 2E5LQ 5IPAA 1JOOA 4A3LH 2DW4A 1IXCA 3V96A 1KC8C 4IO9F 1QVUA 1W7PB 4LNQA 2LF8A 3CMEI 1EIHA 3RPQA 4LK1F 2W48A 4UHTA 3G6EA 4A3EG 2CWPA 5JAVA 3ULPA 2PBIA 4D1QA 5EYRA 4CCLA 5CBAE 5LBQA 5FROA 4DNTB 3IWZA 1V1OA 4JI1Q 3GTKJ 1TWGJ 1SYCA 1IL2A 2LLKA 1MDMB 1X19A 2I10A 5J39A 2NNYA 4MNUA 1R23A 1SRUA 3KYDB 2AQ1B 3SEZA 3FMQA 4RBOA 4N0BA 1D0XA 3RLFA 3RDIA 5EGOA 2ZMEB 5CV7A 5D5VB 4NPSA 1TWGH 3OL3A 3TP0A 3PIPA 4LUVA 1C7YA 2DMPA 2LDUA 1B4AA 1ZYRC 2F0TA 3GBGA 3I4NH 1I3QJ 3HRUA 4OEMB 1N32Q 4AIDA 4RGNA 3ZPLA 2OTLI 1TT0A 2KP6A 1W0TA 5EG0B 4XSZF 1HXYD 1PH9A 3RQIA 1R1UA 3MEHA 3OW2A 4GXOA 3PL8A 3H0DA 3MKWB 1UEAB 5HLGA 2FEZA 1LFPA 4BBSB 3PIP3 2EJMA 4ULLA 1R9TH 1EOVA 1ZRFA 1ZQ3P 2H09A 1WZ2A 5DEQA 3GLXA 2JZYA 3RKWA 4DAPA 1VQLA 3JRAA 5DS9A 1L3LA 2QSGX 5CORA 2WY7Q 3KZZA 2ISYA 6PAXA 4JK1C 1GDTA 1R5HA 4R4IA 4CZCA 4JPBW 1IDZA 1HW1A 3BTLA 3H3VC 1EY7A 2DOFA 4H7BA 3HUGA 1TWCB 4BE1A 5M5WB 2XNAC 3RN2A 3CCVI 2KOLA 1LEBA 2VBYA 2W1OA 2PN6A 4XLFA 5EGOB 1WTOA 3M9BA 3QOJA 1HNWQ 2E7WA 2ZTDA 1QCBD 1RESA 3I4MG 4D0PA 2H27A 3OR1C 5KVRA 4GNXA 4QY7A 1EFWA 4RWSC 3EUAA 4B1RA 1WJDA 1BBUA 2R7RA 2RDFA 3KLSX 5IGEA 5IYBG 4DV5L 1F5TA 4Y7NJ 4LF9L 1H9KA 4HV6A 2HZTA 4II2A 1KDAA 1DP7P 2BDOA 3FMCA 3KYHC 1EFID 1D0ZA 1CUKA 5IY5H 5F04A 3S1QH 1JE5A 4HEA2 4A3KH 4IZ8A 2ICIA 3NHHA 4D7NA 2EOTA 4OL7A 4NQWB 1JC7A 2F5DA 5E7NA 1R58A 5FO5A 3CCMI 3JAMc 5HNFA 4HOBA 5IP9H 1G3YA 1MMGA 2BW3A 1K0RA 1MIUA 3DKXA 4MTKA 5M5YB 1TL8A 3QO2A 2KIUA 1X3QA 4UUSB 2B2UA 3T16A 4HNTA 5K5RA 5EKLA 2YTVA 2E1NA 4A3EH 4AIHA 2FE3A 1G6PA 2UXNA 4OHJA 4CDGA 3A8IE 3K2ZA 1A36A 2NXNB 4HNUA 3QYBA 1S5LC 1SROA 1E0BA 1M4VA 1STHA 1HNXL 2LG4A 2DA5A 3V42A 2K32A 4A3IH 1D1AA 1JWMD 3K5OA 4BY7J 3M7GA 2XF5A 3UKGA 4LFAQ 4UVCA 1N36Q 3S14J 4BQQA 4HLXA 3PO3G 3K4LA 2VS1A 1HUMA 2PMZA 5DCFA 3A02A 4IUVA 4HJ7A 1YRNA 1H8AC 1Y1WB 3I3CA 1OTCA 1VQDA 4GLVB 1Z1DA 4B8XA 1SBBB 2Y2ZA 4DV0L 2L7FP 3TO6A 1C4QA 4AH6A 2E2HH 2Y31A 3TO7A 2IXSA 2J7ZA 1CKNA 2VUMJ 2VQEL 4PGHA 3HBLA 3S9WA 1G8XA 3PF5A 2XB5A 3A0BC 4CCNA 3CJNA 1IGNA 5KEEA 1V1PB 2MNAA 3L3OC 2OQ0A 3B73A 4DUYL 1I6XA 5J6XA 1XNRQ 3EN2A 1SFKA 5IP6A 4OIRF 3GTQJ 4UUVA 4V190 3TN2A 4IJAA 4DA2A 1X1CA 2NTSA 2RHSB 3V2TA 1W1WE 2KIFA 1H9SA 4IEJA 2EIMH 3RJPA 4O5VA 4GGGA 3E3VA 2KCCA 2PI2A 4CYCA 4DPGA 2F0OA 3KK7A 3Q9SA 5C44B 1Z47A 5BN3A 3NWTA 3K1NA 3PO3H 2LBFA 2CV0A 3CDHA 2AUKA 4NDXA 4YCUA 1JGGA 3K4JA 4ZKBB 3K7UC 1H88C 1U8BA 1JTYA 2OZ6A 3OYKA 1OXSC 3WDNA 4KIBA 3W1GA 2B2TA 3G1MA 3GD7A 2PZTA 1IXRA 5D4RA 4OO1G 4DAMA 1VQKA 5DM63 3GW2A 2WC2A 3KLWA 2CW0D 2YR2A 5E17F 5TISC 3DEWA 4DF7A 3S1QJ 3S2DJ 1XMOL 5ISRA 1U9NA 2FNPA 1QUQB 2NS7A 3MAQA 3OYMA 3TO9A 2E2JB 2KJBA 2HQEA 3DEOA 4GYIA 2RCNA 1FJGL 1E3PA 4H13C 1BBXC 2NVQJ 3DBRB 1JUPA 3RNUA 5K7FA 1BCPB 2AS5F 1VQ8I 2Y0SE 1HQRD 4HPQA 1GD7A 1NMFA 2Y30A 2LY1A 4WXHA 4PSWA 4A12A 2HUGA 2RSOA 3KFWX 3BDLA 2JA8H 3LFUA 2QENA 2QQ9A 1GUUA 2WB1N 3BTJA 4FE7A 3KP4A 5IT3A 1CTMA 2UUBQ 1EY8A 3G7LA 1HUNA 1R71A 3ZR8X 4CJ2C 2XROA 1W7PD 1L0YB 3B6CA 4A6DA 1ICWA 2F4VQ 1EU3A 3QPTA 