3GOVA

Crystal structure of the catalytic region of human masp-1
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
147
structure length
147
Chain Sequence
GNECPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIPTCKIVDCRAPGELEHGLITFSTRNNLTTYKSEIKYSCQEPYYKMLNNNTGIYTCSAQGVWMNKVLGRSLPTCLPVCGLPKFSRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MASP-1
publication title MASP-1, a promiscuous complement protease: structure of its catalytic region reveals the basis of its broad specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 27
structure length 147
sequence length 147
ec nomenclature ec 3.4.21.-:
pdb deposition date 2009-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 3govA01
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 3govA02
1NWVA 2EC3A 3GXEA 2O39C 2XRDA 4FXGG 2CG6A 3NFPI 4LOSA 3SW0X 3OXUD 2XRBA 4CSYA 1H2QP 3IU3I 1PPQA 2B5ID 2G7IA 2YRAA 1HFIA 2RLPA 5HYPA 2V8EA 5I0QB 2WIIC 5HZPB 1Q3XA 1QUBA 4WJG2 2QY0A 3R62A 4AYDA 2EHFA 2MCYA 1SRZA 2CKUA 3IX0A 5FO8C 3ZD1A 3GOVA 2A55A 3MQLA 1OJWA 1ZJKA 1E8BA 1MD7A 2XWBF 3M7PA 4ONTD 3T5OA 1H04P 2LOJA 2IZ4A 3ZRZA 4B2RA 4C16A 4KKDA 1GKGA 1ELVA 3KXVA 2KMSA 1OK9A 4AYEA 2XWJI 3ERBA 1U5MA 4AYMA 4B2SA 4J38B 1H03P 1G4GA 2JGWA 1C1ZA 1LY2A 1QO6A 1TPGA 2UWNA 3O8EB 1OK1A 3OP8A 1VVCA 4IGDA 2JGXA 2YBYA 1CKLA 4ZH1D 1UOTP 2RLQA 3TVJA 1GKNA 2W81A 1TPNA 1E5GA 3KZJA 2RKZA 4MUCA 1G4FA 4LOTA 1HCCA 3CALA 2IZ3A 1MD8A 1SS2A 4YNXA 1QGBA 2MCZA 1OK3A 1E88A 2RKYA 1HFHA 1OJYA 1OJVA 4A5WB 4K12A 1GHQB 4AYIA 2CG7A 3INBC 2RL0A 5JPMG 3L89M 2W80A 2ERJA 1H2PP 2JRAA 1VVDA 2BZMA 3OEDC 5HYTB 1O9AA 1OK2A 3ZD2A 3EJHA 3RJ3D 1FBRA 4PZ5A 2KRIA 4DJZA 5HYUB 2XQWC 4F4OC 1Z92B 4JHSA 1TPMA 1GPZA
chains in the Genus database with same CATH superfamily
1NWVA 2EC3A 3GXEA 2O39C 2XRDA 4FXGG 2CG6A 3NFPI 4LOSA 3SW0X 3OXUD 2XRBA 4CSYA 4N7EA 1H2QP 3IU3I 1PPQA 3ZLDA 2B5ID 2G7IA 2YRAA 1HFIA 2Y8SA 2RLPA 5HYPA 5DN4A 2V8EA 4PO7A 5I0QB 2WIIC 5HZPB 1Q3XA 1QUBA 2I2LA 2QY0A 4WJG2 3R62A 4AYDA 2EHFA 2MCYA 1SRZA 2CKUA 3IX0A 5FO8C 3ZD1A 3FGRA 2A55A 3GOVA 3MQLA 1OJWA 1ZJKA 