3GO5A

Crystal structure of a multidomain protein with nucleic acid binding domains (sp_0946) from streptococcus pneumoniae tigr4 at 1.40 a resolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
285
structure length
285
Chain Sequence
GMNTNLASFIVGLIIDENDRFYFVQKDGQTYALAKEEGQHTVGDTVKGFAYTDMKQKLRLTTLEVTATQDQFGWGRVTEVRKDLGVFVDTGLPDKEIVVSLDILPELKELWPKKGDQLYIRLEVDKKDRIWGLLAYQEDFQRLARPAYNNMQNQNWPAIVYRLKLSGTFVYLPENNMLGFIHPSERYAEPRLGQVLDARVIGFREVDRTLNLSLKPRSFEMLENDAQMILTYLESNGGFMTLNDKSSPDDIKATFGISKGQFKKALGGLMKAGKIKQDQFGTELI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a virulence regulatory factor CvfB reveals a novel winged helix RNA binding module.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Gene regulation
molecule keywords Multidomain protein with S1 RNA-binding domains
total genus 68
structure length 285
sequence length 285
ec nomenclature
pdb deposition date 2009-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13509 S1_2 S1 domain
A PF17783 CvfB_WH CvfB-like winged helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3go5A04
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3go5A02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3go5A03
2.40.50.330 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3go5A01
4LFUA 5EAYA 2C6YA 3U9GA 4I7HA 4P55A 5FFXA 2A6EF 2XVCA 3PQJA 3TQNA 2R7ZG 2E1NA 1MD0A 1MKMA 5DUKA 2MC3A 3PUVA 2NN6G 3PO3H 3BROA 2IA0A 3OV8A 4KIBA 5DEQA 2K5NA 4BY1G 5TRDA 4KN7X 2COMA 1D5VA 5E1XA 1FJGL 4JYAQ 1Q8KA 1CSPA 2ALYB 2I5MX 4HJAA 3CCVA 1KIXA 2IA2A 1RUNA 4HX7A 2XKPA 3CCMA 5L3EA 2FQ3A 2R3SA 2WC2A 4DV2Q 4ON0A 4EJOA 1VQMA 4HYEA 5E17F 3IRQA 1W3SA 2RHSB 5M5WH 1GD7A 4WCGA 3HOTA 2PBIA 1QUQA 3I58A 2XHKA 1N36Q 4DV5Q 2A69F 5HS8A 5H1SE 1B6AA 5GQOA 2UXCL 3QRFF 3TOBA 3HOXG 4JI3Q 2O0YA 1Q7YC 3D0SA 5C0XJ 2A3SA 2BA1A 2IVMA 4O5VA 5HVQC 1HJPA 3RPUA 2EFNA 3H3VH 2F5DA 2NVXH 1L1OC 4BQAA 1KD1C 2MBFA 4HDUA 4Y15A 4QIWE 3T1YQ 1ASYA 1V3FA 4JK1X 4XLPF 5KK1A 5HLGA 1T39A 3TO9A 4NXNQ 1JJCB 5GROA 1N32Q 1U6GA 2L02A 1P8LA 1HZ9A 4RB0A 4B3TL 3E6CC 3KCCA 2Q8KA 1VQ6A 4R1HA 4B3MQ 4L5JA 2GQQA 3E5QA 4N9IA 2LXKA 3RJPA 2EV5A 1N33Q 1TXYA 2VC0A 4L5QA 3JAMK 3GZ6A 1J9IA 2PMHA 4B8XA 1KU2A 1SD6A 2Y0SG 4Q5SF 2A6HF 4EV0A 3K69A 4JI7Q 2D45A 2O3FA 2K52A 3OTOQ 5D5XB 3HRSA 3KF6A 3TOAA 1IXCA 3DFGA 5HDNA 3I7FA 4LF5L 1H9TA 3V7SA 1F4KA 3DV8A 1XPOA 3HIFA 3K0LA 1E22A 3N97A 3CQZH 4QQBX 4HX4A 2CW0F 1FSEA 2GWRA 3MCZA 2UXCQ 3R4KA 1O7IA 2JA6H 4OXPA 1BI1A 1E1OA 1ZARA 4JC0A 3A0JA 4WK8F 1HBXG 1TW2A 4X66L 4LFCQ 1W7PB 2EIFA 2DI3A 2G7HA 2QUFA 3CCUA 4YIFA 3ZMVA 2PI0A 2LXJA 4HIKA 2FRHA 4DR2L 2FU4A 1DPRA 4X62Q 3I4OA 2E5LQ 3KJOA 1BJAA 2H09A 2Z5UA 2PN6A 4MTNA 3HOZG 3TEHB 2P6SA 3KFWX 1HH2P 4A0XA 2QLZA 5JJLA 2ETHA 3CC2A 4IVNA 2HT1A 3RI4A 1O3QA 1X3EA 2GAUA 1ON1A 1LQ1A 2D1VA 2VZAA 4JI0Q 1SN8A 3HOWH 4B3SQ 1XSVA 3HRUA 1F1ZA 4AH6A 4DR7Q 5BR8Q 4DR5Q 2GA1A 4PZJA 5CVUA 3GWZA 2CWPA 1KXLA 2BA0A 1D8JA 3I71A 2ACJA 3GTQH 3T1HL 3MFKA 3HOVH 3LA3A 1R1UA 3WTSC 1JHFA 3KP3A 1GXPA 3BP8A 3BWGA 3I59A 3J7AO 1U2WA 2VOOA 5JI6A 2FBIA 4LF9L 4X6AH 4BYYA 2RNJA 2ZNYA 4TV7A 4HIMA 1SFXA 2EFQA 3I56A 3PUWA 1U5TC 5D4RA 4YCVA 1OYIA 3SGIA 2KIMA 1QZZA 2L54A 5C44G 3KYHC 2WB1E 3WE3A 5AJ3L 3S24A 4OU0A 2Q2TA 4OMYA 3ML6A 4M74A 2D0OA 2Z6KA 3CMAA 5K1YA 4XIGS 4DV5L 3KF8B 1J5EQ 3IRBA 4KMFA 2ZBKA 1Q1HA 2PQAA 4JBWA 4KFCA 1P2FA 4RAYA 1SFOH 3CCLA 1RI7A 3I4MG 2JPCA 3H3ZA 1D8LA 4HJ9A 1KL9A 4U0YA 3PCOB 1Y0UA 3DPTA 2CO5A 2E2HH 3GO5A 3FMRA 2FOKA 3SXYA 1XGMA 1U3EM 1XCVA 3JSOA 1BBYA 2ZTDA 2Z6KC 4EJWA 3WG9A 3U50C 3GTLH 3T1YL 5FO5A 5IYDH 3HOSA 4YY3Q 1LDKB 4YIIA 3R60A 1LM0A 1LDDA 2K4KA 3I4NH 4BA1I 4R79A 1I6XA 1FSHA 1K73C 1GKHA 2AKWB 5LEJA 1YEZA 4GCVA 4R4TA 1R58A 2QQBA 1WYDA 4GOPB 4A3JG 3K81C 1W7PD 2VNUD 2BH2A 1N32L 4PDKA 4CHUA 1PA6A 3GW2A 1HZBA 4LG0B 4MTDA 1JXSA 5AIPA 4LGWA 4QWQA 1FNNA 1CF7B 5LMNQ 2VT3A 4RB1A 2E8GA 1TLHB 1P6RA 2CGPA 2BEOA 2NAZA 1NBWA 2O61A 5IE8A 4Q47A 5DUIA 3E9HA 5JEAG 4DR3L 2UUCQ 4MQVA 3KLNA 2R92H 1ON2A 4U88A 3H15A 3DKWA 1R23A 4HJ7A 2NYXA 3KP6A 3K2ZA 1R9TH 4LF5Q 1XMKA 5FJ8H 1DUXC 1B70B 1ZH5A 1HXDA 2N49A 3ULQB 1QZHA 1NE3A 2HHHL 4FHTA 2F5FA 1LTLA 2Q0OA 5BQTA 3HHHA 1VQ7A 1H9GA 4P96A 1RIOH 3V8LA 4LFCL 4KDPA 3WWVA 1YHQA 1EYGA 4RGRA 3GUDA 3F22A 2HIXA 3K80C 3ABTA 3K1MA 1X3GA 5IYBG 3DEUA 5K36G 2CSOA 1S7AA 1D8KA 1IN4A 5CVIA 1FLIA 3LQQA 5BR8L 2IRFG 1NTGA 1XGSA 2BE5F 3S2DH 1R5HA 1YO5C 3KLWA 1MJEA 2OWOA 2ZTCA 4QGUA 3CC7A 3TRZA 1O3RA 4P74A 3ERSX 3GYHX 3KJPA 5CYVA 4OIPF 5LMNL 3RLOA 1K3RA 3S16H 4A75A 4EM0B 4LD5A 5CVRA 1VQIA 3KOJA 1Q86C 2P8TA 2AS5F 4A3EG 4ZYDA 1ZHFA 3KDFB 4HV6A 2V1UA 2H6BA 2JA8H 1R00A 1YJ9A 1OXVA 1QUQB 2RVCA 3T1HQ 2DLLA 2RN7A 2O8XA 1K78B 5K5OA 4EX5A 4BY7G 2IPQX 1VQCA 1GO3E 5ICFA 3KZYA 4HDVA 2UXBQ 4BXUA 2K75A 5LLQA 1G291 2Z0SA 3M9BA 2CFXA 4K2EA 4UP9A 3R0JA 5K5QA 1DP7P 1YS7A 4MTEA 4ETSA 2PI2E 3BJUA 2HS5A 4DUZQ 1KYWA 3WE2A 3ZJYC 3T8TA 3F8FA 3KEQA 4A3CH 4DV7L 1X6OA 4HJ8A 1XDUA 2LSOA 2DK8A 5H20A 5FLMH 3UDIA 1RNLA 1XSXA 3UE1A 5IY0A 1OYYA 1BC8C 3K1PA 5F6FA 4JI5L 3NBHB 5JEAJ 4LFAL 5M3MG 4YWMA 4IFDG 2C35B 4I0AA 5DDGA 3Q9VA 5LHHA 3V7CA 4OO1I 2KCTA 3WGIA 1WSUA 1I5FA 2Q2EA 2Y0SE 4WXDA 1HZCA 1LEBA 1SD5A 