3GOHA

Crystal structure of alcohol dehydrogenase superfamily protein (np_718042.1) from shewanella oneidensis at 1.55 a resolution
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
314
structure length
297
Chain Sequence
MEQHQVWAYQTKTHSVTLNSVDIPALAADDILVQNQAIGINPVDWKFIKANPINWSNGHVPGVDGAGVIVKVGAKVDSKMLGRRVAYHTSLKRHGSFAEFTVLNTDRVMTLPDNLSFERAAALPCPLLTAWQAFEKIPLTKQREVLIVGFGAVNNLLTQMLNNAGYVVDLVSASLSQALAAKRGVRHLYREPSQVTQKYFAIFDAALVPSLKANGHIICIQDRRTISYHEIALGALHDFGDRQDWQILMQQGEALLTLIAQGKMEIAAPDIFRFEQMIEALDHSEQTKLKTVLTLNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alcohol dehydrogenase, zinc-containing
publication title Crystal structure of alcohol dehydrogenase superfamily protein (NP_718042.1) from Shewanella oneidensis at 1.55 A resolution
rcsb
source organism Shewanella oneidensis
molecule tags Oxidoreductase
total genus 94
structure length 297
sequence length 314
ec nomenclature
pdb deposition date 2009-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3gohA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3gohA01
1PGOA 2P4QA 2DQ4A 3DOCA 4R3WA 4LSWA 4D3FA 2ZQYA 2Q1SA 4J1QA 1K6XA 4L4SA 3HZZA 2BMAA 1NPDA 2NM0A 1FDUA 1NAHA 3RBZA 3UXYA 3PZRA 1ENZA 3DZBA 1LUAA 4NFHA 3OEYA 5ES3A 1EUZA 4E0BA 2JJYA 1SNYA 3HDHA 3JQGA 3GEGA 2O4CA 5LDHA 3AM5A 2J3HA 4OSPA 1VKNA 3IL2A 3HSKA 5IZ4A 4EUEA 1C0LA 3RASA 5HWSA 3F5SA 3I4CA 4FJ1A 2OL4A 4RVGA 4MKRA 5DP1A 3ZV5A 4IQ8A 3R3SA 2Y0EA 1CDOA 3NX4A 4O1MA 1GDHA 1DO8A 1CEQA 2IDZA 1V0JA 4PLYA 1PQUA 3F4LA 1MX3A 3WOHA 4MVJM 1V8BA 4FFNA 2CF6A 3ROMA 2O23A 4YVFA 3GUCA 4CLXA 4YT4A 3ZWWA 4BNMA 3R0IA 4FW8A 4KMSA 4Y8VA 5JDCC 5JXWA 2DTXA 1JWAB 2JCXA 3DONA 1F8GA 1P31A 2V7PA 1KY4A 4R5MA 1GYQA 2EKLA 2FRDA 4BKOA 2AMFA 5CDTA 1AHHA 5CG2A 3KEOA 4XYEA 1LLQA 2GPTA 4WLUA 3PLRA 1PU2A 5BT9A 4YAEA 3ZCXA 1NNUA 4RQTA 3PP8A 1HETA 3DO5A 1YOVB 1ZVMA 3K96A 3QVSA 3WFJA 1EMDA 1EUDA 2OOSA 3UCXA 2X9GA 4XB2A 1G0NA 4HFMA 2ZKLA 3OIFA 3D3WB 2HRBA 4Z9YA 1E6WA 1YB5A 3PIDA 4JBIA 4A73A 1BVUA 1L1FA 2AE1A 3TFOA 1DJNA 4KUEA 3ANNA 3OM9A 3CINA 1UDCA 3OA0A 1M76A 4DMMA 4GSLA 1WLYA 3ICCA 1U1IA 2EHDA 4JIGA 2IEDA 2GASA 3ZWVA 1QMGA 1R4NA 5EMHA 3H5RA 5JO9A 5HA5A 3IKVA 1GR0A 1I3KA 1R12A 1XU7A 2AHRA 3P5SA 3G1TA 3DC2A 3STHA 3IUSA 5EPOA 4R4JA 4WLVA 3Q3CA 4RF4A 5FEUA 4CM8A 1C0KA 3M6IA 1GL3A 1PGJA 4X54A 3U0BA 3INTA 5AXDA 2NU9A 1H9AA 1SZJG 4BO9A 5CEFA 3JCZA 3VVBA 4O5OA 2FOIA 4FJ2A 3RKRA 2CVQA 1XSEA 1XLTA 5DCYA 1S6YA 2NACA 2PGLA 1CQIA 3V2HA 4Z3KA 2Y99A 4WK6A 4BNUA 1U8FO 2A92A 2QX7A 2Y66A 3BXXA 1U2GA 3RJ5A 3H8VA 4LGVA 1QLHA 3GNTA 5C5IA 3LZ6A 2IXBA 1HE4A 3B1FA 2WMDA 2X7HA 1W0CA 5COAA 5G0SA 5T8KA 4J4HA 2JHFA 1Y8RA 2HLPA 2VRCA 5AVOA 3TQHA 1UAYA 5IDWA 4WOJA 1N1EA 1WZEA 3TL3A 3PDJA 2BD0A 2TMDA 4GMFA 4IXTA 1N9GA 1PJ2A 2ZJ1A 1B8UA 2YZ7A 3MWEB 5BNFA 1NFFA 3JD1A 3KLMX 1RYEA 4HBGA 5K0ZA 2A94A 2DPGA 4A0SA 1K6JA 4ALNA 4ALJA 3WGQA 4R16A 1BWSA 1I5RA 1E3WB 4A7PA 2RH8A 2VNSA 1MLDA 3PJEA 2JL1A 5KKAA 3L6EA 4DLAA 1GD1O 4YR9A 3O4RA 4IDGA 5IDXA 3TZKA 4WCFA 3EVTA 2I99A 5CPFA 4QO7A 2O3RA 3NTQA 2BFAA 3WS7A 3GVHA 1SBYA 2RHRA 4MVJA 3RUFA 1TXGA 3ZHBA 4LCJA 3RAJA 1HE5A 1U7TA 6LDHA 3IOYA 2VHWA 4BIIA 2EXXA 3UGKA 4OXNA 1R66A 4BNNA 5TGDA 1N7GA 4FN4A 3V1YA 2GZ3A 1K5HA 1E7YA 1XHLA 2WTBA 1X7DA 2J5KA 2AXQA 2X1HA 3L4BC 2D59A 1Q1NA 4ILKA 4CMEC 3KM0A 4IDBA 5A3VA 1WMAA 3GR6A 5MGBA 5C7LO 4IS2A 4DUPA 4CM4A 4MVJE 3GG2A 4U5QA 2GNAA 4BMNA 4PLTA 2VRCD 4E6PA 4TKMA 1RYDA 2I5PO 3RCBA 1LDBA 4WCFB 3U09A 1VC2A 4EBFA 4CM6A 1YL5A 3F1KA 3MWDB 5T64A 3FWZA 1PZFA 1BW9A 4MDHA 1EEHA 5T6BA 3ZWCA 1HZJA 4DWVA 3WNQA 1NPTO 3H9EO 3OIDA 2P9EA 4E5NA 3RU9A 4EUHA 4JQCA 1I24A 1LX6A 1DIRA 4PG6A 4BL5A 1PJCA 1Q2XA 1PX0A 4CR7A 5JMWA 2ZCVA 3GT0A 3LT0A 1HKUA 1AHIA 4LVCA 5K1SA 4IPTA 3HADA 2EV9A 2O3QA 4AL4A 5B37A 3D5QA 4PLPA 2D5CA 4CJXA 4AJ2A 4MVJD 1KY5A 1O94A 1B2LA 1B8VA 2HMWA 3D4PA 2JFFA 1YJ8A 3I83A 2CMDA 2BHLA 3ADOA 3PYMA 4CQMA 5I7FA 5KJ6A 2O7QA 3VZQA 4YJDA 3RC1A 2CDAA 1ADCA 4ZVVA 1KC1A 2GZ1A 1H9BA 4OL9A 3ZV3A 2FPGA 5DCUA 4CLRB 5FI3A 1BVRA 2Q2VA 4BNHA 4IDCA 1E3EA 1GYPA 3ADPA 3VH4A 2Z1MA 1YXMA 4NMHA 4MKZA 4C7JA 5A5EA 1LSOA 5I9LA 4W99A 1TB4A 2AEFA 1GUZA 4AJHA 3B20A 2GLXA 3GVCA 3RC2A 1BMDA 3GHHA 1X14A 5GZ3A 3DEYX 3LC7O 4RF2A 3JQ9A 2I3AA 4YYZA 4QFDA 4Y6PA 2EP7A 4FOOA 3ZNNA 1T1RA 3ANMA 1NYTA 5A9SB 3PEFA 4IZHA 1Q0QA 1MXHA 3OJEA 1RWBA 2YV2A 3E9NA 5IXYA 1P44A 4DLBA 3ENKA 1HSOA 1T2AA 1BDMA 1BXZA 4JP2A 1DB3A 4NIMA 1EBFA 3KRTA 1G0OA 3JQFA 3DOOA 3OA2A 4YBZA 3NDJA 4I5EA 3AW9A 1HF3A 4Q3NA 4CQMD 4BVAA 1H0KA 5KTKA 2Z5LA 1PQWA 1Y6JA 2W2KA 4Y9DA 4FFPA 1LSUA 4QEDA 5HTOA 1PJQA 3INRA 1Y81A 3BMNA 3DAPA 2GGSA 1EQ2A 3SLKA 3UCEA 2GD1O 1HEUA 2AQKA 2NU6A 2VWHA 4EJMA 4W7HA 4YJHA 4ND3A 1NFRA 4D43A 4IMRA 4J7UA 3B1KA 1WWKA 3CSDA 3O9ZA 1HTBA 5HBRA 3EHEA 3MTJA 1LSJA 5T8KC 4FIZA 4EW6A 4U8GA 4DC1A 1PEDA 4II3A 1E1NA 4CLOA 5K9ZA 4K1LA 4BO4A 1H93A 1K0UA 4OJNA 3DAGA 3TJRA 3DBRA 3F6YA 1PQPA 1NQ5A 1XELA 2FSVA 3WNVA 3ZNPA 1O5IA 2B5VA 2XXBA 3SBOA 1ENOA 3WGGA 2HCTA 2QRLA 3ZWYA 1C0IA 2PKRA 3B1JA 1LNQA 1VL8A 4B4VA 1FDVA 1B0AA 5EERA 2ILTA 3S2FA 3WYEA 4CM3A 5A5FA 2Y1OA 1YH3A 4J90A 3LT4A 1SOVA 3WBFA 2X9VA 5TNXA 1NQTA 1WNTA 3CTMA 4L0QA 3R6DA 