3GPEA

Crystal structure analysis of pkc (alpha)-c2 domain complexed with ca2+ and ptdins(4,5)p2
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
137
structure length
137
Chain Sequence
TEKRGRIYLKAEVTDEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRLSVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and mechanistic insights into the association of PKCalpha-C2 domain to PtdIns(4,5)P2.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
molecule keywords Protein kinase C alpha type
total genus 35
structure length 137
sequence length 137
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2009-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 3gpeA00
4QJ4B 5JHAA 4QJ3B 1HE8A 3QR1A 4FLHA 4BFRA 3TWYA 5CCGE 2CHXA 2WXIA 3B7YA 4ICXA 3TL5A 2Q3XA 1W16A 4A55A 4WEEA 4JPSA 1E8XA 2ENQA 1QASA 4DK5A 3PFQA 3FBKA 3QJZA 5H4YA 3QARA 1UOVA 4FJZA 3RDJA 4KITB 3SD5A 4FHKA 4AOFA 1E7VA 4TV3A 2NQ3A 2Y3AA 2ENJA 3F04A 4FHJA 3TJPA 3ENEA 1DJGA 3MJWA 1DJIA 3NZUA 2WXHA 2BWQA 1RH8A 3QAQA 2WXQA 3HIZA 4XX5A 2WXMA 4G11A 3ML9A 3F05A 2YOAA 1E8WA 3GPEA 4LDCA 4NS0A 3W56A 4F1SA 4AJWA 4NPJA 4EZKA 2DMHA 3T8MA 1DJWA 3L08A 2WXPA 3NSJA 4FJYA 2CM5A 2WXRA 3OAWA 4L1BA 4XE0A 4F93B 3OHMB 3RPBA 4ANUA 4F92B 2CHZA 4ANWA 4L1LA 2CHDA 3QR0A 4KZCA 5EDSA 4LT7A 3FDWA 2WXOA 1TJXA 3N5AA 1A25A 4OVVA 2NCEA 2FK9A 5T8IA 3F01A 4ANVA 2WXKA 1DJZA 1WFJA 3ZVVA 2QZ5A 3PS6A 2UZPA 2K45A 4ANXA 1W15A 4QJ5B 4KZ0A 4OVUA 4DNLA 3P2BA 4V11A 1DSYA 3HHMA 2DMGA 3F00A 2CM6A 1TJMA 5G55A 2LHAA 4NP9A 4WWOA 2CJSA 1V27A 1WFMA 4WAFA 1E7UA 1BDYA 3NZSA 1CJYA 4FA6A 2WXGA 2CHWA 4HVBA 4QAMB 3CSFA 2NSQA 2FJUB 4ICWA 3L9BA 4Y1SA 3KWUA 2R83A 4WWPA 4Y1TA 4URKA 3IBEA 1BCIA 2CJTA 1E8ZA 2QZQA 3W57A 1RLWA 1UGKA 3JZYA 4TS6A 4PS8A 3APFA 1BYNA 4PS3A 4F91B 1QATA 1E90A 4TUUA 3S2AA 5KJ7E 5H4ZA 4FULA 3APDA 1YRKA 2YRBA 3L13A 2WXNA 3ZW3A 4WWNA 3IM1A 2RD0A 3QK0A 4PS7A 4L2YA 5CCJA 2A5UA 1UOWA 5G2NA 4GNKB 1RSYA 2V4LA 3R7RA 3R7QA 4J6IA 2ISDA 1DJYA 1DQVA 2A4ZA 3CSTA 2WXJA 1E8YA 2ENPA 3L54A 4IQHA 2WXFA 4EZLA 1K5WA 3L16A 2K3HA 3PREA 1DJHA 2X38A 2K4AA 4HLEA 2JQZA 4FADA 4LCVA 3L17A 4EZJA 5CCHE 3DBSA 1DJXA 2EP6A 2Q0ZX 2K8MA 2ZKMX 3APCA 2N1TE 4MJJA 3ZIMA 2B3RA 3PRZA 3L4CA 4L23A 3HN8A 4XZ4A 4NPKA 4BGDA 5JHBA 2KI6A 4IHBA 3PYCA 2D8KA 3ML8A 4GB9A 3KWTA 3LJ3A 3M7FB 1GMIA 3DPDA 2Z0UA 2WXLA
chains in the Genus database with same CATH superfamily
4I0PB 1E5UI 4RQQB 2ZYSA 3BQUD 4X6CF 5HDRA 3S3SA 2ZKWA 3FFCD 4W9LC 3ULSB 3TJEH 5E5MB 1TZ8A 4MXQC 1AGFB 5HHVH 4MGXA 1QW8A 5FUOL 3ECWA 2R56L 4OR1A 3KHOA 1FPTL 3PJSA 1XGPA 2PTVA 3VUAA 5BS0A 2YD4A 4GP4B 2APVA 4UAHA 5C0AA 5DJ0B 1DFBH 1MCCA 4WFFD 4W9HC 4HX1B 4U1LB 4PV9B 1NIAA 3LN5B 2XN9B 3WY1A 1HHIA 2EEBA 3I3BA 3HIZA 2OR9H 1C08A 3REVB 4K71C 5FKPA 4WNQB 4YHLH 2IH1B 1D5ZB 5K9KB 4NAJA 1NGWA 2C26A 3HPJB 1RSFA 1H3VA 2AMGA 3QXTA 4CC1A 3Q9PA 2D03H 1SNRA 2ZPKL 4AT6A 1UKSA 5I8EB 3STZA 3BZFA 3TBVB 1H3PL 4ANUA 4F92B 1KG0B 1ZOXA 5F9JA 4LO9A 2XN1A 1ZHLA 3OGCB 4XNUL 3NIDF 3HKFA 3NEEA 4N0RA 2DQMA 2GK2A 3MA7A 4L4TB 3RVWD 4ACPA 4NRZA 4YBLB 4GAGL 5GRVK 2F53A 4XODA 5DS1A 5JIHA 2J72A 4B9FA 2VN5A 2I9LB 4ZSOE 3WJMA 2V2XB 1AHKA 1AGBB 5FDWB 4P2QE 2LE9A 4XPFL 1IGYA 2FEDC 3GLDA 2OXGA 3CIQA 4G7SB 5LXGL 4KX9A 4PJ5D 4E9TA 5IB4B 2VXUL 3KPSE 1FI8C 3H7BA 2M26A 1CICB 4XCNA 1QUNB 2Z91B 3NCBB 5M95B 3A6CL 3DVGB 4B0MM 1RK0B 4X9HA 1ACYL 5EIIA 5LVEA 3T2QA 3MJ8B 4ZUUB 2Y7SA 4MCZB 3E2HB 3QZPA 4AI7A 3L9YA 3MZGB 1I1CA 2DKUA 1EX0A 5TE6L 4PHZA 4JFDB 4NRXA 4NDMA 3MLWL 1R4XA 2CE6A 2GK0B 2XX0A 4YDJB 4C83A 1KGUA 2DAVA 4QHPA 3JTTB 3DX3A 4CMHC 