1KU3A 1Z91A 4OX9L 2P4WA 4WWCA 3L7WA 3L9FA 2NNYA 3H0GH 4ZYHA 3KP2A 1G51A 3E6BA 4R4CA 1Q46A 4C2MH 1J2XA 4DK3C 2QZ8A 5HY6A 1XPUA 3ISPA 4GXOA 3IWZA 4A3DH 4DR6Q 2PG4A 1HR0L 3AYHB 5L3BA 5ICEA 1AE3A 1FYKA 4JG2A 2MQHA 5IYBH 1S3OA 1AWCA 2DPDA 3E0EA 3VOEA 1C9OA 2ESNA 4HW0A 4ESBA 3KLOA 2PMZE 3GXOA 1BI3A 2MNAA 3KFUA 2JA9A 2QYOA 1I1GA 4BA2I 1Z9CA 2WFWA 1FP1D 2OBPA 3REOA 1UFMA 2D2WA 2XROA 5JJIA 1TWHH 1I5ZA 1ZLJA 2DFIA 1FJGQ 4JYAL 1D7QA 3KE2A 4A5NA 1XGNA 1BBUA 1IRFA 5DV5A 5A2QK 1LDJA 3GX4X 3Q8DA 1XMQL 5EEHA 3JC66 1IN6A 2YSRA 4QL5A 3RPQA 2HQRA 3B73A 3NELA 4YWKA 2F4VL 4DNCA 4P9FA 3EYIA 1R1VA 2ZJQA 4OMZA 3HOWG 2EQSA 4LFAQ 2K7LA 3M8EA 2B63G 5C4XH 1PV4A 3S17H 3EDPA 5A2QZ 2MO0A 1PUEE 2JT1A 2YX4A 1SD7A 4GLVB 4JI3L 3KP5A 5IT3A 2XKOA 4PCQA 2WB1G 3F8MA 1T0FA 2MA3A 3Q9SA 3S1QH 5AONA 4ZZLA 2KENA 3OYYA 1ZGJA 2BGCA 2D1HA 4S04A 1ZLKA 2ZO4A 3K7UC 4A3FH 3UDFA 1P4AA 4OWTB 4DV3L 1G3YA 5C44H 5LMUL 4IHTA 4P72A 4OIOF 2JA6G 3JAMc 3GTGH 3RLNA 3ICEA 2K86A 3MAJA 1WFQA 5IYCG 1FP2A 3D0FA 3GFMA 3CCRA 2ZMEB 2CG4A 2OQRA 1I94Q 1IZ6A 1VQPA 3D5LA 3ELKA 5IYCH 3DPLC 1HKSA 4HZFA 4JI1L 2M8EA 3RIRA 3JW4A 1XMQQ 1H0MA 1ZGAA 1S72A 3BJ6A 5FLXK 1Z9FA 3PFIA 1IYJB 3B6YA 2OD5A 4JOIA 1DPUA 5ELNA 3J7ZC 1LYLA 4L5IA 2HGCA 4X65L 1B9MA 1VTNC 4NB3A 4JV5L 5M3FG 3JAMZ 1OPCA 3O2PE 3GD7A 1MJCA 2PFBA 3P9IA 1LJ9A 2FNPA 1VS0A 1G4DA 4IRIA 4LUZA 4JBMA 3FM5A 1LNWA 1BIBA 5HLIA 1JGSA 2BBYA 4MNOA 3CPWA 2DUDA 1HNZQ 4L9VA 3BDDA 1MJ9A 2DT5A 2CCZA 3IRRA 1XNQQ 4A3JH 4YFNF 2N8NA 3I53A 5D4SA 1FPQA 4RMFA 2EV0A 2RDPA 1CSQA 4M73A 1SFUA 2DO7A 5CVVA 1SAXA 3S2WA 2NVTH 2JA5G 1WKMA 3KF6B 4HQEA 4X64L 3J80i 4JI8L 1N34L 4MZ9A 4L0YB 4A3KG 4KHZA 2CWEA 4A6DA 4A3GH 3DXJF 1QVGA 3F6VA 1XD7A 1PHJA 2E2IH 4EGZA 3TGNA 4RS8A 3PGZA 1O7LA 1U5TA 3CJNA 3GEZA 1K9MC 2R7FA 1JJ2A 2IP2A 5E20A 4JBKA 2UUAL 3ZPLA 3F2CA 4R4QA 4ZYEA 3DQVC 4BY7H 1YI2A 4U0VA 5J8FA 4HF0A 3KETA 4OO1G 2PQ8A 2XAQA 4LUVA 4NXNL 3T5XA 4I0BA 5IT9c 2P6TA 1PYBA 1BM9A 3ZP5A 5FB2A 3UDXA 3WU1B 4JQFA 3CP0A 3WTUC 4DR6L 2F5CA 4GKKL 2P7CB 2Z3YA 3K8AA 1FBQA 2B63H 4BHBA 4IPAA 3VODA 5FLXc 3R6SA 5M5XH 4KA4A 2FF4A 2BV6A 2GVAA 4EGYA 2JK8A 1R22A 3U4ZA 3J81j 1JB7A 2I5HA 5FGMA 3ULLA 1SMYF 4JCVE 4BBSG 2KJBA 2ZNZA 1AOYA 3ULJA 1FGUA 2WTEA 3QP5A 2W24A 4XLNF 2A8VA 4A93H 1C7YA 1S40A 1KU7A 1PP7U 4MHGA 3CD6A 2B29A 4UVCA 2DK5A 4YCUA 5LEKA 1NHAA 2ZXJA 1KC8C 4C3JH 2XAHA 1P4WA 4KN4X 3H0GG 3FM3A 1R5GA 2GZWA 3H3UA 1YHAA 2VXZA 1UEBA 2UWMA 3V8KA 2ES2A 3J81i 4MGRA 1OXUA 4DV1L 1H95A 4RGSA 2IX0A 4Y13A 1HNXQ 3DP7A 3R0AA 1DGSA 2DQLA 2NVYH 4AYBG 2ZTEA 3M1EA 2KKOA 1L1OA 1WI9A 2A07F 4DR2Q 2VY3A 2E7XA 5HDGA 4DUZL 2QVOA 4ZZDA 1EIFA 5JVTA 1BI2A 1UHWA 1PH8A 4HJ5A 3QU3A 2KHJA 2QQAA 5ILVA 1W4MA 2CWAA 4BHPA 1O3SA 1X55A 3FMSA 1GXQA 1HW1A 1YZ6A 3CCQA 5HS7A 3O3KA 2M1BA 2FEZA 1AE2A 1XJVA 1HR0W 1YIJA 4M9ZA 5HOOA 1QNTA 2O03A 1BBWA 2JEBI 1UE5A 4M71A 5C4XG 2EFOA 2ESHA 5M3MH 4JI0L 3VB2A 4GLXA 5LHGA 2YYZA 1FWZA 1EOVA 1HW2A 4DV3Q 2MH9A 1I94L 1GVPA 2GA2A 4DR5L 1KQ8A 4LB5A 3RZOH 3CCEA 5BOXA 1OKRA 5GAGC 4GOPC 1HSJA 3CCJA 4ESFA 2P7VB 5AIQA 1W5SA 3IWFA 1PH2A 1MDMB 3LAPA 1VQOA 3HTUA 3PO3G 1ZAOA 5D5UB 4HX8A 4KT5C 1FL0A 1IBLL 1FVIA 2GVBA 4EJUA 3TS0A 5FLMG 3I54A 2AMCB 4BXXG 3MEXA 1B4AA 4XBFA 4G7ZF 4LNQA 1JE8A 2XV4S 3T0YA 5D8LB 3WTXC 4G9YA 1JJGA 4O0AA 4KYWA 3CAMA 2NN6I 2HDCA 4BBRH 3NEUA 5C3EH 4UHTA 4JI6L 2A19A 4AIJA 1PYSB 1XGOA 3W6KB 2OQKA 1J5EL 4QY7A 1YS6A 3W1GA 1CKNB 3FXQA 2ISYA 1TW3A 5ERIA 4YCWA 2K50A 1IRGA 5LRRA 2LDUA 5C0XG 4DR4Q 3H3VI 2MLGA 2KHIA 3GTOH 2RV8A 4NHJA 2UU9Q 4WF2A 4PMWA 2HEOA 1QZGA 5LHIA 1J75A 2QM3A 3AFQA 1DDNA 1XDSA 4UP7A 2HFHA 4X64Q 3WTVC 1YG2A 1O57A 4Q48A 5HS9A 1XNRQ 4Y17A 3H92A 5LGNA 1TQMA 1MZBA 3M9AA 3F1ZA 4H02A 5H6RA 2HYFA 2QQ9A 1VQJA 2VW9A 4OWXB 4N0BA 2PJPA 3OOPA 3E5XA 3FZVA 4CXFA 1UE1A 2JPBA 1VQ9A 2E5LL 2B3GA 2E2JH 2VONA 4BHCA 3U1DA 3T8RA 4GN3B 3COAC 4ENJA 1S3JA 2JEAI 4HAMA 2Q2UA 2AWOA 3WTZA 4A3MH 1YJNA 2GIVA 3PUXA 1V43A 3J81Z 4AVPA 4L5TA 4QJFA 4ASNA 2YV5A 4CO8A 2H5XA 4LK1F 4P9UA 4PZ8A 2Q2IA 1XB4A 4MNUA 1WOCA 3FKIG 1XPRA 3RDIA 1VQHA 4BY1H 1F9NA 2K02A 5GAEC 2R7ZH 3NENA 3M4QA 4UVAA 2QBYB 1KHIA 4KI0A 4P73A 1C0WA 1RL2A 3NRVA 4RGUA 4RAZA 3PV0A 4BXXH 1A62A 4DV1Q 4A3MG 1VQ4A 4JI4L 1HNWL 2NS0A 1UB9A 3WGHA 4JV5Q 5F64A 1X3FA 2XASA 3EUHA 3JSPA 3M7NA 3C3WA 3JTGA 1NY4A 4AYBE 1XN7A 3RYRA 2WP8J 1IZ1A 2UXXA 2VBXA 3PIPA 1PP8F 3E3VA 5JJKA 1YIOA 2EB7A 2L3DA 1GHCA 1QO0D 2VE8A 4U0WA 3F8CA 4DAMA 2JSCA 4DNIA 1EWIA 2D62A 2JZYA 1N9WA 3MEFA 2FBHA 3Q5FA 2STTA 3FXRA 2HZTA 2XAFA 3GF2A 4R4OA 4LF7Q 2DBBA 4O2DA 3AFPA 5C0XI 3HHGA 3F8NA 3HTSB 2IW5A 4F7ZA 2OQ0A 1YW7A 2HTJA 3M7GA 1L2FA 1J6QA 2AXLA 4IXAA 3HSFA 1KQSA 4YHHL 4JI8Q 3LQRA 4POFA 4BBSH 4HLXA 5LGTA 3RKYA 4JBJA 4A4IA 4G7HF 1BN5A 2XIGA 4LFBQ 3G48A 1KYZA 1Z1DA 3TS2A 3P9KA 1KAWA 4KLKA 3ROUA 2Y0MA 2UUAQ 2IY5B 5ILUA 2F52A 1Y1VG 3HOUH 1PH3A 4EM2A 5FFZA 3PF4A 1S29A 2FNAA 1HZAA 1FX7A 2NRAC 1QVCA 2PMUA 1X3UA 1VQ5A 1IXSB 1S6LA 2V6CA 4AIMA 2F4VQ 2WWYA 4LF8L 3C1DA 3IHUA 4HBLA 1HNWQ 4I02A 4GYIA 2PQAB 5F1RA 5DLQE 3I0TA 1ZRCA 1P4XA 4LW1A 1ZRDA 3EQLF 3F2DA 4GN4B 5EEGA 3BZ6A 5DCFA 5IP7G 1A04A 4P75A 4LLLA 3LFKA 4DV0Q 1IXRC 4G94A 3HKZE 3R61A 3FX3A 4G8XA 3SFZA 1I3QH 2L4AA 4IPCA 3DLLA 2EFPA 1QQIA 