1BBWA 1KU9A 1MGTA 3EBEA 1LT5D 1J8IA 3OYLA 4X3SA 3K4MA 2E2DC 3TS0A 4GNXC 3C1DA 1T39A 5JI6A 3X3MA 3GTLH 1A04A 3HG9A 2LP0A 1STNA 3WTUC 4PDKA 5A35A 4IRHA 2FOWA 1S8NA 3C2GA 2EH3A 1HW2A 2F4VL 2TRTA 1JB7A 2LBFB 4JBJA 3AG3H 4XLHA 2K4KA 4J8QA 2ETHA 2M34A 4I98B 3OS2A 4KISA 4EJTA 3O8HA 2XGCA 3I4MB 1QA6A 1ENFA 2BA0A 3CCQI 3DU6A 4S05A 3GTJB 2KZVA 3CF5A 5ELCA 3P75A 3E6MA 1G6NA 3HOVJ 2E5LL 3U9SA 2K1BA 3E97A 1SMYF 2XN9C 1VS0A 5J1UA 3Q3SA 2W00A 1TKWB 4ITVA 4KNYA 2V4JC 2WKDA 2JA8B 3TL4X 1X56A 3C18A 2HOTA 3EETA 1DXMA 4UNOA 2HQLA 2IX0A 4C3JB 1LE8A 1JT8A 2QKMB 4X62Q 3DPTA 3MKYB 1ON1A 1GV5A 2ZNZA 3CCUI 4M72A 2R4GA 1CA5A 5C3EG 2FHTA 1S40A 4ZH4F 5C4ZA 3S3MA 5M9OA 1RETA 5KHDA 1I1GA 3ZN1A 3ESWB 3WOEA 3GTPH 1PLFA 3M3YH 2MSYA 5LHHA 4HJ9A 1ZK8A 2H4OA 3TGNA 2KQ3A 2ZXHA 1Y8NB 1V8QA 1SAUA 2PCFB 4DUZQ 2LR8A 1LVAA 3HOXH 3L2QA 1IW7C 1FP1D 1SXTA 1HNZQ 3I56A 4C2MB 4GOPA 3UDGA 1Q82C 3M3YB 4PFPA 1SVOA 5M5WH 3G1LA 3LSIA 1PHJA 4C3JJ 1ET9A 1I3QH 1SD4A 2F0MA 1QWYA 4K6LA 5DYMA 4IKFA 2XB0X 1BXTA 1MMDA 4B47A 5IP7G 2NTTA 1B59A 5C3EH 5J47A 1RI7A 3F8NA 4AU7A 2LS01 1O3SA 4DV4L 5M3MB 2D1HA 4YEJA 2JTVA 4XRMA 5DCMB 4HX7A 4I09A 2QKIC 2DT6A 1YBYA 3S2HH 3TW6A 2CFXA 5K5PA 1ZLKA 4OU0A 4DV2Q 2FX0A 1V5EA 1PTOH 1IKLA 1B9MA 1WJ5A 3FXJA 1E2VA 5H6QA 4GYGA 3T8TA 1LB2A 1IF1A 1OQYA 1LEAA 1VI0A 3DBHB 3E0EA 4A3CG 2L7ZA 4ZDOA 1EEID 2PJPA 2ZJRA 3C2BA 1GXDC 2R92H 1CHPD 1Z9FA 4XN0A 4KMFA 1SFXA 1E22A 2GIZA 1TW2A 1W36C 4A3FB 2E2JJ 2JA8G 1Y14B 4OWXB 3Q0AA 2CHBD 2LVSA 1HJPA 4NXMQ 4O1NA 3OV8A 2BGCA 1XMQL 4E4HA 1ZGJA 3AFQA 5DDGA 1X1DA 5FOBB 4NW2A 2XV4S 2VZAA 2K5VA 1STYA 2I0QA 4DAYB 4DQ2A 1PYVA 4K8JA 2L11A 2L7KA 5IT9c 1QZZA 2R5YA 3CRLC 2EIKH 3L0OA 1Y6IA 4GOPB 2EBIA 5BPDA 4QGUA 2WV6D 1DU0A 1GT0C 1OMIA 1VQKI 3LAPA 3WODF 3UI2A 4IUNA 3HJEA 1VQ7I 2L4AA 1QGPA 3QYEA 3IFDA 3G2BA 4A3BH 3P1HA 2JJQA 1Z6HA 2VE8A 2PJRB 4X66L 1TVXA 1VQPI 3VSLA 5LMNL 2L15A 1K6OA 1GV2A 2LFNA 3RI4A 2NVTH 2VODA 3FHZA 2C9OA 1UNSA 4NKLA 5CV9A 4JI5Q 1KU3A 4OIOF 3PFIA 4BHPA 2OPTA 3QIAA 2QQBA 3CQZB 4M3FA 2CSOA 2RNJA 3JAMK 2R61A 1B44D 3NQOA 2JVHA 3DLAA 1Z6RA 1S5ED 3EJIA 3GFJA 1BDOA 4ZTFA 1XTCD 3PO3B 4IUTA 4XKWA 4KN4X 1WTWA 2OV7A 4BS9A 3Q23A 5HY6A 2VN2A 1JKQC 4HG2A 3ZQ7A 4RAGA 4KA4A 4S3SA 3BZKA 2FA5A 4XLCA 1HZCA 3CPFA 1WH7A 2MHVA 3ERMA 1YIJA 3CD6I 1AKHB 1Q1BA 1T0FC 3PNTA 4F8MA 4CGZA 5CLSA 2LSOA 2KJCA 2VKEA 3SEQA 1X9NA 5HDGA 3QPLA 1SMTA 1MBJA 1X1AA 2PW5A 4KYWA 1AA7A 2A5YB 1DDNA 1V1PA 3I0TA 1YFHA 3HGGA 5G3LF 4IUPA 2R5YB 1B3QA 2OCEA 4L18B 4HTHA 5F0FA 4KK7A 4N9PA 2M8GX 2F5EA 3MWMA 1MBYA 1WSUA 4U0WA 1WTRA 5EGTA 2E71A 3K4NA 1LO5D 4ON0A 5A2QE 2XRNA 4Y17A 3L09A 4NNJA 1N75A 3LL7A 3WTSC 1PZID 5EEGA 2Q2EB 3VYSA 4JI8L 3L2RA 2Z3YA 3HEJA 1WJJA 4Y13A 3OPOA 2EIFA 1E2ZA 4NMZA 2QA4I 3TDQA 3K59A 3WTZA 1BI3A 2XVCA 3AG4H 3FXUA 1H9TA 1EU4A 3LMMA 1XNRL 3HRMA 1QILA 2P0WA 3GCMA 1Q1EA 4DR4L 1FWZA 1IV8A 4QUCA 3J7YJ 2VPLA 4A3IG 5DEHA 2IA0A 2ZC2A 3GX4X 1WVLA 1GXQA 2EZIA 2VT2A 1Y69U 4PFOA 2QCPX 4N9IA 1SMYC 1XSXA 1HHVA 3RIRA 2J0TD 4NBQA 5B5EC 