3GP6A

Crystal structure of pagp in sds/mpd
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
163
structure length
155
Chain Sequence
b'MNADEWMTTFRENIAQTWQQPEHYDLYIPAITWHARFAYNERPWGGGFGLSRWDEKGNWHGLYAMAFKDSWNKWEPIAGYGWESTWRPLADENFHLGLGFTAGVTARDNWNYIPLPVLLPLASVGYGPVTFQMTYIPGTYNNGNVYFAWMRFQFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein pagP
publication title PagP crystallized from SDS/cosolvent reveals the route for phospholipid access to the hydrocarbon ruler.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 45
structure length 155
sequence length 163
ec nomenclature ec 2.3.1.251: Lipid IV(A) palmitoyltransferase.
pdb deposition date 2009-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07017 PagP Antimicrobial peptide resistance and lipid A acylation protein PagP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 3gp6A00
2JMMA 1BXWA 2MHLA 4PUXA 3G7GA 1THQA 1ORMA 3QRAA 1Q9GA 3QRCA 1QJPA 1MM4A 2K0LA 2N2LA 2N2MA 2M07A 2GE4A 1Q9FA 1QJ9A 2M06A 2X27X 2ERVA 2MNHA 2LHFA 2F1TA 3GP6A 1G90A 4RLCA 1P4TA 2F1VA 1MM5A 1QJ8A 3C5OA
chains in the Genus database with same CATH superfamily
2J1NA 2QTKA 3UU2A 3JTYA 2JMMA 5AFUL 5EE2A 4GHBA 1ZHZA 1PHOA 1IZNA 4UB6O 3WU2O 5JDPA 3BS0A 3G7GA 1ZHTA 3AAEB 2KDYA 4GCPA 4D65A 1ORMA 2WJQA 1S5LO 5DL7A 1Q9GA 3QRCA 3RBHA 2Y2XA 4F4BA 3KVDD 4U9CA 1MM4A 2K0LA 3SY7A 4N58A 4AUIA 3VE1A 2N2MA 3AAEA 5GTIO 7PRNA 2KZ7A 4PJ0O 4FMSA 2WJRA 3K19A 3PQUA 4FOZA 1GFNA 3PGUA 2M06A 2ODJA 2X27X 4K3BA 1GFPA 4FRTA 3KZIO 2AXTO 2F1TA 3POXA 3LK41 2XE2A 4PR7A 3T0SA 4C69X 2JQYA 2KXPA 3AA6B 5B5EO 4O4XA 4LSEA 4K3CA 3AA0A 3VZUX 1BT9A 4FRXA 4FZLA 1P4TA 3SYBA 2F1VA 1MM5A 3FYXA 3A0BO 5T5FA 1BXWA 4N74A 2WVPA 3BRYA 4AYNA 2PORA 2W80C 3DWOX 3POUA 3PF1A 1ZHYA 4FZNA 6PRNA 5ADXK 1OSMA 3QRAA 1QJPA 3LK2B 2XG6A 3JCUO 4N59A 2R4NA 4FSOA 4AKRB 5G38A 4GF4A 3EMNX 1YS5A 5B66O 4E1TA 3DA4A 4GCSA 2K4TA 4LSFA 4IL6O 4RL9A 3HW9A 2KC0A 1QJ9A 5E79O 4AYMC 5H2FO 4XNKA 2ERVA 4LSHA 4O3YA 4O3ZA 2Y0LA 3DZMA 3HOEA 3PGSA 3SYSA 4N75A 4AYID 2X9KA 3AA1B 2O4VA 2OMFA 3PORA 1HXUA 