2KIFA 3FMQA 4DR4L 4JI5Q 2VQFL 3K0XA 4P71A 1V1QA 4JI6Q 1KU9A 3FP9A 4ENKA 2HIVA 5L3FA 1JE5A 1I6HH 2KCMA 1EH8A 1J0RA 1UHMA 1J7KA 3ECHA 1OR7A 3K9TA 1YVCA 3LGJA 3BJOA 4L18B 4GKJL 1PH1A 4HV5A 2KRFA 5E7NA 3G6EA 5GADC 1IL2A 1SRUA 3V7RA 4BAYA 5D5WB 1TWAH 4GYGA 1QPMA 1T2KA 2AWNA 3FKIH 2UUBL 1EFWA 2H27A 1W5TA 1XCBA 1KQ0A 1B59A 2PEXA 1D3YA 4M6XA 1G6PA 3K7AH 2K14A 4Y52H 1QVFA 1QGPA 1VQBA 1VQLA 1TBXA 2Z33A 1L0WA 4I01A 3BU2A 3MZYA 4LF8Q 1R1TA 2JA5H 1KGSA 1YYVA 2LF7A 3HSEA 4IPGA 3WU0A 1GVJA 3QAHA 4DQ2A 1Q81C 4PZ7A 2STWA 4DR3Q 2UUCL 3HOVG 2KBNA 3CC4A 3BZCA 2NNNA 1SLJA 2OA4A 2WAQE 1Y1WG 1RZ4A 5D5VB 4G7OF 4FT8A 4WX9A 3P9CA 2EFWA 4LWCA 2HHHQ 3J81c 4IRGA 4UNOA 1SFEA 2K5VA 4B3RL 3EYYA 5DCMA 1G3SA 1UWVA 1IBLQ 3HOYG 3HSRA 3U58A 1PH7A 4DV4Q 3A5UA 3M8FA 3OW2A 1ZYRF 4RB3C 2QENA 4IFDJ 4A3CG 1T6SA 3KZZA 3F2BA 1IW7F 3EN2A 4DAYB 3F72A 1YW8A 4ENMA 1FZPB 2MLKA 3W1BA 4B3ML 3TREA 1NMGA 1Z6TA 3M85A 1UCRA 2YU9H 1W7PA 1XTDA 4XSZF 3CO6C 4APVA 1ZRFA 4YFXF 4RG1A 2W84A 2M87A 4GO1A 3MXNB 5BS6A 5DD8A 1K7AA 2HOEA 1STZA 3GFLA 4A3GG 5JHUA 4O6JA 1YTYA 1FBSA 4G6DA 3OTOL 2HKXA 1R7JA 3F3XA 3SHFA 4AQYQ 4BBRG 2E7WA 5H6QA 3RTRA 3PF5A 1YFHA 1Z7UA 3J81K 3TO6A 2DPUA 1TQIA 5L3CA 2HWVA 1TWFH 1K8GA 3E6MA 1T9HA 2Y48A 4LFBL 4KIFA 2I5LX 5LMNW 1BC7C 1USSA 4UVBA 2I0QA 1IN8A 2YX7A 4K0KL 4GGGA 2UXBL 2F3IA 3GTKH 3STBC 3ULPA 5CVJA 3S1MH 2ID0A 2RQPA 5IT9K 2WV0A 2ADUA 3NQOA 4AD9A 4LF9Q 1L3LA 4DV4L 1EV7A 2IX1A 4HLYA 3M4OH 2VQEL 4DK6C 2JA7G 4LB6B 1EQRA 1REPC 4EJVA 3ERED 4M9XA 4AIKA 4BNCA 4KUMA 3ER0A 2GXBA 3L00A 5AJ3Q 2VBYA 4ME3A 4GOPA 4P5OA 1SMXA 2GN5A 1IN5A 3QPTA 3PO2H 5CJ9A 4E70A 1EIYB 4YG2F 3GFJA 2B0LA 4HQMA 3RZDH 3EBEA 3GFIA 1YBYA 1G3TA 2K27A 3CF5A 4AWXB 4OIRF 1EUJA 4L9JA 4D0PA 3S1RH 4OX9Q 1RUOA 2VN2A 1RIPA 1IBML 4IRHA 4ZH4F 4A3IH 5D6FA 1A8VA 3KEOA 4HF2A 1G3WA 3I4PA 1VQGA 5C3EG 2XGTA 3F21A 1HR0Q 4I09A 2YTYA 4A76A 1SD4A 4M6YA 1VQKA 3HRMA 1B9NA 4A5MA 2A61A 3CPFA 1WRJA 3CXCA 4A3IG 3IKVA 2RCNA 1IN7A 2OU2A 3MZHA 5E18F 1SR3A 3M3YH 2H94A 5E1ZB 3PUZA 4A0ZA 5BPDA 3BPXA 2X0LA 1E17A 4RGXA 3ZMSA 5HGQA 2YTVA 4UUVA 3WGGA 4DV6L 1VQFA 2YPRA 4LK0F 3FHZA 2L15A 1EQQA 4R8HA 4NPSA 3PO2G 1X65A 5ELOA 2W25A 1BOAA 1HQCA 3I4NG 4IJAA 4YHHQ 4A12A 5BPIA 2VQEQ 3AQQA 5JR3A 3LA2A 2ELHA 4JI7L 3EETA 3UDGA 4ENNA 1TNTA 4LUOA 3CCSA 4JBAA 2QBYA 2FXQA 5IP9G 2F2EA 4JOIC 5C4JH 3HFZB 1HW5A 1YHBA 4A3EH 3PIOA 2ZM6Q 5TJJA 3BZKA 4IJLA 3JTHA 2EJRA 1PFSA 4R4IA 4UV9A 1E24A 3ZMUA 4GN5A 3TDUC 4JI1Q 2ZKZA 2MO1A 5FLXZ 2Y75A 5D6EA 4L9NA 5DD4A 1WCMG 2FBKA 3DM3A 4JI2Q 4FDBA 1PH6A 1XMOQ 3ZN0A 4L5RC 4RB2C 5J3BA 4PG3A 2AHOB 3FF5A 2VUMH 2VT2A 1BI0A 2ZJRA 2V1CC 3I2ZA 1N36L 3FXUA 2P5LC 1VQNA 1LB2A 1KA8A 3WTWC 3J80c 3F23A 3I55A 1Y1WH 1LVAA 3PUYA 2PI2A 1Q1EA 2EA2A 2Z99A 2FSWA 1K83H 3STBD 4CICA 2FMYA 5KVRA 4A6EA 1TNSA 1J59A 1K0RA 3WODF 3CUQC 2YR2A 2VODA 4GNXC 2H6CA 2K4BA 3CUQB 1CKOA 3AAFA 2W85A 3ZMZA 3MQ0A 4UPAA 4PGHA 2XRNA 1S7OA 2LF8A 1T98A 1B7YB 3HRTA 4NQWA 4UXNA 4XTCS 3CUOA 5FD6A 3RKWA 1WI5A 1TWGH 2OZ6A 5LBQA 4B3TQ 1OTCA 2FXAA 4A3BG 2J5OA 3HOYH 4GLAC 2OTLA 3BY6A 2EV6A 3BPVA 4XRFA 2J5PA 2NZHA 4K0KQ 5M3FH 1PDNC 1VQEA 3U2RA 2XGXA 4I2OA 1MDMA 1MJAA 1ZG1A 2QWWA 3M4PA 1OXTA 4KNYA 2N78A 1IAWA 1U78A 4L0ZB 4IJHA 4BH9A 3J7A5 4LJZF 1N8RC 1Z05A 4H0EA 3ZQ7A 3CO7C 1HNZL 1E2XA 4WXHA 3NEMA 1XSDA 4OWWB 1YLFA 3N4MA 4KMUX 1YNXA 4UP8A 2VC1A 1YW9A 3TDZC 4CGZA 1TQPA 2ZCWA 4A3LG 3EIVA 3QU6A 2CKZB 1AH9A 2HTSA 1I1SA 3ECOA 3FWEA 1A63A 3GLXA 3L0OA 1VQ8A 2A1AA 1ZG3A 3CLOA 3QOPA 2XAGA 1HSTA 2ASBA 1C0AA 4WXCA 1B1BA 4X66Q 4A2UA 2HYGD 2OAZA 1B8AA 4O3MA 4LF7L 3U4VA 4GS3A 2TDXA 1FBUA 4L5SA 1YJWA 4DR1L 1OXXK 4CDGA 3DF8A 4B3RQ 1Z47A 2JJQA 3G4SA 4I98B 3E97A 1ASZA 3RR5A 2DAOA 3A5ZB 1SMTA 3C7JA 4MEXF 2MFIA 4YY3L 2WAQG 1IBMQ 1S8NA 5J6XA 3IL2A 1NJIC 2RHQB 3PSIA 4IOAA 1QBJA 1FY7A 1NMFA 2FMLA 1KQ9A 3VEPA 2V1XA 1Q1BA 4AIHA 3SZPA 3V8JA 2PNHA 2RGVA 5IWAQ 3F8TA 5CLSA 3ZMTA 4ESJA 1EH6A 2MH2A 4EM1A 4YWLA 4LG0A 1WJJA 1G6NA 2QGQA 2M5WA 4DUYL 1IBKQ 3SZTA 3J80K 1U5KA 4MQ9F 4DV6Q 3T1BA 4DV2L 4HIDA 4CYDA 4OINF 3FHWA 1E3PA 1R36A 3B02A 1I27A 4A3FG 4IOCA 1HKQA 2P5KA 2RKHA 3GTPH 3LA7A 2UZKA 2IHFA 3HOUG 1E7ZA 2YU3A 4NB5A 3LSTA 1M90C 2M30A 4U7BA 3VDYA 4A3BH 1U5TB 1OXSC 2ZFWA 3JAMi 2RC4A 4LF4Q 2UXDL 2DU9A 2CYYA 2KJCA 2IT0A 3J80Z 3E6DA 3F8BA 4DV0L 2DTRA 2EA4A 3L2CA 1XMOL 2LNBA 3PQKA 2ZM6L 1CUKA 4JI4Q 4C3IH 3P7NA 1TWCH 4MEYF 2IJLA 2R6GA 2VQFQ 4EMSA 4N9HA 1TTYA 3LAJA 4UV8A 4KHPQ 3O6BB 5BMZA 3RN2A 3S1NH 3WTYC 4JI2L 3HKSA 3K1NA 2EWNA 2VBZA 3TKYA 5E8GA 2FE3A 4GNXB 2XAJA 2ZJ2A 3LWFA 2L4MA 4CZZA 5IYDG 2OQGA 2IHEA 1MIUA 3HOZH 1SE8A 4S05A 3S15H 1SROA 1FOKA 5ICCA 1IF1A 2HQNA 1BKBA 2ATWA 2OTJA 2HKOA 1CKMA 1PVOA 4HIOA 1QZYA 2VOPA 2VS1A 5LMUQ 2YTXA 4WJ3M 4TVAB 2LKPA 5L3DA 4HF1A 4C3HH 2G9WA 1YITA 4EQQA 2MD5A 1F5TA 2UU9L 1X56A 2CFMA 4IPHA 4J15A 3TQYA 1VCIA 4EQ5A 2FA5A 1UE6A 1V9PA 1JT8A 2ZJPA 4OOIA 3S2HH 3L09A 1XMAA 3G73A 3BOQA 5ILSA 1K8AC 1LEAA 2HR3A 3D31A 4EJTA 1VQDA 1KRTA 2XUBA 1ZG5A 2VBWA 2O6GE 3RNUA 2GXGA 1KRSA 4X65Q 3L2PA 1ONVA 1IUYA 1FYLA 3CDHA 2P5VA 4IHSA 1Y1VH 2D0PA 2R7DA 5K5RA 4X62L 3GVAA 1X9NA 2Q2HA 2VUMG 4PZ6A 2A5YB 3WTTC 1UE7A 1Y14B 2EK5A 3MWMA 4DV7Q 1OMIA 2F5EA 2X4HA 3ZMDA 5J8CA 2HQLA 5M5YH 2ISZA 1MGTA 