3GOVA

Crystal structure of the catalytic region of human masp-1
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
147
structure length
147
Chain Sequence
b'GNECPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIPTCKIVDCRAPGELEHGLITFSTRNNLTTYKSEIKYSCQEPYYKMLNNNTGIYTCSAQGVWMNKVLGRSLPTCLPVCGLPKFSRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MASP-1
publication title MASP-1, a promiscuous complement protease: structure of its catalytic region reveals the basis of its broad specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 27
structure length 147
sequence length 147
ec nomenclature ec 3.4.21.-:
pdb deposition date 2009-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 3govA01
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 3govA02
1MD7A 1OJVA 1SS2A 2EC3A 1H2QP 1VVDA 1O9AA 5FO8C 4AYDA 1U5MA 3CALA 1QO6A 4K12A 4ZH1D 2RKYA 1UOTP 2XRBA 2W80A 1CKLA 3MQLA 1HFHA 2RLQA 1E5GA 3L89M 1ZJKA 1H04P 2UWNA 1G4FA 2CG7A 1LY2A 4AYIA 1H2PP 4B2RA 2A55A 2O39C 3M7PA 1QGBA 3TVJA 3IU3I 1OK3A 1PPQA 2BZMA 1MD8A 1TPGA 2G7IA 2IZ4A 2LOJA 1GPZA 4WJG2 1NWVA 1Q3XA 4MUCA 2QY0A 4ONTD 5HYTB 3ZRZA 1OJYA 2RKZA 1HCCA 1ELVA 1OK9A 4J38B 2WIIC 3IX0A 3NFPI 3GOVA 2EHFA 4C16A 1OJWA 4DJZA 1FBRA 2ERJA 1GKNA 3OEDC 3RJ3D 1GHQB 2XWJI 3GXEA 1Z92B 4A5WB 2CG6A 3O8EB 4B2SA 1E8BA 2IZ3A 3KXVA 4CSYA 1OK2A 2MCYA 4LOSA 2RL0A 3OP8A 2JRAA 3T5OA 5HYUB 1OK1A 1SRZA 4AYMA 5HYPA 1QUBA 2CKUA 5JPMG 1VVCA 2MCZA 2B5ID 4FXGG 2YBYA 2W81A 3SW0X 2XRDA 4F4OC 2YRAA 2V8EA 4JHSA 3ZD2A 2XWBF 1G4GA 3EJHA 3INBC 4AYEA 3R62A 2XQWC 3KZJA 2KRIA 2KMSA 3ERBA 1C1ZA 2JGXA 1HFIA 3OXUD 5I0QB 1TPMA 5HZPB 3ZD1A 4YNXA 1GKGA 1TPNA 2JGWA 1H03P 4KKDA 1E88A 4IGDA 2RLPA 4LOTA 4PZ5A
chains in the Genus database with same CATH superfamily
1MD7A 1OJVA 1SS2A 2EC3A 1H2QP 3WSYA 1VVDA 1O9AA 5FO8C 4AYDA 1U5MA 3CALA 1QO6A 4K12A 4ZH1D 3NJAA 2RKYA 1UOTP 2XRBA 2W80A 1CKLA 3MQLA 1HFHA 2RLQA 2Y8TA 1E5GA 3L89M 1ZJKA 1H04P 2UWNA 2Y8SA 1G4FA 2CG7A 1LY2A 4AYIA 1H2PP 3CI0J 4B2RA 2A55A 2O39C 3M7PA 3ZLDA 1QGBA 3TVJA 5DN5A 3IU3I 1OK3A 1PPQA 2BZMA 3VWOA 1MD8A 