5G39A 4Z3TA 4C4VA 4AKMA 5AFUK 8PRNA 4LSIA 1G90A 2XE3A 5TISO 3HWBA 3VZTX 1T16A 4RJWA 1QJ8A 4RJXA 5G26A 4CTDA 2R4PA 2YPVA 3AA6A 3O0EA 5KAIO 2FGQX 4D5UA 3VY9X 1THQA 1GFOA 2R4LA 1BH3A 3LK3B 2XTQA 4C00A 1H6S1 2R8AA 3BRZA 5PRNA 5GTHO 2R4OA 3WI4A 1GFQA 3UAQA 4KR4A 5FVNA 3AAAB 4G75A 3V8UA 3LK2A 1HXXA 1ZHXA 4D64A 4AKRA 3SZDA 2PRNA 1GFMA 1HXTA 5DL6A 2R88A 3GP6A 4BUMX 3TZGA 1MPFA 4E1SA 2Y0KA 4FT6A 1IZNB 3DWNA 5DL8A 3NJTA 5KAFO 3T24A 2XE5A 3PRNA 5DL5A 3VE2A 4O3WA 4QQ1A 2XTRA 3AA1A 4KR8A 4KRAA 3VZWX 3A2SX 4FESA 4AZLA 2MHLA 3HOLA 4PUXA 2IWVA 5IYUA 2YNKA 3LK42 3DA3A 2KZ7B 2LFUA 2XMXA 2Y7SA 1ZHWA 2XE1A 4G76A 4XNLA 3VY8X 4FUVA 2IWWA 3WI5A 2F1CX 5GV0A 4O49A 4GCQA 2N2LA 4B61A 4FZMA 4O3XB 1E54A 1OPFA 3AA7B 4RLBA 2M07A 5ADXL 2R89A 4FQEA 5D5DA 3PGRA 4AYDC 1T1LA 2GE4A 1Q9FA 3LK3A 2Y0HA 2ZFGA 3SY9A 2KXPB 3AA7A 4AFKA 3POQA 4O4UA 3PQSA 4C4VB 2MNHA 4AYEC 1PRNA 2LHFA 3AA0B 4FSPA 3T20A 2FGRA 3A0HO 4UB8O 3AAAA 2W81C 3UPGA 2ZLDA 4JFBA 3SZVA 4RLCA 3NSGA 2J4UP 4JCHA 5G3AA 3C5OA
chains in the Genus database with same CATH topology
2J1NA 2QTKA 3UU2A 3JTYA 2JMMA 5AFUL 5EE2A 4GHBA 1ZHZA 1PHOA 1IZNA 5JDPA 3G7GA 1ZHTA 3AAEB 2KDYA 4GCPA 4D65A 1ORMA 5DL7A 1Q9GA 3QRCA 3RBHA 2Y2XA 4F4BA 3KVDD 4U9CA 1MM4A 2K0LA 3SY7A 4N58A 4AUIA 3VE1A 2N2MA 3AAEA 7PRNA 2KZ7A 4FMSA 3K19A 3PQUA 4FOZA 1GFNA 2M06A 2ODJA 2X27X 1GFPA 4FRTA 2F1TA 3POXA 3LK41 2XE2A 3T0SA 4C69X 2KXPA 3AA6B 4O4XA 4LSEA 3AA0A 3VZUX 1BT9A 4FRXA 4FZLA 1P4TA 3SYBA 2F1VA 1MM5A 3FYXA 5T5FA 1BXWA 4AYNA 2PORA 2W80C 3POUA 1ZHYA 4FZNA 6PRNA 5ADXK 1OSMA 3QRAA 1QJPA 3LK2B 2XG6A 4N59A 4FSOA 4AKRB 4GF4A 3EMNX 1YS5A 4E1TA 3DA4A 4GCSA 2K4TA 4LSFA 4RL9A 3HW9A 2KC0A 1QJ9A 4AYMC 4XNKA 2ERVA 4LSHA 4O3YA 4O3ZA 2Y0LA 3HOEA 3SYSA 4AYID 3AA1B 2O4VA 2OMFA 3PORA 1HXUA 4Z3TA 1G90A 4AKMA 5AFUK 4LSIA 2XE3A 3HWBA 3VZTX 4RJWA 1QJ8A 4RJXA 5G26A 2YPVA 3AA6A 3O0EA 2FGQX 4D5UA 3VY9X 1THQA 1GFOA 1BH3A 3LK3B 2XTQA 1H6S1 5PRNA 3WI4A 1GFQA 3UAQA 4KR4A 5FVNA 3AAAB 4G75A 3V8UA 3LK2A 1HXXA 1ZHXA 4D64A 4AKRA 3SZDA 2PRNA 1GFMA 1HXTA 5DL6A 3GP6A 4BUMX 3TZGA 1MPFA 4E1SA 2Y0KA 