4L9TA 2PLYA 3KDFA 3L7ZC 1PH5A 1M1KC 2BH8A 4NXML 4YFKF 1XNQL 4B09A 4PGGA 3QP6A 1Z6RA 1E1TA 1K78A 5L3GA 5HLHA 5D8KB 5FD5A 1K79A 1JHHA 2A68F 1CGPA 5GAHC 2V1DA 5IP9H 4Y7NH 5HDKA 4FX4A 1XNRL 5LGUA 2VE9A 3G3ZA 2OZUA 1PH9A 4GKJQ 1T38A 4DR1Q 1USTA 2BYVE 4AQYL 3W5OA 4HA8A 2UXNA 2M45A 4XSXF 2UUBQ 1P92A 3ABUA 1O7FA 1BVSA 4ALPA 1MJBA 2ZMEA 1N33L 5FJ8G 3IKTA 6PAXA 3CTAA 1YQAA 3AEVA 4U7DA 2NZOA 2K4JA 2DQRA 3A74A 2QA4A 2JA8G 4TQUS 3HYIA 1L1OB 4LF6L 2NVQH 2R93H 5IP7H 4GKKQ 1Q82C 4A3LH 5IWAL 1WQ2A 2EXDA 2JTVA 1PH4A 4M9SA 3CMEA 1MKHA 2JRTA 2CQKA 2R93G 2XTIA 3V4GA 4DUYQ 1WWXA 5E8IA 1IBKL 2UXDQ 1FT9A 4LLNA 3S14H 1U8RA 1ODDA 1OYWA 1N34Q 2LSSA 1WCMH 2DGYA 2VL6A 3VFZA 1VQAA 4Z2YA 4G6QA 4DKAC 1K6OA 4NXMQ 3KP4A 2G7UA 5JFRA 2KIUA 1ULYA 4IPDA 4WJ4A 3E5UA 4KICA 3GZ5A 4LF4L 3TO7A 3HUGA 1CF7A 1Q12A 2DW4A 2QEXA 4KHPL 4R1JA 2IT1A 4A3KH 1JMCA 1P16A 5DCMB 1EH7A 4IFDI 3GTJH 4Q4ZF 2JA7H 1IXRA 1W2BA 4LLGF 1LUZA 3I5UA 1ZN2A 1BIAA 3UE0A 3CUQA 4M72A 3E9IA 2IA1A 4KIGA 2E1CA 3F6OA 2CQOA 4GNXA 4OIQF 1HNXL 2V79A 1I50H 2N3SA 4HOBA 1L0OC 3HKZG 3KP7A 2JQOA 1X54A 2V9VA 4IO9A 1GM5A 1V4RA 4A3DG 4EVIA 4B3SL 2L01A 3I4MH 1FYMA 4IF4A 4OONA 2OCEA 3IC7A 1FC3A 5DYMA 3ZN1A 2RF4A 3GDEA 3RLFA 2R92G 3I59B 1O3TA 3HOXH 4LF6Q 4DPGA 1ZREA 3G71A 2W57A 1J5YA 3RYPA 4UY8C 4A93G 5IT9Z 5E1WA 4LMYA 3QPHA 1CKNA 4DR7L 3GTMH 3BJAA 1U0LA 5ED4A 4POGA 1HKTA 3CW2C 5LRSA 2JE6I 3W6JB 3RKXA 4A0YA 4FX0A 5ICGA 4QLCU 2Z9OA 3C18A 1A0IA 3RN5A 4ZYGA 3SQNA 2K5HA 3I64A
chains in the Genus database with same CATH superfamily
2L5QA 4B9WA 3TQNA 5DUKA 2K5NA 4BY1G 4KN7X 5E1XA 4JYAQ 1CSPA 4BEHA 2FQ3A 2WC2A 3HZJA 2IS2A 2LC2A 3VYUA 1D1BA 3IRQA 4RGTA 3CU7A 4KY7A 3D1NI 1GLNA 2K3PA 5H1SE 2X1EA 1B6AA 1SNOA 1YIJI 4ME5A 1Q7YC 2IXSA 3FDTA 2F03A 2A3SA 5KEEA 2IVMA 2MP1A 5HVQC 2EYHA 3G4SI 3SK6A 3MKZA 4BQAA 1C8CA 3T1YQ 1V3FA 5HLGA 5D3DA 3TO9A 1HZ9A 4RB0A 4B3TL 3HOYB 3C1FA 4L5JA 1TZLA 1N33Q 1TXYA 1JT0A 4L5QA 3NTHA 4B8XA 4J00A 2V4DA 3K69A 4JI7Q 2O3FA 3RZDJ 4XLHA 4A3EJ 1VQLI 1TWHJ 1HCZA 2L9RA 1H9TA 3V7SA 2CV1A 3HIFA 2L9HA 3MCZA 1FSEA 2J0TD 2UXCQ 1O7IA 4OXPA 3A0JA 1TW2A 1W7PB 2EIFA 1G6ZA 2G7HA 3TSSA 2LXJA 4DR2L 2E5LQ 3I4OA 2Z5UA 5M5YJ 2P6SA 1HH2P 2QLZA 1W36C 5IPAA 3RI4A 1O3QA 1X3EA 5LL6S 3I90A 1I50J 3J7AF 2X85A 4B47A 3BVMA 4HEA2 3ZGKA 5BR8Q 4IHYA 3OWTA 1NR2A 3I71A 2WAFA 4J01A 5CBEE 1BCPF 3CCJI 3MFKA 1GJXA 1EY9A 3KP3A 1VQOI 4N4NB 1YNJD 1KLGD 2QA4I 4K6LA 2RNJA 1LFUP 3D6WA 1SFXA 1U5TC 2KIMA 1QZZA 2L54A 2WB1E 1R71A 5AJ3L 2KA7A 2Q2TA 2CW7A 1BDOA 4XQNA 2CQNA 2Z6KA 2EYJA 3BDCA 3KF8B 2BXYA 2R7WA 5E1FA 2MC4A 4G57A 2PQAA 3T53B 4KFCA 2ME0A 4R9WA 3NBHA 1XX5A 4RAYA 3CCLA 1KL9A 4LIUA 2BW3A 3DPTA 1XGMA 1X1DA 1VQMI 1XCVA 1QWYA 2WIIB 4EJWA 2E2IJ 3GTLH 3PO3J 1LDKB 3Q0VA 3K4MA 4YIIA 2K4KA 4G12A 3I4NH 3GTKB 4PMCA 2E2IB 1EZ8A 1K73C 1R58A 1WYDA 4A3JG 2VNUD 1D1CA 3OYMA 1TT0A 1HZBA 1T95A 2KZVA 1JXSA 5AIPA 4LGWA 4PQXA 5FKMA 1FNNA 1HA8A 2N88A 4RB1A 2XNAC 3A02A 3T13A 1HUMA 5IE8A 5JEAG 3J81E 1ON2A 4U88A 3H15A 2DA5A 2IGNA 1QZHA 2DODA 1LTLA 3K5OA 1H9GA 4P96A 4KDPA 4KTAA 4F87A 1UMQA 5K5PA 4XM3A 3DEUA 3DTIA 2F0EA 5CVIA 3OYDA 2KPMA 5K36H 2R5YA 1FLIA 3LQQA 1OR7C 3S2DH 1YNND 2VUMJ 1I3AA 1O3RA 3EUAA 3S16H 5CVRA 3H94A 2AS5F 4ZYDA 1ZHFA 3OR2C 3KDFB 4CCKA 3LX0A 1YJ9A 4V2FA 3JRBA 2RVCA 2RN7A 2O8XA 3A0HC 1K78B 5K5OA 4EX5A 3F0CA 2ENBA 3QPSA 1WTVA 1G291 4C3HB 2L1BA 3R0JA 5EBCA 1YS7A 4MTEA 4ETSA 3BJUA 2HS5A 1KYWA 2KCCA 1EYAA 4A3CH 2A68C 2DK8A 2DXIA 2QF7A 5FLMH 3UDIA 1CZWA 5IY0A 1BC8C 5EPKA 5FO9B 2OUMA 3H0GJ 3ONAB 4IFDG 5DDGA 3Q9VA 3V7CA 1SDFA 1YHQI 4UUTA 2Y0SE 4WXDA 1HZCA 1LEBA 1F9QA 2CQQA 2P4WA 3RCOA 1F77A 4R4CA 2QZ8A 5HY6A 1XPUA 2O5IC 3ISPA 1ETOA 4DR6Q 3AYHB 5L3BA 1AE3A 3QQAA 5IYBH 2DPDA 3EPZA 1LFBA 4HW0A 3KIOA 2KMUA 1XX8A 3GXOA 1KDAA 3OW7A 1I1GA 4BA2I 1I4HA 2F6CA 1MMDA 2HCIA 1FJGQ 4XRSG 4A5NA 1XGNA 5A2QK 5EEHA 4E7HA 4DZPA 1AZPA 1UG2A 3NELA 4CCLA 2F4VL 5J22A 2DJFC 4P9FA 4H13C 3WHCA 3M8EA 2JA8B 1MNDA 1WTHA 2B2YC 1PV4A 5A2QZ 1SEUA 2B39A 4F7XA 5IT9L 4GLVB 4PCQA 3MC0B 2DFFA 3Q9SA 1BL0A 1BJZA 5JPNC 4E7IA 1IDZA 3H6MA 3K7UC 4OWTB 4ZUIA 1G3YA 2Z1DA 2JA6G 3PO3B 4CGYB 3GTGH 3RLNA 3OMYA 1NG7A 3KUPA 4HSRA 1WFQA 4KN4C 1FP2A 4BEHB 1STEA 3CCRA 3DPLC 4HZFA 3RIRA 1T5EA 3JW4A 1H0MA 3TP3A 5FLXK 1GHJA 1IYJB 5DTDA 4JOIA 5ELNA 3HL2A 1LYLA 2F3WA 3QWNA 3VR4A 2HGCA 1YRNB 2J7ZA 1VTNC 4JV5L 3PIO3 3X3MA 1OPCA 2NYZD 1JR0D 4OHJA 2J4XA 2MJ8A 2Z4HA 1LJ9A 1G4DA 4IRIA 1ETWA 1YJNI 1UG0A 3BR0A 1LNWA 2V6EA 2KL4A 5HLIA 1JGSA 3LNNA 4MNOA 4E7LA 2DUDA 4DK0A 1HNZQ 3LNQA 1Y69U 2R5ZA 5AFWA 3RUZA 1SAXA 4LJZC 5EJWA 3FKIJ 2AQEA 3GTKJ 4I65A 4KHZA 1QVGA 2Z9HA 2R3ZA 3EROA 1GUWA 1U5TA 1K9MC 2IP2A 2ZXWH 4JBKA 4BXXJ 1WJCA 3KETA 3PSFA 4HF0A 2PQ8A 2XAQA 4N8X1 4DIQA 4DGZA 4LUVA 3T5XA 4I0BA 3ZP5A 5FB2A 2KIQA 2L9SA 3CP0A 2F5CA 4GKKL 3S1RJ 3R6SA 5J3LA 2BV6A 2GVAA 1LT4D 1R22A 4RBOA 1SMYF 5K7ZA 4RKBA 3ULJA 3QP5A 2W24A 4XLNF 1KU7A 3M4OJ 1PP7U 2DK5A 4YCUA 2ZXJA 5T1GA 3T4AC 1P4WA 3H3UA 1YHAA 3IP4B 3J81i 4MGRA 4DV1L 4V19K 1H95A 2IX0A 1SFOJ 3DP7A 2NVYH 1DGSA 1L1OA 1WI9A 3SK8A 2NOGA 2VY3A 3H9QA 3S1RB 4DUZL 1X4PA 2KHJA 2I46A 1R4NB 1BBXC 2ZXHA 1YZ6A 3CCQA 1P7IA 3H5NA 1XJVA 1C48A 4M9ZA 5HOOA 3TP8A 2LRDA 2JEBI 3OL4A 1I94L 2MH9A 