1TPGA 2G7IA 2IZ4A 2LOJA 1GPZA 4WJG2 1NWVA 1Q3XA 4MUCA 2QY0A 4ONTD 5HYTB 3ZRZA 1OJYA 2RKZA 1HCCA 1ELVA 1OK9A 4J38B 2WIIC 3IX0A 3NFPI 3GOVA 2EHFA 4C16A 1OJWA 4APLA 4DJZA 1FBRA 2ERJA 1GKNA 3OEDC 3RJ3D 1GHQB 2XWJI 3GXEA 1Z92B 2X2ZA 4A5WB 2CG6A 3O8EB 1RLHA 1E8BA 2IZ3A 4B2SA 3KXVA 3ZLEA 4CSYA 1OK2A 2MCYA 4LOSA 4PO7A 2RL0A 3OP8A 2JRAA 3T5OA 5HYUB 1OK1A 1SRZA 4AYMA 5HYPA 4BWCA 1QUBA 2CKUA 5JPMG 2I2LA 3F6KA 1VVCA 2MCZA 2B5ID 4FXGG 2YBYA 2W81A 3SW0X 4N7EA 2XRDA 4F4OC 2YRAA 2V8EA 4JHSA 3ZD2A 2XWBF 1G4GA 3EJHA 3INBC 4AYEA 3R62A 2XQWC 3KZJA 3K3TA 2KRIA 2KMSA 3ERBA 1C1ZA 2JGXA 3FGRA 1HFIA 3FGTA 3OXUD 5I0QB 1TPMA 4YIZA 5HZPB 3ZD1A 2ZYCA 4YNXA 3WSXA 1GKGA 1TPNA 2JGWA 5DN4A 4MSLA 1H03P 4KKDA 1E88A 2Y8RA 4IGDA 2RLPA 4LOTA 4PZ5A
chains in the Genus database with same CATH topology
1MD7A 1OJVA 1SS2A 2EC3A 1H2QP 1VVDA 1O9AA 5FO8C 4AYDA 1U5MA 3CALA 1QO6A 4K12A 4ZH1D 2RKYA 1UOTP 2XRBA 2W80A 1CKLA 3MQLA 1HFHA 2RLQA 1E5GA 3L89M 1ZJKA 1H04P 2UWNA 1G4FA 2CG7A 1LY2A 4AYIA 1H2PP 4B2RA 2A55A 2O39C 3M7PA 1QGBA 3TVJA 3IU3I 1OK3A 1PPQA 2BZMA 1MD8A 1TPGA 2G7IA 2IZ4A 2LOJA 1GPZA 4WJG2 1NWVA 1Q3XA 4MUCA 2QY0A 4ONTD 5HYTB 3ZRZA 1OJYA 2RKZA 1HCCA 1ELVA 1OK9A 4J38B 2WIIC 3IX0A 3NFPI 3GOVA 2EHFA 4C16A 1OJWA 4DJZA 1FBRA 2ERJA 1GKNA 3OEDC 3RJ3D 1GHQB 2XWJI 3GXEA 1Z92B 4A5WB 2CG6A 3O8EB 4B2SA 1E8BA 2IZ3A 3KXVA 4CSYA 1OK2A 2MCYA 4LOSA 2RL0A 3OP8A 2JRAA 3T5OA 5HYUB 1OK1A 1SRZA 4AYMA 5HYPA 1QUBA 2CKUA 5JPMG 1VVCA 2MCZA 2B5ID 4FXGG 2YBYA 2W81A 3SW0X 2XRDA 4F4OC 2YRAA 2V8EA 4JHSA 3ZD2A 2XWBF 1G4GA 3EJHA 3INBC 4AYEA 3R62A 2XQWC 3KZJA 2KRIA 2KMSA 3ERBA 1C1ZA 2JGXA 1HFIA 3OXUD 5I0QB 1TPMA 5HZPB 3ZD1A 4YNXA 1GKGA 1TPNA 2JGWA 1H03P 4KKDA 1E88A 4IGDA 2RLPA 4LOTA 4PZ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MD7 A;  1OJV A;  1SS2 A;  2EC3 A;  1H2Q P;  1VVD A;  1O9A A;  5FO8 C;  4AYD A;  1U5M A;  3CAL A;  1QO6 A;  4K12 A;  4ZH1 D;  2RKY A;  1UOT P;  2XRB A;  2W80 A;  1CKL A;  3MQL A;  1HFH A;  2RLQ A;  1E5G A;  3L89 M;  1ZJK A;  1H04 P;  2UWN A;  1G4F A;  2CG7 A;  1LY2 A;  4AYI A;  1H2P P;  4B2R A;  2A55 A;  