2GBYA 3W6KB 4LF7L 3WG7H 2J4XA 4B3RQ 1X4PA 1BF4A 4JI3Q 2IVMA 5FLVA 1UEBA 3PUFA 4CDDC 2Z5UA 5ED4A 4OXPA 1D8KA 1LYLA 3OSFA 3R60A 2OUMA 4DXFA 3RZDJ 3HB9A 2ID3A 1JOQA 1ZKOA 5J4VA 1L1OA 4LF6L 2EQSA 3HIFA 2IAIA 2OCCH 2GQQA 2GWRA 5ICCA 2MC3A 4J00A 4IJHA 4HIOA 2H8RA 1EQQA 3ZGKA 4ZYHA 5E3FA 1Y1VH 2OWOA 4GN4B 2IW3A 1DGWY 2ZJPF 3VYSB 3K6GA 4E7KA 3S15H 5H2FC 2QF7A 2XGXA 3HOXG 1KRSA 3BC8A 2E34A 1U9OA 1T95A 4C2UA 5BMZA 2WAQB 3TS2A 3OYFA 1ODDA 1U78A 3QJYA 3S2HB 1DOKA 2IT1A 3I70A 5CBEE 3RLNA 5CYVA 1C0WA 4K2LA 3KZYA 4JV5Q 4E7LA 1DQUA 4ZKCB 4DV4Q 2AMCB 3GTKB 2BH2A 1MD2D 2EV0A 4XOTA 4A3KG 2ADUA 3F2BA 4BXXJ 2L55A 3MXUA 4IX7A 3WE3A 5JLWA 1LUJB 4CSWA 4BYYA 3MFGA 5GAHJ 1ZRCA 3K4CA 1B50A 2XWBB 3F3XA 3E6ZX 3R0JA 4QIWB 3TP6A 3IAYA 5IYBH 3H1CA 2NVXJ 2L12A 1REPC 2COMA 1QVTA 2ZXRA 2UUCQ 3AG1H 4BY1H 2NZOA 2XAGA 4I0BA 5KAFC 2EFQA 3G73A 3SK5A 1EKEA 5CQEA 2D62A 2SEBD 4BBSG 2O8KA 4OIQF 2KCMA 1VQIA 4L9TA 4A3LJ 1TT2A 4DJAA 2LKXA 1PA6A 3HDDA 3GV6A 2PLYA 2ICEC 2MGSA 3V7CA 3E0JB 5D8LB 2LKVA 1MSGA 1P92A 2KENA 2MQHA 4XT1B 2V9PA 1S5CD 4DIQA 4FX0A 1CA6A 2EZHA 4BBRG 2I46A 1T5XD 2L3DA 1JORA 1PUFA 2XSJC 1DUXC 5IT9E 4DR1Q 4HDVA 3BG5A 2R6GA 5FJ8J 1X1PA 1Y0UA 5IYCH 2O0YA 2YX4A 3OMGA 2OZUA 3OMCA 1HR0L 3IRRA 1PTOB 3BLYA 5C3EJ 1NY4A 3PQJA 4M6VA 1YJNI 4FDBA 2A5HA 3H35A 3NQTA 2E60A 1TLHB 4PJJA 3HOXJ 1Y1VJ 3DPUA 3HGBA 1F36A 4G6TB 1T8IA 1WTXA 3ABLH 3FDTA 5LL6X 5HGQA 3LQRA 4O0AA 2EFNA 3T13A 3S16J 3BVMA 1K28A 2DDAA 3PQKA 3I54A 1IZ6A 3PIPF 2DO7A 4P9FA 1R5ID 1ETYA 3OYGA 3TOBA 1TXYA 4LFBQ 1KONA 4IXAA 2JSOA 1SJHD 2JUCA 3CW2C 1K61A 2FXQA 3R2TA 2JA7G 2M7BA 1P8LA 4BL0B 3U1KA 1IYUA 2BYVE 4A3JH 4E7HA 4A3GH 2OEOA 3I4NG 5C5LA 1VQJA 3BG9A 1MJEA 4AYBA 2KPMA 1UHWA 4BXXH 1D3YA 4C3IH 2HYGD 3HYIA 4BBSJ 3CXCA 4RB0A 3H3UA 5JHFA 2DT7B 3LWUA 4G8XA 3BY6A 4A93J 4J15A 4MEYF 4GS3A 5F1JA 2VQFL 2JRMA 2FOKA 2L9SA 2XASA 4FYDA 1OCPA 2Z0SA 1EYAA 2A5WA 2IS4A 3LAJA 5ELNA 2GIVA 2A6EF 1TR5A 3JR9A 1UJ8A 1W0UA 1PMRA 1F43A 2WINB 3NBHB 5H6RA 3KIOA 2C5CA 1TWAB 1BOBA 2W85A 4KN7C 3G71I 2QEJC 2OT2A 5JHUA 3CJTB 1KABA 5EZHA 2E1MB 1LDDA 1FL0A 3BCAA 2O4XA 1FZPB 2IX3A 2M45A 1S29A 3H3ZA 2YSRA 3GTPJ 1YHQA 5K36G 4XDXA 2ZMEA 4QF4A 3QRFF 4P1WA 2KIQA 4IURA 5I4DA 2M00A 4IFDJ 4N4OB 1U4MA 5IP7H 2F0QA 2K01A 2CQKA 3I59B 2P81A 3UE0A 2CFOA 3I55I 1TNTA 3E6CC 3R2IA 2F3IA 4QPOA 1D1IA 2WAFA 2F03A 3CCJI 3LFKA 1R49A 1KQ9A 4YWKA 1PRTC 1VQFA 3GYHX 1AOYA 5C44G 4XONA 4CCKA 3A7AB 2VASA 3FXKA 1ZLJA 2V1XA 4RGMA 3GTQB 1I5FA 5LEJA 5GAEC 2JA6H 2O2LD 1LLRD 4E7ZA 3F22A 1PYBA 4PUSA 1SNQA 3NEMA 1R6RA 3J81L 2NYXA 4P55A 2DAOA 4BKXA 1X1BA 5A2QK 2O03A 3HRTA 2X51A 4IHVA 4P73A 4G57A 1S7EA 3RR5A 3FM5A 2L9RA 4XMYA 1YJWI 1IBKQ 3ZMTA 3NWSA 1UAPA 1JWUD 3MXGA 4JOMA 3KEYA 4ZDLA 1X32A 2IX1A 4P74A 3RKYA 2LFBA 5DD4A 1MBHA 1MI2A 2JMWA 2RQPA 1CI3M 4EJOA 4DV0Q 4PMCA 1R7JA 2QQ8A 4MQ9F 3WTYC 3WU0A 1QRYA 4ZK9B 3HEFA 2M30A 4V2GA 1JT6A 2VI6A 1IRFA 5IODA 2I5MX 3WU2C 1F9RA 1Q1HA 4N4NB 3F6OA 2JA2A 2D9UA 2BEOA 1PRTB 1D1BA 2L4MA 2B63H 1S5BD 2ASBA 3LSTA 