3WQQA 3E6AA 4OAQA 5JBIA 1I3MA 2YHIB 3C1OA 4E31A 1VJ0A 4KQXA 4F45A 5CP8A 4PVDA 2JFHA 1R0SA 3JQ7B 1ZNQO 3ZU2A 2WEKA 3U4HA 1DC3A 4WKGA 1IY8A 2JD2A 5JS6A 1J5PA 5TLSA 5TT1A 4N5MA 4XCVA 1H6DA 2E49A 5TRTA 3DBHB 5JC8A 1UUFA 4E21A 2JAPA 3L0DA 4CL3A 4CQLA 1TLTA 2NTJA 3GQVA 4RPJA 3JQCA 2PR2A 3WJ7A 4JNKA 5G0TA 1EVIA 3EY4A 1A9ZA 3ETEA 5GZ6A 4E12A 4PLCA 3ZWXA 3G3EA 1XGKA 1B15A 4F3YA 3NKLA 5BSFA 2EEZA 3KV3O 3ZV6A 3ONDA 5ADHA 3JYPA 4TMFA 3FI9A 1UH5A 1XKQA 3PWSA 4B4OA 3GC6A 1GZ4A 1ZIDA 4RDIA 1K2WA 4CR8A 4J7XA 2J3IA 3B6ZA 5KVVA 1HYEA 1VJTA 2W2LA 1F8FA 3GLQA 2NNLD 2X0JA 3R3JA 3HJAA 5IJZA 3Q1LA 2V6MA 1C1XB 2YY7A 1PJTA 5FWNA 1NP3A 2FP4A 3MJ4A 5KKCA 3E03A 4DC0A 2Y05A 1WP4A 4CQLB 3RUDA 5AOVA 1LDGA 4JGBA 1BXGA 3SEFA 3E5MA 2VHYA 2OBYA 1LRKA 3L4SO 2NU7A 1DC4A 5G2OA 4CLHA 5FFFA 3I23A 3AI1A 3HWRA 1H5QA 4ESOA 1AE1A 1IB6A 3KYDA 4LSMA 3GZ4A 3H2ZA 4BQRA 1C3VA 1OMOA 4I9UA 1B26A 1WVGA 3NT2A 4JBGA 4H7PA 2XPCA 1Q0LA 1B3RA 2D8AA 1AUPA 2FHSA 2VWPA 1N5DA 5BNTA 4YRAA 3WR5A 3ZI0A 2O3SA 1DAOA 3I5MA 2OXIA 3QWFA 1EVZA 1HL3A 4LW8A 3WWZA 1P0CA 2J5QA 3CMCO 5EQDA 2P5UA 4CUJA 4N7RA 1DRVA 4K9DA 1Y8QB 4IQ0A 4BO3A 7MDHA 1DXYA 1ZEMA 2PGDA 3BMCA 3I9JA 1B14A 2OUIA 1HYHA 2O2YA 3DAFA 3G1UA 4RF5A 4L4RA 4J3FA 3DBLB 2OP1A 3N58A 3KYCA 4I5GA 3ZWNA 3M1AA 2W2LD 4XGNA 2C20A 4R3NA 1U4OA 2Y93A 3IS3A 4GH5A 3A9WA 3JQFC 2BLLA 1Y7TA 1QXSA 2Z95A 3U5TA 3C3XA 4H3VA 3WB9A 2C54A 4EUFA 1YL6A 4PLWA 4PG5A 4AJLA 3RFVA 1ISHA 1ISMA 2JHGA 1JQBA 4GX2A 3WMWA 1E77A 1JKJA 1PJBA 5KWEA 2ZTVA 5JCXA 1E7WA 3KOUA 3FF4A 1LBEA 4F46A 3EAGA 3QIVA 1LC0A 3DOJA 4FFLA 4ZQGA 2DC1A 1R4MB 3PHIA 1MA0A 1T4DA 5CEEA 1HZZA 1NQOA 1UR5A 1C14A 3AOGA 4ZQFA 4BNGA 3KEQA 4DVJA 1P1IA 4CUZA 5A9RA 2WWRA 4I5FA 9LDTA 3D5TA 3DR3A 4WEQA 2ZCUA 4UAGA 3HQ4O 1Y9AA 4MVJI 3GPDG 5THKA 3EZLA 1MUUA 1LLUA 2CF5A 4RZIA 3TOZA 3UHAA 4CMHA 3DXFA 3AY6A 1HDOA 1EUCA 4KZPA 5HRUA 3JD2A 3DZKA 4DGSA 1QORA 3MCVA 1PZEA 3JYQA 3TZHA 4MKXA 3C1TA 3WLFA 4GX1A 2R6JA 2YDYA 1TT5A 3AJRA 3MJEA 3HN2A 4PLVA 1V3UA 3SJUA 2WE7A 3KBOA 3PJFA 4Y6SA 4NFYA 3I9LA 4BO8A 4DLLA 1HE2A 4E32A 2YHUA 4UREA 3BMOB 4GLOA 3Q9NA 2GR9A 1UXHA 3GA0A 2C7GA 1NVTA 1HDYA 3LSYA 1SOWA 1E3LA 3VH2A 4WEOA 4A03A 3V2UA 2X86A 5T5QA 3CUKA 2NVUB 2VUSA 1JTVA 3ZHYA 3PQFA 3N74A 1H6CA 3QWHA 5BR7A 4GVXA 4MOWA 5A3JA 1LDEA 2EP5A 3AFMA 3HFGA 4YJFA 4BNJA 4XR4A 1ZMTA 3OECA 4RZHA 3OQ6A 4OQZA 5A4DA 3PQDA 1QYXA 4E3ZA 4GQAA 3VTFA 1XQ1A 4J1SA 3RROA 4JROA 1B16A 4U7WA 3ASUA 4R1UA 4DBZA 2EERA 2H1SA 4EI2A 1TVEA 4E5KA 1Q7BA 1DFIA 3PFWO 5DOZA 3I9OA 2A35A 4IGEA 1ONPA 4YACA 3RBXA 3WG9A 4BNZA 4PZDA 1GZ3A 1T2FA 4CMAA 1IL0A 2AA3A 3A4VA 1VSUA 1BRMA 2GRAA 3WYBA 1YB4A 4XJSA 4NQZA 3LYLA 1EE2A 4RPLA 4U6SA 3QJ5A 2AQIA 3E1KA 1TEHA 3PTZA 3K5PA 3QWIA 4BO2A 2XOXA 1DJQA 4FCCA 4P22A 3DB2A 3HG7A 1HLPA 3PWKA 3W6ZA 1BXKA 4RCVA 1QLJA 2BF7A 1XQ6A 4LRSB 5F1PA 2H9IA 5JPIA 1KVUA 5TSDA 1QYVA 2VOJA 4FJ0A 4IXWA 3ZWPA 2B69A 3KB6A 4IDFA 4J16A 4QT0A 2X8LA 1MV8A 2HMSA 5TS3A 4TRJA 2I6TA 5L7TA 4L74A 2HK8A 3PIIA 4PN3A 4URFA 2VRBA 4NBUA 2B4QA 3CZMA 3BTVA 3GDGA 3ST7A 1Z45A 1ZH8A 4OXYA 4BNXA 4OOEA 3EUWA 1YOVA 3RJ9A 2PZMA 1GADO 1HYGA 4QXMA 4W4TA 2WJPA 3OETA 2PKQP 3D3WA 1YE3A 4N5LA 3GY0A 1N7HA 2IEBA 3ZN2A 3WIEA 4XQGA 2ZB3A 4PLFA 1LRLA 2G82A 1PJ3A 4Y67A 3KETA 1WDMA 2D5AA 2WYUA 1MC5A 4CV3A 4FBGA 2QZZA 2LDBA 3FNHA 3PI7A 4R9RA 4IIUA 4N54A 2FY8A 1W6UA 5CPBA 4TZKA 5B4UA 4WCDA 4RJTA 4J1TA 1U3WA 3UKOA 3OJFA 4AFNA 1SCUA 1ZW1A 5KJCA 5JY1A 2DAPA 4D3DA 4UEJA 2YV3A 5LCXA 4LVUA 3EMKA 1E3SA 1XA0A 1GPDG 3V2GA 2C0CA 4OO3A 4BKRA 3FRJA 3BZUA 1XG5A 1BG6A 1GU7A 2W98A 2Q4EA 4UVGA 3GRKA 1YGYA 2VOEA 2VCYA 5C7IO 2CY0A 4WNIA 3U62A 5K6AA 1PS9A 3ZNOA 2D2IA 4JJIA 4BNWA 1LSSA 5CDSA 1P45A 4UUPA 3NDRA 3NUGA 3H9GA 4BV8A 4TVBA 1I33A 2OP0A 4WECA 3OP4A 3WGHA 4GAEA 5L4SA 1ID1A 4YRDA 1PZGA 3LF1A 4HV4A 5ITWA 1HDZA 4W7IA 2E4AA 2ZTLA 3KXDA 4WOKA 2G76A 3K8ZA 1DSSG 1GZ6A 4J9UE 4BMVA 4CMBA 5JAQA 1E3WA 1ZMOA 4WGGA 3DWFA 3CE6A 1KERA 4OQYA 3QP9A 3X2EA 3S2GA 4CMIB 3TRIA 2X5JO 1H6BA 2PFGA 4DYVA 2Y0CA 1DLJA 3VVCA 4ZU3A 1ADFA 5A06A 3BTSA 1T26A 3EDMA 1F0YA 2C07A 3I4FA 3ITDA 3P7MA 4FC7A 3ULKA 3K6JA 2CD9A 4TSKA 4E2WA 4EDFA 1F17A 3INGA 1EFKA 2IXAA 5THQA 3I3OA 4MVJG 2H6EA 1DC5A 1YDWA 4IUYA 5KVCA 1N1GA 4P38A 3JQ8B 3FBTA 2VHZA 4KTTE 3PHGA 2V6GA 5L45A 2OORA 3C1AA 1TA4A 2IYOA 3V5NA 3N7UA 2AG8A 4LK3A 2VNAA 1GPJA 1MB4A 4E5YA 4K26A 4YPOA 2PK3A 4ZD6A 1UXGA 2YJZA 4BO7A 3UH1A 4CM5A 4YEDA 1CRWG 4UUMA 1QYDA 2DFDA 1IPFA 3QW2A 3KHUA 4CM9A 4ZA2A 2ZATA 4FPXA 3PGJA 3W6UA 1RM0A 2VZ9A 3QVTA 4G81A 1DEHA 2HUNA 1C1DB 2B36A 3VZPA 3GPIA 5H83A 4OIMA 4CV0A 2PH5A 2HQ1A 1NAIA 2R00A 3RU7A 1ADBA 4PRLA 1I30A 1JDJA 5TC4A 2JFGA 4J2OA 5IF3A 3GAFA 3CEAA 3JV7A 4YQYA 3SX2A 3AWDA 1QR6A 1T2CA 3LLVA 5ICSA 4R41A 3H7AA 4E2YA 2C59A 4K28A 1BDBA 4TZTA 3E18A 3BTOA 4QECA 2FWMX 5C37A 3QE3A 1DFGA 5DT9A 5ER9A 2BKAA 1OC4A 4HKTA 3RSHA 4WUVA 3H2SA 1WMBA 1IHYA 2X0RA 1ISFA 2D1YA 2P4HX 3PZBA 1ZXLA 2FZEA 1A9YA 4ZN6A 4BO0A 3RKUA 4CMKA 1EBUA 4TWRA 5KJ1A 4ZRNA 3WMXA 1JAXA 2UDPA 3F5QA 1U7HA 4MIOA 4U0JA 1PL7A 3CMMA 1ZZEA 4PRKA 3FPLA 1LDNA 4J49A 3IP3A 4CLRA 1IZ9A 3AU8A 4Z0PA 3OF2A 3D4OA 2EGHA 2EG9A 2BFOA 4QUKA 2D4AA 1Y5MA 2ZK7A 4DYDA 4J4BA 4E2XA 1PIWA 2X5OA 3QHAA 