3OMIB 1Y0LB 2BVTA 1Z9LA 2D3NA 2X6MA 2IWKA 3LS4H 3MRMB 3VI4F 1QUPA 4JKMA 2BVOA 1NBZB 1LO2L 3NK4A 4NSKA 4U6XA 4DQOL 1MIML 2IV9A 3KLKA 2HFGL 4PRBA 3MV9E 1T5XA 4XPAL 1ZVHA 3SPCA 3UERA 2EUVA 4GS7B 3ETSA 1M1XB 2P24A 3QZNA 4HIJA 4IMKC 1KTJA 3SQOH 1AZUA 4EI5B 3II1A 1TYJA 1OZTG 2J4WH 3DJTA 2DN7A 4XOEA 3L3OA 3IDYC 1C7SA 1TFPA 3T6VA 4LDLB 4AY0A 2BSED 2WLYA 2MH4A 1CPUA 5MERA 4KKLC 3FHQA 4AYEC 3N1FC 5I0YA 1WD9A 3AT9A 2GKIA 1CLYL 2P26A 2F1EA 2HT4C 4FG4A 1MCQA 2PR4H 3IFLH 3K0YA 4R5TA 3WIFB 2CO6B 3ARQA 3VYPA 3BWAA 4PY7B 1IBZA 2WZPA 3HG4A 2G75A 3QAQA 3GMQA 2JSFA 4QRQA 4O2CB 2VDNH 4ZUWA 2XXMB 1DZ0A 4EXKA 4ZQKA 1KPUB 1LL1A 1JZDC 4IOIB 4NKOA 2X1XR 4K3HA 2IVFC 5EZIH 4F93B 2MCPH 3GHBL 4MCNA 2ZNWA 5BOJA 2JJTC 2CQVA 2HT3D 4JM2A 2V3DA 2CHDA 2ZUWA 4ODBD 2K78A 3RY4A 4PJFE 4ELMB 1YAZA 1T83A 1ZHKB 3C6EA 5D5MA 1HHJA 4H2CA 4EN3B 3APNA 2B4CH 1IGMH 2UY7B 5JHDA 5EG6C 2UZPA 3FO9B 5E5LA 1MHEA 4G8FB 3UBFA 2I25N 4N8UA 4QXVA 2Z93A 1BQSA 2VJ0A 2VKWA 5C07E 4PTTA 4YLQT 2DM4A 1PBYA 5IFHL 4GH7B 3MRIA 4M8UA 4C83B 3M1BB 1CD0A 3IGUA 3X13A 2R1WB 3U4EB 1J18A 2K9FB 3MRCB 1E4JA 2PUQT 3KGTA 2BIIA 3CDGA 1A9EA 4NWUL 5TDPB 1K85A 1VIWA 3KLHC 5JW3L 4H20H 3RTQB 2P5PA 5DHVH 1FVDA 3DUSB 4XWGH 1N59A 4YDVA 1WA0X 1ZANH 2VMDA 2WBWB 1NAMH 1KIRB 3VXPB 1NCCH 2ADFL 5C9JA 2QADD 3SDCA 4R7NA 1NFDF 3TGXA 5KOVC 5C6TH 1AC0A 3LVTA 4IU2A 3RGHA 3RNQB 3IDJA 5E2WH 2X2HA 1QLEL 2QVKA 3CN0A 4WU7B 2DQIL 2ZWZA 4PBDA 5HGAB 2ZWKA 4LU5H 2EUZA 3HI6L 4CNIB 5FX3A 5DQ9A 1J8KA 3HR6A 2A74B 1MFCL 4RESB 1RCYA 4GYBA 3VU2A 3GUTA 3LXBA 4ZMNA 3LQZA 1I8AA 1FVCB 3L7EB 3RL2B 1UC6A 4TKWA 5ICZA 4LGPB 4RCAA 1EUTA 4ZAKC 3QDGA 3ZQXA 3V0WL 1DQML 2EACA 1N18A 4AYSA 1OANA 4MX7B 4XP6H 5DQDH 5D7KD 3OTTA 2UZYA 1QUNA 3WV0A 4F33B 4L8BB 1DBML 3GYRA 4JG1H 4PB9L 1FA4A 2YMXL 4QRPB 2FTAA 5GGVH 5IMKB 2JJSA 1K4DB 2HLAB 2BY0A 1YYMH 1XGUB 2J73A 3REVA 2IWFA 2R0LH 3R8QA 2P80A 3QJZA 1DQJB 1KCRH 3PNRB 3JWOL 3MFFA 4UT7L 5E8EA 4ZUTA 4ZNEE 5CGMA 4B9ZA 4AW4A 4OQTL 5I9QB 3DGGA 2DI8A 2V17L 2OZ4L 4NN7C 3TA4D 3F83A 4GMSL 3IEAA 5JXEA 4F8NA 2ZWYA 5IQ9A 2ZXGA 5EZOH 2JIXB 4I3RL 4K7FB 2AMUA 2JB6B 3BKML 3BUTA 2YWYA 3EGXA 3AY4A 5C0EA 1UASA 1HHHA 3SDAB 3BEVB 1PYWA 3VH8G 2A0LC 5HHOA 2WSPA 3FQTA 3HAEB 5DDHB 5CUSH 3O6ML 4BSVB 3QDGD 1RZKL 1A1MB 1IJNA 3PWJB 1BM3L 1NLDL 5CEXA 1QLEH 3CDZA 2HLEB 4S10A 3B56A 4WSKA 4Y2OA 4CDGC 3VXRA 4IGBD 4JN1H 4M6OL 2UZIH 1WUZA 3HHMA 1MCPL 3P30H 4Y89A 3AXLA 5GGVY 2CM6A 3UBXB 5ADOH 1I3RB 1Q0YL 1TZHA 3F12B 4MAUH 1R3JA 3CBJB 3L5IA 3PE9A 1AD0B 2VDNB 4XTRD 1MLCB 3FH7A 3ATDA 3G04A 3UJJL 4YSCA 3P3UA 4ZUVB 5IW1B 1E2WA 4RAUB 1EAPA 2W0FB 3ILQD 2CK2A 4HCIA 3DURB 1YSOA 1XR8B 3AQZA 3WXWL 1NBQA 5DF0A 1WITA 3WMQA 3DETD 4V2BA 4IKNA 4OB5H 1XF5A 1YYML 2W95A 1ZA6A 5A6LA 3QFJD 3SZKC 5B38G 2FHCA 4GNKB 3CK0L 3AB0C 3NSDA 3I6LE 4DFIA 1V54B 2AJZA 3HPLA 3N9GH 4MKMA 4P23A 4N0YH 4BK5C 5GZNC 1PX4A 1CLZL 5E99H 2BVPA 3FAXA 2D7PA 4OGAC 5DJAA 2RGSA 1K4DA 3H4FA 1GA2A 4JREC 4XNYL 1YYLH 5F88A 1RAMA 3FB7B 5KBDA 2EH8L 1T04B 2X0UA 2ZAIA 2XBDA 5LN4A 2MCMA 3DV6A 1J8HD 3MODH 1ESOA 3GSXB 3ROLB 3KS0J 1NPNA 4YSTA 1EGJL 2HVJB 3MUHL 1YJDH 1TJIH 3BCFA 4NO2A 3KYAA 1Q0XL 1HE8A 2EE9A 5I16B 1ZT1A 3L95A 5MEOB 4UOW0 4JGJA 1I1RA 4HZLA 4HJJH 4WEEA 1JZ4A 1EK3A 2HP4A 5DRZA 4A04A 4XNXH 1OALA 3FRUA 4X5XA 3SKUD 2XY2A 3BSZL 4X7TB 3NSYA 2BNUB 1NAKL 1U92A 1IM9D 1V7MH 2DV6A 5I8CB 3TEXA 4YHIB 1CUOA 2CR3A 2IIJA 3S5ZA 3F04A 3IETA 2YPLB 4PP1D 1VZGA 2GSGA 2ZCZA 2X05A 4ZDHB 3ARBC 1NDMB 2C7UB 3WGUB 2DS4A 4G11A 4J1UB 5KAQG 2CR6A 2QPDB 1TG8A 1FORL 3WEAA 5IVNA 1M6OB 3BRGC 4N8VG 4XH2B 4KUZL 1FNLA 2G30A 2VITB 