2ACJA 1BOAA 4OAYA 2MH9A 3JSOA 3BDDA 3PIOF 3CUQA 2BHZA 3GV3A 1TP4A 2G7UA 2ZBKA 1YVCA 3Q0VA 3JTGA 1HBXG 2K14A 3GEZA 1WFXA 2VUMB 2BA1A 2BDNA 2F0EA 4OWRB 4A3DG 1RUOA 2HGCA 3SDBA 3FXOA 1LQ1A 3PIO3 3FISA 1A31A 3KX2A 4JOIC 3K6OA 2NVTJ 1OXTA 4ZZDA 4ZZLA 3S1MB 1J09A 2K86A 4A3GB 2AXLA 1LTSD 4DR2Q 2KUMA 2VQLA 1RR7A 2HWVA 3LQQA 3H3VK 4IOAF 3LA7A 5GAHC 4EQNA 3JSPA 1A6IA 3BS1A 1MBFA 4HSPA 3JREA 1HR0Q 2VJIA 3TMOA 4LIVA 3K70D 2HCIA 5L3EA 5LEKA 2HR3A 2QM3A 2X0LA 5IGFA 3KOJA 2R7FA 4HX4A 3RLOA 4UXNA 2JA8J 3E5UA 1AWCA 3HSEA 5FD5A 2K9NA 3R0AA 1NK2P 2R7ZJ 1VFCA 2LTPA 2Y0SN 3QU6A 2BW3B 3X2QH 2VJJA 5ILSA 1IW7D 1HZAA 3AFHA 3TEHB 2KHMA 4LLGF 2I5UA 1XGNA 4MGRA 2CWEA 2V26A 1KTKA 2Z6KC 4HMJA 1BR9A 4L6TB 1WJEA 1P9QC 4LLNA 4PQXA 2NAZA 3I4MJ 3I58A 2PNHA 1ESFA 2VBXA 1PTOF 2DJNA 5FKMA 5HODA 3J7A5 1WTPA 3SK4A 1XB4A 3F1ZA 4IHTA 1YNJC 3ZQGA 3I3LA 2OBPA 4B4CA 4BDYA 4I65A 1MH4A 1TZLA 2JN6A 2DA3A 1OXXK 2F0LA 1WYDA 3CMEA 5E1WA 3KFUA 2UXBQ 4QWQA 3KBXA 1QB5D 2LH9A 1G3TA 4EQQA 5FLXL 1LFBA 1HKQA 1HF0A 1Z7LA 3OYHA 4GN5A 1FIAA 2WADA 5KGUA 1CF7A 2O7OA 3J81Z 1YRNB 2FUG2 5C4JB 3DLLA 4YIIA 1F2MA 3SXYA 3ER0A 2JA7B 1X54A 1JJGA 1G2TA 3OYAA 1KLUD 1PH6A 4FF2A 1YJ9I 1IDYA 1XCVA 1JOKA 4I6ZA 2DBBA 3GFLA 4NC8A 2A69F 4X3KA 1VF7A 3KLSA 2FNAA 5FLXc 1GHKA 3D3RA 3SXHA 1T0FA 4IALA 1FBUA 4EM1A 3NP8A 4HV5A 3EQLC 1VQHA 4HIMA 3TZUA 3J80c 5F0CA 4NDLA 3UNGC 3T1YL 5DAUA 4N9HA 4TRDA 5D5XB 1QVCA 3VA7A 2HT1A 2EYPA 3RZDH 1FBSA 3P9IA 1USSA 1H9SB 3J80i 5I6YA 1VTNC 4H44C 4PV1C 4PZ6A 3U1DA 4JI6Q 1PJRA 1BJZA 3M4OB 4NB3A 1B70B 2MLGA 1GOZA 4DKAC 3EIVA 1CHQD 1T98A 1U0JA 4H02A 2BY2A 1O3TA 2WV1A 3I8ZA 5FKLA 1C48A 3HPGA 4QL5A 2QZ8A 5IIFA 5F1RA 1I4HA 3RZOB 3HOUJ 1J9OA 3T8RA 5TRDA 1QUQA 3CQZH 2A68C 4JK1X 1X65A 3HOUB 2DMTA 4FF1A 3HTUA 2IS2A 3FHWA 3NTHA 2OC6A 4K2KA 3MFKA 2R7ZH 2V7FA 2Q8RE 2BCOA 3O3KA 5COYA 1VQGA 2DTZA 3S16H 1MKMA 1IN6A 1I94L 4A3EJ 4I7AA 4OONA 5C4XH 2XAJA 3H5RA 3OR2C 3BJ6A 1J9IA 5HVQC 4JI0L 2CUEA 4OIJA 4LB6B 4IPCA 2EY6A 3J81c 4LFAL 4ABNA 2Q2HA 3FP9A 4JCVE 3NBHA 3ZN0A 3ZMZA 5EJWA 3CPWA 2TCTA 1ETOA 4RG1A 4DV1Q 1XMKA 2JYOA 4C56C 1X3UA 2HHHQ 1ZGWA 4A3MJ 4PMWA 3K0LA 3OL4A 1WRJA 1VQ4A 2NN6G 4FF3A 5L3BA 1SANA 3BJOA 1TS4A 3JAMZ 2WA0A 2IWHA 1JUMA 1DOLA 1ETWA 2NVYH 2HXOA 2WV0A 2QEXA 5CVIA 4KJZA 1BO0A 2K03A 3RN5A 1X58A 2VUMH 1UE1A 2N8GA 4LB5A 1EEFD 4ZYDA 4WX9A 1LV9A 2EYHA 1RR8C 4I2OA 4ESJA 2NVQB 1H9MA 3IH3A 4WXDA 4AIKA 3ZQLA 1SYEA 2NOGA 2DYRH 3JAMi 2M3AA 2DU9A 4DR3L 1MJCA 4UVAA 4QJFA 3S1NJ 3RPUA 3OW7A 2LOOA 5B66C 1ZR2A 2QUFA 5IYCJ 2DJIA 3CKIB 1JE4A 1EA3A 2E35A 1T2KA 4U7DA 4I99C 4AWXB 2QDLA 2BOLA 1RCVD 3I2ZA 5CV5A 3M8EA 2UXDL 1PDNC 3AG2H 1LTID 1OCTC 3J80E 3LA3A 2QWWA 2EXZA 4DR7L 4A3DB 1U3EM 3N52A 4X3TA 3VR3A 3URYA 2HEOA 4Q0FA 5HNHA 2MABA 1UE6A 2B63G 5E18F 2ZJRF 3ZMUA 1HDDC 2FINB 1RJTA 1BI1A 1HA6A 2HTJA 1AHDP 3HKZB 1FC3A 3PUZA 1TWCH 1K8OA 1W36D 1B8IB 3JW4A 4Q5SF 2KMUA 5FKAC 3R4KA 1JJ6C 2XIWA 1XPXA 4GRIA 1HCRA 2EY5A 1F2YA 4QSHA 3N6RA 4DR7Q 5C6AA 2IL8A 1O3RA 2F0SA 1LTTD 1D0YA 4PG3A 