3H3FA 5IDQA 1PS0A 3DHNA 1H2HA 2P91A 3AI3A 4CM9D 1D1SA 2EWMA 3TN7A 3KSZO 5H82A 1J4AA 2AG5A 1F06A 3H4VA 1LDYA 1UZNA 3WFIA 4IDDA 4DREA 4E13A 4DMLA 4FR5A 4AVYA 3OQBA 3PJDA 3S2IA 1EDOA 2FSSA 2RHCA 1P74A 5A9SA 1ONNA 1W4ZA 1ZO8A 1PWXA 5L40A 4PG8A 1I3NA 5T67A 3ROQA 5ENVA 3CXRA 4E4YA 4NDNE 5U4QA 1E6UA 2IZ0A 1OI7A 5BSHA 3OJ0A 2AW5A 5JDIA 2P9CA 3RUEA 1GYRA 3WX0A 4BNVA 4KWIA 3VKVA 3Q11A 1NPYA 4GGPA 1YBMA 3I9MA 2J3JA 3RD5A 3RUCA 3FCOA 4ALMA 4YT2A 4QQRA 4NG5A 2VUUA 1N2SA 3FN4A 3HDYA 4IZIA 4WPGA 3ICPA 3GMDA 3CIFA 4UVIA 3FR8A 1A4UA 1IE3A 3FNFA 1GCOA 4NJMB 3DMTA 4EGFA 1JAYA 5EESA 2O2SA 5BSGA 1H94A 3GVPA 1QSGA 4ZICA 4NBWA 5K6AC 1M2WA 1SEVA 2UVDA 3HN7A 3Q6IA 2CDCA 3U49A 4BKQA 1E0DA 1I3LA 1HDCA 4NU5A 4FFMA 1YDEA 5A03A 1QV6A 3GZNB 1MG5A 2PD6A 2XF8A 4H15A 3S8MA 1D1TA 5IN5A 2GO1A 1Q0HA 3QLJA 3PXXA 3OIGA 4YB8A 4CL8A 2POQX 1OBFO 2BFPA 3BMQB 4S1VA 2Q3EA 1ML3A 3L6DA 3TWOA 2QZ9A 4J91A 2DBZA 1N8KA 4LMPA 4CV2A 2QYSA 1WDLA 4JX8A 4BKPA 4DRYA 3TFQA 5F1OA 2V6FA 1ARZA 4YXFA 4DTIA 3TPCA 4BOYA 2RBEA 4GBJA 4PFJA 3FTNA 4QO8A 2FR0A 1E7QA 1PTJA 4G65A 4XYLA 2BGLA 4YQZA 3WBBA 1C0PA 1K3TA 4IY1A 4PVCA 3VZSA 4MVJP 4J4TA 5BQFA 5KIAA 3WQSB 4P4GA 3WJAA 1YQXA 4R1SA 1E1LA 1GQ2A 1PGNA 2YHIA 3DHEA 2Y1GA 1ADGA 4Z6KA 2HJSA 3JQ7A 4JP3A 2O3UA 3FWNA 4L76A 3FNGA 3JD0A 1B7GO 1U5AA 4HFRA 3UF0A 3EVNA 3JTMA 4HFJA 5FF9A 1NHWA 3IC5A 1VRWA 2J5RA 4M54A 1DC6A 3JQAB 2YUTA 4R1NA 2Q1TA 1SB8A 2G5CA 4JLWA 1N92A 3Q0EA 3ZU3A 1HT0A 1KEWA 3AM4A 4IM7A 4KUGA 5JO0A 1O95A 1I8TA 3DBHA 3GVXA 2CNBA 2Y67A 5L4NA 1MXFA 4D41A 1PGQA 3DHYA 3PHHA 2B83A 4GWGA 4ID9A 5DF1A 2HMUA 3L9XA 4XR9A 4PLZA 4CLDA 1M66A 2AEMA 3A28A 1DPGA 3OFSA 4IGFA 2PZKA 4WCFC 3W1VA 1JN0A 3UAGA 4GKVA 2CUKA 3ONEA 5G4KB 3RUHA 1PR9A 4PGFA 1T2EA 2HRZA 3E8XA 4KUHA 1ZK2A 1UP4A 4BGIA 1U2DA 4L9RA 1R0LA 1EVJA 2R00C 4FGWA 4D0SA 3RVDA 3P19A 2C2YA 3NV9A 4W9NA 4LISA 5F5NA 3H65A 5L51A 2VWGA 4Q3CA 1WW8A 4J2HA 1V35A 3RUAA 5HS4A 5EIOA 2X0IA 1C1XA 2NTVA 2DM6A 3DFZA 3U9LA 5A04A 2BI7A 5ILGA 3TF5A 5A02A 2EW8A 4BNYA 4GI2A 4YCAA 3BHJA 1ZUD1 1E1MA 1OC2A 2V6BA 2HJRA 5ILOA 1U8XX 3RWBA 3S2EA 1KVTA 5IZCA 3BHIA 3QRWA 3QVWA 1P0FA 4ZQEA 4Z3DA 4D0RA 4GWKA 4MP6A 3DFUA 4KWHA 3ASVA 4NK5A 1NWHA 1GY8A 2NV6A 1E5QA 4BGEA 1NHGA 1XU9A 2UUOA 3EC7A 4UVDA 4M89A 5JAMA 4CM7A 1D8AA 3UW3A 3GDFA 4DPMA 1PZHA 4B3HA 1P1JA 4YAKA 3K31A 3SXPA 3QV1A 1O8CA 5U1PA 2YQ4A 2DT5A 1XR3A 3WDSA 2QG4A 1UXJA 4RVHA 2OMEA 3RQSA 3PK0A 2VYNA 3ZU5A 2FN7A 4YAIA 1ONOA 3LC1O 4TKLA 4MINA 4BB6A 3KLPX 4XYGA 1QYWA 3GFGA 4OKIA 1Y8QA 2ZYDA 3LT1A 2VYVA 2GUGA 1EK5A 2WE8A 3W8DA 1VI2A 4UUNA 3GVIA 4D44A 1YVEI 3DBLA 2WD7B 1V3VA 5A9TA 4AJOA 1J49A 3PHJA 5DOVA 3L07A 1XWFA 5MDHA 2FZWA 4YJGB 1NASA 2BFMA 2LDXA 3AOEA 5JDIC 5CDYA 4P4NA 3JQ6A 3MJTA 2CVZA 4EEZA 3RFXA 2NQ8A 1YRLA 1KEUA 1UDBA 3MJSA 3SLGA 4R68A 1CF2O 2VT2A 2DFVA 3G0OA 3V8BA 2AE2A 3LVFO 1ZFNA 4DIOA 1X0XA 3DMTC 2P2SA 1NWCA 3JQ9C 1H2BA 4Z9XA 1MG0A 1R4MA 3LLSA 1FJHA 5JC1A 1VL0A 3QA9A 2Y0DA 2RAFA 3DZJA 1ORRA 4IJUA 4OXKA 3U3XA 3VAZA 3QQPA 3S55A 5CHEA 2A9FA 5TX7A 1Y9EA 4XDYA 1B3BA 2EGGA 3AUUA 4G2NA 4S3MA 1LC3A 3DZIA 3BAZA 4ITUA 1DOHA 1EFLA 1IUKA 2VYND 4M87A 1PS8A 4Y98A 4C4OA 5B4TA 5KCZA 2DUUA 4Q9NA 1KYQA 1A27A 1V3TA 1WPQA 4RPHA 5L9AA 5B4VA 2ZB8A 2VYVD 4XKJA 3KO8A 2E6UX 2GZ2A 2NTNA 1BHSA 5G0WA 5JYDA 1DHTA 2PGJA 1M6HA 3VH1A 4R51A 4DPKA 2IYPA 4NPCA 4RDHA 3I6IA 3O38A 1XIVA 1I0ZA 3BMOA 4BNIA 5B1YA 3WGIA 3W8FA 3JYOA 3I9KA 1I10A 1CERA 4YWJA 1LRJA 2YFHA 3ETDA 3GGOA 5GZ1A 2DTEA 5EINA 1GFSA 2FMUA 2NVUA 3OMLA 4RV9A 4XQ9A 4CV1A 4OMUA 5G4LA 3ETGA 4RLHA 5GY7A 1Y5RA 4OGWA 2DLDA 2I76A 2NQTA 1GUYA 5AXBA 1UDAA 3GHYA 3A14A 4QTZA 1DIAA 1O6ZA 2QQ5A 3EGOA 1W73A 4NH4A 4BGVA 4AJEA 4Z0TA 4IINA 4L4XA 2Q2WA 1YL7A 4UEOA 3K2EA 3GGPA 2WSBA 4XYMA 3OICA 3ITKA 3W4JA 1RM5A 4GMGA 3I6QA 4FGSA 4I5DA 4A27A 1XDWA 2Y68A 2X6TA 4OSOA 1T1SA 2IE0A 2ZYGA 4OM8A 1KBZA 4M8SA 1VKOA 5TT0A 3OSUA 1JWBB 4XIYA 4GKBA 4P4LA 1SEPA 1U3UA 4QX6A 1X1TA 1QP8A 2JCVA 2JKVA 4R01A 3CPSA 4NNJA 4XQEA 4MO2A 4YAJA 1X7HA 1I2ZA 4Q39A 1PJ4A 2C5EA 1CYDA 4IDEA 1LLCA 3JQDA 4KQWA 4W9NC 2PZJA 3WXBA 4FOSA 4KTVE 3GAZA 1YONA 5KVSA 2Q1WA 8ADHA 4IJWA 4I8XA 3KUXA 1A7AA 4NZ9A 2I3GA 4XGKA 4J1NA 2OO5A 3ZH2A 3Q9UA 4PG4A 2VWQA 5EJ2A 2NVWA 5CAEA 1X1EA 4E5PA 5F5LA 4BMSA 2GSDA 1BSVA 2ZTUA 3G17A 1SO8A 2Q49A 2E82A 2H63A 2VZ0A 2X4GA 5IZCC 4RQUA 1T2DA 5FI5A 1WAMA 3DL2A 4EEXA 4TVOA 2JAHA 1O9BA 1VLLA 4XD2A 3W4IA 5G0UA 5I8WA 1CWUA 5ICMA 4WLEA 4HUJA 4NR0A 3DQPA 5JE8A 2DKNA 3WLEA 3WGTA 4R5HA 1RPNA 3NJ8A 2O48X 4I08A 3LDHA 2I9PA 3BA1A 4CMJA 3UICA 2PY6A 1NVMB 1UZMA 2Q99A 3NJ4A 3IJRA 1Q7CA 2GYYA 2DBQA 3HNPA 1Z75A 3BHMA 2VT3A 3C8MA 1ZJYA 3IDSA 4B7CA 5I8ZA 2TMGA 4XEHA 5L7YA 3KVOA 2AQHA 2BI8A 4R1TA 3TDKA 4XIJA 2HU2A 3TL2A 4D42A 1ISJA 4NBVA 4RL6A 1U28A 4XGIA 4XRRA 2YFQA 5JNLA 4OYRA 3O8QB 1PWZA 3OH8A 1FMCA 3E5RA 1JVBA 4MJLA 1UP7A 1JKFA 4XRGA 2O7SA 3AOEC 4RLSA 4M55A 4OHUA 2DPHA 2D0IA 3COSA 1D3AA 1FXSA 2BGKA 1UJMA 1P1RA 4NK4A 1VE9A 3KZVA 4ZGWA 1IZ0A 3IQDB 4M1QA 3OEWA 4Z9FA 2P9GA 3WICA 2NLOA 5U9CA 3OBBA 4LN1A 3PDUA 4PIVA 3H9UA 2DU8A 3NT4A 4D45A 5T57A 1ZSNA 4B3JA 3DTTA 1EZ4A 1LDMA 3RC7A 3UFXA 3NEPX 1ZBQA 3HHPA 4JJFA 4INAA 3K92A 4CMCA 3JSAA 3H6KA 1GAEO 2EKPA 2NVBA 