1E8BA 1MD7A 2XWBF 3M7PA 4ONTD 3T5OA 1H04P 2LOJA 2IZ4A 3ZRZA 4B2RA 4C16A 4KKDA 1GKGA 1ELVA 3FGTA 3KXVA 2KMSA 1OK9A 4AYEA 2XWJI 3ERBA 3K3TA 1U5MA 4AYMA 4B2SA 4J38B 1H03P 1G4GA 2JGWA 1C1ZA 1LY2A 1QO6A 1TPGA 4APLA 2UWNA 3O8EB 1OK1A 3WSYA 3OP8A 1VVCA 4IGDA 2JGXA 2YBYA 1CKLA 2Y8TA 4ZH1D 1UOTP 1RLHA 2RLQA 3ZLEA 3TVJA 1GKNA 2W81A 1TPNA 1E5GA 3KZJA 2RKZA 4MUCA 1G4FA 4LOTA 1HCCA 3CALA 4YIZA 2IZ3A 1MD8A 1SS2A 4YNXA 1QGBA 2MCZA 1OK3A 3CI0J 4BWCA 1E88A 2RKYA 1HFHA 1OJYA 1OJVA 4A5WB 4K12A 1GHQB 4AYIA 2CG7A 3INBC 2RL0A 5JPMG 3L89M 3F6KA 3NJAA 2W80A 3WSXA 2X2ZA 2ERJA 1H2PP 2JRAA 2Y8RA 1VVDA 2ZYCA 2BZMA 3OEDC 5DN5A 5HYTB 1O9AA 1OK2A 3ZD2A 3EJHA 4MSLA 3RJ3D 1FBRA 4PZ5A 3VWOA 2KRIA 4DJZA 5HYUB 2XQWC 4F4OC 1Z92B 4JHSA 1TPMA 1GPZA
chains in the Genus database with same CATH topology
1NWVA 2EC3A 3GXEA 2O39C 2XRDA 4FXGG 2CG6A 3NFPI 4LOSA 3SW0X 3OXUD 2XRBA 4CSYA 1H2QP 3IU3I 1PPQA 2B5ID 2G7IA 2YRAA 1HFIA 2RLPA 5HYPA 2V8EA 5I0QB 2WIIC 5HZPB 1Q3XA 1QUBA 4WJG2 2QY0A 3R62A 4AYDA 2EHFA 2MCYA 1SRZA 2CKUA 3IX0A 5FO8C 3ZD1A 3GOVA 2A55A 3MQLA 1OJWA 1ZJKA 1E8BA 1MD7A 2XWBF 3M7PA 4ONTD 3T5OA 1H04P 2LOJA 2IZ4A 3ZRZA 4B2RA 4C16A 4KKDA 1GKGA 1ELVA 3KXVA 2KMSA 1OK9A 4AYEA 2XWJI 3ERBA 1U5MA 4AYMA 4B2SA 4J38B 1H03P 1G4GA 2JGWA 1C1ZA 1LY2A 1QO6A 1TPGA 2UWNA 3O8EB 1OK1A 3OP8A 1VVCA 4IGDA 2JGXA 2YBYA 1CKLA 4ZH1D 1UOTP 2RLQA 3TVJA 1GKNA 2W81A 1TPNA 1E5GA 3KZJA 2RKZA 4MUCA 1G4FA 4LOTA 1HCCA 3CALA 2IZ3A 1MD8A 1SS2A 4YNXA 1QGBA 2MCZA 1OK3A 1E88A 2RKYA 1HFHA 1OJYA 1OJVA 4A5WB 4K12A 1GHQB 4AYIA 2CG7A 3INBC 2RL0A 5JPMG 3L89M 2W80A 2ERJA 1H2PP 2JRAA 1VVDA 2BZMA 3OEDC 5HYTB 1O9AA 1OK2A 3ZD2A 3EJHA 3RJ3D 1FBRA 4PZ5A 2KRIA 4DJZA 5HYUB 2XQWC 4F4OC 1Z92B 4JHSA 1TPMA 1GPZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NWV A;  2EC3 A;  3GXE A;  2O39 C;  2XRD A;  4FXG G;  2CG6 A;  3NFP I;  4LOS A;  3SW0 X;  3OXU D;  2XRB A;  4CSY A;  1H2Q P;  3IU3 I;  1PPQ A;  2B5I D;  2G7I A;  2YRA A;  1HFI A;  2RLP A;  5HYP A;  2V8E A;  5I0Q B;  2WII C;  5HZP B;  1Q3X A;  1QUB A;  4WJG 2;  2QY0 A;  3R62 A;  4AYD A;  2EHF A;  2MCY A;  