2QBYB 4LF8L 3GTJJ 4AIJA 5LGTA 4RKLA 1ETVA 3VPRA 4U673 4C3JH 2BY3A 3OYDA 2JXMB 4DR6Q 1JKRC 1VQ5A 4ZRZA 2P5VA 2HZDA 2PQEA 2PZWA 5JVG3 2B2UC 1OYYA 1JQYD 2IT0A 2UV1A 5E1ZB 1SVLA 5J3BA 1VMPA 2X6WA 3L2PA 4B3TL 1O7YA 2CW0F 1QVFA 3LOCA 2A69C 1J5EQ 4MLOA 4FETA 4L9JA 4U0YA 1MBKA 3PUXA 4G7HC 2F4OB 2OJED 4PJLA 2LXKA 2F5CA 4DNIA 1VQ8A 3BOQA 4KICA 3ML6A 2YUSA 5FD6A 4E6KG 1FYMA 2X48A 2R92J 2LD5A 1QZGA 1EY5A 2R93B 2WACA 4BJ6C 2JJ7A 2UUZA 2R93J 3CC4A 2UUCL 2V4DA 1PYWD 2M0MA 1BI0A 3RZDB 3CUQC 1B8IA 2XF7A 3DWPA 4X6AJ 1UE5A 4BQNA 1VNDA 2ID0A 5EBDA 1JGSA 4AUXA 1ITYA 2DN8A 1QNKA 2DGYA 4HSVA 4C1NI 4OIKA 4IFDI 3E6BA 5M5XJ 1H89C 1N9WA 3UDXA 1HZBA 2BVMA 4MHGA 3NEUA 2P4WA 3F21A 4P75A 2RN7A 3BVGA 1PTOC 1ZELA 1ETKA 1T08B 4LF4L 3ERQA 1PUFB 3TRZA 1VQEA 2CJJA 4X62L 1P4XA 4H0EA 1SYFA 5HOOA 4OO1H 3S15J 2PX9A 1VQNI 1B53A 3K57A 4M74A 4M8AA 1VQ4I 1PRTF 4YCWA 1ENCA 2CWAA 4FHTA 4RFBA 3H15A 1AKHA 5DUIA 1WTVA 2ATWA 3HOWG 3CJQB 2JA6J 3JC66 1TWHJ 2GM4A 3PO2H 3G48A 2AUJD 2K3PA 1SFOJ 1HTPA 2DA6A 2H6BA 1TQPA 4JC0A 4EVOA 1HQMC 1D5XC 2DOAA 1V1QA 1IXRC 1VQCA 4DUZL 4M6YA 2OF7A 5DD8A 1VQMI 1AZQA 1O3QA 4UV9A 3K7AB 5F0HA 3U50C 3ZCOA 3RMHA 3E6DA 3OTOL 2NS0A 4X3UA 1RPWA 4RA8A 4WXCA 4BY7H 2K7VA 2W82A 1IJWC 1ZN2A 4TSSA 1I39A 1MNEA 3ULJA 3MWYW 2DY8A 3S2HJ 2QGQA 1GUOA 5B3SH 3E9HA 2BE5D 1X6OA 4IZZA 1TWGB 4WWCA 2N55A 5LHGA 4XXEA 1SDFA 4WORA 5IOCA 5C0XH 2YU9H 3A03A 1Q12A 3HOTA 3S16B 1KLGD 1Z05A 3DMUA 1SNCA 2DNEA 1RKWA 4FNFA 3D8GA 4HR7B 3V8LA 1W5SA 4MHEA 2VIXA 4JI1L 3AMUA 3GVAA 1EUJA 1EZ6A 4YWLA 2STTA 4IO9A 3K1PA 1VQBA 2HVSA 5BS6A 3HRZC 4U0VA 1D5VA 1R1TA 4JG2A 5ICFA 2EZLA 4N8X1 3K0YA 2F0JA 5CC4A 1G59A 3BQZA 2VQHA 5AJ3L 2I07B 2MC4A 4G7HF 3VDYA 1HH2P 3PCOB 3ULLA 2VLAA 1YNNC 2HIVA 2KFDA 3S2WA 3HKSA 5JR3A 4NXNL 5FLMJ 1MSEC 1VZ0A 4KDPA 4I7ZC 1NCVA 5CMDA 5JJLA 2PMZE 4C3IB 4BA2I 1P6RA 2RA4A 1MKHA 1NMGA 1MMNA 2FSWA 2CCZA 2QILA 2YPRA 3GFMA 4OO1I 2R3SA 1KDBA 3PV0A 1E24A 1L2FA 5JVH3 1TWFB 1K8MA 3HZXA 1WJBA 5C4XJ 1YOVB 1NNXA 5EPLA 3A0HC 5EAYA 4KN4C 2F3WA 3A01A 1SE4A 4YY3Q 2DUDA 3I59A 3TP5A 2FMYA 2SDFA 4I0AA 5HS9A 2P6SA 4HIDA 1WWXA 2DOEA 4P96A 4JI5L 1HCZA 4A3BG 2EA4A 3L2UA 4RB2C 1G91A 3P7NA 1L0XB 1TWFH 1YO5C 3FRPB 2LMCB 3MTSA 2H8WA 1EL0A 2MH2A 1H0MA 3IH2A 3KDFA 2B2WC 1LFUP 2CGPA 2K5HA 3BT9A 1K83B 3H5NA 2EINH 4FE4A 5IOZA 2EPFA 3KP5A 1RKTA 3BG3A 5D65A 4DV1L 2Z1CA 2QGUA 2XDVA 4BEHB 2R0QC 1WTQA 2NVXH 2ZNYA 1QZYA 4PNYA 4DBQA 5TGTA 3I56I 4JI7Q 3DEPA 1BA5A 1HLVA 4HCEA 3ABKH 1IBLQ 3HZJA 3VYRB 2EJFC 1KXLA 1JXSA 3CMAA 4APVA 4GLAC 2RREA 3VOEA 4BY1G 3SHFA 1X3ZB 1OLTA 2E7XA 3PUVA 2D5VA 1ACIA 3QOPA 2XIGA 2JP1A 2DPUA 4DW6A 1I4RA 2JA6G 1EOTA 4YHHL 3H0GG 3PJRA 4A4IA 2O5IC 4IHWA 1TWAJ 1F9NA 2RDHA 4W97A 4M3DA 2YU9J 3W1BA 5C0XJ 2NVYJ 4JI4Q 2Q2IA 4OELB 2KEEA 3I55A 2NBFA 2FMLA 1V9PA 1BI2A 3HTSB 4ZTJA 4BE0A 2ESNA 4LWCA 1Y8PB 2VB2X 2XC7A 1SNPA 1G3SA 3CO6C 4LLLA 4RB3C 4RS8A 5ILVA 2DQRA 1X2MA 4HF2A 4DNRB 1L1OC 4X64Q 4IPAA 1T33A 4MIMA 1CM9A 2DLLA 1VCIA 1UWVA 5DM7F 5L3GA 1E2XA 4LJZC 4B3RL 