4BGUA 3IIEA 4MIEA 5I9NA 4A2CA 4O59O 4BNLA 3DTYA 4OOFA 3TZ6A 1YS4A 1OOEA 1R6DA 4C7KA 1FF9A 1KETA 2HMVA 2WYWA 2WYVA 2HSDA 2VUTA 5IFLA 5I9MA 1O89A 1Z6ZA 4CMIA 1X13A 2VZ8A 3WSVA 3ZDFA 4Q3AA 2NUAA 3FD8A 1NX6A 4WE3A 3V1UA 3RUIA 4XJTA 1I2CA 4AG3A 1Z7EA 2A4KA 1KEVA 3T4XA 4FS3A 1D7OA 1CIVA 3VDQA 4F6LA 3JQGB 4HFNA 4A26A 2GN9A 3ANLA 3TZCA 4B8WA 1Y1PA 4JCOA 3ZHXA 3VH3A 4O6VA 5FYDA 1X7GA 2HDHA 1PGPA 4FFOA 4XYBA 1DLIA 4BNTA 1HSZA 2I66A 4BHTA 3DZFA 1JA9A 1YBVA 1ZCJA 4ND2A 4U0KA 5EL0A 2CVOA 1D4FA 3BIOA 3QWBA 3JQ8A 4HNHA 4YT5A 4UVHA 2DVMA 2B0JA 3LQFA 1PJSA 2X23A 5BSEA 5J23A 1ZEJA 1IYZA 2EKQA 2Q2QA 4DXHA 4GPD1 5A05A 2EJWA 8LDHA 4DQXA 1E7RA 1AXGA 4BQPA 3HB4X 2GERA 1F14A 2VHXA 3F9IA 3GG9A 3E82A 3AFNA 2ZB7A 1HDRA 4HNGA 3ABIA 4BV9A 1ZSVA 4AJIA 3AY3A 4TRNA 2NSDA 1C1DA 4NHEA 4PLHA 1FDWA 2W4QA 2W8ZA 1T25A 3NAQA 5CDUA 3PLNA 1H6AA 3A1NA 1E3IA 3ROPA 1UXIA 3LU1A 4DIFA 3NYWA 1ZK0A 1K6IA 4LMRA 4NU6A 4AJ4A 3AI2A 3FHLA 4FD3A 1NFQA 3D4NA 5CDGA 1RJWA 5L53A 2QW8A 3U4IA 2GN4A 4JK3A 1FK8A 3JYLA 4HY3A 4RO0A 3U4DA 3RC9A 5C7OO 1RKXA 4L75A 4GVLA 2VTEA 2C2XA 1A72A 1P9LA 1HDXA 1KC3A 5EQFA 1DRUA 1KIFA 1R4NB 3LT2A 1HWYA 1I01A 3BTUA 4P8RA 4F6CA 4RVUA 4N5NA 5I7EA 4WLFA 2O50A 3H5NA 3DBVO 2C82A 3UN1A 3PRJA 2J6IA 2PZLA 5DN9A 3GF4A 1P1KA 3VC7A 2CDBA 5F1KA 4IMPA 4CM8B 4LCEA 2NWQA 3UUWA 1WZIA 4BO1A 3AUAA 1P33A 3WGOA 4PLGA 1SB9A 3VKUA 3NT5A 3ZWBA 3HDQA 2PTGA 4UEKA 2QYTA 3D64A 3EZYA 4GL4A 5ER6A 3K30A 3RIHA 3I1JA 3MZ0A 4TRMA 3G79A 1G1AA 4D3SA 4PG7A 3RI3A 2YQ5A 1R37A 3PGXA 1ZJZA 1VSVA 1AGNA 4CMGA 4WLOA 3I9NA 5HM8A 3T7EA 3LK7A 3D1LA 3D7LA 4PCVA 2Q4BA 4CPDA 5KNLA 2I67A 3PQEA 4I1IA 1NXQA 4MPDA 5AXCA 1Y8RB 3FPCA 5DZSA 1R0KA 1YO6A 4XZ3A 3E48A 1QKIA 2Q45A 4QSMA 5G0VA 3C24A 4FFRA 3S1LA 5IDYA 1N9GB 1PL8A 1P3DA 3QVXA 1NQAO 4GSKA 3I52A 1LA2A 1QG6A 4FSHA 4Q3EA 3TSCA 4RVSA 1ISGA 2F00A 5DBFA 1LEHA 2IODA 4J0FA 4BB5A 4YAGA 4MIYA 4UUOA 3JQBA 4D79A 5BNIA 4BNKA 5IG2A 4Q3BA 4NJMA 5F3RA 4IQGA 4UULA 4XX0A 5DNAA 1DAPA 4AICA 1L7EA 1LJ8A 3TNLA 2JD1A 1E3JA 3F4BA 2PD4A 1PR3A 2OZPA 5JCJA 1ZXBA 1KEPA 2D3TA 3MJCA 3FBGA 2E48A 1XYGA 3Q2IA 4Y6RA 5L3ZA 2W90A 1HE3A 4HP8A 4NBRA 1UZLA 3GZNA 4YTEA 1DIHA 3WYCA 1HXHA 3UOGA 1QRRA 4AJ1A 3M2PA 2C29D 3BYZA 4J43A 4B7UA 4WASA 2GN6A 3WTBA 4IJKA 1VM6A 3BMQA 2GDZA 3AK4A 1IPEA 2IZZA 1UAGA 4HX5A 4CUKA 1JU9A 5DP2A 1OAAA 2PV7A 3MJVA 1M75A 4E5MA 1DIBA 3VPXA 3ZV4A 2G0TA 4CM4B 3OQ1A 3P2YA 4JXKA 3OHSX 1AXEA 5IXSA 1UP6A 4J0EA 2J8ZA 2BRUA 4IIVA 5IN4A 1V6AA 4BKUA 3HB5X 3KSUA 4FC6A 4II2A 1EQUA 1BW9B 5L4LA 5JYEA 4D7AA 1CETA 1WXDA 3ZZNA 3F3SA 2YDXA 4E33A 3EW7A 3ZWMA 4AJNA 4KDEA 3QVOA 4L73A 1SC6A 5HS6A 4H16A 5JY6A 3GFBA 4DL9A 4DPLA 1E92A 3H9JA 2PNFA 1TI7A 1Z82A 2O4UX 3JQAA 4B4UA 3VPHA 4BUCA 4AJJA 3ORFA 3EYWA 5JLAA 2EF1A 3IAHA 5JCJD 1LTHR 3OJOA 3PYXA 1Z7BA 2XAAA 3G49A 4JBHA 3PJGA 3VOSA 4CQMB 4U6QA 3FSRA 2B4TO 3GNQA 2Q46A 1ISIA 3WGZA 1CQJA 2PLAA 1U3VA 4NJOA 2ZTMA 3JD4A 3Q2KA 1GTMA 5ENDA 1EDZA 1PSDA 3GRPA 5G4KA 5JSFA 3WIDA 2UV8A 1VL6A 4XA8A 3ON5A 1HRDA 1LQUA 2G1UA 3F46A 3QY9A 3AM3A 3D0OA 3AUTA 3M1LA 3ZU4A 1ULSA 2VN8A 2PH3A 1KOLA 5DBIA 3OJLA 4NBTA 3VDRA 3X2FA 3M2TA 4I9NA 3FR7A 3L77A 4XB1A 5JFOA 1I2BA 3GOHA 3WWYA 4ALIA 3PVZA 6ADHA 1P77A 1YQGA 3L9WA 5JAZA 1ZK3A 5JMPA 1QV7A 2VHVA 5TJ9A 5I7SA 5CFZA 2FR1A 3CKYA 4YRBA 4DQUA 2Q50A 3HDJA 1M67A 4ND1A 2GCGA 2PKQO 1SMKA 1ENYA 1YB1A 2XXJA 5GMOA 3NDIA 2Y1DA 1PL6A 1E5LA 1Q7GA 4W6ZA 1L7DA 4EZBA 2QHXA 5COBA 7ADHA 4YDRA 3UCFA 4D46A 3JQAD 3WTCA 3D3EA 1F12A 1R15A 1E7SA 3DZGA 1NR7A 2CFCA 3PPIA 3C7AA 1DRWA 4NFSA 1VPDA 4YT8A 5KJFA 3JYNA 2UUPA 4E30A 2SCUA 1BTOA 1LXCA 2Q1UA 5DCWA 3SJ7A 1I36A 2W2KB 1R16A 4HXYA 4FB5A 4E2ZA 1Z73A 2WDZA 4A10A 2Y1EA 5CG1A 1UXKA 3GGGA 2B35A 4GX5A 3NTOA 3ROKA 3V1TC 3ZWAA 5ITVA 1GQQA 3BMNB 2B4RO 3ZHZA 2Y1FA 3PYLA 3GN1A 2HKIA 3K9QO 1AN9A 5JW6A 2HK7A 4RVFA 3L6OO 1IOLA 4YJHB 2BELA 1MC4A 5L7WA 4R9SA 3HE3A 2Z1NA 3GEDA 3K2BA 1GEGA 1KVRA 4DBVO 3ENNA 2WD7A 1G6KA 2ZYAA 4CLOB 3AUSA 4YJGA 3DBRB 1RM4A 3VPSA 2QRKA 1VJ1A 3IJPA 2OHXA 1GCUA 4N18A 4AJKA 3DZHA 4B4WA 1MGOA 1X0VA 2B5WA 1A7KA 3AU9A 1LLDA 2DTDA 4JJGA 2YYYA 2QIOA 4EITA 3JQBC 4R69A 3T7CA 4QFCA 4L8VA 1S7CA 2P5YA 2OFPA 2ZJ0A 4TRRA 3SVTA 4K6CA 2G17A 4M86A 4O0LA 1XCBA 3GH3A 4IDAA 1RM3A 5C3MA 4BO5A 4MVJH 3IUPA 3ZW9A 2X58A 1A4IA 4GX0A 4KDFA 3ZNQA 5TJHA 1J6UA 1JW9B 2CZCA 4W82A 2E37A 4ALLA 3JQEA 2YW9A 1DFHA 5B12A 4CM1A 1P1HA 1IHXA 2GF2A 3ONFA 3TOXA 3O26A 2WD8A 4WNCA 3MTGA 4PZCA 1BGVA 1W8DA 3E9QA 2FPPA 1P1FA 3W4KA 4B7XA 5CEJA 1DHRA 4HADA 1YWGO 2EJVA 1E1KA 2CSUA 4XWYA 1E6EA 1EE9A 3DDNA 1T4BA 2YV1A 2C5AA 4CODB 1NBOA 3PFFA 2H5LA 2FR8A 2FPIA 3F1LA 1HLDA 2DUWA 3PHLA 3PWZA 4PZEA 1GV0A 2GN8A 5DBGA 1A5ZA 5TQVA 5I7VA 3P2OA 4JN6B 4B79A 1XEAA 3ZW8A 4BS9A 4RVDA 2X0NA 3GMSA 5JAIA 4ND4A 2X22A 3FNEA 2HMTA 4EYEA 1EK6A 3GEMA 4NI5A 2O3JA 3GNSA 4J7CA 3NGLA 4O63O 4ND5A 1SAYA 3T4EA 1IULA 1NR1A 1LQTA 2VTDA 3GN2A 4RORA 1T24A 3KTDA 5IAAA 1MFPA 5LDGA 1KS9A 4ALKA 4BO6A 3TZQA 2OGUA 3MEQA 3F47A 2R2GA 4FDAA 1YJQA 2B37A 1MFZA 5JDCA 4K6FA 3VZRA 4EJ0A 3VPGA 2WM3A 4Z0HO 4WJZA 1U4SA 1QYCA 1ZKMA 4KOAA 4RGBA 1DBVO 1BXGB 4RPKA 3IP1A 1V9LA 3U4CA 4TROA 4J9VA 1GEEA 4IS3A 1JLLA 1EVYA 4TQGA 2OBNA 3WGYA 3RBVA 5H81A 