4FT6A 1IZNB 5DL8A 3VE2A 3T24A 2XE5A 3PRNA 5DL5A 4O3WA 4QQ1A 2XTRA 3AA1A 4KR8A 4KRAA 3VZWX 3A2SX 4FESA 4AZLA 2MHLA 3HOLA 4PUXA 5IYUA 2YNKA 3LK42 3DA3A 2KZ7B 2LFUA 2XMXA 2Y7SA 1ZHWA 2XE1A 4G76A 4XNLA 3VY8X 4FUVA 3WI5A 5GV0A 4O49A 4GCQA 2N2LA 4B61A 4FZMA 4O3XB 1E54A 1OPFA 3AA7B 4RLBA 2M07A 5ADXL 5D5DA 4AYDC 2GE4A 3LK3A 1Q9FA 8PRNA 2Y0HA 2ZFGA 3SY9A 2KXPB 3AA7A 4AFKA 3POQA 4O4UA 3PQSA 2MNHA 4AYEC 1PRNA 2LHFA 3AA0B 4FSPA 3T20A 2FGRA 3AAAA 2W81C 3UPGA 2ZLDA 4JFBA 3SZVA 4RLCA 3NSGA 2J4UP 4JCHA 3C5OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JMM A;  1BXW A;  2MHL A;  4PUX A;  3G7G A;  1THQ A;  1ORM A;  3QRA A;  1Q9G A;  3QRC A;  1QJP A;  1MM4 A;  2K0L A;  2N2L A;  2N2M A;  2M07 A;  2GE4 A;  1Q9F A;  1QJ9 A;  2M06 A;  2X27 X;  2ERV A;  2MNH A;  2LHF A;  2F1T A;  3GP6 A;  1G90 A;  4RLC A;  1P4T A;  2F1V A;  1MM5 A;  1QJ8 A;  3C5O A; 
#chains in the Genus database with same CATH topology
 2J1N A;  2QTK A;  3UU2 A;  3JTY A;  2JMM A;  5AFU L;  5EE2 A;  4GHB A;  1ZHZ A;  1PHO A;  1IZN A;  4UB6 O;  3WU2 O;  5JDP A;  3BS0 A;  3G7G A;  1ZHT A;  3AAE B;  2KDY A;  4GCP A;  4D65 A;  1ORM A;  2WJQ A;  1S5L O;  5DL7 A;  1Q9G A;  3QRC A;  3RBH A;  2Y2X A;  4F4B A;  3KVD D;  4U9C A;  1MM4 A;  2K0L A;  3SY7 A;  4N58 A;  4AUI A;  3VE1 A;  2N2M A;  3AAE A;  5GTI O;  7PRN A;  2KZ7 A;  4PJ0 O;  4FMS A;  2WJR A;  3K19 A;  3PQU A;  4FOZ A;  1GFN A;  3PGU A;  2M06 A;  2ODJ A;  2X27 X;  4K3B A;  1GFP A;  4FRT A;  3KZI O;  2AXT O;  2F1T A;  3POX A;  3LK4 1;  2XE2 A;  4PR7 A;  3T0S A;  4C69 X;  2JQY A;  2KXP A;  3AA6 B;  5B5E O;  4O4X A;  4LSE A;  4K3C A;  3AA0 A;  3VZU X;  1BT9 A;  4FRX A;  4FZL A;  1P4T A;  3SYB A;  2F1V A;  1MM5 A;  3FYX A;  3A0B O;  5T5F A;  1BXW A;  4N74 A;  2WVP A;  3BRY A;  4AYN A;  2POR A;  2W80 C;  3DWO X;  3POU A;  3PF1 A;  1ZHY A;  4FZN A;  6PRN A;  5ADX K;  1OSM A;  3QRA A;  1QJP A;  3LK2 B;  2XG6 A;  3JCU O;  4N59 A;  2R4N A;  4FSO A;  4AKR B;  5G38 A;  4GF4 A;  3EMN X;  1YS5 A;  5B66 O;  4E1T A;  3DA4 A;  4GCS A;  2K4T A;  4LSF A;  4IL6 O;  4RL9 