2O39 C;  3M7P A;  1QGB A;  3TVJ A;  3IU3 I;  1OK3 A;  1PPQ A;  2BZM A;  1MD8 A;  1TPG A;  2G7I A;  2IZ4 A;  2LOJ A;  1GPZ A;  4WJG 2;  1NWV A;  1Q3X A;  4MUC A;  2QY0 A;  4ONT D;  5HYT B;  3ZRZ A;  1OJY A;  2RKZ A;  1HCC A;  1ELV A;  1OK9 A;  4J38 B;  2WII C;  3IX0 A;  3NFP I;  3GOV A;  2EHF A;  4C16 A;  1OJW A;  4DJZ A;  1FBR A;  2ERJ A;  1GKN A;  3OED C;  3RJ3 D;  1GHQ B;  2XWJ I;  3GXE A;  1Z92 B;  4A5W B;  2CG6 A;  3O8E B;  4B2S A;  1E8B A;  2IZ3 A;  3KXV A;  4CSY A;  1OK2 A;  2MCY A;  4LOS A;  2RL0 A;  3OP8 A;  2JRA A;  3T5O A;  5HYU B;  1OK1 A;  1SRZ A;  4AYM A;  5HYP A;  1QUB A;  2CKU A;  5JPM G;  1VVC A;  2MCZ A;  2B5I D;  4FXG G;  2YBY A;  2W81 A;  3SW0 X;  2XRD A;  4F4O C;  2YRA A;  2V8E A;  4JHS A;  3ZD2 A;  2XWB F;  1G4G A;  3EJH A;  3INB C;  4AYE A;  3R62 A;  2XQW C;  3KZJ A;  2KRI A;  2KMS A;  3ERB A;  1C1Z A;  2JGX A;  1HFI A;  3OXU D;  5I0Q B;  1TPM A;  5HZP B;  3ZD1 A;  4YNX A;  1GKG A;  1TPN A;  2JGW A;  1H03 P;  4KKD A;  1E88 A;  4IGD A;  2RLP A;  4LOT A;  4PZ5 A; 
#chains in the Genus database with same CATH topology
 1MD7 A;  1OJV A;  1SS2 A;  2EC3 A;  1H2Q P;  3WSY A;  1VVD A;  1O9A A;  5FO8 C;  4AYD A;  1U5M A;  3CAL A;  1QO6 A;  4K12 A;  4ZH1 D;  3NJA A;  2RKY A;  1UOT P;  2XRB A;  2W80 A;  1CKL A;  3MQL A;  1HFH A;  2RLQ A;  2Y8T A;  1E5G A;  3L89 M;  1ZJK A;  1H04 P;  2UWN A;  2Y8S A;  1G4F A;  2CG7 A;  1LY2 A;  4AYI A;  1H2P P;  3CI0 J;  4B2R A;  2A55 A;  2O39 C;  3M7P A;  3ZLD A;  1QGB A;  3TVJ A;  5DN5 A;  3IU3 I;  1OK3 A;  1PPQ A;  2BZM A;  3VWO A;  1MD8 A;  1TPG A;  2G7I A;  2IZ4 A;  2LOJ A;  1GPZ A;  4WJG 2;  1NWV A;  1Q3X A;  4MUC A;  2QY0 A;  4ONT D;  5HYT B;  3ZRZ A;  1OJY A;  2RKZ A;  1HCC A;  1ELV A;  1OK9 A;  4J38 B;  2WII C;  3IX0 A;  3NFP I;  3GOV A;  2EHF A;  4C16 A;  1OJW A;  4APL A;  4DJZ A;  1FBR A;  2ERJ A;  1GKN A;  3OED C;  3RJ3 D;  1GHQ B;  2XWJ I;  3GXE A;  1Z92 B;  2X2Z A;  4A5W B;  2CG6 A;  3O8E B;  1RLH A;  1E8B A;  2IZ3 A;  4B2S A;  3KXV A;  3ZLE A;  4CSY A;  1OK2 A;  2MCY A;  4LOS A;  4PO7 A;  2RL0 A;  3OP8 A;  2JRA