2FR4B 1FVCA 3L7EA 4L1BA 1MCOH 1BBJA 4GQ9L 2YRPA 3DROB 3VD0A 5TF1L 3GBML 1AI1H 2Y7LA 4O02H 1AGDA 2W81C 3KGRA 2BW5A 1BFVH 4JDZB 5F7AA 3SYPA 4KRPC 1J0ZA 4AYFB 2X0WA 2P45B 4DEWA 2FK9A 2P5WB 2X2UA 1DJZA 4XBMA 3D4GA 1L9PA 3CN1A 2ZG2A 3OQRA 3MXVL 2ZKYA 3VFPB 1E6JL 3AT8A 2EDTA 5L88H 3VSUA 3SDDC 3CZJA 3RGVB 1KLUA 2OMVA 5E23A 3LHPH 2GT9A 4Q4EA 4HIEA 1IM9A 4E2OA 3WKQA 1M2OA 3WTYA 1F5WA 3HC3H 3QO0B 3WO4C 1I9RH 2VLRD 5CGBA 1JPGA 3PWUA 5GS1B 3C8KA 1Q0XH 2Q6WB 5ECGA 3WKMH 2PXYD 1BOGA 5FECB 5F9DC 1VCBC 1CGXA 3IFNH 1DBKL 1I4FB 3CTTA 1WICA 3W9EB 2K3TA 2XQYA 3V4PH 3L4YA 4QRUA 5E9DD 1T2QL 1FIGH 2WWOA 4ZAKA 1UVQA 2PP9A 2WXJA 1YYLL 2Z31A 1H15B 3N41B 3V4PA 2O93L 2VDRL 1YY9D 2DQGL 3NSFA 1MF2H 5DD5L 1KIUB 4NKMB 5IFHH 2BNQB 4HUUB 3ZHDA 4FQCH 3SE9L 1QSVA 4XHJD 1UZ8B 2YBGA 4A7UA 4AEHH 2YGVA 4AUUA 1ZEAL 5DGRA 5DUPH 5TH2A 3B6SB 4MJ4A 3RVUC 4ONFH 4WNSA 5FWQA 5T3ZE 2ZOKA 4P9HC 3IMVA 1IIKA 4UMSA 3EDKA 3NA9H 5CILL 1IC4H 1T7WA 1A8ZA 4GPVA 3I2CH 3BISA 3UBXG 5IQNA 1PLAA 1FPTH 2BSDA 3RWFB 4KQ0A 3V0DA 3FAWA 4KQ3H 1K3IA 4BELD 1TEYA 1Y0LA 3MRMA 3O81A 4M7LL 1MCRA 1OCCB 2WINB 5CBEA 4IBUA 1HL8A 5ICYA 2VUKA 3ZHFA 2RR3A 1D5MA 3GI9H 3GMLA 4MCMA 5EUOB 4QI3A 1CT8A 3WAJA 2NY6D 5SWSE 1M6UA 2UVFA 2VYRE 3GSNA 3UTPD 4HOXA 1UZ8A 2AJUL 3RPKA 1BVZA 2OFQA 5DRNA 4EI5A 3MLXH 4NCC1 3FONB 4NN5C 1NKGA 1MCOL 3WFCH 2PNDA 5IV2A 4FNPA 2YO3A 4MNQB 2ZCKH 1T04A 4FFYA 2Z91A 2XACC 1PD6A 5C86A 4N2NA 4FG2A 1IKFH 3MLWH 1Z9NA 4PJIF 3HMXA 4HQQH 1YMME 3RDTD 2L3BA 3OXRA 5B8CA 3U2JA 4W9EC 2NW3A 4AQOA 2QFPA 1G7QA 4JDTH 5FF6B 4UTBH 2W60A 1M7DB 2QPFA 4DKFH 5DEFA 2ZWSA 4BV1A 3K5SA 5HDBB 3AG3B 5LN8A 2IFFH 2QEJA 4X6CA 4EO5A 4X7EC 4PGBA 1HE7A 3ILEA 4EZMA 4I0PC 3ILQC 5J1SC 4JFSA 3V6OC 4G6JH 1I9RL 3HFMH 1YPZE 4MMXC 4FQ2L 3ZYJA 3TCLB 4J3OC 4C8XA 1NGQL 4W6XB 3HE6B 2QHRL 1MJUH 4XBEL 1HQ4B 3UYPB 3Q9QA 3QGVA 4HUKB 4KROD 4YHPB 3AS3A 4Z3TA 5JPMC 3UO8B 4FXKB 1FG2A 2VLME 4JHWL 4LPXA 4FP8H 4RFNB 4WJ5A 5GGUB 1ZHBB 1VEMA 2J6WA 1T6WA 1SHWA 3F7YB 4WHCA 3U30B 1F4AA 5HI5C 4M7LH 2J8OA 3QHTC 1E42A 1XHHA 2FX8L 5AYTA 3VWJB 3ZYZA 3GI8L 2EDDA 3NSCA 4W4OA 3UFIA 4Z7WF 1TVDA 3L16A 3NQKA 4IIZA 3MNVA 3RUGE 2ZE0A 1AGFA 2AFNA 1XBRA 1SMDA 2VL5A 2R15A 1MOEA 1OW0C 5DLMH 4DHLA 3D85A 3JUYA 1BF8A 3BO8A 1O6TA 3CSYB 1GIGL 1HKFA 5F7WC 2W38A 2VE6B 5E9DA 4DGIH 4YBLC 1SMAA 3QPKA 2VW7A 4K3DL 4LSTL 3M7FB 2IH8A 1E50A 1KLGA 4UT9H 3ECVA 2WXLA 2QLYA 5ITBH 4TSCL 2MNJB 4BXSV 4Q97A 3GS4A 4KU1A 3FT2A 2Z64C 2HFTA 4G43A 2Z8WC 4LKCA 4J1UA 2NY3B 4DK5A 3WL9B 4WKXA 2IMMA 1OE1A 1Z5HA 3QXDB 5E4IA 2PO6D 2VITA 2FR4A 4XGZA 5C8JA 1NC2A 1Z1WA 1JXDA 3SJVD 4D0BA 1YLBB 1I7UB 4G6JL 3WD5H 3QQNA 4J6RH 4DGYH 4UIMA 2YOCA 3QVAA 1SDDA 1I85A 1UFUA 2FEEI 2MHAB 3MTXA 5GJTL 5JHDD 3IK2A 1HL4A 4QHMB 4HKBA 2AQ2A 2X9WA 2CCLA 4GAJH 4G5ZH 4H4NA 2EDLA 3P9WB 4WCYH 3ZUCA 4GEIA 1P5UC 4BH8B 5GS0H 1C5DA 2XFXA 5ID0B 1SJEB 1D3CA 2HWZH 4NX0A 3FS9A 4P5TC 3SE8L 4QTHA 3MX0B 2YD9A 4FD0A 5EF1A 1P1ZB 4J3TA 3UZEA 3H9SB 4S1DC 1DL7H 1TJHH 3GK8L 3CXDH 3P4OA 1E27A 3MBWB 3OXSA 3V0VA 4BDVB 3OKDB 3CHPA 1TJMA 3HFML 1NOFA 1FZOB 3PL6C 3FB6B 3FMGH 5D7SL 2Y7QA 1XF5B 2FL5A 5G4NA 1BFSA 1ADWA 3EIFA 3KPLB 5EU5A 3TO4A 5BW7A 4XP6L 2V5MA 2YN5A 1UXWA 3ZDWA 5FW6A 1KB5A 2ZCHH 1O9WA 5LBSL 1ICTA 1NGZB 3D50A 3VFRB 1R75A 5F1NB 4LB8A 1KTCA 3OM3B 2PXYB 2UZXB 3E8UH 4XNUH 2WXNA 1M71B 1Q9LB 1XH1A 4PRHE 1MAMH 3MRBA 3HI6H 3SDYH 1CGYA 1RK1B 5DRWA 5BMFL 5EEVA 1XR9B 2VM4A 1EIBA 1INQA 2SEBA 2WXFA 3V9FA 2AGJL 5IROD 4JFFD 4XC3H 2O4EA 1QBBA 5ESVA 1JJUA 1YNLL 3EJZD 4N2OA 4JLRA 4NQEE 4TXVB 5HI3C 3V6FA 1NM9A 1WC7B 5MEQA 1M2VB 2P80D 1NCIA 5C09A 1UHVA 