1SRZ A;  2CKU A;  3IX0 A;  5FO8 C;  3ZD1 A;  3GOV A;  2A55 A;  3MQL A;  1OJW A;  1ZJK A;  1E8B A;  1MD7 A;  2XWB F;  3M7P A;  4ONT D;  3T5O A;  1H04 P;  2LOJ A;  2IZ4 A;  3ZRZ A;  4B2R A;  4C16 A;  4KKD A;  1GKG A;  1ELV A;  3KXV A;  2KMS A;  1OK9 A;  4AYE A;  2XWJ I;  3ERB A;  1U5M A;  4AYM A;  4B2S A;  4J38 B;  1H03 P;  1G4G A;  2JGW A;  1C1Z A;  1LY2 A;  1QO6 A;  1TPG A;  2UWN A;  3O8E B;  1OK1 A;  3OP8 A;  1VVC A;  4IGD A;  2JGX A;  2YBY A;  1CKL A;  4ZH1 D;  1UOT P;  2RLQ A;  3TVJ A;  1GKN A;  2W81 A;  1TPN A;  1E5G A;  3KZJ A;  2RKZ A;  4MUC A;  1G4F A;  4LOT A;  1HCC A;  3CAL A;  2IZ3 A;  1MD8 A;  1SS2 A;  4YNX A;  1QGB A;  2MCZ A;  1OK3 A;  1E88 A;  2RKY A;  1HFH A;  1OJY A;  1OJV A;  4A5W B;  4K12 A;  1GHQ B;  4AYI A;  2CG7 A;  3INB C;  2RL0 A;  5JPM G;  3L89 M;  2W80 A;  2ERJ A;  1H2P P;  2JRA A;  1VVD A;  2BZM A;  3OED C;  5HYT B;  1O9A A;  1OK2 A;  3ZD2 A;  3EJH A;  3RJ3 D;  1FBR A;  4PZ5 A;  2KRI A;  4DJZ A;  5HYU B;  2XQW C;  4F4O C;  1Z92 B;  4JHS A;  1TPM A;  1GPZ A; 
#chains in the Genus database with same CATH topology
 1NWV A;  2EC3 A;  3GXE A;  2O39 C;  2XRD A;  4FXG G;  2CG6 A;  3NFP I;  4LOS A;  3SW0 X;  3OXU D;  2XRB A;  4CSY A;  4N7E A;  1H2Q P;  3IU3 I;  1PPQ A;  3ZLD A;  2B5I D;  2G7I A;  2YRA A;  1HFI A;  2Y8S A;  2RLP A;  5HYP A;  5DN4 A;  2V8E A;  4PO7 A;  5I0Q B;  2WII C;  5HZP B;  1Q3X A;  1QUB A;  2I2L A;  2QY0 A;  4WJG 2;  3R62 A;  4AYD A;  2EHF A;  2MCY A;  1SRZ A;  2CKU A;  3IX0 A;  5FO8 C;  3ZD1 A;  3FGR A;  2A55 A;  3GOV A;  3MQL A;  1OJW A;  1ZJK A;  1E8B A;  1MD7 A;  2XWB F;  3M7P A;  4ONT D;  3T5O A;  1H04 P;  2LOJ A;  2IZ4 A;  3ZRZ A;  4B2R A;  4C16 A;  4KKD A;  1GKG A;  1ELV A;  3FGT A;  3KXV A;  2KMS A;  1OK9 A;  4AYE A;  2XWJ I;  3ERB A;  3K3T A;  1U5M A;  4AYM A;  4B2S A;  4J38 B;  1H03 P;  1G4G A;  2JGW A;  1C1Z A;  1LY2 A;  1QO6 A;  1TPG A;  4APL A;  2UWN A;  3O8E B;  1OK1 A;  3WSY A;  3OP8 A;  1VVC A;  4IGD A;  2JGX A;  2YBY A;  1CKL A;  2Y8T A;  4ZH1 D;  1UOT P;  1RLH A;  2RLQ A;  3ZLE A;  3TVJ A;  1GKN A;  2W81 A;  1TPN