2LR8A 5JVH3 2X1CA 4E6IA 4G7OC 1KQ8A 2DJIA 3CCEA 5GAGC 1HSJA 3CCJA 5M9OA 1W5SA 4HR7B 3AB9A 1FVIA 4L8JA 5KGUA 4PJNA 4G7ZF 4LNQA 3SZGA 4G9YA 2Q2EB 4KYWA 3CAMA 2NN6I 2JA8J 2FD5A 4UHTA 1IKLA 2A19A 1PYSB 1XGOA 2OQKA 1II3A 4IQJA 2B2UC 5ERIA 2XB5A 2K50A 4HNUA 1MBKA 5LRRA 2EY5A 1U9NA 3GTQJ 3GTOH 4NHJA 2UU9Q 2HEOA 5IP9J 3AFQA 2R7XA 1XDSA 2K9LA 2HFHA 2NVTJ 1O57A 4MLOA 1MZBA 2TMPA 2VW9A 5CQEA 1R4QB 2E2JH 5I2XA 2EYFA 1F2MA 3T8RA 1I39A 4HAMA 2Q2UA 5D65A 2AWOA 3WTZA 4A3MH 2LVSA 1XTCD 4L5TA 3VA5A 4B08A 5EG0A 2YV5A 1RR8C 2LY2A 3FKIG 1F9NA 2HD3A 3QOEA 4KI0A 2B2TA 2Q8RE 3BDLA 3NRVA 2F0TA 3E5SA 4HNTA 1Y1VB 3L2VA 4IUUA 4C3JB 1UB9A 3OYEA 1NY4A 3T51B 2VBXA 3HKZB 3E3VA 1GHCA 5JJZA 5M5XB 1KDBA 2JZYA 3MEFA 3Q5FA 2STTA 3FXRA 2HZTA 2B2TC 3S17J 2DBBA 1B8IA 3AFPA 5C0XI 3HHGA 1TWGJ 5CBAE 3HTSB 2IW5A 3J80L 2HTJA 3M7GA 3HZXA 1L2FA 4B48A 4YHHL 4JI8Q 2LH9A 3I56I 1KYZA 3BR2A 2M4KA 3ROUA 2UUAQ 3CD6I 4U68A 4C3HG 2HQ5A 1IXSB 4AIMA 5F0FA 4HBLA 4I02A 4GYIA 5F1RA 4RCOA 3CQZB 3CCEI 2CS3A 3OYBA 1WJ5A 1A04A 4LLLA 3ABLH 1NK3P 1Z21A 4ZTFA 3HDDA 4IPCA 2EFPA 4ZKCB 4DOZA 1NAPA 2VQFL 3K0XA 1K8MA 4ENKA 5L3FA 3EQLC 3JRAA 1J0RA 1ZKGA 2DA4A 1HXYD 4L18B 5HNHA 3BZDB 3VSLA 4Y7NJ 4HV5A 2X6YA 1QPMA 1T2KA 1FTZA 2EXZA 3MWYW 2DA1A 1PZKD 4IUPA 1QVFA 1VQLA 4D5FA 4FNFA 2O7OA 3BU2A 3SEQA 1R1TA 3CCVI 2Q8TA 1PRTC 2NVUB 3WU0A 5DM7F 4KJOA 2UV1A 4CKCA 5J39A 2KBNA 5EKLA 2OA4A 1WTQA 2BOLA 3E1SA 4X3UA 2MHVA 4G7OF 4C30A 1O4XA 4WX9A 1EWCA 3P9CA 4UNOA 4B3RL 2PMZB 5T1IA 3HOYG 4BE1A 4N4OB 2HQAA 3A5UA 4IUVA 3OW2A 4Y4RA 4A3CG 3EN2A 4DAYB 3P1HA 1YW8A 1HTPA 1IYUA 2ZJPF 2JN4A 1Z6TA 1Z7LA 1R6RA 4APVA 2W84A 4GO1A 4UB6C 1STZA 4A3GG 1YTYA 4G6DA 3OTOL 3RZOJ 2WY7Q 3F3XA 1E2WA 5FO8B 3PF5A 1Z7UA 4QF4A 2HWVA 1TWFH 1B53A 1SVLA 2Y48A 2QCOA 1I6HJ 1SXTA 5KIXA 2YX7A 4GGGA 2F3IA 2ID0A 3ABMH 3JCUC 2WV0A 4DU9A 4LF9Q 1PUFB 4P2CB 1L3LA 3M4OH 3JRIA 2VQEL 5CMDA 2AO9A 3R3OA 4DK6C 1REPC 4AIKA 2D5VA 4XT1B 2GXBA 4AC0A 2GN5A 3PO2H 5CJ9A 5BNGA 2B0LA 2ZSHB 4OIRF 1J8IA 3S9WA 1U9OA 4Q5VA 4ZH4F 2M9VA 3A55A 4HF2A 4DW6A 2XGTA 2P5ZX 1PJRA 2YTYA 4A76A 1SD4A 1B9NA 3CPFA 3M3YH 5E1ZB 3BPXA 2PNRC 1MH3A 2YTVA 3UNGC 3WGGA 4UUVA 1VF7A 1EQQA 5D14A 1X65A 3I4NG 5BPIA 2VQEQ 1K8OA 2VLAA 2DY7A 3AQQA 2ELHA 3UDGA 2E36A 5EPLA 3K2AA 4JBAA 1EOTA 1GHKA 5E3NA 2F2EA 4AM3A 1S72I 5TJJA 3BZKA 4IJLA 3JTHA 2YS9A 2EJRA 1PFSA 5GTIC 3ZMUA 3TDUC 5FLXZ 1K3BC 5D6EA 3GTJB 2E76C 3D4DA 1T8IA 1UZCA 2VT2A 1BI0A 1OCTC 4DJAA 4QIWB 2PW5A 1A5JA 2VI6A 3J80c 4RHRA 1PRTB 3GTOB 1Q1EA 2EA2A 3HEFA 2TRTA 1K83H 2F0IA 2FMYA 3L2UA 1TNSA 1J59A 3I4MJ 3WODF 5BN4A 4GNXC 4KJNA 3GZNB 3H3VC 1IV6A 2LF8A 4FE4A 3SDBA 3OOUA 1WI5A 1TWGH 2OZ6A 1EY8A 1T33A 4WFN3 3BPVA 4K0KQ 1SANA 5M3FH 1PDNC 1ZG1A 2BY1A 1B2TA 1IAWA 5KAIC 1ENAA 3S2HJ 3OR1C 4G4KA 3HGYA 1X1BA 4FE7A 2HPMA 1E2XA 3S93A 3U1KA 3W2VA 3N4MA 4KMUX 1YNXA 2VC1A 3EIVA 1CI3M 1AH9A 2HTSA 1I1SA 3ECOA 2FQ4A 3ERQA 1Y8RB 1VQ8A 2ASBA 4WXCA 2AQ2B 3DEEA 4DA2A 4ODGA 4CCNA 4DF7A 3U4VA 3IL8A 4L5SA 4DR1L 3DF8A 1I6VC 2JJQA 2LS01 2KCNA 3E97A 3RR5A 3VYSA 3C7JA 2EYMA 2MFIA 3LWEA 1Y8PB 1CFMA 1NJIC 2RHQB 1Z77A 2YUSA 4IOAA 1QBJA 3L2RA 1SNQA 4II3A 3VEPA 1Q1BA 3SZPA 2RGVA 5IWAQ 1MW7A 3F8TA 4ESJA 4QCLA 2MH2A 3RMHA 1RKTA 5C3XA 3H35A 2BXZA 1IBKQ 4K8IA 4HIDA 4CYDA 1HC8A 3FHWA 4IO9F 1BNZA 2RKHA 2IGMA 4OWRB 2IHFA 1DJRD 2YU3A 3RSNA 3FVQA 1VDZA 3DPUA 4U7BA 1U5TB 1OXSC 2ZFWA 3HS0C 1O7YA 2RC4A 2CYYA 3LSRA 2MABA 3E6DA 3HPGA 3D6CA 3DMUA 4L63B 1TWCH 4MEYF 2MSYA 1TWFB 3HOZJ 1O7ZA 2VBZA 1A3TA 2DDBA 3MAQA 3F9KA 1TL8A 2XAJA 3LWFA 3GTJJ 1AW7A 5IYDG 1SE8A 4S05A 3S15H 1SROA 1IF1A 4B9XA 1CKMA 1JB3A 2O4XA 1PVOA 4C3IG 1W0UA 1H9SB 3G2BA 2YTXA 4WJ3M 4C3IB 4G7ZC 5L3DA 2BE5C 4HF1A 3DTKA 1YITA 1F5TA 4IPHA 1Q90A 1DOMA 3CC4I 1V9PA 3OWEB 1YITI 2XUBA 2VBWA 2O6GE 2EJMA 1L0YB 2A5WA 4CYCA 1FYLA 4Z9CB 2Q2HA 2VUMG 1AP0A 3DLLF 2DN0A 1ZKOA 2F5EA 2X4HA 2HQLA 4FXKC 2PLYA 4A3JJ 2LOOA 1JJ8C 4PJ0C 2BH8A 4YFKF 4B09A 3C2BA 1E1TA 1MMGA 3SR1A 5D8KB 2K5QA 1JHHA 4BY1B 2A68F 3NPPA 3S16B 3EFXD 2V1DA 5IP9H 5EYRA 1XNRL 2VE9A 1ZYRC 1PH9A 4GKJQ 3SXHA 3H9JA 2G0EA 3ESWB 2QDBA 1W6KA 2K9MA 3W5OA 2M45A 4CJ1B 4V0BA 1XPXA 3ABUA 1O7FA 1LACA 2DDAA 5FJ8G 3IKTA 1STAA 1YQAA 1PTOF 2K4JA 2DJGC 2JA8G 1J9OA 3OPOA 2NVQH 2R93H 2LBFB 3TW7A 2M34A 1WQ2A 4BXFA 4IFDH 4M9SA 1GV2A 2R93G 4DUYQ 3O13A 5E8IA 4ITVA 2UXDQ 3S14H 1ODDA 5E4WC 1OYWA 5ELBA 1WCMH 2VL6A 4ZC3A 2KEDA 5F0HA 1R5ID 1ULYA 3D8GA 3E5UA 3GLLA 2GXAA 3GZ5A 2IT1A 1WTWA 5DCMB 4IFDI 2VQGA 3X3NA 2A6ED 1W2BA 2XGCA 3E9IA 2IA1A 2NS8A 2E1CA 2CQOA 1OCPA 1L0OC 3KP7A 4DAYA 4IOCF 1V4RA 3I4MH 3QYEA 3OYIA 2KZGA 4Q0FA 3I4NB 3BG6A 5DYMA 3RLFA 2R92G 2VQHA 1SMYC 2H1KA 4DPGA 2VJ5A 1WVLA 2F0VA 3PUFA 3QPHA 1CKNA 5FOBB 3BJAA 5LRSA 2A6HD 3W6JB 3C18A 2K9NA 3OIPA 4LG3A 2IS1A 4LFUA 5HNFA 3U9GA 4I7HA 4FF1A 2E1NA 2NN6G 5TRDA 2COMA 1FJGL 3CCVA 2F0MA 4K2LA 1EYCA 2B2VA 5L3EA 3D4WA 3QOJA 2KRCA 5HGTA 3ITPA 1N36Q 2XSCA 3BTLA 5HS8A 3NBIA 3BYTB 4GFBA 5GQOA 2V26A 3TOBA 1S5CD 1XG1A 3SE0A 2O0YA 1JORA 1B4OA 1JQYD 1PRTF 2BA1A 3VYTA 2LMCB 3RPUA 2F5DA 2NVXH 2I8DA 2F4OB 4HDUA 4Y15A 1NTCA 4QIWE 1Y56A 1ASYA 4LAAA 4XLPF 4NXNQ 1N32Q 1U6GA 2CMPA 1VQ6A 4R1HA 4B3MQ 3E5QA 4N9IA 2M3AA 3RJPA 1VZ0A 3JAMK 1J9IA 4Q5SF 3HOUB 2F0SA 