3GP6A

Crystal structure of pagp in sds/mpd
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
163
structure length
155
Chain Sequence
MNADEWMTTFRENIAQTWQQPEHYDLYIPAITWHARFAYNERPWGGGFGLSRWDEKGNWHGLYAMAFKDSWNKWEPIAGYGWESTWRPLADENFHLGLGFTAGVTARDNWNYIPLPVLLPLASVGYGPVTFQMTYIPGTYNNGNVYFAWMRFQFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title PagP crystallized from SDS/cosolvent reveals the route for phospholipid access to the hydrocarbon ruler.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Protein pagP
total genus 45
structure length 155
sequence length 163
ec nomenclature ec 2.3.1.251: Lipid IV(A) palmitoyltransferase.
pdb deposition date 2009-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07017 PagP Antimicrobial peptide resistance and lipid A acylation protein PagP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 3gp6A00
2MHLA 1P4TA 2MNHA 3QRAA 1THQA 2LHFA 3GP6A 2N2LA 1ORMA 1Q9FA 3QRCA 2F1VA 2GE4A 2K0LA 2N2MA 2JMMA 1MM5A 1QJ9A 1MM4A 1QJPA 1QJ8A 3G7GA 2M07A 3C5OA 2ERVA 4PUXA 1Q9GA 2F1TA 1G90A 4RLCA 2X27X 1BXWA 2M06A
chains in the Genus database with same CATH superfamily
1MPFA 4AKRA 3PF1A 2WJRA 2ODJA 4LSFA 3RBHA 2KC0A 1IZNA 1ZHZA 4C4VA 4BUMX 2R8AA 2K4TA 2MNHA 3NSGA 4FZLA 2LHFA 1OPFA 3GP6A 4K3BA 4KR8A 4FRXA 1PRNA 5T5FA 5TISO 3AAEA 2KZ7A 2ZFGA 2YNKA 3DZMA 5G38A 3QRCA 3DWNA 2F1VA 2KDYA 2W81C 2XTRA 2N2MA 3BRZA 4D64A 2W80C 3AA6B 3POXA 1QJPA 2KXPB 1GFOA 3SYBA 4Z3TA 3G7GA 4AKMA 4LSHA 2PORA 2ERVA 3AAEB 1ZHWA 2Y7SA 1YS5A 3BS0A 2Y0KA 4O3XB 5KAIO 1BH3A 4N59A 3SYSA 3WU2O 5JDPA 5G3AA 2R4OA 3HW9A 4FUVA 3VZUX 1G90A 3VE1A 3AA6A 2X27X 1ZHYA 1BXWA 2X9KA 2F1CX 3AA7B 4KRAA 4N74A 5ADXL 4N75A 4AYID 4FZMA 3A2SX 5GTIO 2JQYA 1PHOA 2R4LA 2R88A 3HOEA 3JTYA 4LSEA 5D5DA 5KAFO 1ZHTA 3SY7A 1T16A 1GFMA 4RLBA 3T20A 3AA1A 3PQUA 1OSMA 2GE4A 5GTHO 1HXTA 3PGUA 1HXXA 1MM5A 2XE3A 1MM4A 1HXUA 2FGQX 3UAQA 4O3YA 3JCUO 1BT9A 3K19A 2ZLDA 3PRNA 2M07A 4RJXA 3AA1B 3C5OA 3KVDD 4CTDA 5ADXK 4JCHA 4LSIA 3POQA 3VZTX 5E79O 5B66O 3POUA 2Y2XA 4G75A 4C69X 4AKRB 3SY9A 3DA4A 5FVNA 