4M49A 1GUFA 1TT7A 4IBOA 1E7MA 3KYDB 3LF2A 2ZIZA 5DULA 2P68A 4DQVA 4ZHSA 2IZ1A 2RCYA 1DIGA 3NRCA 5AYVA 1HDGO 1NVGA 5L95A 4DIBA 4HWKA 1JKIA 1WDKA 2V65A 2X5KO 2NU8A 3C85A 2BGMA 3R1IA 4AJPA 1O0SA 2HK9A 3MOGA 1OZAA 2PWZA 4IJVA 5KOIA 4J6FA 9LDBA 3BMCB 4R54A 1U3TA 3CH6A 3QSGA 1U5CA 5KVQA 3KSDO 3VPFA 2BH9A 3KYCB 4OH1A 4B8ZA 3IKTA 3W8EA 2IRWA 5COQA 4DA9A 1A71A 2HAEA 1KVQA 2UYYA 2O3TA 5DDIP 1MP0A 2EW2A 3FTPA 3SC6A 3A06A 3RFTA 4I9HA 2JCYA 4XDZA 3HFSA 5TF4A 2AQ8A 4MP3A 2VQ3A 5EN4A 3LC2O 3GK3A 4YA6A 1FDTA 4ZJUA 1YKFA 2ZB4A 3H5AA 1M6WA 1X15A 4ZQBA 2C7VA 3MOIA 1LI4A 4G5HA 1JVSA 2I65A 4CR6A 2EIHA 2DBRA 4RF3A 5F21A 1OFGA 2QRJA 2RH4A 3WSWA 4A5OA 4B3IA 3C7CB 3EK2A 2HO5A 1I32A 2JD0A 4BNFA 1SPXA 4UVEA 1ZK4A 2ET6A 1DDOA 4XQCA 2PA3A 2ZQZA 4MP8A 3O8QA 1PJLA 3ZWOA 2RIRA 4Q3DA 3GDOA 4RPGA 5AXAA 4ONEA 2Y1CA 1J0XO 3E9MA 5TIIA 2J3KA 3JD3A 4KP7A 3C7DB 4OKNA 1CJCA 2DBVO 4WLNA 3WQRA 1ZK1A 4ZQHA 1YBAA 3HUDA 3VTZA 2UAGA 2AEJA 3B70A 3SC4A 3QWAA 3KYBA 1B8PA 3H9QA 1TT5B 3ZGYA 5AQ1A 3H3JA 4ZRMA 1U9JA 2NADA 3K73O 4ROSA 4GGOA 4GLLA 4CLEA 3AY7A 3VHRA 4LRTB 1ULUA 3CZRA 1LU9A 4MVJF 4EJ6A 5LC1A 1ENPA 1NM5A 3IMFA 4FQ8A 1ZSYA 2F1KA 1Z74A 3DMYA 1K89A 1FDSA 1YQDA 3L4BA 1GV1A 5A1TA 1NTOA 3NTRA 1KVSA 4CMEA 1GQYA 3GUYA 4YJFB 5KJEA 3O03A 2X9NA 2PD3A 3NGXA 3UVEA
chains in the Genus database with same CATH superfamily
2P4QA 4C6SA 4ESVA 5FBLB 2OCKA 3ROEA 4FEYA 4GPTA 1Z63A 2VJPA 4R3WA 5LOVA 3UJNA 1FSSA 1K6XA 2DR0A 1J09A 4YRRA 2BMAA 1NPDA 2PMFA 3R4VA 4FR2A 4A1OA 1NAHA 3RBZA 5JNTA 1VGQA 3DZBA 1XPJA 1LUAA 2J0EA 4WX2B 4JB3A 3DOUA 2AMVA 1C5KA 1EUZA 3NEYA 2OV4A 2F1IA 2ODWA 2V0CA 1NOKA 1YJ5A 2QTLA 3ORQA 4J8PA 4N65A 1FQOA 4Q1CA 3GLGB 1QGUB 3BK2A 1V95A 4Z5XA 3ESDA 4LV5B 3AM5A 3LP8A 3O8OB 2XYRA 4YRZA 4OSPA 4AUMA 2QMUA 1Y6ZA 1SH7A 5KTMA 3WLIA 3HSKA 4UDNA 5IZ4A 2C88A 4J03A 4JI6B 3RASA 4QELA 3C5EA 3CRQA 3I4CA 3MT9A 2VBIA 2WQ7A 5DP1A 3U9SA 3X43A 4IQ8A 2OK8A 3V4FA 3TB6A 3R3SA 1CDOA 2J45A 1SG6A 2W6QA 3PENA 3AL3A 5GONA 3S27A 1NLYA 3LXXA 3RFUA 1WO8A 3F4LA 4KXWA 1H0SA 4FZVA 1VXRA 1WXIA 3G9ZA 4FFNA 1QCZA 2CF6A 4B4DA 4TYNA 3GLIE 4YVFA 3GUCA 4B32A 1U9IA 3R0IA 4X6UA 3QI2A 4DSNA 1I7SB 2E5WA 3W6PA 1Y3CE 2DTXA 3DONA 1E4EB 1F8GA 2V7PA 1IWPB 2VCEA 1A8UA 3K0BA 1BCSA 2FRDA 4R5MA 3X0DA 5EJ7A 4B71A 5CDTA 1VHDA 2GPTA 1VDMA 3HMKA 2QORA 1U8UA 2H18A 2ZUCA 4KV9A 1KDOA 2B94A 4TM8A 5FTJA 5BT9A 4EFKA 4FFDA 3ZCXA 2XCIA 3B6JA 3K9GA 4GLFA 1CUEA 3VNUA 3PP8A 2A1TS 3G0IA 3IEKA 3R24A 1X86B 5K0CA 1G55A 2PANA 5LBIA 4KVGA 3RYHB 4FYIA 1IHDA 1EMDA 1V26A 4QHSA 1OAOA 2X9GA 3DUFA 3VNQA 5B57C 5IJ9A 2I1WA 5LA6A 2PBLA 1GL7A 1XROA 3GRCA 3F5FA 4JBIA 3PIDA 4MS3B 3B7WA 4UAVA 4Z9YA 3E3AA 5E9AA 1BVUA 4EMSA 1ESMA 4I1PA 3ORRA 5ALXA 1J99A 4CCAA 2JZOA 1FU4A 4KUEA 2WYIA 2ZI4A 1CY0A 3PX2A 1LLFA 1PP4A 1M76A 4X20B 2VH1A 1MGPA 5EIWA 3GT4A 5EPUA 1GL6A 1WLYA 1SA0A 3WL8A 2IEDA 4H1UA 1RZ3A 1JWLA 4XGQA 1HNXB 2DHQA 2DZDA 3NOQA 1XZHA 4B6GA 2IXDA 2JHCA 5DNEA 2IPMA 1V4NA 1GR0A 1I3KA 1U3GA 1KO4A 1NDHA 3MD9A 1GLGA 4DWOA 1II0A 1FVOA 1EXDA 1Q2UA 1OI4A 5CVVA 4LZLA 1GGVA 2YCBA 2B3TA 4RF4A 5ESDA 4CM8A 1C0KA 4RKEA 5EZYF 2KM1A 3DEJA 3ZY6A 1GL3A 1PGJA 4JNCA 4X44A 3INTA 1C29B 1NF9A 2ZAIA 3NIBA 4WVLA 1YVUA 4A1FA 3EEOA 1SZJG 3RT1A 4XWAA 2CLMB 1NP6A 1NY6A 2X41A 3DUFB 1ZHFA 3JCZA 3NVDA 1L4UA 3VVBA 4H0CA 3E1GA 4O5OA 1GUDA 1LBHA 1OJLA 1I1OA 2NACA 2I80A 5LZ5A 1FS4A 3V2HA 1FX1A 2AF4C 3CWQA 1B41A 2PG3A 3HU5A 3ZY3A 2WHPA 2Y66A 3CVJA 4IDHA 3DOFA 1IH8A 1YVPA 1QLHA 4GMDA 3F90A 3KHTA 2YMMA 1HE4A 4KIGA 1RMYA 4KGZA 4LC9A 4OUDA 1W0CA 1FYXA 1KI9A 4PE5B 2FPSA 3EDYA 1W9HA 3MA0A 3R6WA 5COAA 5T8KA 4J4HA 4AQDA 3A05A 1Y8RA 1D09A 2HLPA 3AHEA 4RANA 1T5HX 5F73A 3TQHA 1UAYA 3W06A 4DWJA 5F3WB 1GGHA 1EK1A 1N1EA 3AUKA 3LUCA 1TNDA 4ZAYA 1NG9A 3U26A 2TMDA 1J25A 2IYYA 4J2TA 1ST3A 3U13A 1Z68A 1U0EA 3LHDA 1SKYB 1N9GA 2JK0A 4R05A 3AERA 4G0NA 5KYVA 3CKMA 5K0ZA 3FE2A 4IFBA 5LSAA 1AKMA 1K6JA 3K4PA 1Z38A 3ME5A 2C03A 1BWSA 2J59A 5D2CA 2VTBA 4LG1A 4ZV4A 5KPDA 2HIMA 1E3WB 3I8XA 4I2VA 2VNSA 4YUZA 4MKGA 2VP6A 4DLAA 2NZWA 5KKAA 3L6EA 1B76A 5FLYA 5FWYB 2EJBA 1KZ1A 4XARA 1XD9A 2J87A 2R1ZA 2ZGVA 4WCFA 2G77B 5CPFA 4QO7A 3ZWQA 5HCUA 4D5GA 1QV9A 4EA8A 2VQSA 1H2XA 5H9WA 2WLTA 3NTQA 1UXOA 4OQ4A 4EHLA 3QEAZ 2CXQA 3PDIA 3NTXA 1SBYA 4KQ9A 2RHRA 4TTIA 2FSHA 5C31A 4D9KA 3ZHBA 3P4XA 5EHQA 1CJVC 1HE5A 1U7TA 1V8DA 4WK0B 6LDHA 3H1EA 3MPUA 4I4IA 1GLVA 2GAJA 4LC0A 3CZ9A 1HTTA 1NM5C 1PEAA 2WSYB 3PNYA 3UGKA 3O2QB 4BIIA 4WAUA 2UXBB 5AFSA 3V1YA 1I4DD 1CRLA 5HQ3A 1EIZA 3HBMA 1X7DA 2LD4A 2AXQA 4UPDA 3BD9A 2N1BA 5IF9A 5K0LA 1PFVA 3DWIA 2ZI9A 1Q1NA 4CMEC 2HQRA 3FNBA 3KM0A 2X1VA 4GI5A 3VZDA 5BSVA 3F96A 3TR6A 3AERB 3MTBA 4XWGA 5IJWA 1WMAA 3FMGA 2O0HA 1A1SA 3GRZA 2CJXA 4AWAA 2CSXA 2NZUG 1S8AA 4Y1GA 1K66A 4GOMD 5AI0A 5CBPA 5IARA 1TUBA 1WXGA 3BIWA 4IDNA 5J59A 3DDOA 1SZDA 4PLTA 5F3DA 4ZVQA 2WVAA 4YC7A 1HT3A 4E6PA 1RYDA 3KQVA 4KFRA 2OCIA 5KU1A 4WCFB 3U09A 4EBFA 2DH6A 1XNJA 3F1KA 3MWDB 1MOQA 3FWZA 2R6AA 2J85A 3ZWCA 1JG3A 4NCHA 4DWVA 1NPTO 3OIDA 1PSZA 1YS2X 3CB2A 1ULZA 2GN2A 3HCDA 4I4LA 5EHNA 1LX6A 1NJ5A 3A2NA 3VKFA 3JWPA 2F17A 3IV6A 1WUJS 3QK7A 3TIIA 2NUPB 5AKYA 3G9TA 1ULBA 4BTLA 4A8JA 5JEEA 1L7NA 3F7TA 1PX0A 2VJDA 