3N42F 3WDHA 1E4XL 3G7TA 4KK5D 4YAQB 5LBSA 3D4ZA 4AQ8C 4ZTOL 1ND0B 1IB5A 1KYOJ 2ED8A 2G75B 4M7ZC 4Q2ZB 5JZ7C 3KR3L 1KC5L 4WK2B 2EIKB 2IO5A 2MNWA 2AW2A 4HXAL 3PIQA 5D7JC 1ZWIB 1GW6A 3VDAA 3WIIL 3S9DB 3IFNL 3BFWA 3OKEA 2CXKA 3HAEA 5DDHA 3RE0A 4QD2E 3CIAA 3ZOAA 2CNZA 4KDTC 4ETYA 5KSBB 3O9WA 2XA8L 4AGQA 1EAQA 4LL1A 2GJPA 4X4MA 5B3NA 5I71C 2XKNB 5GS3A 1Y1UA 2C3HA 2CUAA 3IJ9A 4NRYB 3VD5A 4F15B 1Q9OA 1TQCC 2A1WL 1LVEA 4MXVF 5CJQL 2NOYA 2XWEA 1JWUA 1NL0H 1DJWA 4NJ9H 3CZGA 3KYKL 4FNTA 3O4LA 4BZ1A 1BG1A 1QRNE 5IBTL 3UP6A 1KGWA 2BC4B 1BAWA 2ZX5A 2R0KL 2BVEA 2NPLX 2O5YL 1FZMA 1R9FA 2WAQA 4MNHB 5DZLA 2Y36L 3C75A 1CLCA 3MFGB 3CLFL 5KBLA 1B4JL 4K9EL 1U41A 3O6LH 3F00A 4Y5XB 5BXFB 4TLTA 3X3FH 1BVKA 2N7SA 4L8SA 4AC2A 4LSRL 4Y7MA 4YPGB 4R6UA 4JY6B 3IAQA 4X8JB 4JZJC 4XH2A 1NBYB 2EH8H 3I9AA 3MJ8A 3QFJA 2W0PA 3EH3B 4XPGL 4ZUUA 3PAYA 4FA6A 2ICEB 1HZKA 3S36H 3HNVL 3QDME 4HPOL 3E6FB 3Q1SH 1JWUB 4OF8A 4NUPA 1RUPL 4I3GA 1SLVA 1UWEL 4DOHE 5L2KD 2VDLH 1USQA 3K71B 5IFJA 4YZFF 2DQUH 3GKWL 3VXSA 3WSQL 3LV3B 4ZK8A 4LLDB 2PCPB 2OM5A 3MLYH 4HJIA 2PW2A 4Z7VF 3RTLA 4HZLB 4FXGC 1NA8A 1A6TA 5DMGC 3BCDA 4G9FE 1AIFA 3V79C 2GJ6B 2XC8A 1ZY9A 4R90L 1C9SA 2PYFB 5HI4D 2BX5A 2IFFL 2RFXA 1JZ6A 5E24E 2VLJD 2EDKA 1KG0A 5TK4A 1JNNL 2FIRT 4QXTA 1WLHA 5ICUA 1DVTA 2ZKMX 3IJSB 4IBQA 5D93B 5DVLA 5IEKB 4PJFF 5E6IB 3N3EA 4G6FB 3MV7E 1MLCA 1V3LA 3GMNB 4MQXD 5E9NA 1TXKA 4HCRA 4LLYA 1IFHH 5BOZG 3IS0X 3ZDZE 4MMXA 4G7VH 7PCYA 3TWYA 4KK8D 1OT1A 1DCLA 2L04A 3QCTH 4JG0H 2PPFA 3L3OC 1IGJB 4LEBA 1ZA6B 4A67A 3H2PA 3ZL4L 3UTTD 2Y1ZA 3E9UA 4QRRD 1RVFL 5IUCA 3WMPA 3LHPL 4HP5A 5ABDE 1J0HA 3BPNB 3ME0B 4CU8A 1DSFH 4B41A 3VWKC 4F27A 1AS7A 4XVUC 1PPIA 5KVMC 3IFPB 3RHWF 3QPQC 4E41D 3DSNA 4YHNB 4YXKH 1KXQE 4HSAC 1JF1B 4MNGB 5GRWA 1SFDA 4PRIB 1C8PA 4PY7A 2F8OA 4D9LL 2F08A 1CGVA 1AR2A 3K2UL 5D2NC 5GGSY 1FNHA 4GIOA 4JZOA 3P73B 4XP1H 3HUJB 1ZGLB 4LHQB 2DLFL 4ZPVA 3U6RA 5D1ZD 3QDJB 3MJ7B 1NDGB 3WI9A 4TTDC 4AGNA 4TNWF 5E5UB 3E9TA 4C56A 2HJLA 2EXTA 2X44D 2JLPA 4L1DA 2KZWA 4WHDA 3UG3A 4HPHA 5EOTA 3U0PB 4L8BA 3U7YH 2B1OA 2GHWB 1N6VA 2Y2TA 3O8XD 5CWSB 1BWMA 1HS6A 5JOPE 3G9AB 5HYSG 4XNBA 1S7TA 1UACL 1KN2L 4G9DB 3SO3C 1SLXA 3QDJD 5KG9A 3FQ4A 3FTZA 2KUTA 3NN8B 1JHLH 3DXAE 1KJ2H 4P5KB 2G4GA 1O6SB 5E51A 5IF0B 4RGND 5EU7E 1UD2A 4KPHH 5LUMA 4XXDA 2Y72A 2X4TB 3DX6A 1OTTD 1NIFA 3E2HC 3O0RH 1GZPA 4JFDA 4LLQA 2VOTA 4KK6D 2XZZA 4NENB 2GEQA 4EJ1C 1L9SA 1NEPA 1P4BH 5I82A 5IVZA 1WBXB 3ASNB 3L6FB 4R5XA 3LDBB 5EU6B 2R51A 3WJLA 1WCQA 4Z3GA 3SDCB 3SEPA 2WTRA 5HHNA 4FFYL 4FXLA 3GTNA 3MLTA 1RUKL 4KTYA 3WY3A 3QWRA 4PJHB 3BD4A 5CSZA 3WHXA 1UD6A 3SQOL 1XT5A 2ID5A 3NACL 2O61A 3TWCH 4OF6A 2B9AA 4UU9B 4YGAB 5TE4L 1CL7H 2XJLA 3MCG1 3V5DA 1B0GB 1P9MC 5JA9A 1RERA 5I1KL 4IOSD 3P54A 4HJUA 1HEZB 3U36B 2WWKO 3CD4A 2VMJA 1TQTA 1WFNA 2YARA 3CZFA 5L4MA 2WQSA 3LZLA 4WFFE 4JDTL 1F6FB 2VSCA 4QOKB 5DJ0A 4NQUA 3QUML 5BNXD 5K9OA 2XA3A 4HZAA 2Y06L 3TBYA 1H6FA 5IJKC 1KTBA 2EIMB 1YVLA 2JJVA 3GZPA 2VUOA 4OIAA 4Y19D 4RWYL 2NMSA 1GTNA 1IQWL 1ET7A 2OJZL 3O6KH 4IOIA 2YPLE 4NKOB 1XZWA 4DERA 2VDRB 2Z8RA 1FZJB 1U36A 3I9GH 4ZZKA 3FULA 3NSJA 4XNZC 2WMPA 3RWHA 1NLBL 1U3HC 3O2DA 1MUJA 4XPBH 5E2WL 3CVHL 4O2EB 3KL5A 2DJSA 1TR7A 1KWKA 3FQUA 3L1FA 3DGCR 3V95A 4UTBL 4Z7UA 4UNIA 4PGCB 2HRPH 3O41A 4P46D 1ZS8B 4YHYC 1MHHA 1EZUA 5GRZA 4MJHA 1OM3H 3T8VA 2K0RA 1RP8A 4X5PA 5JYLA 4AC4A 2DMGA 2OR8A 4GXVH 1GRWA 4IRSB 1ZE3C 4J3OG 1GS7A 3VFGH 4LPUA 2Z92A 4M7KH 2YD1A 2X4OB 1YC8A 2CXGA 4IK6A 5DLML 2XIDA 3C09B 1MEXL 3K6OA 3NRPA 4YXHH 1T4KA 2YZ1A 4CMMA 1PU0A 1F97A 4PN6A 2EYTB 2B7DT 