4FESA 4IL6O 3A0BO 3T0SA 4D5UA 5DL5A 4PR7A 2R4NA 5PRNA 5DL8A 6PRNA 2LFUA 2Y0HA 2KZ7B 2XG6A 5DL6A 3VE2A 2WVPA 1ZHXA 1THQA 4K3CA 3PGSA 2N2LA 3PORA 5B5EO 3VY8X 4O3ZA 3LK3B 1IZNB 1Q9FA 4AYEC 4FOZA 5DL7A 4AZLA 2IWWA 2JMMA 2XMXA 4G76A 3LK41 3AA0A 3NJTA 4U9CA 4O4UA 2XE5A 3SZVA 2YPVA 3LK3A 4FSPA 5IYUA 4AYDC 2J1NA 3AAAA 4XNLA 2WJQA 4FRTA 3TZGA 3HOLA 1GFNA 2OMFA 2XE1A 3T24A 2XE2A 3WI5A 4E1SA 1E54A 3AA0B 4RLCA 4FSOA 3LK42 2MHLA 2J4UP 5H2FO 5EE2A 4D65A 1P4TA 5AFUK 4AYMC 3AAAB 5AFUL 3UU2A 1GFPA 3QRAA 4RL9A 4UB6O 4XNKA 4FT6A 3BRYA 4O3WA 3O0EA 2O4VA 5GV0A 1ORMA 3FYXA 2PRNA 4FQEA 4JFBA 1S5LO 2Y0LA 4F4BA 2K0LA 2XTQA 4FZNA 4GCSA 4N58A 3KZIO 3V8UA 4C4VB 3DWOX 3UPGA 4PJ0O 2IWVA 3VZWX 3A0HO 1QJ9A 3PGRA 1H6S1 4GF4A 3AA7A 2AXTO 4GCQA 4O49A 3SZDA 4E1TA 4O4XA 1QJ8A 3DA3A 3VY9X 4AFKA 1T1LA 8PRNA 2R89A 4GHBA 4PUXA 4B61A 4AYNA 4QQ1A 4RJWA 5G26A 4KR4A 3WI4A 1Q9GA 4AUIA 4C00A 7PRNA 2FGRA 1GFQA 4GCPA 2KXPA 2QTKA 4UB8O 5G39A 2F1TA 4FMSA 3PQSA 3LK2A 3LK2B 3HWBA 3EMNX 2R4PA 2M06A
chains in the Genus database with same CATH topology
1MPFA 4AKRA 2ODJA 4LSFA 3RBHA 2KC0A 1IZNA 1ZHZA 4BUMX 2K4TA 2MNHA 3NSGA 4FZLA 2LHFA 1OPFA 3GP6A 4KR8A 5T5FA 4FRXA 1PRNA 3AAEA 2KZ7A 2ZFGA 2YNKA 3QRCA 2F1VA 2KDYA 2W81C 2XTRA 2N2MA 4D64A 2W80C 3AA6B 3POXA 1QJPA 2KXPB 1GFOA 3SYBA 4Z3TA 3G7GA 4AKMA 4LSHA 2PORA 2ERVA 3AAEB 1ZHWA 2Y7SA 1YS5A 2Y0KA 4O3XB 1BH3A 4N59A 3SYSA 5JDPA 3HW9A 4FUVA 3VZUX 1G90A 3VE1A 3AA6A 2X27X 1ZHYA 1BXWA 3AA7B 5ADXL 4KRAA 4AYID 4FZMA 3A2SX 4LSEA 1PHOA 3HOEA 3JTYA 5D5DA 1ZHTA 3SY7A 1GFMA 4RLBA 3AA1A 3PQUA 1OSMA 2GE4A 1HXTA 1HXXA 1MM5A 2XE3A 1MM4A 1HXUA 2FGQX 3UAQA 4O3YA 1BT9A 3K19A 2ZLDA 3PRNA 2M07A 4RJXA 3AA1B 3C5OA 3KVDD 5ADXK 4JCHA 4LSIA 3POQA 3VZTX 3POUA 2Y2XA 4G75A 4C69X 4AKRB 3SY9A 3DA4A 5FVNA 4FESA 3T0SA 4D5UA 5DL5A 5PRNA 5DL8A 6PRNA 2LFUA 2Y0HA 2KZ7B 2XG6A 5DL6A 3VE2A 1ZHXA 1THQA 3PORA 2N2LA 3VY8X 4O3ZA 3LK3B 1IZNB 1Q9FA 4AYEC 4FOZA 5DL7A 4AZLA 2JMMA 2XMXA 4G76A 3LK41 3AA0A 4U9CA 4O4UA 2XE5A 3SZVA 2YPVA 3LK3A 4FSPA 5IYUA 4AYDC 2J1NA 3AAAA 4XNLA 4FRTA 3TZGA 3HOLA 1GFNA 2OMFA 