2HDWA 2RAVA 4AY5A 5HQ3B 3GT0A 3J7AC 1RQGA 1K92A 1HKUA 1OXXK 1AHIA 1ZXXA 4E1VA 3VSCA 1VP3A 2V03A 3C15C 1RZRA 2EV9A 1FFHA 1R9JA 2JCBA 2FG5A 2C7PA 4X7PA 2XHEA 4PLPA 2H4XA 1KY5A 1O94A 2WFLA 4NBSA 3GJ7A 1H2EA 4QYTA 1FNSA 2CMDA 3GQBA 3RS2A 5C1PA 5FBHA 4C1BA 5KJ6A 5KDLA 4YJDA 1U9IC 4MI3A 1KA9H 1UJ2A 4ACAA 4C6HA 4Q3LA 5ALNA 2CDAA 3E2IA 5CB8A 1W93A 2GZ1A 1H9BA 2CFTA 2DPMA 2GF0A 2J9RA 4B40A 3EXIB 4Z4FA 5DCUA 4EKNB 4C4XA 4BQIA 2TMYA 3CLHA 1VL5A 4BNHA 1P2VA 1E59A 1Z7WA 4HMOA 4QAQA 1H4VB 4WESA 5DXAA 3N5CA 3HZRA 4HI0E 3VH4A 1YXMA 2GD6A 4NMHA 3VMFA 2HNAA 3E5HA 3GJ5A 4C7JA 3IUJA 1LSOA 2ZJ3A 4JVMA 3GRUA 4ZT5A 3SZRA 4MI1A 5C53B 1XFAA 3DLAA 3OZEA 4EQ6B 3LTNC 2X3UA 1P2UA 2GLXA 2IKQA 5GZ3A 1DKPA 3ESCA 3GHHA 3ID6C 2AMJA 2MYPA 3QX7A 1E2EA 2OG1A 2JFNA 3Q3GE 3SKYA 3GWGA 3DWGA 1Y80A 3TIFA 2KLBA 2IOHA 4W1SA 1KYWA 2AL7A 3VR6A 3W5VA 3ZNNA 3D6NB 4DYHA 3U9LA 4IF4A 4IZHA 1Z28A 3SYKA 5K4HA 4CKWA 5G1PA 3QJYA 1MO2A 3OJEA 1RWBA 3IE2A 4N0DA 1P5RA 4AWBA 3RVJA 4DLBA 1MORA 1YU6A 1T2AA 1BDMA 1G9XA 3C3BA 5CMLA 4DN6A 3DLHA 4MDFA 5CFQA 3A6ZA 1K63A 1DB3A 4IJ5A 4JP2A 5B6JA 2Y1KA 2Z43A 1RZRD 1NVXQ 1G0OA 2PZGA 3TR0A 2VDKB 5KTNA 2PUEA 3OA2A 2JKYA 2OV3A 1ZC4A 4CRWB 2I1QA 4FCWA 1OHHA 1JLKA 1HF3A 3CH7A 1O94D 4Q3NA 3SC2A 2Q7DA 5DHSA 4HGQA 1OX4B 2AFHE 2HIHA 1O1YA 5JBNA 3KDPA 3T1QA 4D4HA 3ZJ4A 4AZ3B 2VBFA 4F3TA 4OPMA 2W2KA 2CBXA 1QH8A 2QAIA 4ZQCB 1JFTA 1FRVA 2Q6KA 4HZUA 4G41A 4P84A 3LUPA 3QA3E 4ZU1X 4E0BA 1HNNA 1Y81A 3E23A 1E5TA 3PC3A 4KH0A 1T1EA 3AR9A 3EFOA 4ETIA 2A0UA 1EQ2A 4KDCA 3TVYA 1CY6A 3IKMB 4C0AC 2VJLA 1HEUA 5KNDA 3INYA 3ZVMA 4YJHA 2HWYA 4ND3A 1NFRA 2M6SA 4IMRA 2Q9BA 2YWFA 3P0EA 4Y2RA 3Q10A 5CJJA 4MZXA 5DPMA 3SF0A 5CB4F 3JQQA 3CE9A 3NHMA 1LSJA 3DLPX 5T8KC 2XE8A 1PHPA 3MWLA 5CT6A 5E4YA 3NUQA 1KYTA 4YMUA 1QHXA 3V7YA 2R7NA 4II3A 4OYYA 3BE6A 1QBGA 4C0QC 4BUZA 2OLKA 3COWA 2V0GA 1TZMA 3T3EA 2HB6A 2BGUA 3ILXA 2X14A 3C6BA 3NC1C 1K68A 3LFUA 3OZ7A 4MW9A 1Z47A 5JADA 3H42B 4BMYA 3WNVA 2FSVA 3OPYI 4UM7A 1O5IA 2Y6UA 3SBOA 3VR6D 9MHTA 2GD2A 2OYSA 2PSEA 4LUCA 1XZDA 4GE3A 2CBGA 4C9BA 1LNQA 1GN8A 1FDVA 1PX2A 3AR3A 3EX7C 3BN3A 1YR7A 1N6LA 1PFGA 1T8YA 3DKIA 3DMDA 3OZRA 5EERA 3X1KA 5A5FA 3W8NA 2WA2A 4L78A 3EWAA 4PC6A 1X80B 1WM1A 2YV5A 3EDQA 2BH2A 3EFOB 1QFYA 3NHKA 4YMWA 1OHHD 3TRKA 4YAFA 1FZTA 1G2QA 1TCVA 3HU3A 2VA9A 3R6DA 1JEYB 4OQQA 5JBIA 3ZWDA 5DH9A 4E31A 4KQXA 4O4JA 2XVXA 4DJAA 2LWIA 2JFHA 2ST1A 3HJTA 3LYHA 5E7QA 4KVAA 3H11A 3HXMA 1ZNQO 3D4IA 3OZXA 3MCAA 5LB2A 3E9CA 4DNFA 2V74B 5E3HA 4POOA 1JQLB 1V37A 1YASA 2FE4A 4WKGA 5IT4A 2C1XA 3G5UA 4DLNA 3OU7A 1ESNA 5KNDD 3HBAA 1N36B 3N2IA 3I5YA 3LX5A 5JC8A 2DG2A 4Y2VA 3VU8A 4Q03A 1Z0AA 3L0DA 3J81A 4O02B 3QU9A 1MAHA 4WBNA 4B2YA 4CQLA 1TLTA 1WPXA 4B3XA 3JPWA 3AQIA 5ITZA 3AHCA 4YIHA 2VPTA 1L5FA 1QCYA 3BB1A 3RQIA 4BXOB 2OILA 3OLYA 4JNKA 2M6LA 2POCA 3V8MA 1EVIA 4ZEVA 2C4MA 4CL2A 1C7FA 4OLBA 1J2UA 2H9AA 3ETEA 3X1MA 4EFNA 4AY4A 4YDQA 4PLCA 4QUDA 2OWEA 4O8CA 2GEVA 2PX8A 4JEUA 4F3YA 3MT8A 5BSFA 2EEZA 1XD8A 2R5FA 2K5UA 3KV3O 1QQ5A 1KI1A 4OQMA 2FNAA 2KW5A 3H04A 2WG1A 1EZ1A 2C3OA 3ONDA 4FQ5A 3EOAI 4NE7A 4WQMA 3SP1A 4R9NA 2DFLA 4B4OA 4EUNA 4ZK2A 4AY6A 2C00A 1G8GA 1P2TA 2AFIB 5JRZA 1GZ4A 3L8ZA 1XDBA 3NG1A 4MGKR 4N03A 3Q2OA 3PUXA 4RDIA 2X1LA 4CR8A 1NXPA 3OQHA 4A8JC 3B6ZA 4W5QA 2A4MA 2QD2A 1RJDA 2YVUA 3M6LA 1L8XA 4LWPA 1UPUA 1F8FA 2XBUA 3N8DA 2NNLD 2X0JA 4ZCQA 3Q1LA 2V6MA 3OT1B 2APJA 2J3QA 3DMRA 1P8JA 1PJTA 3T7KA 2ZSKA 2NO4A 1NP3A 1JAHA 3FX2A 4TKZA 4PCUA 4RAOA 4HQRA 1O94C 4JSYA 2WJYA 2DUNA 1ULTA 5IXJA 1VMDA 5BW4A 4QDTA 5BNZA 4MRMB 4ZARA 4CQLB 1WP4A 2LBPA 4KK3A 5K8IA 2YMPA 1ZISA 3L49A 5JS7A 1BXGA 3E5MA 4AG5A 3MWFA 2R8YA 4F1KA 2VXOA 4NBKA 2O8FB 3FA2A 3A3KA 2AUTA 4G4IA 3BFPA 4XFDA 3RG8A 1C81A 4ZPJA 1XA4A 3I23A 1L9KA 2ZBFA 5K3DA 1AE1A 1EXVA 2ODPA 3SSNA 2XD9A 1B26A 1WG8A 1WVGA 4KOEC 2V1XA 2PYZA 3LGXA 3KXLA 4PFQA 3TKYA 1N0IA 3D7SA 1A5AB 2VSFA 1AUPA 4F2GA 1E1DA 3ZS8A 1QH0A 4KBFA 3GH1A 4YRAA 4F6RB 3LDAA 3JAKA 2I7CA 1IN5A 1OW3B 2OXIA 2D0OB 2W93A 1U2PA 2QA5A 1P0CA 3BDVA 5FP0A 4Z7OB 2WTAA 5FUQA 1BX0A 2QR5A 3HSYA 4H35A 4N3CA 2R1VB 4INPA 4N7RA 4K9DA 4YFVA 2WKQA 3LD9A 1WVMA 4P0TA 5LVAA 1OY1A 2PGDA 2FSFA 4IP0A 3DAFA 4TT8A 5CLLA 3CNEA 4UCFA 5A6VA 1IHUA 4AZSA 4KFCA 2E6KA 4I5GA 3KYCA 4TTPA 1QHFA 1EFHA 2PRJA 4XUEA 1Z39A 4R3NA 1OLXB 3NIDB 2Y93A 3ZV7A 5B3LA 3M5WA 4AECA 1ZH6A 5AVJA 4Y3UA 2Z95A 1W52X 5AP9A 2QTRA 4JOQA 4OTZA 3WB9A 1W4CA 5F7ZA 3OOHA 1ZQ9A 4G8DA 3BREA 5AI8A 4AJLA 2F1JA 4WXHA 5DX8A 2GUWA 1U65A 5CXXA 4RHTA 4X9XA 1VLQA 2JHGA 4GX2A 5CW2A 4XCXA 3GLHE 4P08A 5KYWA 1PJBA 3V4VB 5KWEA 2ZTVA 1YK0A 5CVTA 3F0TA 1E7WA 1W2HA 3CRZA 1T5TA 2JFOA 3FF4A 3GLUA 1Z33A 2P9YA 5E6UA 4GKAA 1KMNA 3EEQA 5GJWC 4F46A 3ROZA 1OLSB 3QIVA 3O1HB 3DOJA 2EDAA 4FFLA 3I12A 3ZXYA 2C04A 3CWZA 3PHIA 3L84A 4ARCA 1JT2A 1XEXA 5K0NA 1HZZA 1NQOA 1UM8A 1XWIA 1UR5A 3K5HA 4J0HA 1MB0A 5BR8B 3R9XA 1EIWA 5CLJA 4I4TA 5BSUA 4F4HA 1XTSA 3TM5A 2HQBA 5A9RA 2HGZA 3ETCA 3WL7A 3E3MA 1M6EX 4OXIA 2R84A 3E84A 1QH1A 2HT6A 3DR3A 4WEQA 2R7AA 4N0EA 2BEUB 1GIAA 2VIIA 4UAGA 1Y9AA 5EKTA 2R8RA 4WFJA 2NNWB 2FSVC 2V4MA 3EZLA 2PX2A 1VJCA 3R3YA 1VHJA 4G3XA 2I6GA 2WG2A 3P96A 3RC3A 4C4SA 4KZPA 5JXHA 3LOUA 5EE9A 4YCCA 