3D07A 1QR1B 4Y5XC 4JFZL 5EUOF 4HIHB 3IN0A 4N2HA 1OEZW 5KANI 4AMKL 4KTEH 5EIIG 1WK0A 1ED3A 5DRXA 2ZOKB 4J6IA 3QDJA 1ZLUK 3DGDA 5I0DA 4N2FA 3HJ0A 3Q8BA 1CICD 1MFCH 3G6AA 2CRMA 4KO7A 4PJIA 2W59A 2OBGA 5JIDA 2ICWA 4GP5B 4UDTB 5DZPA 2A74C 2EDBA 4NGHL 1KIUA 4NKMA 4EUPA 2VRAA 1FH2A 2FGZA 5DD3H 4EF3A 3SBPA 2DH3A 1W0WB 3O45B 5TFSH 1KEGH 5HDLA 4AKPA 4IOFD 4PJ5A 4FXGB 1ZSDB 4TSCH 4E9XA 5L8JB 3T0AA 2UX7A 1ZXKA 2WSKA 4HIXH 2Y1VA 1FAIH 3MNZA 5AZEL 4ZD3H 3DXAA 4BQ6A 1B6UA 1UH3A 3OSKA 1IL1A 2G3ZA 1OGAA 1NPJA 2V8MA 4A55A 1FYTE 2FH6A 3IGKA 2O6DA 3D85D 2KT6A 1T6BX 5GS1A 4HSQA 1HOEA 12E8L 1Q9WA 1HVXA 4G8GA 4NQCD 4XE5B 1E4XI 3A4DA 1E6OH 4TUKH 1KGXA 1FBIH 2VN4A 3BP5B 2NR6A 1IQWH 1RU9H 4IOSA 4JE4B 3A5VA 3QNZB 2H32A 3V4LA 3HEIB 3QHFH 1CGWA 3KPTA 3CLWA 4JQXA 3WXWH 1OAUL 1XD0A 3H0TA 1OP5H 1CVRA 3W11D 1DVXA 1T1WB 3KVPA 2XQBH 3PV6A 1YN6B 3K46A 3WFDL 4PJCB 4EVNB 4MVBC 3S8FB 2APTA 4XVOA 4H1LG 2AGJH 5EEXA 1E5ZA 2NYYC 5HD8C 2VISB 2D7OA 2ZOTA 3UG4A 4AH2A 3A21A 1G6RA 1OTTC 1MCPH 3QNYB 1OV8A 2NQDA 1IM9B 3HG5A 3PWLA 5LGJA 4TF4A 4YBQC 43CAA 4A2GA 2GB2A 3DV4B 3QZMA 4JCLA 3QCUL 3GO1H 1YO4A 3SQRA 1N5YL 5HDQL 2VO5A 3B83A 1CFQA 4G8GD 4ILDA 4NQCA 4QEGA 3NCYS 5L4FA 2HKAA 1OL0A 3KS0H 5E2VH 1TF4A 1D6EB 1T5WA 5EUOE 4AMXA 3B9KA 2X9ZA 3ZE0F 1BZQK 1LQSR 2H41A 4IU3A 4TOYL 5AZEH 1KB5H 4AQ8A 1ASPA 1ZPUA 1ERNA 3SDDD 5DVNA 5B1JC 5IP4A 5E0QA 1MWAB 1ACXA 5AOLA 5H2BB 4CN4A 4BKSC 5DYFA 2CZNA 3BD3A 4HG4K 5CBAB 4MA7H 4YVNA 1URLA 2OJEB 3B9DA 2VC2L 5T1LB 4OZFA 1M7UA 4R96B 3KPSD 2FJGA 2QSQA 5HI3D 1NEZB 1FBIL 1I1YA 1U8LB 2MTPA 5HY9B 2VMEA 4KFMA 4AG4L 4WIQA 4XMLH 4AYMC 2BNRE 3ZY7A 2BM3A 3DROA 2WKOF 3I85A 5I6MA 4JREB 4QRRE 3STLA 2DJ4A 1A7OH 2MQ3A 1LHZA 1Q9WB 2WPGA 1MFEH 3NJIA 3UYRL 3WS6A 4G6AD 2MRYA 1P6AB 3RHWK 1HU8A 3TBTA 3MUY1 1TZAA 5FYJL 3GMPB 4KJPC 3ILPB 2BIOA 1EJ8A 3CX2A 3DX4A 2DQTL 2WBXA 1VENA 4JJHA 1YEDA 3C8HA 1IGTB 3EYUL 4PWHA 2YIHA 2NY4B 3QEQB 4KKLD 4OLYH 2LW3A 4KJYB 3BDXA 4W4NA 4MMYB 5L2KA 3BLKA 2PMZA 4M6AA 1IGIL 1MAKA 4PJGA 4TUKL 3VGHA 6TAAA 4PWJA 5JW4N 5C1MB 1KJ2B 1MFDL 5FB8A 4Q14A 4W70A 4LL9A 3N04A 3VXME 3HUJA 1ZGLA 1GPOH 4NAMA 1BVOA 2BERA 5CJOL 1MCDA 3ZKNC 3KH3A 3O3UN 4JG1L 1WC7A 4IOFC 4L0YA 4JFHD 1ZLVH 4CJ0A 1A6WL 3FUHA 3MRDB 1FH5H 2BLFA 2QBWA 5CO1A 2IDCA 2WIMA 3MRHA 5KSAC 1R33A 3C5XA 4IHOA 2CSPA 1GR7A 1WRFA 3L3DA 4Z7QE 1JN6A 3B4NA 5D2LA 4M93C 1OW0A 2Y36H 1DBJH 4TULL 1CICC 3QXAB 4NQEB 2YK1H 3MNMA 4UANA 4KRPB 2EC8A 2R7EB 3UC2A 2WN3A 5CEZE 5MI0C 5BZDA 1YQVL 1IJ9A 5IMOA 3MROB 1AY1H 2MEJB 3WJJC 3EJJX 4IYKA 5B39A 5BQ7A 3F7QA 4Q8BA 5CINH 5B1CA 1QBLH 4IIQB 4WAFA 4M3JA 2VXTH 4O5LH 2A9BA 2P8PA 3SODB 3L9BA 3FZUC 4L0ZA 4S1SH 2NXZD 3MREA 4ZS7H 4LCYB 4PFEA 4YL4A 5LG1A 4IBVA 2VABB 3CXFA 2XPGB 2XQYG 5AOMA 3EO9L 4NHCH 1UGKA 5EEUA 4PVBA 1OCOB 3QBTB 3A47A 2IALA 5KZCB 2ATAA 2VLJA 5CLZA 3GMOB 4HU2A 2HT2D 1JN6B 5EBMA 2AJSL 3W9EA 2BC4A 1M7IA 3PJNA 1HHKB 3T2NH 2PP7A 1X5JA 5IB2B 2GITB 5J4MA 4PR5A 3NZHL 2EYRB 4DOHB 2NZ9D 1H8LA 5HHOD 5HJGA 1SF3A 4UILL 1UUSA 1C5DB 1AYRA 2XFXB 4BGLA 5HYJA 2AKRB 4FL4C 5HGHB 1XGQB 4U3HA 4AMWA 5ID1B 1RZ7L 4DGWC 1CTOA 1BVKB 4L8SB 1BXAA 5D96B 1RHHA 3SDDA 4MA8H 1L6PA 3GUTB 4JM4L 2VIRA 1JVLA 2JI3A 1A6WH 5SWZA 1TU2A 1Q1JL 2J4WL 4HCRH 2YRZA 4ZO8A 4BA0A 3A23A 4HSCX 3BWSA 3LN9A 4QJ3B 4YK4C 3TN0D 4Y4HA 5D7EA 2OCCB 5FCUH 5F89A 2XZQH 2HX7A 2PCPA 1ODUA 2VZSA 1FZKB 2NSXA 1E9PB 5BZWA 3QDHA 3RTQA 4E9RA 5G5DB 4H8VA 2VLKE 5F9AC 2DTSA 1KF9B 1JGLL 3U7WL 3WEXA 3VTMA 4PJAE 1QACA 3U83A 2YPKA 5I2IB 3H3PL 4OQTA 1BX2B 1NEZA 4UINH 2KL6A 5T33H 2X2JA 5D4JA 5I6XB 5FR3A 2GIXA 5DD3L 1P4UA 2P8MA 1WZKA 