2XE1A 3T24A 2XE2A 3WI5A 4E1SA 1E54A 3AA0B 4RLCA 4FSOA 3LK42 2MHLA 2J4UP 5EE2A 4D65A 1P4TA 5AFUK 4AYMC 3AAAB 5AFUL 3UU2A 1GFPA 3QRAA 4RL9A 4XNKA 4FT6A 4O3WA 5GV0A 3O0EA 2O4VA 1ORMA 3FYXA 2PRNA 4JFBA 2Y0LA 4F4BA 2K0LA 2XTQA 4FZNA 4GCSA 4N58A 3V8UA 3UPGA 3VZWX 4GF4A 1QJ9A 4O49A 1H6S1 3SZDA 3AA7A 4GCQA 4E1TA 4O4XA 1QJ8A 3DA3A 3VY9X 4AFKA 8PRNA 4GHBA 4B61A 4PUXA 4AYNA 4QQ1A 4RJWA 5G26A 4KR4A 3WI4A 1Q9GA 4AUIA 7PRNA 2FGRA 1GFQA 4GCPA 2KXPA 2QTKA 2F1TA 4FMSA 3PQSA 3LK2A 3LK2B 3HWBA 3EMNX 3T20A 2M06A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MHL A;  1P4T A;  2MNH A;  3QRA A;  1THQ A;  2LHF A;  3GP6 A;  2N2L A;  1ORM A;  1Q9F A;  3QRC A;  2F1V A;  2GE4 A;  2K0L A;  2N2M A;  2JMM A;  1MM5 A;  1QJ9 A;  1MM4 A;  1QJP A;  1QJ8 A;  3G7G A;  2M07 A;  3C5O A;  2ERV A;  4PUX A;  1Q9G A;  2F1T A;  1G90 A;  4RLC A;  2X27 X;  1BXW A;  2M06 A; 
#chains in the Genus database with same CATH topology
 1MPF A;  4AKR A;  3PF1 A;  2WJR A;  2ODJ A;  4LSF A;  3RBH A;  2KC0 A;  1IZN A;  1ZHZ A;  4C4V A;  4BUM X;  2R8A A;  2K4T A;  2MNH A;  3NSG A;  4FZL A;  2LHF A;  1OPF A;  3GP6 A;  4K3B A;  4KR8 A;  4FRX A;  1PRN A;  5T5F A;  5TIS O;  3AAE A;  2KZ7 A;  2ZFG A;  2YNK A;  3DZM A;  5G38 A;  3QRC A;  3DWN A;  2F1V A;  2KDY A;  2W81 C;  2XTR A;  2N2M A;  3BRZ A;  4D64 A;  2W80 C;  3AA6 B;  3POX A;  1QJP A;  2KXP B;  1GFO A;  3SYB A;  4Z3T A;  3G7G A;  4AKM A;  4LSH A;  2POR A;  2ERV A;  3AAE B;  1ZHW A;  2Y7S A;  1YS5 A;  3BS0 A;  2Y0K A;  4O3X B;  5KAI O;  1BH3 A;  4N59 A;  3SYS A;  3WU2 O;  5JDP A;  5G3A A;  2R4O A;  3HW9 A;  4FUV A;  3VZU X;  1G90 A;  3VE1 A;  3AA6 A;  2X27 X;  1ZHY A;  1BXW A;  2X9K A;  2F1C X;  3AA7 B;  4KRA A;  4N74 A;  5ADX L;  4N75 A;  4AYI D;  4FZM A;  3A2S X;  5GTI O;  2JQY A;  1PHO A;  2R4L A;  2R88 A;  3HOE A;  3JTY A;  4LSE A;  5D5D A;  5KAF O;  1ZHT A;  3SY7 A;  1T16 A;  1GFM A;  4RLB A;  3T20 A;  3AA1 A;  3PQU A;  1OSM A;  2GE4 A;  5GTH O;  1HXT A;  3PGU A;  1HXX A;  1MM5 A;  2XE3 A;  1MM4 A;  1HXU A;  2FGQ X;  3UAQ A;  4O3Y A;  3JCU O;  1BT9 