2O5CA 1PZEA 3TZHA 4MKXA 4IJQA 3WKBA 1TQ4A 2VA8A 1TT5A 2YDYA 4LRWA 1M83A 4OI0A 1V3UA 4V0LA 4AY2A 4Y2HA 2DT8A 3TNJA 4C2AA 4NFYA 4C0XA 4DIUA 1U0RA 4E32A 4HDMB 3LFTA 4HDKA 4ZVRA 3WRYA 1NXVA 1MVNA 2WNIA 2YZKA 1P4RA 3GGJA 4HATA 1TVKB 4KE9A 3LV8A 3VOTA 5HP4A 2H4YA 2IDMA 1MIOB 1REQB 3PGMA 5DTIA 3KQHA 1HDYA 4X6YA 1Y42X 1E3LA 4CKCA 1T3SA 2C5GA 4P6VF 4JJ7A 4WEOA 3S7ZA 2YH2A 3DGEC 2X86A 4XB6B 5EEGA 2A84A 5EJGA 5T5QA 3SZOA 3D6UA 4BEBA 2QL6A 2E18A 2VUSA 4FGZA 1JTVA 4AG6A 3ZHYA 1COZA 3OEEA 4CFZA 5BR7A 3GPBA 3LMKA 4IL5A 1IN1A 4MOWA 4ZMRA 1LDEA 3AFMA 3HFGA 2QGZA 3HVKA 4LKRA 3DKPA 1P0PA 1ZMTA 4RZHA 3RSSA 1N33B 4OI4A 4OAPA 4X63A 4DY6A 1G8SA 1WKBA 3CH4B 4OX9B 1XQ1A 1N2HA 4PXSA 2OCXA 2J31A 2YIMA 4R31A 4U7WA 1UF9A 3H2GA 3IO3A 4ZOLA 4R1UA 2H1SA 1KTVA 4ARZA 2JA2A 2K87A 4AQ7A 1QE0A 3S2ZA 3FB4A 4E2FA 1ONPA 1YF3A 4WZZA 4EIWA 1QRUA 2RDMA 4ZT4A 1NJFA 4YACA 5CH8A 4BUJA 2ZBRA 3OE1A 5K0TA 2R6ZA 5KB3A 1PT7A 2ZUVA 2EKZA 5ILQA 3WKAA 1D2GA 2W83A 1N2JA 2GZDA 3A4VA 1SXJE 1VSUA 4V39A 3T9AA 4Z3OA 4LF8B 4MGIR 2GRAA 3V4PB 1YB4A 2J46A 4B9EA 1QIHA 4JVOA 3TMAA 1EE2A 2PGOA 1XQXA 4MUMA 3HJHA 2ORYA 3LXMA 4OK3A 1ZD5A 3QWIA 1CE8B 2VXCA 3CV3A 4MAMA 3M5PA 2BKVA 4ZZ3A 2HSJA 2QNBA 3B2NA 4FWTA 4GKJB 3KPUA 3DTNA 2BF7A 3EGWA 5K0EA 2W6MA 5LXTF 3TUJC 2QEQA 4TL8A 3C70A 3EAFA 1NBIA 4PYIA 5B1EA 1W5TA 3PGVA 2VOJA 2VXYA 4KQEA 5DGHA 3ZWPA 1G41A 4TTQA 4ZOLB 3Q9LA 4MXDA 4MLPA 1FBTA 3KB6A 4XVUA 2E4WA 2WVGA 4B3TB 4OFBA 4KO3S 3OEED 5IH3A 2NO9A 1ST2A 2ZR9A 3EZNA 4JZKA 1VOTA 1VLMA 4L74A 1FX0B 2YBDA 4KCGA 3K72B 1OZ0A 2W48A 4URFA 5FADA 1CUHA 1OIXA 3IVAA 3ST7A 1T8RA 4I7EA 3G5MA 4M3NA 3S2SA 5ES4B 3MYRA 3I76A 2P90A 4KN5A 4OOEA 1M8JA 3ORYA 1YOVA 2F90A 1LPBB 4OM7A 3I9V6 3FOAA 1A04A 1UZAA 3AEZA 3CY6A 3H19A 4WADA 2NSYA 2WOOA 4KE7A 3BSWA 1ZIXA 4QXMA 4X7MA 4W4TA 1AF4A 5ARCA 4D4KA 3TUIC 3M6FA 2F59A 3D3WA 3FCEA 4O5AA 4M7WA 2O6HA 3LQ4A 4MRRA 1N7HA 3RH0A 2ENWA 4XQGA 2ZB3A 4MYUA 5KX5F 3EOBI 3A0UA 3H13A 1A77A 2UZ3A 3H2JA 4EX7A 2XOKD 4WW0A 2D5AA 2Q1XA 4CV3A 1Y37A 2HBRA 2R7MA 2RJ3A 3FUXA 1T5LA 3AUYA 4D80A 1UWKA 3ESRA 1XQ9A 5HOQA 2QMQA 3QPDA 3CEHA 3A4IA 4N54A 2FY8A 1G6HA 3UMRA 3MRTA 4TZKA 2MR5A 1R50A 1GTJ1 4B09A 4NCBA 1NI4B 1U3WA 4M46A 4PCLA 3OQMA 1R6VA 2QTBA 1XLUA 3UHOA 4AFNA 1KMMA 3DFIA 4I6EA 1ZNWA 3QVLA 4C20A 4FGLA 4TMYA 5J40A 2RFLA 4D3DA 1KZ7B 1YHYA 3W5AA 2YV3A 3EGCA 1JEDA 3EMKA 1E3SA 2Y0BA 4LVUA 3RLIA 1LCIA 2NIPA 3W2TA 2FFHA 1X8XA 3N6RA 1A69A 1BG6A 5DASA 2P69A 1FNNA 2W98A 3K0AA 3UT0A 2Q4EA 3BWEA 3SX4A 1C8VB 3HR7A 4UVGA 3OO0A 3KR9A 1VGRA 2PZ8A 2GBPA 3QVKA 5KCMA 4DJ5X 3UJHA 2QTNA 1CF9A 3UMYA 1WMDA 2CY0A 4WNIA 3U62A 1PS9A 4X8MA 3ZNOA 3P9YA 5K6AA 3T06B 2D2IA 3KJNA 3K94A 2ANCA 2H1RA 1JF8A 5DRTA 3UXEA 2IZ7A 1P45A 5G41A 4K9RA 4EWLA 1LW6E 4ACBA 3H18A 4TVBA 1HZZC 4UZSA 2OP0A 4WECA 3HYSA 3QM1A 2M1XA 4GAEA 1PCXA 16PKA 1ZN2A 4GNRA 5AQEA 1XYVA 2P6OA 4OBBA 4ZJZA 3L0CA 4DQ0A 5D86A 2Z8XA 3FCXA 1JEQB 2OEPA 4B84A 3GA7A 3VSBA 1AZLA 2XDAA 4HV4A 1HDZA 3KSMA 3MWEA 4FZ3A 4LXXA 1YZUA 3UK7A 5ESRA 2QRQA 2E4AA 4W7IA 3CKLA 2FFAA 2G76A 1XNHA 2IYNA 5BVGA 3JAMA 3RIEA 3HL4A 4BMVA 3SXJA 4MJXA 1CY2A 5F7JA 5JAQA 1ZMOA 2YXEA 3AC0A 3DWFA 2OAQ1 4OQYA 4P9NA 2GO7A 3X2EA 4BFLA 4CMIB 3UPUA 4KAJA 2Z57A 2PQ2A 2RG1A 3IAM1 3GJXC 2C9DA 4DYVA 2B2XA 5EI5A 3TFWA 3AH8A 3EBPA 2J41A 5KTOA 4GSYA 4JR0A 2WVJA 3CJTA 4MUNA 2PMBA 1LTQA 2PQ0A 3ITDA 4JA0A 3MGAA 3WRYC 1NVAA 4P0PB 4WZ6A 2GJ8A 4MITA 4TSKA 1G8HA 1ZOLA 3A1UA 4XW2A 5IAEA 2PS9A 2VP5A 5BURA 3D4LA 2V7TA 2C97A 4BLTA 3THXA 2WF5A 3I3OA 1ZCAA 1RSZA 3AJ8A 5HIJA 2XMSA 3M33A 1R5JA 3QX3A 4P38A 2EZ9A 2W2VA 3T38A 5C52B 3IQZA 4XDHA 3N8NA 4XPZA 2F55A 2VHCA 3MILA 5SY9A 2J1LA 4WHMA 2OORA 1TA4A 2IYOA 5BVGB 2AG8A 4LJKA 1XDDA 1H2FA 1MB4A 1L8OA 1KFJB 1N9KA 1ZRHA 1R6UA 1G7RA 1OFHA 4UCXA 2PXHA 1UXGA 3FNIA 3WLJA 3UH1A 4R83A 4YYEA 3PXEA 2H65A 3L8DA 4D8TA 4TTTS 3HP1A 2WZQA 3DV0A 4LXHA 2PIDA 4CM9A 3IVMA 4MJ3A 4ZA2A 5FUBA 1G4UR 1TFRA 4DCUA 2CLHB 2VZ9A 4BZQA 2QLLA 3QVTA 4G81A 4U7HA 1H4QA 1C1DB 2B36A 2P6MA 3FKQA 8AT1A 4L5YA 4I46A 4FYXA 4OIMA 5H83A 1VL1A 5CUQA 2YKGA 1ZHOA 2CHUA 2ZBPA 3RU7A 1DBQA 4TV8A 5TC4A 2JFGA 2I91A 2PIAA 3LLVA 5ICSA 1MJGM 2XB9A 2BFFA 2AC7A 1BDIA 1A82A 3LDFA 3BIFA 1NC1A 1U3FA 4CTJA 3TKAA 2FQ1A 1WV0A 5BT8A 1WMFA 5CDHA 1WSDA 5FCDA 2A9PA 5ER9A 1JH8A 3RSHA 3GJ0A 3H2SA 5HILA 5LZ8A 5AWFC 1KI6B 5ED0A 1Z4MA 2HU8A 3WNDA 1ISFA 1AA9A 1P75A 2P4HX 3BWYA 3OMXA 1E0KA 5FTKA 3QEMA 2W0SA 1DRJA 1RHMA 4NZMA 5P21A 3RKUA 1X7WA 2DKFA 2OOKA 1NNI1 2PO5A 1JAXA 4UM8B 3WMXA 3C3WA 3JASA 4MIOA 5JXJA 3E9YA 4U0JA 2HHHB 3CMMA 2IZ6A 4PRKA 3FPLA 1LDNA 4JLNA 4C7OB 2QE7A 1IZ9A 1I6LA 1M72A 3MTDA 2C2ZA 3D4OA 3ELDA 4N0QA 4LF6B 3T7RA 2AX3A 4FEGA 1V9CA 1NXXA 2ZR7A 4K1XA 3HI4A 3TINA 2XNHA 3GLVA 1RS0A 1MKYA 3CX3A 4J4BA 4A6XA 1RAIA 3OD1A 3AR7A 3QHAA 4OQLA 1KDRA 3K9NA 4CM9D 3UJ6A 3A1CA 3GFFA 4YJ3B 3I30X 3Q85A 2WWHA 1IJBA 2XQFA 2YTZA 3H4VA 1C50A 1QC5A 4IDDA 3K09A 4MCJA 3WFIA 4CG1A 2ZJ7A 4DMLA 3DYBA 4B6PA 4E13A 4DMCA 2V5VA 1I4OA 1EDOA 5I5EA 4MICA 5DIFA 5A9SA 1JHPA 2RBKA 2WUFA 4DMKA 1QM5A 3MGGA 4UBNA 1ZO8A 5JRJA 2P3QA 1WW3A 3BGDA 2RAUA 1I3NA 1X7WB 2B6HA 3ROQA 4AP5A 2WABA 1MAVA 2OFFA 2X6QA 1FP1D 2GBLA 2XUDA 3NTLA 2WIJA 4IVNA 1OI7A 