1RZIB 4AEFA 3FB7A 1TQBB 4WF7A 5IFAH 3O0RL 3QUXA 3QNYA 2AEWA 2QTVA 5FUCE 4POYA 1LLAA 1NANH 4HHAA 4UNUA 1TTBA 4M03A 3SPJA 2VSKB 3ABKB 5F89B 2B8OT 5FA4A 4J8RA 1VA9A 1N2RA 4TVUA 5KYYB 2OXHA 4PJAA 4GIPD 2N56A 4XVTH 5T1KD 4MB1A 3C08H 3VD2A 3BKYH 5FDYA 1D5XA 2VQ1B 3ABLB 5JHLH 4O5LL 3ARFB 4AT6B 2DI9A 3D33A 5IB2A 4OZIF 4RSYA 2CJSA 4OCXH 3WAKA 4NC1C 2YBRA 3O3BA 1C1EL 2NUTA 1CXEA 1VRSA 1Y1DA 5JHDB 2AKRA 4Y5VA 5E6IC 1CL7L 3PHQA 1WFIA 5KSVB 1M71A 4E9WA 2J1WA 4CSZA 2K7PA 3MRLB 5E00A 4Z18A 3HZYB 4MCYA 3BPNC 3RY6C 1ZV2A 4N2BA 1JK8A 2YD0A 4PBXA 3QRLA 1MJ7H 4PRHB 5JPMB 3QWRD 1M05A 2R0KH 1VADB 2EEXA 4NN5B 1UXWB 4PG9B 1DVFD 3IDGA 4WUUA 4G6AC 5TTRA 4ZX4A 4U7SA 3T0WA 4HJSA 3H3KA 3EBAA 4NERA 4R26L 1XXDC 3UAFA 5B8CC 5KEZA 3IRZA 2EIEA 4X5LA 3IDNA 2OQJA 4GKZB 3QJFA 2R7EA 4IBSA 4XBGA 3COOA 3BSHA 1KCWA 2Y23A 3I9GL 1U8IB 3Q2LA 2A38A 1SOSA 1FFPA 1YMMB 1I8MA 3VACA 3MX0A 4LSPL 4JFTA 5EUKB 5KOMC 1BIIB 3H2QA 4OJEH 4OLZL 5C0DA 4AUJA 4AGPA 1QVOB 5HGGS 1U8NA 1V7NL 4UWQB 4G8AC 2XIIA 4G43B 4CDHA 3LS4L 5HYEA 4I3SH 4MMXB 4Z7VB 3VD7A 2HTKC 4CW1A 2CLRA 1G6RL 5IW1A 5F7UA 2DZEA 3BX7C 4AM0B 5AD0B 1NIDA 2OZ4H 3Q5OA 4G1MA 5I5RA 3JVGA 2OI9B 1BREA 5EFIB 4FHJA 5CD3A 3P3YA 5F44A 3FOMA 2ERJB 2AZAA 2BY1A 1ZK5A 1JPSH 5JORA 2E9WA 2OKMA 1LO4H 4PJ9D 3ZGIA 3RP1A 4NOFA 4PRPD 1PIGA 1JAEA 2JXMB 1LO3L 3ESVF 3RTQD 4Z7WA 5J6HA 4OB5L 3LSOA 1CD8A 2IBGA 1MFUA 1RUAH 3P9MB 4QLWA 2BP0A 3GSUA 3O0LA 4FFZH 1GGIL 4LKXB 5CF3A 1WQVT 3BDYH 3VFOA 1EVTC 1ZGLP 1UT1A 4JPWL 2GFBA 3PXJA 4JZNA 1IRAY 3HUJE 2O5NA 3W0WD 3P4MA 1A3QA 3L81A 3AXHA 1HYRC 4S0HA 2JF1A 4FABL 1DSYA 4ENZA 5I1EH 2X70A 1IFGA 3SGJA 4Z8FL 1HT6A 7CGTA 3B3BA 3AWFA 2OL3H 2HUHA 2AXFB 2XG4A 5B38B 4YXHL 5C0FB 5IHHA 3NSXA 1NFIB 3FFOA 2MMXA 3CFKA 5BZXA 3RX5A 4D9LH 1F4WH 2AITA 1ZLSH 4GW5B 3PV6B 2FJGB 3EFDL 4PJ7F 3W57A 3KBFA 3LQMA 5L2JA 5C0AE 1UEYA 2J5LC 5DFAA 1RFDH 2O6CA 4K7PH 4FTDA 4MNGE 1N26A 5EBGA 5ICXA 1X6LA 3APDA 3K2KA 3OJVC 3VJ6A 3QIWA 4KRLB 5I8KL 3Q6FB 4AH2B 4IRSD 4K4KA 1AQ8A 4R26H 1C5BH 4IRJD 1B0GA 2BNRA 3QDGE 1U0QA 4JM2D 3PQYE 3I6GB 1HILA 1YNLH 1T89C 4DUVA 5ILTH 1A9EB 3LNFA 4X4ZA 3UADA 4AEEA 1N0LA 4WSGA 3W0WA 5AZ2L 4I4WB 4YDNA 1JCVA 5C7XL 2GJJA 4LSPH 5B1KA 1HNYA 1CE1H 2X0VA 1DQDL 3T77B 4P5RA 4JUTA 5GGSA 2FSEB 1AQMA 3VH8B 1KC5H 3CBKB 4GB9A 4I18A 5DK2B 4YHYB 5J1AB 3EYVB 3Q5TA 4Y4FA 1T22A 3WHE0 3LRKA 5T1DL 4B53A 2AK4D 2XWRA 4XXCA 4DVBB 4OJDH 5EZJA 5AVYB 4OZGB 2B1HH 1XGYL 3BDYL 3KGSA 5E1AB 5CCKL 1YN6A 1PLGH 4K9EH 1Q72L 3O6LL 5DQJB 1ID2A 1JV2A 3Q2CA 5IQ7H 1KFAH 4DUXA 4WGWB 2HH0H 4JPKL 5EUOA 3NJFA 2WBKA 1IIIA 5HPMA 2N1KA 3HG1B 2FBJH 3VFSA 1XTLA 1DUZB 4GKZA 4LDCA 4NQCE 1NEUA 4Z0BH 3L6FA 4PJFB 4ZUSB 2X4SA 1WD8A 2E4FA 1S3KH 1YQ2A 3N43B 3QA3B 5C0JA 3LN4B 1AQDA 2FZ3B 3HN5A 3SPIA 4KVCL 2A6JA 2OYLA 3RGVC 1J8HE 4OCYL 2HJLB 3V4PL 2JK5A 2IAAC 4QYOB 3U9WA 2O5XL 4NQDA 3ECBA 1MREH 4R3SB 5IOPB 1I31A 1GAFL 2AJZB 1HSBB 3HPLB 4HH9B 1CFNA 4JRYB 3KH4A 5EO9B 1IL1B 4PUBL 1ZXQA 3OAZK 1WIPA 4GMSH 5EDSA 4NKDA 3MLRH 1MFAL 3K4ZA 4JZOB 2TRHA 5JPNC 3C5ZC 2VC2H 3BGMA 4ZMYA 4RMQA 5KS9E 4BBWA 2YMOA 1AKJD 1UJ3C 1J88A 1QR1A 3X12B 5ILTL 3SBWC 4TQHA 1GKOA 5TE7L 5DJ2B 4PWFA 1RZKC 4YDMA 4E9VA 1GCYA 2DYPD 4HAKA 1P84J 1A7RL 1KTKE 1I1YB 4XN5A 5AWNL 5HY9A 1QP1A 3S36L 3CSPA 3IRPX 1KCVL 3L3GB 5AYQA 1NJ9A 2X4OA 3L9RA 1KBPA 4N8VA 1IM3B 2DQTH 1A6UH 1P0SE 2FX7L 3FQWA 1BQHA 1N9PA 4FFWC 1F11B 4Q74A 4G3YL 3ULVD 3SDXF 5I15H 5IJVA 1RMFL 2AXWA 2UZIL 1BEYH 2X09A 3K81A 2HB0A 4NO5B 4KK5C 5J13B 2WO4A 2IXQA 4JHBA 2AI0H 3ZW3A 2P7TB 3PG2A 1I1AA 3K2MC 4A63A 2QQQA 4YHOL 2E4TA 4FNUA 1PZ5A 1GJUA 3GSOB 