A;  3K19 A;  2ZLD A;  3PRN A;  2M07 A;  4RJX A;  3AA1 B;  3C5O A;  3KVD D;  4CTD A;  5ADX K;  4JCH A;  4LSI A;  3POQ A;  3VZT X;  5E79 O;  5B66 O;  3POU A;  2Y2X A;  4G75 A;  4C69 X;  4AKR B;  3SY9 A;  3DA4 A;  5FVN A;  4FES A;  4IL6 O;  3A0B O;  3T0S A;  4D5U A;  5DL5 A;  4PR7 A;  2R4N A;  5PRN A;  5DL8 A;  6PRN A;  2LFU A;  2Y0H A;  2KZ7 B;  2XG6 A;  5DL6 A;  3VE2 A;  2WVP A;  1ZHX A;  1THQ A;  4K3C A;  3PGS A;  2N2L A;  3POR A;  5B5E O;  3VY8 X;  4O3Z A;  3LK3 B;  1IZN B;  1Q9F A;  4AYE C;  4FOZ A;  5DL7 A;  4AZL A;  2IWW A;  2JMM A;  2XMX A;  4G76 A;  3LK4 1;  3AA0 A;  3NJT A;  4U9C A;  4O4U A;  2XE5 A;  3SZV A;  2YPV A;  3LK3 A;  4FSP A;  5IYU A;  4AYD C;  2J1N A;  3AAA A;  4XNL A;  2WJQ A;  4FRT A;  3TZG A;  3HOL A;  1GFN A;  2OMF A;  2XE1 A;  3T24 A;  2XE2 A;  3WI5 A;  4E1S A;  1E54 A;  3AA0 B;  4RLC A;  4FSO A;  3LK4 2;  2MHL A;  2J4U P;  5H2F O;  5EE2 A;  4D65 A;  1P4T A;  5AFU K;  4AYM C;  3AAA B;  5AFU L;  3UU2 A;  1GFP A;  3QRA A;  4RL9 A;  4UB6 O;  4XNK A;  4FT6 A;  3BRY A;  4O3W A;  3O0E A;  2O4V A;  5GV0 A;  1ORM A;  3FYX A;  2PRN A;  4FQE A;  4JFB A;  1S5L O;  2Y0L A;  4F4B A;  2K0L A;  2XTQ A;  4FZN A;  4GCS A;  4N58 A;  3KZI O;  3V8U A;  4C4V B;  3DWO X;  3UPG A;  4PJ0 O;  2IWV A;  3VZW X;  3A0H O;  1QJ9 A;  3PGR A;  1H6S 1;  4GF4 A;  3AA7 A;  2AXT O;  4GCQ A;  4O49 A;  3SZD A;  4E1T A;  4O4X A;  1QJ8 A;  3DA3 A;  3VY9 X;  4AFK A;  1T1L A;  8PRN A;  2R89 A;  4GHB A;  4PUX A;  4B61 A;  4AYN A;  4QQ1 A;  4RJW A;  5G26 A;  4KR4 A;  3WI4 A;  1Q9G A;  4AUI A;  4C00 A;  7PRN A;  2FGR A;  1GFQ A;  4GCP A;  2KXP A;  2QTK A;  4UB8 O;  5G39 A;  2F1T A;  4FMS A;  3PQS A;  3LK2 A;  3LK2 B;  3HWB A;  3EMN X;  2R4P A;  2M06 A; 
#chains in the Genus database with same CATH homology