3OTOQ 3HRSA 3KF6A 3OMGA 4J8QA 4LF5L 4ZDPA 3LSPA 3MVVA 3FK7A 3DV8A 5IODA 1XPOA 4RAFA 4EATA 3JR9A 3K57A 2CRGA 4A3JB 3GV6A 1ZARA 1HBXG 2R92J 4LFCQ 3TP5A 5CR3A 3HC7A 4HMIA 3ZMVA 3PIOF 4HIKA 4X62Q 2ZSIB 4U87A 3OSFA 3KJOA 1BJAA 3HOZG 3KFWX 3AG1H 1WVRA 5JJLA 3MD2A 3WOFA 2ETHA 3CC2A 3TMOA 5GADJ 3OYFA 4IVNA 2L7KA 2GAUA 3JRDA 3HKZA 1U4PA 1ON1A 5KYLA 2JA5B 2VZAA 3B6CA 4JI0Q 3ZQCA 1XSVA 4AH6A 4ZAIA 1BOSA 2GA1A 1BA5A 2CUZA 2JP1A 1NH3A 2M9HA 2M0CA 4IUQA 3HOVH 2JSPA 2K85A 1R1UA 3WTSC 3QOLA 1OFCX 3BP8A 3J7AO 2VOOA 1PFMA 2BHYA 4X6AH 1UHSA 5KNCA 2ZNYA 4TV7A 3NWSA 5D4RA 5C44G 3KYHC 3TP6A 4A3IB 1ENFA 3ML6A 1K83J 5K1YA 4DV5L 2LTPA 2DJNA 4KMFA 3ERMA 4OELB 1SFOH 4BY7J 3I4MG 2DA7A 3KF8A 4HJ9A 4EGVA 4NP5A 4XQJA 2GA4B 2E2HH 3GO5A 3SXYA 1BBYA 2Z6KC 3T1YL 1STNA 2RA4A 4KMUC 2TCTA 5I9PA 4R79A 1I6XA 1RTNA 2OV7A 2GIZA 1YEZA 4R4TA 3S2DJ 2QQBA 3D5RC 2L0CA 2BH2A 4HPQA 4PDKA 1N32L 3DBLB 4CBVA 3K70C 3LSHA 4MTDA 4QWQA 4HNVA 3HUGB 1STGA 1P6RA 2P0WA 2LFNA 4AU7A 4I7AA 3ND8A 4Q47A 5GP9A 2UUCQ 3KLNA 2R92H 2X48A 1U8BA 1R23A 2NYXA 3K2ZA 1B70B 2DOFA 3S1QJ 3DKXA 1ZH5A 2Y0SB 3ULQB 2HHHL 2F5FA 3HHHA 3Q23A 1TT2A 3DXJC 4LFCL 1VQPI 4RGRA 3F22A 2HIXA 3K80C 3CMYA 2R7ZB 3ABTA 1GUOA 2CSOA 2DMUA 4BQNA 1S7AA 3HP3A 1D8KA 2SNMA 1A15A 2VJ4A 3ZYYX 5BR8L 4RAGA 1XGSA 1TU2B 2OWOA 2KT0A 4TSSA 3OMCA 1YX5A 1HHVA 3TRZA 1MBGA 1X2NA 4P74A 3KJPA 5CV7A 5CYVA 5LMNL 1K3RA 4PJJA 3RQ4A 4EM0B 1ZR2A 1VQIA 3KOJA 3GTQB 1WHUA 2F1MA 2V1UA 2JA8H 1OXVA 1QUQB 1LTID 2IAIA 2JVHA 4KJZA 1JKOC 2CVRA 3BLYA 4HDVA 2UXBQ 5IGFA 2Z0SA 3IAS2 2LREA 4OAZA 3BR3A 3LFUA 3WE2A 1QCBD 2L4NA 4DV7L 2EQRA 4UY8I 1X6OA 4HJ8A 1XDUA 3UE1A 3NK9A 4JI5L 5JEAJ 4YWMA 2C35B 2CHBD 3NTKA 1SD5A 3MVPA 2KUMA 4WWCA 3H0GH 4DBQA 4ZYHA 3KP2A 3E6BA 1QPIA 4C2MH 3GCMA 4A3DH 2PG4A 1HR0L 5DEHA 3J7ZI 1FYKA 1S3OA 3E0EA 3OYLA 2JSOA 4ZLTF 4ESBA 1V8QA 2PMZE 1TKWB 1WZ2A 2JA9A 1SNPA 2QYOA 3AFHA 4XRMA 1Z9CA 4FP5D 3IV5A 2OBPA 1LABA 2X9DA 2XROA 1W6JA 1FMWA 2K5CA 4JYAL 1D7QA 3KE2A 1QZEA 1BBUA 1IRFA 2PZUA 3Q8DA 1LDJA 4X3SA 1XMQL 2AXTC 1IN6A 2HQRA 3WOEA 4NKLA 4MFDA 4IZ8A 1HA6A 5IGCA 1R1VA 2ZJQA 4F52A 4LFAQ 2B63G 5C4XH 3S17H 4BDZA 2BY2A 3E6ZX 2YX4A 1SD7A 1OCZH 2XKOA 4AIDA 2ICEC 3S1QH 1J09A 4TRDA 1B3QA 2D1HA 1F9SA 4A3FH 3FXKA 4DV3L 5LMUL 4IHTA 4OIOF 3JAMc 2FMMA 4XMYA 2VJJA 1MNEA 1IC8A 1KNEA 5IYCG 3D0FA 1I94Q 1IZ6A 1VQPA 3D5LA 2ZMEC 1HKSA 5FRNA 4JI1L 2RSNA 1IV8A 3ZQFA 1JKPC 5K7FA 3H09A 2E2JB 1DPUA 4BBRJ 5M3FG 2XWBB 1SYFA 4XICA 3JAMZ 3O2PE 1MJCA 3P9IA 2FNPA 4LUZA 3FM5A 1BIBA 2BBYA 3CPWA 3BDDA 3J7AY 2DT5A 3IH2A 1XNQQ 4A3JH 4YFNF 4M3EA 1FPQA 2VPRA 2EV0A 1RESA 1CSQA 1Z67A 1SFUA 4OAYA 2JA5G 2NVTH 4R8NA 4JI8L 3TP0A 4MZ9A 4A3KG 3DXJF 2RREA 1XD7A 2E2IH 4RS8A 3FXMA 3CJNA 4NC7A 1JJ2A 3KBXA 2UUAL 2SNSA 1OO9B 4I6ZA 1YI2A 5J8FA 1D1AA 4OO1G 1PYBA 2XIWA 3WU1B 4JQFA 3WTUC 4F55A 1L0XB 1HCRA 2P7CB 2Z3YA 1N75A 4HMJA 2B63H 1HRJA 4BHBA 4IPAA 3VODA 5FLXc 5KHDA 1AHDP 5M5XH 2FF4A 3M07A 5JLWA 3HOXJ 2JK8A 5GAGJ 1BR1A 1JB7A 2I5HA 1A35A 1DU0A 4BBSG 4JCVE 1AOYA 1FGUA 2WTEA 4A93H 4FCYA 1C7YA 1DOLA 5DNFA 2DA2A 4UVCA 3WU2C 3AMUA 2QCPX 5CC4A 3CJQB 5LEKA 1TS5A 1NHAA 2I5UA 4KN4X 1R5GA 2W48A 1OXUA 3CC7I 3PIPF 4Y13A 1HNXQ 3R0AA 4AYBG 2DQLA 3M1EA 4UDUC 2KKOA 1WFXA 4ZZDA 1EIFA 1PH8A 1ESFA 3QU3A 4XQFA 1W4MA 4M3GA 2CWAA 1O3SA 1X55A 1GXQA 2HOTA 2M1BA 2FEZA 5F2DA 4XR6A 1AE2A 3AG4H 5C4XG 5M3MH 4JI0L 1VQNI 1VMCA 1FWZA 4DV3Q 1PZID 1GVPA 4LB5A 4J1MA 4GOPC 4ESFA 1VQ5I 3CP8A 1PH2A 4AVZA 4N8FA 2R7QA 1S7EA 4C2MB 4HX8A 1FL0A 2GVBA 2A69C 3TS0A 2HNHA 3MEXA 4XBFA 1ETYA 4CA0A 2ZC2A 2XV4S 2RDGA 5D8LB 3WTXC 2D9UA 2ICWG 1ILPA 4O0AA 1JJGA 3FXOA 1SNMA 5C5LA 2RVLA 3HJEA 4RGOS 4JI6L 4BBRB 3W2WA 1A2UA 4FTHA 2Y9ZA 1CKNB 2ISYA 4YCWA 5I4DA 5C0XG 1AA7A 4WF2A 4PMWA 3HRZC 1DDNA 3VDXA 1YG2A 5LGNA 4LMQD 3I4NJ 2VUMB 3M9AA 5H6RA 1BCPB 3DU5A 4N0BA 3OOPA 3E5XA 3HGGA 4QUFA 4BHCA 3GMEA 2JEAI 3SHLA 1YJNA 4JX6A 2GIVA 4NDLA 4ANJA 1HDDC 2QSFX 1F43A 3PUXA 1V43A 4LK1F 4P9UA 4PZ8A 1WOCA 4BY1H 4QIWN 5KYIA 2K02A 2R7ZH 1EY5A 2L9VA 2QBYB 5FKOA 4A3FB 2D2CC 3CJRB 4I7ZC 4RAZA 3PV0A 4BXXH 4ZDOA 1A62A 5M5YB 1VQ4A 4JV5Q 3OSGA 2X1DA 2XC7A 1BXTA 3EUHA 3C3WA 3JTGA 3J7YJ 2O2LD 4AYBE 3U9SA 2Z16A 3PIPA 1SBBB 2VE8A 1PXUA 3NE5B 2FBHA 1WD1A 1X2MA 2HXOA 4LF7Q 5CYUA 4O2DA 2LK2A 4QPQA 2A69D 1X1PA 1KQSA 1T08B 1ILQA 4POFA 4JBJA 4A4IA 2MG4A 2XPVA 2M2EA 2XIGA 4LFBQ 1Z1DA 3P9KA 2E1OA 1A3VA 5FFZA 2FNAA 4K2KA 1KLUD 2PMUA 5FROA 4K8JA 3MKLA 1YJ9I 2KDOA 3C1DA 3IHUA 1HNWQ 5DLQE 1P4XA 1ZRDA 1LO5D 3KPHA 1SFOB 2MYSA 5IP7G 5KRUA 4G6TB 4DV0Q 1LTBD 4XKWA 3R61A 1ZTRA 4C2UA 1WH5A 2KIFA 3BVZA 4JI5Q 1JTYA 1WH7A 1KU9A 1JE5A 1J7KA 3C2PA 3K9TA 3CZ6A 3QPLA 2HDMA 3BVGA 2KRFA 3JRFA 1IL2A 3V7RA 5D5WB 3QODA 2H27A 1W5TA 1XCBA 1KQ0A 2PEXA 3LOCA 3VYTB 4XDXA 2K14A 4Y52H 2Z33A 4I01A 3MZYA 5F0CA 4LF8Q 5E4XA 2L7FP 4EQOA 3SEBA 5IYDJ 5IOZA 2OT2A 5KAFC 4PZ7A 4IHWA 1E0BA 1TVXA 2XF5A 3HOVG 2HXIA 3CC4A 3A8JE 2WAQE 3S16J 5D5VB 2JK3A 4LWCA 5FJ8J 3HSRA 3U58A 3M8FA 2KECA 1ZYRF 3KZZA 2A68D 2K7VA 1IW7F 3F2BA 4BACA 4A3GJ 4BE2A 4LK1C 4IHXA 3TREA 1HQMC 1UCRA 2R61A 1RODA 3CMMA 3AG2H 5C4JJ 4XSZF 3CO6C 2E5NA 4RG1A 5BS6A 3GFLA 5JHUA 1TY0A 4O6JA 5EQ0A 4BJ6C 2E7WA 2KEEA 4N9PA 1YFHA 3J81K 5KNLA 2LY9A 1QVUA 1Z3XA 2CQXA 