4B46A 2OV8A 1YR1A 4WDRA 2AW5A 1Q57A 1UBJS 3SOZA 3N1UA 4Q24A 5CA0F 3PCTA 2P9CA 3F78A 3RNLA 2HBQA 3NHFA 3WX0A 4KWIA 4B3RB 1SY7A 1S8FA 2P40A 3RS7A 1L5HB 4D5EA 3RD5A 1IAVA 2GJ9A 3ET4A 4Y2QA 2IUYA 4TMKA 5E3IA 4QQRA 1J07A 1JQ3A 4NG5A 2VUUA 2VDQB 1IEVA 3HDGA 3GMDA 3N2NA 3QKSA 3GGSA 4UDXX 3WAKA 3WGUA 4P3YA 5FTLA 1A4UA 3R7WB 1DCFA 1OUMA 3IQIX 3LHSA 4WL0A 2CKMA 5BMOA 3AXTA 1YC2A 2QZPA 5KAPA 4UTOA 1FFWA 5J1SB 1C7IA 4MQFA 2PCLA 3KE8A 1QOPB 1JX6A 1GTL1 2BUCA 3HCRA 4U2FA 4S04A 1DG9A 4J29A 5K6AC 1UKVY 2WAXA 3ZU3A 3O4VA 1YUMA 1MVOA 2W9XA 1YQUA 5LB4A 2YWRA 1MZPA 1DP4A 4KJXA 3HCBA 1Z29A 4FFMA 2P75A 2X76A 4NU5A 2C0PA 3ZX4A 2PJDA 3V80A 4B79A 5A03A 4X94A 3UOAB 1MG5A 3KZ1E 3RPEA 2YC2C 1J8QA 2WFZA 4D9IA 5JZBA 2YWCA 4EGQA 4HGNA 1E99A 2HTFA 3GJ3A 3QLJA 5H1YA 3F3MA 5DNVA 4CL8A 2POQX 1QKKA 3BMQB 3HB7A 3T3MB 2GXAA 1NQXA 3D1VA 3F97A 1ML3A 3L6DA 4JLKA 1YK1A 3OSZA 3TG8A 1LW7A 4BKPA 5LZ7A 2QLMA 3AIIA 3TFQA 4QKQA 3GARA 2QPOA 1MJGA 2CB9A 2Q5CA 3QKSB 4PYLA 4DTIA 4YXFA 1XZNA 2X2OA 1OH7A 3E7WA 5E6SB 1X87A 2Q7OE 2RBEA 1B6TA 1JLMA 2AN9A 4YV1A 4PFJA 3FTNA 5F64A 3OUZA 4QO8A 1OPRA 4UNIA 5EAIA 3VSAA 2BGJA 3GIDA 4MQFB 1O97D 2BGLA 1KAMA 1MC1A 1SU8A 4JJKA 3RDPA 3HU2A 2QRHA 2NX2A 2IV7A 1DDIA 2OZEA 2FEOA 3VZSA 1S2DA 1SC3A 3OM0A 4J4TA 3RVNA 2CLCX 3LQRA 4JJEA 4JOBA 3TDMA 3DF7A 2GJKA 4P4GA 4F8JA 5KYXB 1GQ2A 2YHIA 3P0HA 1QWSA 2Y1GA 1ADGA 3OOEA 1M5UA 4XTCS 1CG6A 4FFVA 1A9RA 2YS7A 1RAAA 4GOXA 1N5LA 1EG7A 3JD0A 2W8BB 1YIDA 1JI0A 3CUUA 4QSHA 4HFJA 4JC4A 3GDWA 3MXTA 1UT6A 3BB3A 2JLYA 1CS4C 4MV0A 1A95A 3BMXA 2FFRA 1JFLA 3MCZA 1KH3A 2ZI7A 2WYOA 4ZKDA 3ZVRA 4KUGA 3BFVA 4FOLA 1I8TA 2I6FA 2ZIWB 1XD2B 2PSSA 3DBHA 3T12A 1B0UA 1MJHA 3IHWA 5TARA 3PHHA 4J3JA 1UC9A 3MELA 1TM3E 4IHQA 2FZGA 1L7QA 4NEGA 3VMMA 5KYTA 2XYGA 1DPGA 4LJ7A 3OFSA 5JZVA 1AV7A 1ZG3A 2PZKA 4M22A 1G4AE 5L3QA 2VQDA 1UDXA 1P6UA 2G1AA 1RC8A 3OHPA 5CFOA 4P5DA 5C4IA 1UP4A 1X7ZA 4AP9A 4D0SA 4FGWA 2C2YA 4EVSA 4W9NA 4F12A 1CKEA 4G0ZA 5F5NA 3R5XA 5K8UA 1Y5LA 4CXMA 3AX6A 1HL7A 2IY7A 4BZPA 1SHUX 3FYCA 1QDEA 3AJAA 1PK8A 3EN0A 1V35A 4MV3A 5AKJA 1YQQA 4ZEOA 4HNVA 5CVEA 2PGNA 1D9ZA 4LZJA 1DO0A 2X0IA 2FXVA 3RAEC 3BHNA 4BFZA 3I8OA 4A6DA 3DV9A 2CD7A 3E7PA 5LQJA 3WIUA 3THSA 1Z4IA 2VHEA 4IH9A 4RAQA 4BNYA 5FO0A 4UFPA 1XEWX 1KHTA 2L17A 3PU6A 4GI2A 1YBHA 4KV7A 1E1MA 4HDAA 2HJRA 4F71A 1H69A 4E51A 1KVTA 2BTQB 3T0IA 3BHIA 3QVWA 2HK6A 4Z3DA 3GFRA 4GWKA 4MP6A 1KRWA 3DFUA 4KN8A 4PX3A 5D8DA 2H1FA 3OQIB 1KAHA 1S2GA 2VP4A 1M1YB 3U4QA 1NHGA 3K5WA 3WLSA 1XU9A 2KWIA 2QG6A 3G0CA 3EC7A 1LK5A 5JAMA 2ZUDA 1FW8A 3UJCA 2OAEA 1N3IA 2I34A 4O08A 1U7WA 3GDFA 2Q28A 3AV0B 3D7KA 3IIJA 1AIPA 1JMVA 1TJ5A 2HWWA 1P1JA 4B3HA 4R8VA 4YCSA 1N77A 4US2R 3QV1A 5U1PA 2VJYA 5DCLA 5ITSA 1LX7A 3RRJA 2QTGA 3HKBB 4AC9A 1ZUNA 5EFZA 3WDSA 2PL5A 4YQFA 4ZRDA 4X1IA 1BU8A 3H5TA 2CUTA 4OQPA 3AI7A 4RVHA 1SFRA 3BXEA 2VYNA 3PS9A 1N2GA 1XXHA 1PFKA 1ZYUA 3FKJA 3K09C 2ZM6B 1YTUA 2NP7A 1ONOA 3IDQA 1QYWA 5K0GA 2ADMA 1OTYA 5JS8A 2LNDA 1WB5A 3V1LA 4QG7A 1RBYA 3W8DA 1IUNA 3DO6A 1HEYA 4RDCA 4UUNA 4X61A 1AUOA 4TT3A 2A86A 2ZI3A 1P5ZB 3DBLA 3QU2A 4FVTA 4AJOA 4D44A 1J49A 2AI1A 2GBLC 2XOEA 3PHJA 4AK9A 2P9QA 4GXNA 1O03A 4UHDA 5DOVA 3TXAA 5KDOA 1QDUA 2Q3DA 2XJ4A 2YZMA 3AKYA 3L7IA 2LDXA 2RARA 3QI7A 4L2IA 3REQA 4B5KA 4JYBA 4C08A 1O97C 5CDYA 2XD4A 2OCLA 4B31A 4DV7B 3K70B 4UTVA 3MJTA 4R1MA 1J21A 1CP2A 1XXHE 2OV2A 2P65A 3KZMA 5EG5A 4EPYA 2VHJA 3RFXA 2NQ8A 5F76A 2GEBA 2RCNA 4E88A 3SLGA 2GN0A 1GPMA 1XQWA 1CF2O 2IYFA 4LK2A 3R8FA 3FSEA 3G0OA 1DKNA 3N0RA 1PL0A 4H1HA 2I78A 1QU3A 4FOTA 2IIBA 2PUJA 1ZFNA 3IAEA 2GNOA 1MABB 2O2ZA 2R8XA 2XDQB 3FDZB 5EJ8A 5HW0A 5GGYA 1Q7TA 4FFBB 3JQ9C 2K2QB 5I7HA 2NXCA 2WJZB 3CT6A 2JLAA 5ELLA 1LH0A 1VHWA 1XL0A 1FJHA 3MPOA 5I5GA 4AKSA 5ENZA 3QA9A 4GEGA 1T6XA 1V7ZA 2PL9A 3EFHA 3PFBA 1YC5A 4RESA 5H16A 3U3XA 3VAZA 4C6TB 4K2AA 1O87A 5HIIA 3DNPA 4UKDA 3ADCA 1FLDA 2A1IA 1KKLA 4L27A 1B3BA 2EGGA 4K6MA 2P62A 4BQOA 4N41A 4BWYA 1HDEA 3HJRA 5DSZA 1ZL0A 5KYYA 3CRNA 3KT8A 3REQB 1DOHA 1NT2A 2VYND 3ENQA 2PFKA 3IILA 3N07A 2W00A 4Q12A 5B4TA 2XGMA 5I9BA 4OA8A 1KYQA 1A27A 1WU7A 4RPHA 1OU0A 4H7HA 3T99A 1Z6GA 2AG6A 1JTFA 2ZB8A 4LOAA 1Y1QA 3R7SA 5A0VA 1HPLA 1XL1A 2XCLA 4CEJA 1VG9B 4AS1A 3F9RA 2B92A 3K3PA 4FS8A 5FPHA 5G0WA 5JYDA 4TT3D 1DHTA 4BNDB 5EXEA 2XRYA 2IYPA 5FNVA 4A8HA 5UKDA 4DPKA 2FPIB 1WV1A 2ZROA 4DR7B 3O38A 1FMJA 1Z17A 1W5SA 3AKZA 1M8PA 2CBZA 3LAWA 2DSTA 4UXJA 2IW3A 3T9FA 1AZSC 1XPOA 2PUFA 1I94B 2O20A 1ORIA 2DCMA 3COVA 4KACA 3RVSA 3MJDA 5EINA 2AZMA 1ETUA 3LPNA 4I8IA 3QOFA 3N2ZB 2XIQA 4XQ9A 1JBEA 4QGGA 3DE7X 2HTEA 1FNMA 1NVBA 4RSRA 4LDNA 5HF9A 1Y1RA 1SVIA 3NYQA 4K40A 4IKOA 3V4ZA 1TZ2A 4ZTUB 2XBMA 3ZD9A 4QTZA 1O6ZA 3AJEA 3FY4A 1SJ9A 1ZLYA 4XPIB 3UJ9A 1X3LA 2RHJA 2GPAA 3EGOA 3NXKA 4NH4A 1KI2A 4Q7KA 4ZXPA 5K6TA 1ODFA 4MGEA 1JEEA 3L0OA 5C1BA 1YL7A 1LBTA 4UEOA 1JHDA 1R10A 4N3GA 4QNRA 3BVPA 3CJRA 1UMDB 1AKVA 2WJWA 3HVUA 2ZUTA 1ES9A 4PAWA 4XYMA 4RXMA 1T1IA 1FTQA 4JVNA 4GMGA 1IEXA 3IMCA 4Q4DA 4FGSA 4P53A 3EVDA 4EJSB 4A27A 5CA1A 1XDWA 2BKEA 5CFRA 1CUFA 2ZYGA 3TLGB 4M8SA 4TXNA 1JLLB 1VKOA 3R3ZA 1D2RA 4FLFA 4DIDA 1VTKA 1WY7A 1L7OA 4GKBA 1SEPA 4P4LA 2IIPA 4PBSA 4WWHA 5CVCA 1A0OA 3AFIA 5TS2A<