1O4XA 5ELFA 2CW8A 3OYYA 2Z6BA 1YJWA 2NZHA 1QE6A 2EE1A 3TSSA 4BY7B 1IAWA 1Y8RB 1WCMH 1VF9A 4F93B 4Q48A 2J5PA 1JJCB 2K52A 3H92A 3CJRB 4C30A 1QHGA 4B48A 4M9SA 5D3DA 1M8AA 2K5NA 5CR3A 4S0HB 2Q1ZB 4M71A 4G12A 2A68D 1CQVA 1WCMJ 1SVMA 3VYRA 2ELKA 4BQAA 1STZA 1ZGAA 3BR2A 1Q86C 2EY1A 2E5ZA 1WCMB 5M5YJ 1Z7TA 5IGGA 2ZJ2A 4IHSA 1WPKA 1U4LA 1EYDA 4GOPC 3I4LA 4R4TA 1SYBA 4WRDA 2G7HA 2HS5A 4XM3A 4JI8Q 4DBRA 5D14A 1LABA 4EEFG 2ZM6Q 4H0LC 5EKKA 2EFPA 3HOWJ 2LRDA 3WHCA 4BA1I 2KISA 2WAQN 3OOUA 4RCNA 4AYBB 1QQIA 3H09A 3FK7A 1LNWA 4M3GA 2HPMA 2BE5C 2F0VA 1F9PA 3DXJF 1HPCA 3B6AA 4R4OA 3K80C 3CUOA 4N9TA 1CZGA 2IP2A 4Y52H 3GP7A 5CKTA 3M4OH 4HMIA 4HJ8A 2M4KA 3A74A 2SNMA 4HN7A 2RGVA 1V3FA 3E5SA 2EIJH 2UXCL 2O9LA 1HC8A 5D6FA 1IHZA 1B7YB 2ES2A 5J1RA 1BL0A 1Y8OB 3HHHA 3CF5F 2WBMA 2D0OA 3IL8A 1XJVA 1HQCA 1E1OA 2E76C 2QQAA 5AFWA 4V19K 2F0GA 3HOVH 4MZ9A 3S2DB 1I3QB 3BWGA 1G4DA 5LD2C 1UMQA 4X1EA 2AWNA 4HIKA 5EEHA 1VQNA 2GA2A 4AYBE 3GTOJ 2PYKA 5IT9Z 4RGRA 1UFMA 5GROA 3OYCA 1NR2A 2PI0A 2ECBA 3HOZG 1QHHD 2KT0A 3G6EI 1B1BA 3ZP5A 4D5CA 4HEDA 1IBMQ 1F9SA 2M4GA 4B9WA 5JEAG 2OF1A 1HDPA 4HRIA 1LTGD 4PCQA 2Q8KA 5CGKA 4G94A 4ZQ3A 5NUCA 1CT1D 3FM3A 1TQIA 4MTNA 1N78A 4CKCA 5IGBA 2KRHA 2KQRA 1G2HA 2Q2UA 2FU4A 4ZYEA 2HKXA 1NR4A 1RODA 3M7NA 3RKQA 3R93A 4CDEC 5KAIC 1EQVA 1F9QA 3W3CA 1GUSA 2X1EA 2CYYA 5JVGF 2JN4A 4DFAA 1B4OA 2L0KA 3T1HL 3C1FA 3VR2A 1CGPA 1FT9A 3ND9A 2MD0A 3SQNA 2B2YC 3F8TA 2COBA 2XF6A 1FYLA 1W6KA 4ALPA 1LVKA 4L5JA 5KIXA 2MFZA 4F52A 3DTKA 1FNNA 4AVPA 3RQ4A 2VQCA 2P6TA 1AW7A 2WB1G 1AFPA 1IC8A 3L2WA 1D7QA 2W24A 4XRSA 2XPWA 1HA5A 3STBD 4B3SL 1Q46A 2C6YA 5H1SE 4V0BA 1SFOH 3F8FA 5FGMA 3J81j 3RZOH 1J7KA 3DWAA 1WJFA 4DYQA 4G9YA 2CQAA 2G9DA 1U6GA 2KRFA 1I6HB 3VEPA 4CXFA 5KYIA 2YYZA 3L2CA 3HC7A 3D31A 4HDUA 1SD7A 5B1AH 1K78A 4IVNA 5M3FB 2HOEA 1IN4A 4A3KB 4GO1A 5KNLA 3L7WA 4Z9CB 1DD2A 3WTWC 1QJOA 3ABTA 2F0UA 4PSXA 4LUOA 3KYCB 1GUNA 1J0RA 2UXBL 2DNCA 2EV5A 1O7IA 5E8GA 5IGDA 3MZ8A 2Q8TA 3FIWA 2XRSD 2EZKA 2OU2A 4K0KL 2ZFUA 2TSSA 2HDWA 4P5OA 1LT4D 4QMGA 4DK6C 2B29A 3TREA 3BYTB 3M4YA 3CUQB 4XQFA 3ONQA 3CCVA 5IYCG 1PRTD 4BJ5C 2GOMA 3K81C 1NE3A 1AEXA 5DTDA 1HNWL 3IV5A 5CVUA 3AB9A 1Y1VG 3V7SA 1FD7D 3GTQH 2NWGA 3J7AY 3OYIA 2LKPA 2F0IA 3H0GJ 2MO1A 1EQTA 4X6AH 3FPUB 1GJXA 4Y15A 3J7AF 1F2ZA 2XAFA 1MJAA 3NENA 4E70A 3JRBA 2VXZA 4A3KJ 1S5DD 4X64L 4XKVA 5HDKA 5FRMA 5EG0A 2XAHA 4LK1C 2B2TC 3PUYA 3V8KA 2WP8J 1XMAA 2A68F 1KYZA 1B3AA 4JBKA 1A5JA 4A75A 1XTAA 3KDFB 2L9VA 4ZYGA 1PFNA 2WIIB 2FQ3A 3U4VA 5JOBA 1IO2A 5M3MJ 5D3IB 3PFYA 1IG7A 3I71A 4ESFA 2X69A 3U4ZA 1S7AA 1N8RC 2JQOA 4CHTB 3SK8A 4EGZA 1GHCA 3QOLA 2CMPA 2WB1B 4NC7A 2DCEA 4JI3L 3A1YA 3WGIA 3A0JA 2MBFA 2OA4A 4KHZA 2QSHX 1JJ8C 2FBIA 5L3DA 1PTOD 1AH9A 3WE2A 1LT3D 1FGUA 4HQEA 3FWEA 2DA2A 3J7ZC 3K8AA 3HKZA 2CQXA 1I27A 5FFZA 1K4TA 1SFUA 1UAAA 2PFBA 2EJGC 2IHEA 1E1TA 1VF5C 5LHY1 3RZOJ 3FXRA 3KBGA 3QR8A 3EUHC 3TZDA 1JTXA 2PG4A 1YX3A 3D1NI 2JE6I 3COAC 2A6HF 2OTLA 2HPIA 1O7FA 1Q1VA 2VQEQ 2VJ4A 1FTTA 5LLQA 2V6EA 