1GS6X 4PRIA 1E8YA 3F85A 4OZHE 5F1OB 3GXPA 5BUGA 4O02A 5I8EA 3PHAA 3P4MB 4PJ5E 3NJJA 1W6LA 4KWUA 4UAOB 3O11B 5DJCA 1JE6A 3K2UH 4N90E 3DK0A 2RB8A 1T6VN 1GSKA 2GQHA 4ODUA 3ZZSA 4N2DA 3OKOA 4WGVB 4Z7NF 4Z5RB 2J88H 4QTFA 1UH4A 4RMRA 1IGFL 1WWAX 2GI7A 2ZSWB 4PJIE 1WUNT 2R4RL 2VN7A 5BUAA 3X1FA 2OK0H 4NT6B 1CLZH 1ZDQA 3I02B 2DQFB 4NLHA 4OKVB 4TUJA 4RISL 4E5XG 3EF7A 3QDJE 4G7YH 1EXHA 2D7QA 4G80B 2EIBA 4ADJA 1ASQA 4H5SA 2A3TA 2YFNA 4Z7NB 1A3ZA 3UMTA 3D3VD 3F7VA 2EINB 3CFJB 3LB6D 4KITB 1ZT4B 5TE7H 5C08B 3V0FA 3MRNA 2OA9A 3G5ZA 3QISA 5KVEE 4MDIB 3VYNA 4Z7NE 1MW3A 3EOAA 5MEND 1T1XB 1A7PH 4EOWL 3NCJL 1QHOA 1F58H 2F54E 2EICA 3QZOA 2O6EA 3F05A 4JANB 4L5FH 3MRKA 4ZFGH 4HS6A 2H2SD 1N2RB 3TJEL 4S1SL 2HRHA 4ZS7L 1A7QH 2J6EA 2WO3B 4JO1H 1TQCB 1BXVA 3KLAA 3IYLW 4RRPG 4OLZH 4F1ZA 3ARTA 1GYVA 3OG6B 4ZD3L 3FT9A 4YH6A 2WKOA 5ITFB 2PLTA 1TNMA 1G9NH 1NC4B 3ZZQA 3ELQA 3IDJB 4R0LB 1YQVH 5AKSA 1T03H 5CS7A 1H8OA 4U4BA 1FQ9C 5EO0A 2EC9U 3S34H 4MNQA 5E08L 1EJFA 3LH9A 4GG6E 3WEXB 32C2A 4FTVE 4RWHA 1FC1A 3ARGD 4LLVA 3MNWA 3MR9B 3U1SL 2VDPH 1I1AB 1DQMH 3L1OL 2DPKA 4I0KA 4JM4H 1BG9A 4CGTA 1AHWA 1IO4C 1PJWA 3D9AL 3D2UB 4OD1H 3K8LA 3QUMB 5MENA 3IJEB 2UXFA 3BH4A 4NO2B 1F3RB 3T2NL 1JTTA 2FCBA 1B4JH 3AQDA 1F56A 1KCRL 2XBZA 1AQKH 4FCHA 3H55A 4WWNA 3WTWA 2OTUA 4GAYB 1FO0L 3T77A 1BM7A 5GISL 1JVOA 4N0UA 1P53A 4LESA 1B4LA 5GGTA 5E7FA 5EUKA 3V4VL 2HSIA 1RUKH 3GSNB 1PD0A 1I8IB 4BZ2A 2J8UA 3TURA 3BGMB 2OMTA 4EOWH 2J5LB 5T1KA 1WZAA 3TEZA 4IS6B 4LFHG 5J8OA 1DJXA 3DI3B 1Q9KB 5E1AA 4LSTH 3WFZA 4BUHA 3SCMA 5AB1A 4CBPA 4KVPA 4Y5YB 4PLJC 4M5ZL 3EFFA 5KYUB 5EC1A 3KWTA 4L1TA 3F8UB 5I18L 3FO9A 3OD3A 4WFHD 3LPPA 1G9MH 3FQTB 4P4KA 1XF2A 4A37A 2FLRT 5FO2A 4X4YB 3OJ2C 4J4PC 4D8PA 5DFTA 5AENA 4WHTA 2HFFA 2NTFB 4IRJB 1R1CA 4JPVH 4Y2OB 5I24A 3TV3H 1S78C 1JXFA 5I6OA 2RALA 2OLDA 2WLMA 4BFOA 1U8PA 1JGLH 4A68A 5C3LD 5IMMB 4TLKA 3QUKB 3HBGA 3D12B 5ISZA 1F58L 3G5WA 3LZFL 3WE6A 5I0WA 3B7SA 4K2UH 2DB8A 3S3DB 4LRIC 5F7HA 1LWHA 4GAGH 4KTGA 4I2XA 3CCHA 1Z9MA 3K6SA 4ZS6D 4X5QA 4HXBH 1PF3A 3HCVB 1FCCA 3OKMA 2BSBA 2DEXX 2VMFA 3FCTB 4KY1H 3EFFB 5KYUA 4RGMC 3O8XB 1JV5B 5IK3A 3VO0A 3QQ9C 5CJ8A 3B2MA 2X1OA 4KNSA 4GSDL 1Q94B 5FKAA 3S96A 2AQRA 2E9BA 3V52L 4X83A 4EDXA 5C0FA 5CCKH 4S1RL 2C9UA 2WWKT 3T3ME 3VAEA 5TPWL 2QADC 4OJCA 2BY3A 1T20A 1KPVB 5H35B 1E67A 2VDPL 2Y7QB 2J25A 4U1MA 15C8H 5LNEA 3Q6GL 1DVFB 5IHLB 2B5IC 2UZYB 3S37X 2A9MH 3GB7A 2YUWA 5GGQL 2UWEB 2RA1A 3VJ6B 1KDIA 1X5IA 1KCLA 4MJIA 4P3CL 3F7KA 1NBYA 4UM8B 1ZTXH 2Q2LA 3FU9A 2R8SL 4X80H 1BIHA 4G8FA 3WTVA 4HMCA 4OGYH 4QRTB 4D8OA 3OKMB 4JKLA 3CHXA 3VMNA 3MYZA 4XAKE 2J2ZB 3OWRA 5GGRY 3ZRCC 2D73A 1G9ML 3DX6B 2C1OA 3UACA 4WHYG 1LEGA 3U7YL 3V5HA 3WNLA 2H0FA 3NJGA 4CVWA 4NP4L 1SY6L 3CDGB 4AITA 5F7FA 2XVLA 1KN2H 5LQBH 2X6VA 1R24A 4PGZA 3M7OA 1TTRA 4M7ZB 4Z3EA 5KVGL 2JCCB 2Y69B 4HLJA 4O2CA 4XMWA 4GUCA 4XBEH 5DYOB 4D8PB 2X12A 1QSEA 1B90A 4WO4A 1FNFA 5E4EB 5EOTB 1AFVL 1PY4A 2HG5A 5J13C 4JGMA 3QUKA 2V5TA 4JRXB 1V7NH 1XWVA 4XCCL 1L9TA 1TVBB 2WN2A 4DP7X 1IMHC 2O5YH 4RDQG 1KXTA 3GBNL 3LQAH 3LNDA 1AKPA 4P5KA 5DHMC 3EBGA 5IB1A 5FO7B 4XMUA 3QFJE 2OZNA 4N6RB 1JNLL 3CN4A 3QRGL 1W72A 5EZIL 4TRPL 5LB1A 4S1QL 3EJYC 3BESR 4L8DA 1XSKA 3EG9A 4M6MH 4NQSA 4PRHD 2CO2A 1TVHA 4S0SD 4B7LA 2DY2A 1U21A 3FN3A 3ATBA 2F18A 2D7TL 2Z7UA 5C0NC 4TVSa 3K1DA 1EJOH 5E8OB 3BUYA 2J8UB 4YHKL 3P3RA 5I75B 4HC1A 4S1DD 3KYNA 4P99A 3IJYB 3PPSA 2I60H 4QKTA 3U82B 2QV4A 4KKCC 1P6FA 3KL3A 4ODTL 3F58L 4PHXA 2W9DL 3TIDB 1MCBA 4HEPA 4P23C 1A7NL 5T3ZL 3ZU8A 2Y06H 1K6QL 3VX0A 2IDSA 3ULSA 1UXSB 3NPZB 5I1AB 