A;  1E5G A;  3KZJ A;  2RKZ A;  4MUC A;  1G4F A;  4LOT A;  1HCC A;  3CAL A;  4YIZ A;  2IZ3 A;  1MD8 A;  1SS2 A;  4YNX A;  1QGB A;  2MCZ A;  1OK3 A;  3CI0 J;  4BWC A;  1E88 A;  2RKY A;  1HFH A;  1OJY A;  1OJV A;  4A5W B;  4K12 A;  1GHQ B;  4AYI A;  2CG7 A;  3INB C;  2RL0 A;  5JPM G;  3L89 M;  3F6K A;  3NJA A;  2W80 A;  3WSX A;  2X2Z A;  2ERJ A;  1H2P P;  2JRA A;  2Y8R A;  1VVD A;  2ZYC A;  2BZM A;  3OED C;  5DN5 A;  5HYT B;  1O9A A;  1OK2 A;  3ZD2 A;  3EJH A;  4MSL A;  3RJ3 D;  1FBR A;  4PZ5 A;  3VWO A;  2KRI A;  4DJZ A;  5HYU B;  2XQW C;  4F4O C;  1Z92 B;  4JHS A;  1TPM A;  1GPZ A; 
#chains in the Genus database with same CATH homology
 1NWV A;  2EC3 A;  3GXE A;  2O39 C;  2XRD A;  4FXG G;  2CG6 A;  3NFP I;  4LOS A;  3SW0 X;  3OXU D;  2XRB A;  4CSY A;  1H2Q P;  3IU3 I;  1PPQ A;  2B5I D;  2G7I A;  2YRA A;  1HFI A;  2RLP A;  5HYP A;  2V8E A;  5I0Q B;  2WII C;  5HZP B;  1Q3X A;  1QUB A;  4WJG 2;  2QY0 A;  3R62 A;  4AYD A;  2EHF A;  2MCY A;  1SRZ A;  2CKU A;  3IX0 A;  5FO8 C;  3ZD1 A;  3GOV A;  2A55 A;  3MQL A;  1OJW A;  1ZJK A;  1E8B A;  1MD7 A;  2XWB F;  3M7P A;  4ONT D;  3T5O A;  1H04 P;  2LOJ A;  2IZ4 A;  3ZRZ A;  4B2R A;  4C16 A;  4KKD A;  1GKG A;  1ELV A;  3KXV A;  2KMS A;  1OK9 A;  4AYE A;  2XWJ I;  3ERB A;  1U5M A;  4AYM A;  4B2S A;  4J38 B;  1H03 P;  1G4G A;  2JGW A;  1C1Z A;  1LY2 A;  1QO6 A;  1TPG A;  2UWN A;  3O8E B;  1OK1 A;  3OP8 A;  1VVC A;  4IGD A;  2JGX A;  2YBY A;  1CKL A;  4ZH1 D;  1UOT P;  2RLQ A;  3TVJ A;  1GKN A;  2W81 A;  1TPN A;  1E5G A;  3KZJ A;  2RKZ A;  4MUC A;  1G4F A;  4LOT A;  1HCC A;  3CAL A;  2IZ3 A;  1MD8 A;  1SS2 A;  4YNX A;  1QGB A;  2MCZ A;  1OK3 A;  1E88 A;  2RKY A;  1HFH A;  1OJY A;  1OJV A;  4A5W B;  4K12 A;  1GHQ B;  4AYI A;  2CG7 A;  3INB C;  2RL0 A;  5JPM G;  3L89 M;  2W80 A;  2ERJ A;  1H2P P;  2JRA A;  1VVD A;  2BZM A;  3OED C;  5HYT B;  1O9A A;  1OK2 A;  3ZD2 A;  3EJH A;  3RJ3 D;  1FBR A;  4PZ5 A;  2KRI A;  4DJZ A;  5HYU B;  2XQW C;  4F4O C;  1Z92 B;  4JHS A;  1TPM A;  1GPZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...