5I9PA 3G4SI 1CSPA 1CF7B 2M2EA 2HXIA 5CV8A 4UY8I 5JVTA 3P9CA 4JYAL 1YI2A 3S1QB 2MJ8A 4HSRA 1PVEA 1LPQA 3TQYA 3X3NA 3FZVA 2KEDA 1D1KA 4BAYA 3T56B 4X65L 2F0HA 2ZXOA 4ILWA 3IRBA 3RD4A 2GXAA 3I53A 3K58A 2ZT9C 1C8CA 5IYDG 5K5QA 1SNMA 3K7AJ 2GAUA 1AN8A 1PXUA 4L5RC 1IN8A 2ELJA 3O2PE 3JCUC 1B72A 4BY1J 2IRFG 1OXUA 2LXJA 4EX5A 2K4BA 1S3JA 5ELBA 4A3MB 5DUKA 3K4BA 2PQAA 2R7VA 4BY1B 3RUZA 3D5LA 2YTXA 5JFRA 3NARA 2CH0A 3K7AH 1H95A 3K10A 3S1RH 3F2CA 3PIOA 2MUYA 1XGMA 2IGMA 4LGWA 4BY7G 3S32A 2DPDA 2D2CC 1BIAA 1ICFB 1SE8A 3HSFA 4RB1A 2HDDA 1ESRA 4CH7A 1RF2D 4NB5A 3N05A 3CD6A 1JHFA 1L0OC 2L7MP 2GVAA 5F64A 3BZCA 3GXOA 9ANTA 2R7QA 1BVSA 4KKUA 4UP8A 3R61A 4JI2Q 4YIFA 2ZSHB 3DV8A 4D7MA 3D0FA 1SE2A 3CQZJ 4G7OC 1J5YA 2H1LA 1GVJA 5JLXA 3WOFA 1FJGQ 2LYCA 1NBWA 4CA0A 3NTKA 4BU2A 1D5YA 3VYTA 2GXBA 3K5MA 1PP8F 1TY2A 2DJGC 5D4SA 2L9HA 1KU7A 5LMNW 2IPKD 4P2CB 4AVZA 5TJJA 3L1PA 4KD4A 1PFSA 2X9DA 1KDCA 4ZYSA 4JI7L 1MGSA 3I91A 1E3HA 1OFCX 5JEAH 1Y56A 2DFFA 3W6VA 4F88A 5M3FH 2DTRA 5C4JJ 1MDMA 3V4GA 2E1MC 2RNGA 4PK4A 1HRJA 2NZ1D 1K8GA 4A3LG 1EYCA 5J1ZA 5A2QL 2DY7A 1A63A 1ZRDA 1I6VC 1WGXA 2F0DA 5J22A 3S3OA 3W3AA 2YS9A 4KHPL 4UPAA 4LG3A 4DR4Q 3GZ5A 2X6XA 4BQOA 2GLOA 4QLCU 2HQRA 5E8IA 2XGTA 1N33Q 2A6TA 1Y8QB 4A93G 4GCVA 2B63B 4A3JB 5IT9L 3CC4I 3OMYA 2F0NA 2UUAL 4CZZA 1D8JA 1CKMA 4QIWN 2F2EA 2GOXB 3EDPA 2Z4HA 1WJCA 3VDXA 1XNQL 3Q8DA 2XRLA 2EYJA 2EXDA 2WWYA 1G6ZA 1RRJA 2FRHA 3SZPA 2V9KA 3K1MA 1R22A 3H94A 3E7LA 2GZWA 1ZAOA 2JEAI 3O8GA 3GTOH 1RIOH 3EPZA 1U5KA 3DKYA 2EILH 1Q8IA 2B8FA 1XMXA 2BE5F 1LTBD 4DAVA 5LGNA 1VMCA 1VQ5I 1EH8A 2QDBA 4K6DA 4L63B 1IXSB 4FASD 1HZ9A 4M3BA 2JA5J 2PMUA 1PH5A 1ORKA 2JA6B 1YS7A 3OYNA 2K04A 3NAUA 1NK3P 3ZQIA 4C2TA 5E79C 3QQAA 1BR1A 3M85A 4M73A 2K75A 3AU7A 2CG4A 4C2MH 1AE3A 1FNWA 3DLLF 4DR5L 2B8GA 4JX6A 1BIBA 2WAQA 1SMXA 2XRQD 1YI2I 1KQ8A 1D6EC 4ESBA 2W4SA 3REOA 3CU7A 3NUCA 3E0JA 1SMYD 2IGNA 3DU5A 1DYQA 2HIXA 3GTJH 1KQSA 3QB3A 4L5QA 3MD2A 5LMUL 3M8JA 3H9QA 1GUGA 4PZ7A 3S14H 3MCZA 4WFN3 1MHWC 5FLXZ 4XL9A 3HOYB 1TY0A 3QP6A 1QG7A 4KJOA 4F87A 4LJZF 2K6AA 1HNXQ 4RAUC 1XSDA 3OTOQ 1N25A 3O6BB 1OCRH 1JE8A 1FY7A 4AYBN 1JI8A 4BHCA 2VBWA 2E2HJ 4JYKA 2L0CA 2QSFX 3VYUB 3ITPA 1DONA 5EF6A 4P72A 5T1IA 4HX8A 5C4XG 4GFBA 1S72A 4DXGA 4IQZA 1QPIA 5LFAA 2NVXB 5GPAA 3LNQA 2HQ5A 3BDCA 2D1VA 3A8JE 3HOWB 4I76A 3IRQA 3PQIA 1WOCA 5I9OA 1FYKA 2ZXPA 5E4WC 2JRTA 2DDBA 1FIPA 2Z9OA 2A6HC 5I6WA 4HNVA 1MD0A 1MJ9A 4L0ZB 1ZHFA 1R5GA 4BACA 3CHBD 2LKSA 4C3JG 1GM5A 3ZOBA 4HJAA 2F0WA 5G3LD 3ELKA 4IOAA 5LMNQ 2M87A 1VQLI 4BNCA 3DQVC 5HGTA 4IL6C 3HOYG 2WB1E 5AJ3Q 4RM2A 4GKJL 1T38A 2LF7A 3I7FA 1BC8C 4DN4M 3KJOA 2K05A 1SC7A 2A3SA 1XGOA 2KCTA 3JTHA 2R93H 1BQQT 2FD5A 4CDCC 4A3IB 4JOIA 2M9HA 1AZPA 4FO2A 2BY1A 4DV3Q 3J7AO 3M4PA 3TP3A 2K85A 1B1ZA 4CJ1B 3RYRA 4JI0Q 3F8BA 4S04A 1K83J 2Y9ZA 2HD3A 3E1SA 4PZ8A 2YU9B 4YY3L 1Y1WH 1A3UA 2MO0A 4CBVA 3RYPA 2MG4A 3IHUA 1DU6A 3I4NJ 2A6HD 1UE7A 5EBCA 4DYCA 2P7CB 4DR2L 2D5DA 4HSTA 3C46A 1KL9A 3WTXC 4KKSA 1MBGA 2K50A 