A;  3T5O A;  5HYU B;  1OK1 A;  1SRZ A;  4AYM A;  5HYP A;  4BWC A;  1QUB A;  2CKU A;  5JPM G;  2I2L A;  3F6K A;  1VVC A;  2MCZ A;  2B5I D;  4FXG G;  2YBY A;  2W81 A;  3SW0 X;  4N7E A;  2XRD A;  4F4O C;  2YRA A;  2V8E A;  4JHS A;  3ZD2 A;  2XWB F;  1G4G A;  3EJH A;  3INB C;  4AYE A;  3R62 A;  2XQW C;  3KZJ A;  3K3T A;  2KRI A;  2KMS A;  3ERB A;  1C1Z A;  2JGX A;  3FGR A;  1HFI A;  3FGT A;  3OXU D;  5I0Q B;  1TPM A;  4YIZ A;  5HZP B;  3ZD1 A;  2ZYC A;  4YNX A;  3WSX A;  1GKG A;  1TPN A;  2JGW A;  5DN4 A;  4MSL A;  1H03 P;  4KKD A;  1E88 A;  2Y8R A;  4IGD A;  2RLP A;  4LOT A;  4PZ5 A; 
#chains in the Genus database with same CATH homology
 1MD7 A;  1OJV A;  1SS2 A;  2EC3 A;  1H2Q P;  1VVD A;  1O9A A;  5FO8 C;  4AYD A;  1U5M A;  3CAL A;  1QO6 A;  4K12 A;  4ZH1 D;  2RKY A;  1UOT P;  2XRB A;  2W80 A;  1CKL A;  3MQL A;  1HFH A;  2RLQ A;  1E5G A;  3L89 M;  1ZJK A;  1H04 P;  2UWN A;  1G4F A;  2CG7 A;  1LY2 A;  4AYI A;  1H2P P;  4B2R A;  2A55 A;  2O39 C;  3M7P A;  1QGB A;  3TVJ A;  3IU3 I;  1OK3 A;  1PPQ A;  2BZM A;  1MD8 A;  1TPG A;  2G7I A;  2IZ4 A;  2LOJ A;  1GPZ A;  4WJG 2;  1NWV A;  1Q3X A;  4MUC A;  2QY0 A;  4ONT D;  5HYT B;  3ZRZ A;  1OJY A;  2RKZ A;  1HCC A;  1ELV A;  1OK9 A;  4J38 B;  2WII C;  3IX0 A;  3NFP I;  3GOV A;  2EHF A;  4C16 A;  1OJW A;  4DJZ A;  1FBR A;  2ERJ A;  1GKN A;  3OED C;  3RJ3 D;  1GHQ B;  2XWJ I;  3GXE A;  1Z92 B;  4A5W B;  2CG6 A;  3O8E B;  4B2S A;  1E8B A;  2IZ3 A;  3KXV A;  4CSY A;  1OK2 A;  2MCY A;  4LOS A;  2RL0 A;  3OP8 A;  2JRA A;  3T5O A;  5HYU B;  1OK1 A;  1SRZ A;  4AYM A;  5HYP A;  1QUB A;  2CKU A;  5JPM G;  1VVC A;  2MCZ A;  2B5I D;  4FXG G;  2YBY A;  2W81 A;  3SW0 X;  2XRD A;  4F4O C;  2YRA A;  2V8E A;  4JHS A;  3ZD2 A;  2XWB F;  1G4G A;  3EJH A;  3INB C;  4AYE A;  3R62 A;  2XQW C;  3KZJ A;  2KRI A;  2KMS A;  3ERB A;  1C1Z A;  2JGX A;  1HFI A;  3OXU D;  5I0Q B;  1TPM A;  5HZP B;  3ZD1 A;  4YNX A;  1GKG A;  1TPN A;  2JGW A;  1H03 P;  4KKD A;  1E88 A;  4IGD A;  2RLP A;  4LOT A;  4PZ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...