3DEOA 3E6MA 1T9HA 4LFBL 2I5LX 5LMNW 1BC7C 1USSA 1IN8A 4K0KL 2UXBL 3GTKH 3ASNH 3ULPA 5CVJA 5IT9K 2SDFA 4D7MA 4ZTJA 1EV7A 1POGA 1EKEA 2JA7G 1EQRA 3MKYB 2F3VA 2M00A 4ME3A 4GOPA 4P5OA 1SMXA 2VQLA 5CGKA 4RKLA 1RCVD 4YG2F 3GFJA 3RZDH 3EBEA 1G3TA 2K27A 2YU9J 3CF5A 4AWXB 3CCMI 3CCQI 4L9JA 3S1RH 1RUOA 1YNNC 2BE5D 3M3YJ 4IRHA 2RKSA 1JWUD 4A3IH 3TW6A 3KEOA 3FXJA 3I4PA 3F21A 1HR0Q 3S3MA 3V42A 1WRJA 3IFDA 4A3IG 3RD4A 2RCNA 5DAUA 3K7AJ 3MZHA 5JVG3 1HUNA 1JCKB 2H94A 4A0ZA 5BPDA 4IOAF 1EQVA 1LT5D 1EEID 5HGQA 1LFPA 2YPRA 4LK0F 2EZIA 3G1OA 2W25A 3HBLA 1HQCA 4JI7L 3EETA 4ZUJA 3FKIB 1QNUA 2L5TA 1YHBA 4A3EH 2IGKA 1O80A 3PIOA 4CCJA 4IX7A 4R4IA 4XLEA 2HVRA 2Y75A 4L9NA 1TT5B 1WCMJ 4FDBA 1PH6A 3ZN0A 4L5RC 1TP4A 3CF5F 2LP0A 4RB2C 5J3BA 3TBIB 4PG3A 4CKEA 3FF5A 4PUSA 3WTWC 3I55A 2NBFA 1Y1WH 1LVAA 2PI2A 4A3DB 2ZB9A 4M1UB 5EGTA 2Z99A 2FSWA 4A6EA 1FTTA 2KHSA 4FF4A 2YR2A 2VODA 3H1CA 3AAFA 5FRMA 4RGMA 2W85A 3O8HA 4UPAA 2R0QC 5C4ZA 1X4OA 1B7YB 3HRTA 4NQWA 2HDLA 3CUOA 3RKWA 1UNSA 4BWGB 4A3BG 3HOYH 4XRFA 1VQEA 4I2OA 3M4PA 2QW7A 2LY1A 3M8JA 1OXTA 4E7ZA 4L0ZB 3J7A5 3PIP3 2XGDA 1GXDC 3ZQ7A 3CO7C 1EY0A 3C2GA 3S1MJ 4FF2A 2PJRA 1TQPA 4A3LG 3I91A 1TY2A 3QU6A 3HGBA 3FWEA 1KTKA 2DT7B 1GUTA 1ZR4A 2XAGA 1HSTA 1C0AA 4X66Q 4A2UA 1NK2P 4C1NK 4BJ5C 1B8AA 5B1BH 5F1JA 4GS3A 1NSNS 3SEZA 3P7JA 2DAOA 3ZQLA 2IX3A 4Z6YA 5HODA 4YY3L 1H88C 1S8NA 3GTGB 4N9TA 3NARA 2W7NA 4EQNA 3I3LA 1FR3A 1FY7A 3K7AB 1NMFA 1Y39A 1KQ9A 3C1EA 2V1XA 3PFYA 1BUVT 5CLSA 4DZJA 3ZMTA 3MFYA 1IW7D 4DV6Q 1U5KA 4A3FG 1R36A 3B02A 1I27A 4IOCA 1HKQA 2P5KA 3OYGA 1CT1D 5FLMJ 5LL6X 1GUNA 2EY6A 2XDVA 2M30A 4CJ2C 4A3BH 4NDXA 4LF4Q 2KJCA 2V7FA 2EA4A 5F04A 2WKDA 3SDZA 4E7JA 2VKEA 1RETA 2R7UA 1ET9A 1CUKA 3P7NA 4F3QA 2IJLA 2VQFQ 4W97A 1K4TA 4EMSA 3H0GB 3NWTA 4CHTB 3LAJA 1E3HA 3I73A 4M3FA 2OTLI 4J6HA 2FE3A 3FRPB 2L4MA 2OQGA 2IHEA 3QR8A 1ZEQX 3KLSX 1PYWD 4QB4A 2ATWA 2OPTA 4NW2A 5C44J 2KVMA 4HIOA 3H9GA 5H2FC 3FXLA 2VS1A 3SK5A 1P7JA 2CU7A 3M1CA 5LD2C 2MD5A 2H4OA 2CFMA 3TQYA 2VIXA 1BF4A 4D1QA 3RZOB 3P5JA 3I72A 4EQ5A 2ZJPA 3L09A 3G73A 2L12A 1KRTA 2CV2A 2BDOA 2BVLA 3OY9A 1IUYA 3E3XA 3DTEA 4K5WA 4IHSA 4F91B 3BTIA 4X62L 2B8GA 2G5DA 3MWMA 3G71I 1OMIA 2K1BA 3D4RA 3D5SC 3ZMDA 4Y33A 2XRSD 1MGTA 3KX2A 1FNUA 3IH3A 2QGUA 2B9SA 5IIFA 1GDTA 3L2WA 1IW7C 2LD5A 5HDKA 4FX4A 3RZDB 5LGUA 3D3RA 1SJHD 2OZUA 1USTA 4HA8A 2DNEA 1GV5A 4XSXF 2QKLB 1BVSA 4ALPA 6PAXA 3CTAA 3AEVA 5J47A 4U7DA 5HLTA 3S3NA 3A74A 4C2TA 4JVZA 2B63B 1RD9D 1WJBA 4LF6L 1UUPA 2WADA 4GKKQ 3X2QH 1W0TA 1R9TJ 1PH4A 4B43A 1Y1VJ 2XTIA 3P75A 1TWHB 2DYRH 2A5HA 1U8RA 2ID3A 2LSSA 3LMMA 3FBNB 3VFZA 1VQAA 3LWUA 4NXMQ 4H0LC 4BL0B 2KJXA 4A3MJ 4KICA 4C3JJ 3GTLB 4LF4L 3TO7A 3KYDB 2QEXA 1G2TA 1EH7A 4XONA 3GTJH 4BU2A 4Q4ZF 4LLGF 1KZHA 4OL7A 1ZN2A 3UE0A 3CUQA 4KIGA 4UUSB 3F6OA 2XSDC 4BBSB 1X54A 1Y1WB 3A01B 1TC3C 4EVIA 4XNFA 1FYMA 3J7AV 2OCEA 3GDEA 1O3TA 4LF6Q 5M3MB 1ZREA 3RYPA 1ET6A 1XTAA 4A93G 4DR7L 5J1ZA 1MNMC 5L37A 1U0LA 4A69C 4POGA 1HKTA 3CW2C 3RKXA 4Y7NB 2C5CA 4FX0A 5ICGA 1H9SA 4ZYGA 1W5CC 5CV9A 4XKVA 3I64A 3S14J 2M0MA 4WJWA 1AEXA 1BQQT 5EAYA 2C6YA 5FFXA 1OCRH 2A6EF 2XVCA 3PQJA 3BDOA 4BBSJ 1MKMA 3PUVA 2MC3A 4EEFG 3OV8A 4KIBA 4IQ4A 1D5VA 1IHZA 1Q8KA 2ALYB 1KIXA 2IA2A 1RUNA 2XKPA 3CCMA 2PJRB 4ON0A 1VQMA 2MUYA 1ACIA 5E17F 1W3SA 2RHSB 4FF3A 2KP6A 1GD7A 3CQZJ 4WCGA 1FIAA 2PBIA 1QUQA 4IHVA 3I58A 4HSPA 4DV5Q 2MD0A 2A69F 2UXCL 3QRFF 4JI3Q 2Y31A 2E71A 3D0SA 5C0XJ 1Z7TA 1L1OC 1VF9A 3K4KA 2MBFA 3I4MB 1STHA 2V1NA 2NVYJ 5KK1A 2ECBA 5GROA 4D9JA 3VYRA 2BY3A 1P8LA 3E6CC 3VR3A 1G8XA 2H1EA 1IO2A 4GDFA 2EILH 4JX5A 2EV5A 2W1OA 2VC0A 3SDGA 4YIJA 3GZ6A 4J19A 2AUJD 3M4YA 1KU2A 3GQBA 4EV0A 2D45A 2X69A 2NVTB 2K52A 1DD2A 1OCOH 3DFGA 5HDNA 3I7FA 2G9HD 1B3AA 2PZTA 2R7RA 4XLCA 3K0LA 1B44D 2COBA 5TISC 4QQBX 2M2LA 4HX4A 4JC0A 4WK8F 3A03A 2DI3A 2QUFA 3CCUA 4YIFA 2PI0A 2FRHA 4YEJA 5CV4A 1WJAA 5JAVA 4XK4A 4MTNA 5EGOB 3TEHB 4XN3A 1EL0A 3DEPA 3VA7A 2HT1A 3K4NA 1LQ1A 4HSTA 3HRUA 1LE8B 2L0KA 5M3MJ 2DCEA 2QEJC 4PZJA 4JX4A 3GWZA 2CWPA 1KXLA 2BA0A 1D8JA 1JOOA 2A05A 5E3MA 3GTOJ 3GTQH 3DLAA 1FEXA 3LA3A 4NQWB 3CCRI 3I59A 1U2WA 5JI6A 3W3CA 2KDZA 5ELDA 3M3YB 2XWJB 2PX9A 4DAPA 2R7SA 2FJ2A 1SYDA 3O8GA 1QE6A 4OMYA 2Y2ZA 1B1ZA 3CMAA 4XIGS 4E7KA 1BCPC 2FX0A 4JOMA 4BS9A 1PVEA 4M8AA 1J5EQ 2DMNA 1P2FA 2IW3A 2JPCA 1IDYA 3H3ZA 2Z1CA 3TMEA 4IURA 2Y69H 2ZJRF 1X58A 2WAQN 3FMRA 2FOKA 1U3EM 2GOMA 5F27A 2B63J 4PK4A 3WG9A 1FD7D 4YY3Q 1DZ1A 5E3FA 4BA1I 2BZTA 1FSHA 4DYRA 1GKHA 2PQEA 1LTTD 4GOPB 2LLKA 4XRSA 1AKHA 1UELB 4CHUA 3GW2A 2X6LA 4JYKA 3IFTA 1CF7B 2R93B 2NVQB 2VT3A 5FLVA 2LKVA 2E8GA 2CGPA 3N05A 2NAZA 1NBWA 2O61A 2DOEA 1MMSA 1E3OC 1CQFA 4DR3L 3S32A 2WB1A 1JKRC 3KP6A 4A3LJ 2MW8A 3K5MA 3TDQA 1XMKA 5FJ8H 1DUXC 3V2TA 1HXDA 1GVDA 1X1CA 3I9V2 2NS7A 2Q0OA 1RIOH 3BT9A 4FASD 1YHQA 1R4PB 1EY4A 2O5JC 1EYGA 3GUDA 1OQYA 3K1MA 5IYBG 3BYYB 3ZQQA 4X1EA 4OIJA 1NTGA 2WINB 2AUKA 1YO5C 2B8FA 2HUGA 1RRJA 1K6YA 1SNDA 1EU4A 4NMZA 3VYUB 1U4RA 4HV6A 1V1OA 2CQ7A 2H6BA 1R00A 1BO0A 3PL8A 4BY7G 2IPQX 1VQCA 3OYHA 1GO3E 5FKAC 4BXUA 1GUSA 2K75A 5LLQA 3M9BA 2CFXA 4K2EA 2IEKA 5K5QA 1DP7P 2ZFUA 3R2TA 1JTXA 3KEQA 2N55A 3CCYA 5M3FB 2LSOA 1EFID 5H20A 2E34A 3NUCA 5C4HA 1RNLA 