2FQ4A 4JVZA 2B2VA 4ZAIA 4OAZA 4WJ3M 3AFPA 3AL0B 2AO9A 1X3PA 3HKZN 4Y33A 4L9NA 1V5GA 3DTEA 1VQ9I 1XD7A 2FJ2A 3E5QA 4P71A 2UU9L 1HSTA 2L1BA 3FKIG 3U2RA 4DAYA 2PI2E 3PO2G 1Z91A 3MA2B 1UHSA 5E3NA 3G71A 3SFIA 4B08A 3EUKL 2VPRA 1R4NB 1KAWA 1DZ1A 4UAIA 1BC7C 4JBWA 3BDOA 5HLTA 5F2DA 1UELB 3FMRA 4I02A 2VL6A 4ME5A 3MFYA 3AKZA 1L0WA 5FJ8G 3S8PA 1ZG3A 1DOMA 1F77A 1PFMA 1MSFC 1BW6A 2AWOA 4HYEA 1FOKA 1ETQA 1ONVA 5K5OA 1TWAH 4DR3Q 5C5MA 4E7SA 4OX9L 2FXAA 4MIUA 1GXPA 4U7BA 2DI3A 1TQOA 4KN7X 4MFDA 3BP8A 2HDCA 4TKOB 2O6GE 4JI4L 1TW3A 4DUYQ 2E2JH 4LF7Q 4RDUA 2JEBI 2P5LC 3F8CA 3MXPA 3GZ6A 2H1KA 4B3TQ 4C1NK 2V1NA 3CCLA 1YX5A 4LD5A 3NK9A 3VR5A 5F08A 3HOYH 2HDMA 4ME3A 5DM73 2AQFA 3DEUA 2XSDC 4UVBA 3QU3A 1PUEE 1RC9A 2F3VA 2M5WA 1WI9A 3R3OA 1O57A 1VQ7A 3H6MA 2CV1A 2CKZB 2RVCA 3WWVA 2N88A 1XPOA 1W7PA 2R7WA 2N8NA 4A69C 1U5TA 3C3LA 4KFCA 1K3BC 1IZ1A 4HAEA 2K28A 2LK2A 4BXFA 3FKIB 1RDPD 1XWEA 1JB3A 1LTLA 1EWHA 4A3DH 1PYSB 4R79A 2XGDA 5JJIA 1Z0XA 4LFUA 4Y3OA 2NUCA 3H0GB 4B44A 1FBQA 4UY8C 5DM6F 4A6EA 5BQTA 3SE0A 1I3AA 1K83H 2Q2EA 2JT1A 3Q0WA 3DP7A 5GQOA 2IJLA 3BZ6A 5D5WB 4XQQA 2D2WA 3DF8A 1A62A 3T4AC 3V8JA 2A69D 4QQBX 3A01B 2WTEA 2Y0SB 4IPHA 4JYAQ 1U9RA 3H5AA 1J5EL 2B39A 5IP9G 4X65Q 1A2TA 4BHBA 1TIID 3FKJA 1I5ZA 4EJUA 4XKCA 1BBYA 1FNUA 1S6LA 1TWFJ 4E7JA 3EYYA 1RIPA 1SFEA 5KRUA 3BR3A 3ZQQA 2HNHA 4DZPA 2XTIA 1O80A 4BBRH 1WQ2A 1UHMA 1SSOA 4CHUA 2QYOA 2B3GA 4RHSA 3OY9A 4MO7A 1SD6A 4N8FA 3GTLJ 5GTIC 1WTHA 3KEOA 4PJ0C 3BR0A 5BN5A 2BH8A 1FTZA 3OSGA 3DUZA 3S1MJ 4ZUJA 1NHAA 2DFEA 1G8ZD 5J40A 3LNNA 1L1OB 4XLEA 1DPRA 3GTGJ 3HS0C 2Y0SG 4XNFA 1NSNS 4AC0A 1JR0D 4FVMA 1XMQQ 1NH3A 4LG0A 4RMNA 2XHKA 1J2XA 1LDKB 5H20A 3KP6A 2NS8A 2Z6KA 4EM0B 5J4YA 3T5XA 5C4XB 1Z3YA 3OWEB 1I50H 3J7YW 1QNTA 3CESA 3FBNB 5IWAQ 3C2HA 3N4MA 2V6CA 2K9SA 2IGOA 1IUFA 4IQ4A 2W7NA 3HPHA 3RKXA 4ZC3A 4FT8A 2VXWA 3SGIA 2PEXA 1LDJA 2JA5G 1K4SA 3QODA 4X66Q 3CAMA 3KF6A 4CDFC 3ISPA 4D9JA 1LTRD 1A2UA 3VB2A 2K9QA 2XAQA 4K5XA 2Y69H 1GO3E 1BR2A 2QEXI 2HVRA 2ZXIA 4TV7A 5IT9K 2E74C 3PGZA 2A07F 1CK1A 3K4KA 3NTIA 4M1UB 5GADC 1ZTRA 1K3RA 1W5CC 3HL2A 1KQ0A 4NHJA 2A6ED 4LIUA 1KNAA 1K9MC 3AYHB 1VQOI 2PNRC 5FK9C 1KD1C 4CICA 1T9HA 1IN5A 5ELOA 3EA6A 4U87A 4FXGC 4ANJA 3OYEA 5M3FJ 2CUFA 2KVMA 2AQ3B 2EA2A 2F6CA 3OIPA 4FTHA 2X1DA 2JA7J 1S9HA 4C9YA 1AE2A 1M1KC 3VR6A 3J81i 3LGJA 4A3FH 2NYZD 5GP9A 4O42A 4GNXB 2KLOA 3OSOA 2WAQG 5AIPA 3F2UA 2XGEA 3ERSX 2K40A 2AHOB 2RHQB 2SNSA 1RHPA 5EDNA 3IWFA 2O8XA 1SNDA 2WY8Q 1EV7A 1QO0D 2JA7H 3NSWA 3CCLI 1TS5A 3GTPB 2HHHL 2IW5A 2OAZA 2YU3A 4A3MH 1NTCA 1P4WA 2BVLA 2GVBA 1YIJI 1IBLL 4F92B 1Z7UA 4MNOA 2PMZB 1FMVA 4QCLA 4LW1A 1ETXA 2RBMA 5ICEA 1KU2A 1YHBA 1ILQA 1JT0A 3W6JB 1VQ6A 1O7LA 5CYUA 5IOYA 2NNNA 1EY9A 3VWBA 1SN8A 4IRGA 1I1SA 1B9NA 4CCMA 1SD5A 2R7DA 1LUZA 3PSFA 2KHJA 5GPCA 3I4OA 1HA8A 3GTGH 4BWGB 2VKVA 4UUSA 3M1CA 2Y48A 5FO9B 2V79A 4A93H 1JCKB 1KGSA 3PUBA 1E3OC 4A3GG 3Q0UA 3WTTC 3EVQA 5ICGA 5F27A 3F8MA 3A4CA 3CCRI 1Y1WJ 2EZVA 3MVPA 3HM5A 2VB3X 2KL4A 2B7EA 2ENBA