 1MPF A;  4AKR A;  2ODJ A;  4LSF A;  3RBH A;  2KC0 A;  1IZN A;  1ZHZ A;  4BUM X;  2K4T A;  2MNH A;  3NSG A;  4FZL A;  2LHF A;  1OPF A;  3GP6 A;  4KR8 A;  5T5F A;  4FRX A;  1PRN A;  3AAE A;  2KZ7 A;  2ZFG A;  2YNK A;  3QRC A;  2F1V A;  2KDY A;  2W81 C;  2XTR A;  2N2M A;  4D64 A;  2W80 C;  3AA6 B;  3POX A;  1QJP A;  2KXP B;  1GFO A;  3SYB A;  4Z3T A;  3G7G A;  4AKM A;  4LSH A;  2POR A;  2ERV A;  3AAE B;  1ZHW A;  2Y7S A;  1YS5 A;  2Y0K A;  4O3X B;  1BH3 A;  4N59 A;  3SYS A;  5JDP A;  3HW9 A;  4FUV A;  3VZU X;  1G90 A;  3VE1 A;  3AA6 A;  2X27 X;  1ZHY A;  1BXW A;  3AA7 B;  5ADX L;  4KRA A;  4AYI D;  4FZM A;  3A2S X;  4LSE A;  1PHO A;  3HOE A;  3JTY A;  5D5D A;  1ZHT A;  3SY7 A;  1GFM A;  4RLB A;  3AA1 A;  3PQU A;  1OSM A;  2GE4 A;  1HXT A;  1HXX A;  1MM5 A;  2XE3 A;  1MM4 A;  1HXU A;  2FGQ X;  3UAQ A;  4O3Y A;  1BT9 A;  3K19 A;  2ZLD A;  3PRN A;  2M07 A;  4RJX A;  3AA1 B;  3C5O A;  3KVD D;  5ADX K;  4JCH A;  4LSI A;  3POQ A;  3VZT X;  3POU A;  2Y2X A;  4G75 A;  4C69 X;  4AKR B;  3SY9 A;  3DA4 A;  5FVN A;  4FES A;  3T0S A;  4D5U A;  5DL5 A;  5PRN A;  5DL8 A;  6PRN A;  2LFU A;  2Y0H A;  2KZ7 B;  2XG6 A;  5DL6 A;  3VE2 A;  1ZHX A;  1THQ A;  3POR A;  2N2L A;  3VY8 X;  4O3Z A;  3LK3 B;  1IZN B;  1Q9F A;  4AYE C;  4FOZ A;  5DL7 A;  4AZL A;  2JMM A;  2XMX A;  4G76 A;  3LK4 1;  3AA0 A;  4U9C A;  4O4U A;  2XE5 A;  3SZV A;  2YPV A;  3LK3 A;  4FSP A;  5IYU A;  4AYD C;  2J1N A;  3AAA A;  4XNL A;  4FRT A;  3TZG A;  3HOL A;  1GFN A;  2OMF A;  2XE1 A;  3T24 A;  2XE2 A;  3WI5 A;  4E1S A;  1E54 A;  3AA0 B;  4RLC A;  4FSO A;  3LK4 2;  2MHL A;  2J4U P;  5EE2 A;  4D65 A;  1P4T A;  5AFU K;  4AYM C;  3AAA B;  5AFU L;  3UU2 A;  1GFP A;  3QRA A;  4RL9 A;  4XNK A;  4FT6 A;  4O3W A;  5GV0 A;  3O0E A;  2O4V A;  1ORM A;  3FYX A;  2PRN A;  4JFB A;  2Y0L A;  4F4B A;  2K0L A;  2XTQ A;  4FZN A;  4GCS A;  4N58 A;  3V8U A;  3UPG A;  3VZW X;  4GF4 A;  1QJ9 A;  4O49 A;  1H6S 1;  3SZD A;  3AA7 A;  4GCQ A;  4E1T A;  4O4X A;  1QJ8 A;  3DA3 A;  3VY9 X;  4AFK A;  8PRN A;  4GHB A;  4B61 A;  4PUX A;  4AYN A;  4QQ1 A;  4RJW A;  5G26 A;  4KR4 A;  3WI4 A;  1Q9G A;  4AUI A;  7PRN A;  2FGR A;  1GFQ A;  4GCP A;  2KXP A;  2QTK A;  2F1T A;  4FMS A;  3PQS A;  3LK2 A;  3LK2 B;  3HWB A;  3EMN X;  3T20 A;  2M06 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...