1XSXA 5F6FA 2EVBA 1ZXTA 2H1LA 5M3MG 5K7HA 4C3HJ 1N77A 4OO1I 2KCTA 3WGIA 1WSUA 2DA3A 2E75C 2Q2EA 1KU3A 1H9JA 4OX9L 3L9FA 1Q46A 4BUPA 1DQUA 4GXOA 3IWZA 2W00A 2MPMA 4A3KB 1PFBA 4IUNA 5ICEA 2MQHA 2GOXB 1AWCA 3VOEA 3GTGJ 3CRLC 1JUPA 1C9OA 2ESNA 1D0XA 1GUUA 1EA3A 3KFUA 5B1AH 4CDEC 4WRDA 3CJTB 2WFWA 3REOA 1Q1VA 1UFMA 2D2WA 1TWHH 2JYOA 1ZLJA 1YX3A 1MBJA 5DV5A 3GX4X 2KFDA 1BW5A 2YSRA 1CK1A 3RPQA 1EZ6A 2BY0A 1MBEA 4YWKA 4DNCA 1NUCA 2K7LA 2F0FA 3I4LA 3DWPA 3NTIA 3VWBA 2MO0A 1PUEE 3KBGA 3KP5A 5IT3A 2M7BA 3F8MA 4OO1H 4RDUA 3NXWA 3QWLA 1T0FA 1VQ7I 2BGCA 3ONQA 4S04A 3Q3SA 1ZLKA 2O8KA 1QA6A 5IT9E 1Y8NB 3UDFA 1P4AA 5C44H 4P72A 5CORA 4TKOB 5EZGA 3GFMA 2CG4A 2FOWA 2JVGA 1MIJA 5J4VA 5IYCH 3HOWB 3QJYA 1ZGAA 1S72A 3BJ6A 3PFIA 1WGXA 3R8BA 4L5IA 5EZHA 4NB3A 3OYAA 1BW6A 3GD7A 3RKQA 5FKLA 1Y0NA 1VS0A 4JBMA 2GLOA 3HEJA 4L9VA 2VKVA 1MJ9A 2CCZA 1PTOD 3I53A 5D4SA 4M73A 1TS3A 5CVVA 3S8PA 1PMRA 2X6OA 1IJWC 4ZK9B 4X64L 3J80i 4XIDA 4L0YB 3A7LA 1PHJA 1T5XD 3PGZA 1QILA 2XF6A 2RDFA 4MTKA 3F2CA 3DQVC 4U0VA 1OLTA 3WG7H 4AYBB 2E5ZA 1BM9A 3UDXA 4DR6L 5C4JB 1FBQA 1D5ZC 1PZJD 4KA4A 1TS4A 3A4CA 4EGYA 3J81j 4P1WA 1V55H 2HI3A 5FGMA 3ULLA 2KJBA 2ZNZA 3LSJA 1SYEA 4MHGA 1Y8QB 1PFNA 3L3OC 4ZQ3A 3FM3A 2GZWA 2A73B 3UKGA 2UWMA 2PYKA 1IG7A 2ZTEA 2HVSA 3BG9A 4DR2Q 4XT3B 1SYCA 1TWAJ 2QVOA 1UHWA 4RMNA 2K28A 2QQAA 5ILVA 1SNCA 5E79C 2A6TA 1HW1A 5TGTA 3LL7A 4FQGA 5HS7A 2JA2A 1YIJA 1QNTA 5IGDA 5IOCA 4M71A 3MTSA 2ESHA 4RH6A 2OEOA 3VB2A 4GLXA 3MZ8A 3DKYA 1EOVA 3S17B 2K3FA 2GA2A 2B2WC 1XC5A 3RZOH 5CV5A 3IWFA 1MDMB 1VNDA 2QKMB 1VQOA 2JA6B 3PO3G 3MA2B 4I76A 4KT5C 1IBLL 2L7MP 4EJUA 3KYLA 4MN3A 3I54A 5FLMG 4BXXG 5EJCA 1B4AA 2ZXIA 4XQQA 3S1NJ 3T0YA 2E74C 2XSJC 1D0YA 4W1UA 1M1EB 4EQPA 3NEUA 5C3EH 3W6KB 3S14B 1J5EL 4QY7A 1YS6A 3W1GA 5I9OA 3FXQA 2LMDA 1IRGA 1TWCB 2LDUA 3H3VI 2MLGA 2KHIA 2RV8A 4A3CJ 2JRMA 5EKKA 4UP7A 4X64Q 3WTVC 1H9MA 4Q48A 5HS9A 1XNRQ 4Y17A 3H92A 3NHHA 2XN9C 2Y0SA 1XXGA 2HYFA 2QQ9A 2BHZA 4OWXB 2PJPA 3FZVA 4CXFA 2JPBA 1EYDA 2E5LL 2VONA 3CMAI 1VF5C 1S5BD 3COAC 3FPUB 2K04A 1ONLA 3KLSA 4AVPA 4QJFA 4ASNA 4CO8A 4ILWA 1XB4A 5G3LF 1VQHA 1ENHA 5M5XJ 3LSGA 2K01A 4MFEA 1RL2A 4RGUA 2BDNA 4A3MG 2ELKA 5F64A 1X3FA 2XASA 2VXDA 1GOZA 4A3MB 1XN7A 1FOXA 2R92B 5JJKA 1EEFD 2EB7A 2L3DA 1QO0D 1QOHA 4U0WA 4BGDA 2BCOA 4JPBW 4DNIA 2D62A 2Q8IB 4R4OA 2M8GX 2DA6A 2CFOA 1MGSA 4F7ZA 3CESA 1S9HA 1YW7A 1I4PA 3OHXC 1J6QA 2AXLA 4IXAA 4OEMB 2XF7A 2B2YA 1UJ8A 3G48A 3TS2A 5ILUA 2IS4A 1PH3A 4EM2A 4CH7A 1S29A 1HZAA 2NRAC 4X6AJ 1QVCA 1VQ5A 2V6CA 1HTLD 2WWYA 1B72A 3MZ5A 1LUJB 1F9RA 2I10A 3I0TA 3F2DA 4GN4B 3BZ6A 2K9QA 1IXRC 3HKZE 3A7AB 3PQIA 3SFZA 1I3QH 2L4AA 1JE4A 4DR4L 4HRIA 4P71A 2DY8A 4K14A 2VJIA 3CHBD 1UHMA 4DFAA 1OR7A 1YVCA 3LGJA 3BJOA 1LTGD 3Q0AA 1ERDA 4GKJL 2OJED 1PH1A 3BCAA 5E7NA 3R2IA 1SRUA 4GYGA 3FKIH 1N25A 3EA6A 1E2ZA 2X6WA 5J1YA 4M6XA 1V1PA 1G6PA 4HSVA 1QGPA 2F0WA 3W2AA 5DM63 1L0WA 2G9DA 2JA5H 5C44B 4IPGA 1GVJA 3QAHA 4DQ2A 1Q81C 3HB9A 2STWA 3G6JB 1ETXA 5FKKA 4DR3Q 3BZCA 1SLJA 2E35A 1S5FD 1Y1WG 1YNJC 2PMZN 2JN6A 3J81c 4IRGA 4NC8A 1G3SA 1UWVA 4DV4Q 2B2VC 4RB3C 2QENA 2EYLA 4IFDJ 5GTHC 3F72A 4NC6A 1FZPB 3DWAA 2MLKA 3W1BA 4B3ML 1CHPD 1NMGA 3M85A 2YU9H 2HPIA 1XTDA 1ZRFA 4YFXF 3DCFA 3MXNB 4GRIA 1K7AA 2HOEA 5JEAH 5ELCA 1RTOA 4XKCA 3OYNA 4RA2A 1R7JA 3SHFA 2RDHA 2JXMB 2F0LA 1EQTA 2DPUA 1TQIA 5L3CA 3P20A 1K8GA 2ZXRA 2EH3A 1DXMA 3BG7A 4KIFA 4UVBA 3S1MH 5CV8A 5BN5A 2UUZA 3BQZA 4DV4L 2EJFC 1IL8A 1GUGA 4KK7A 1Z0XA 4KUMA 1O78A 4ZCKA 1XMXA 3L00A 3DBHB 4DK1A 1IN5A 3QPTA 3BTCA 1JKQC 4E70A 1EIYB 3K5LA 2JJ7A 1YBYA 4CJ0B 1FNVA 4OX9Q 5IYCJ 3CKIB 3BS1A 1VQGA 5C3EG 5NUCA 5DM6F 4I09A 4M6YA 1VQKA 5A35A 2A61A 1JWSD 3CXCA 2VB2X 5EG0B 1IN7A 2FFKB 2OU2A 5E18F 4ID6A 4HAEA 2X0LA 1E17A 3ND9A 3GTMB 5JVGF 3QIAA 4NPSA 3PO2G 2K40A 4A3BJ 2R4GA 3Q22A 4IJAA 1FMVA 3BR6A 5JR3A 3LA2A 1ENCA 4LUOA 3CCSA 2QBYA 2KQRA 3MEHA 4JOIC 1VQKI 3TP7A 3HFZB 1DGRM 1D0ZA 3HXLA 2VPLA 2ZM6Q 3KLRA 4GN5A 3JRGA 1F36A 4IUTA 1OISA 5DD4A 1WCMG 2FBKA 4D7NA 3KYCB 4ULLA 1XMOQ 2M4GA 2VUMH 2RQXA 2IWHA 3FXUA 2P5LC 2BW3B 2L7ZA 5I6YA 3F23A 3GTPJ 3PUYA 2LKXA 3STBD 1KDCA 1SE3A 5KVRA 3MXNA 2F48A 1FYCA 3VR2A 2DMQA 5IY5H 4RLQA 3CUQC 1I4XA 1X19A 3G1MA 3CUQB 1ZELA 3ZMZA 1S7OA 1SYBA 1T98A 5JHFA 2EIKH 4E6KG 4UXNA 2WACA 5FD6A 1BR2A 2CH4W 4B3TQ 1OTCA 2FXAA 4GLAC 2OTLA 3BY6A 2EV6A 2NZHA 3G1LA 3U2RA 2XGXA 1MJAA 1X3PA 3ZQGA 2QWWA 3A8IE 1JICA 2N78A 1U78A 4BH9A 4OGQC 1TIID 2A6EC 4XXEA 1Z05A 4H0EA 4MHEA 1ZGWA 1HNZL 3QYBA 1LT3D 3DBRB 2PW7A 4OWWB 2E60A 1JJ6C 4UP8A 2ZCWA 1WTRA 3KZIC 2CKZB 3Q24A 1SVMA 3L0OA 2A1AA 1RHPA 1ZG3A 1B1BA 4QPOA 2OAZA 5M5WB 4LF7L 1YJWA 1OXXK 4CDGA 4MIUA 2C9OA 1Z47A 2F0HA 3G4SA 1DM0B 4I98B 1ASZA 4PSWA 3ZQIA 3A5ZB 4XYQA 1VMPA 2WAQG 4IEJA 5J6XA 5CKTA 4Y52J 2WAQB 3ZOBA 1HDPA 1TWAB 4AIHA 3V8JA 2PNHA 1VQ4I 1EIHA 2F0QA 2O5RA 1JOQA 1EH6A 4EM1A 4YWLA 4LG0A 1WJJA 2QGQA 2HQEA 4DUYL 1YI2I 3SZTA 3J80K 3T1BA 3VR6A 2CUEA 2OF1A 3L9AX 3GTPH 2CH0A 3LSTA 1M90C 3VDYA 3CF2A 2NUCA 3JAMi 4A3GB 3F8BA 4DV0L 3L2CA 5JOBA 2E1MB 3OIOA 2LNBA 4PFPA 2ZM6L 1X3QA 4C3IH 2ECCA 1RKNA 1K83B 3S3OA 2R6GA 3I70A 4XLFA 1EF4A 1TTYA 4KHPQ 3O6BB 5BMZA 3RN2A 1XYIA 3S1NH 4QSHA 1K0SA 2E2JJ 3TKYA 4CZZA 3EUKL 3ZR8X