A;  3HW9 A;  2KC0 A;  1QJ9 A;  5E79 O;  4AYM C;  5H2F O;  4XNK A;  2ERV A;  4LSH A;  4O3Y A;  4O3Z A;  2Y0L A;  3DZM A;  3HOE A;  3PGS A;  3SYS A;  4N75 A;  4AYI D;  2X9K A;  3AA1 B;  2O4V A;  2OMF A;  3POR A;  1HXU A;  5G39 A;  4Z3T A;  4C4V A;  4AKM A;  5AFU K;  8PRN A;  4LSI A;  1G90 A;  2XE3 A;  5TIS O;  3HWB A;  3VZT X;  1T16 A;  4RJW A;  1QJ8 A;  4RJX A;  5G26 A;  4CTD A;  2R4P A;  2YPV A;  3AA6 A;  3O0E A;  5KAI O;  2FGQ X;  4D5U A;  3VY9 X;  1THQ A;  1GFO A;  2R4L A;  1BH3 A;  3LK3 B;  2XTQ A;  4C00 A;  1H6S 1;  2R8A A;  3BRZ A;  5PRN A;  5GTH O;  2R4O A;  3WI4 A;  1GFQ A;  3UAQ A;  4KR4 A;  5FVN A;  3AAA B;  4G75 A;  3V8U A;  3LK2 A;  1HXX A;  1ZHX A;  4D64 A;  4AKR A;  3SZD A;  2PRN A;  1GFM A;  1HXT A;  5DL6 A;  2R88 A;  3GP6 A;  4BUM X;  3TZG A;  1MPF A;  4E1S A;  2Y0K A;  4FT6 A;  1IZN B;  3DWN A;  5DL8 A;  3NJT A;  5KAF O;  3T24 A;  2XE5 A;  3PRN A;  5DL5 A;  3VE2 A;  4O3W A;  4QQ1 A;  2XTR A;  3AA1 A;  4KR8 A;  4KRA A;  3VZW X;  3A2S X;  4FES A;  4AZL A;  2MHL A;  3HOL A;  4PUX A;  2IWV A;  5IYU A;  2YNK A;  3LK4 2;  3DA3 A;  2KZ7 B;  2LFU A;  2XMX A;  2Y7S A;  1ZHW A;  2XE1 A;  4G76 A;  4XNL A;  3VY8 X;  4FUV A;  2IWW A;  3WI5 A;  2F1C X;  5GV0 A;  4O49 A;  4GCQ A;  2N2L A;  4B61 A;  4FZM A;  4O3X B;  1E54 A;  1OPF A;  3AA7 B;  4RLB A;  2M07 A;  5ADX L;  2R89 A;  4FQE A;  5D5D A;  3PGR A;  4AYD C;  1T1L A;  2GE4 A;  1Q9F A;  3LK3 A;  2Y0H A;  2ZFG A;  3SY9 A;  2KXP B;  3AA7 A;  4AFK A;  3POQ A;  4O4U A;  3PQS A;  4C4V B;  2MNH A;  4AYE C;  1PRN A;  2LHF A;  3AA0 B;  4FSP A;  3T20 A;  2FGR A;  3A0H O;  4UB8 O;  3AAA A;  2W81 C;  3UPG A;  2ZLD A;  4JFB A;  3SZV A;  4RLC A;  3NSG A;  2J4U P;  4JCH A;  5G3A A;  3C5O A; 
#chains in the Genus database with same CATH homology
 2J1N A;  2QTK A;  3UU2 A;  3JTY A;  2JMM A;  5AFU L;  5EE2 A;  4GHB A;  1ZHZ A;  1PHO A;  1IZN A;  5JDP A;  3G7G A;  1ZHT A;  3AAE B;  2KDY A;  4GCP A;  4D65 A;  1ORM A;  5DL7 A;  1Q9G A;  3QRC A;  3RBH A;  2Y2X A;  4F4B A;  3KVD D;  4U9C A;  1MM4 A;  2K0L A;  3SY7 A;  4N58 A;  4AUI A;  3VE1 A;  2N2M A;  3AAE A;  7PRN A;  2KZ7 A;  4FMS A;  3K19 A;  3PQU A;  4FOZ A;  1GFN A;  2M06 A;  2ODJ A;  2X27 X;  1GFP A;  4FRT A;  2F1T A;  3POX A;  3LK4 1;  2XE2 A;  3T0S A;  4C69 X;  2KXP A;  3AA6 B;  4O4X A;  4LSE A;  3AA0 A;  3VZU X;  1BT9 A;  4FRX A;  4FZL A;  1P4T A;  3SYB A;  2F1V A;  1MM5 A;  3FYX A;  5T5F A;  1BXW A;  4AYN A;  2POR A;  2W80 C;  3POU A;  1ZHY A;  4FZN A;  6PRN A;  5ADX K;  1OSM A;  3QRA A;  1QJP A;  3LK2 B;  2XG6 A;  4N59 A;  4FSO A;  4AKR B;  4GF4 A;  3EMN X;  1YS5 A;  4E1T A;  3DA4 A;  4GCS A;  2K4T A;  4LSF A;  4RL9 A;  3HW9 A;  2KC0 A;  1QJ9 A;  4AYM C;  4XNK A;  2ERV A;  4LSH A;  4O3Y A;  4O3Z A;  2Y0L A;  3HOE A;  3SYS A;  4AYI D;  3AA1 B;  2O4V A;  2OMF A;  3POR A;  1HXU A;  4Z3T A;  1G90 A;  4AKM A;  5AFU K;  4LSI A;  2XE3 A;  3HWB A;  3VZT X;  4RJW A;  1QJ8 A;  4RJX A;  5G26 A;  2YPV A;  3AA6 A;  3O0E A;  2FGQ X;  4D5U A;  3VY9 X;  1THQ A;  1GFO A;  1BH3 A;  3LK3 B;  2XTQ A;  1H6S 1;  5PRN A;  3WI4 A;  1GFQ A;  3UAQ A;  4KR4 A;  5FVN A;  3AAA B;  4G75 A;  3V8U A;  3LK2 A;  1HXX A;  1ZHX A;  4D64 A;  4AKR A;  3SZD A;  2PRN A;  1GFM A;  1HXT A;  5DL6 A;  3GP6 A;  4BUM X;  3TZG A;  1MPF A;  4E1S A;  2Y0K A;  4FT6 A;  1IZN B;  5DL8 A;  3VE2 A;  3T24 A;  2XE5 A;  3PRN A;  5DL5 A;  4O3W A;  4QQ1 A;  2XTR A;  3AA1 A;  4KR8 A;  4KRA A;  3VZW X;  3A2S X;  4FES A;  4AZL A;  2MHL A;  3HOL A;  4PUX A;  5IYU A;  2YNK A;  3LK4 2;  3DA3 A;  2KZ7 B;  2LFU A;  2XMX A;  2Y7S A;  1ZHW A;  2XE1 A;  4G76 A;  4XNL A;  3VY8 X;  4FUV A;  3WI5 A;  5GV0 A;  4O49 A;  4GCQ A;  2N2L A;  4B61 A;  4FZM A;  4O3X B;  1E54 A;  1OPF A;  3AA7 B;  4RLB A;  2M07 A;  5ADX L;  5D5D A;  4AYD C;  2GE4 A;  3LK3 A;  1Q9F A;  8PRN A;  2Y0H A;  2ZFG A;  3SY9 A;  2KXP B;  3AA7 A;  4AFK A;  3POQ A;  4O4U A;  3PQS A;  2MNH A;  4AYE C;  1PRN A;  2LHF A;  3AA0 B;  4FSP A;  3T20 A;  2FGR A;  3AAA A;  2W81 C;  3UPG A;  2ZLD A;  4JFB A;  3SZV A;  4RLC A;  3NSG A;  2J4U P;  4JCH A;  3C5O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...