5GRJH 2X4PB 5EZOL 4X4ME 3VXNA 4MRBA 4W4OC 2HMID 3FCSA 4R4NC 3NJHA 1U8KB 3D06A 4F80A 5JQHC 2A6DA 1CFVH 4R2GD 4LHUB 1U8PB 2OMNA 3NTCH 2X5PA 4Q58C 1P7QB 4GXFA 4R0LC 3VXMD 1BCIA 4A6YH 3K74B 4LLDA 5GHWL 1FLRH 1SXCA 2Q8AH 1DQQB 1FN4A 3HZVA 3E80A 2V9RA 2RQEA 1T66D 3CFDA 1D7CA 2DEYX 1ZHLB 2UY6B 1GC1L 3AABA 3Q13A 1OSYA 3T6ZA 4F2MA 1Q0YH 1MUJB 1BZ9A 2XN0A 4I87A 1NANI 1XF4B 3M1CA 4MBOA 4S1QH 2EKSA 5HHMD 4Y4FD 4W6WB 4I85A 1ECYA 1QNZH 3CC5A 3EUUA 3GJFA 4FQIL 3AUWB 4DP9X 3B5GA 3JWOC 1QD0A 1BQRA 2NNFA 4NUMA 4OF3A 1JSYA 1SDDB 1IFRA 3G6JB 4FS0A 4GW4B 2E0PA 4XCNB 3WFBL 1O0VA 5DJZB 4F5CA 5CM1A 4HJGA 1MW1A 4Z0XB 3LJ3A 2VGLM 1EO8H 2ZKXA 5DMIL 2E76C 2PCFB 1V3KA 3TO4D 4KROC 4XNYH 1IUZA 1W72L 1DBBL 3BIBX 4LBAA 4N6QA 3CCHB 3S37L 2NXZC 4NGHH 1PG7X 4K8RH 2BMKB 5F0JB 2FVNA 4FGMA 4LLUA 4L3CB 4TUOB 4JY6A 1A7RH 1KJVB 2PWDA 3AU0A 1OTSC 1JGVH 2AK4B 3FU5A 5EORH 5D2NE 1FZKA 1RZKH 2JVUA 1BZOA 4P0DA 4U6YB 2WXHA 5K1NA 4YFEA 3GBLA 5AW7B 2R9HC 2HMIC 2DQDL 3EO9H 2LVCA 2NY5H 2ZOUA 2OYMA 1AKJA 3NJXA 2W9EL 4G2AA 1HWWA 4WUKL 4A6YA 2OXGB 5IW3A 5KBKA 1GAFH 1EBAA 1HXKA 4P2RD 2C3VB 3QEQE 1AMYA 4U05A 5EPMA 2LU7A 1LMIA 4U31A 1GC1H 3P3SA 5C2BL 1N59B 3DI2B 1ZTMA 1TSRA 1XH3B 1P4IL 3UTPE 3V0GA 1E4WH 5I66A 3R8BB 4UB0L 1AY1L 4X6EA 3ZXAC 4PD4J 1W91A 1A5FH 3T0VA 4XR8C 5FO9A 4NZUH 1DE4A 1M4KA 1T66C 2OS7A 5K59E 3ZKND 1QTPA 4EUPG 4LCWB 3ARPA 4NPYA 1RZFL 1NFDE 4KHTH 2IPTH 5E1HB 3MGOB 2YAEA 1NKRA 1Q1JH 2NY4C 1XF4A 4GQ9H 5FF6A 3MJ6A 5EBLA 1CXLA 3GJEB 4NQXB 5EBWA 3ZIYA 1HH6A 1XCQB 4ZO7A 3R4RA 3PHSA 1E5CA 2G0KA 1F45A 4BM7A 1IGFH 2VDQH 5FYLH 4RLDA 4Y9BA 4ZXBD 3SGEH 4P5TA 3FXIC 3I9IA 1RLWA 1FWXA 1T4KB 3D4CA 1VEOA 5DRZB 3ZTJG 2ZSWA 3OC8A 3BJ91 1PKQE 3JWDL 4WQOA 3RRQA 4U3SB 3L13A 4HWEL 5T1KB 3CPUA 2DYSB 4EDWH 3LEXA 2RD0A 2WHVA 2ZOLB 4P2RA 4H40A 4ODSH 2R29H 3SJVE 1F3JA 1BFOB 5IWLC 2HVJA 5CZXC 3CMOL 5D8JH 1H9DA 2WQVA 6FABL 4FQIH 3WEMA 2IQ9L 4PRNB 1VHPA 3WNKA 2K4AA 4LVNC 5LAXB 4KXZH 2BFVH 2VDLL 3V5KA 3NCXA 1D5RA 2BHFA 3QNFA 1P5VB 4G5ZL 3U9PL 2VUYA 4NUGL 4UI2A 3PABA 3WIFA 3HBQA 3LZNA 1KXVC 4PRPB 1T4WA 2BCKB 2W9EH 2V33A 4KUCD 5C0RL 1KNOB 4JFOA 1A6AA 4KFZC 4UM9D 1XL6A 1FIGL 2QQNL 1J05A 3FN9A 3QR2A 4X6DE 1I8MB 4HOZA 5AALA 4AG4H 4ZXBA 3IFOA 1UB5B 4YX2L 3WE1A 2VH5L 4FQHA 2ENQA 3EADA 3FT3A 1MIMH 2ESVD 4EBQL 3QARA 2VW6A 4EN3C 2G3MA 1FF5A 3TZVA 3DIDA 4KVNL 4GAAA 3SDXA 1L9NA 3HMXH 5F72S 3SGDH 1R5VB 4M5YL 5KVFH 1A64A 3BW9B 1YEJL 3HA0A 4Z7OE 1A7QL 4GS7C 1GY1A 1DE4B 3LIZL 1U93B 1VADA 4PG9A 4OD1L 2P5WA 5CU9A 4AZUA 5C3TA 4F58L 1BPVA 1A6ZA 1MJ7L 1GGBH 4NWTL 1IGJA 3GXIA 5D7JA 2FGWH 5JUEH 3S6CA 1NGXB 1HOCB 2AAAA 1QR4A 2BOCA 1UOLA 2Z4QA 4AMKH 4DIXA 3BPCA 1IKNC 4WLCA 4Z7IA 3NABL 2BK8A 8FABB 4U1NA 1P7KB 5J89A 3ZZ1A 1LO0H 3M17B 4EN2A 3Q3GA 5D8JL 3S5LB 3CFJA 5JHLL 4L9DA 3HPJA 3VWKD 4JHVA 4G82A 2RFXB 2H6PA 3LKRA 4HK3N 4KKAC 2WLJA 2OMYA 4ZTEA 4DK3A 3NFNB 2CLZA 5LAPA 2Z7WA 4GRWB 3SBRA 5G4MA 4Y19E 2OMWB 4GRLC 4Z76A 1M7DA 2FWLB 4J3BA 3MRLA 5E00B 1DUYB 1RZ8A 5C0GB 4I3SL 3TP4A 1MHPH 4PJXA 3S88L 1EFXB 2W8CA 3ECQA 2OZ4A 5C9KA 1RLBA 4QOKE 1G9MC 3DYPA 4ZMQA 2Z4TA 4AYBA 1M9SA 1BV8A 4NIKB 1K5NA 1RV6X 3L4TA 4JRFA 3QQ3B 4RH4A 4HWZA 1LD9B 5AL8A 3UPCA 1N0XH 3MLRL 4MZRA 3SSGA 3C87A 3KEHA 4YEFA 1IV8A 1MDAA 3BKJH 2JXMA 4HHGA 3HLAB 2E7LA 5IHWA 5IGXL 3I75A 2NLJA 4FJ6A 3PP3H 4JHUA 4PJEE 3I50H 2I26N 4G6MH 2AAVA 4NRYA 1PY9A 4XWOD 3RL1B 4I8DA 4DTGH 2VR4A 4GXUM 4FI6A 5C0RH 4YSDA 1KCVH 3IMWA 2I85A 5KBMA 1BIIA 3PCYA 4TLUA 3HRZC 2CDGB 3ML8A 4TVPH 4WTQA 2WTPA 3GGWB 4B3EA 1TPXB 4ZMXA 3D0AA 3LNHA 3S3PA 1BF5A 1BZ8A 2UXGA 3O2VL 2P3YA 2VLKD 1NBVL 3NABH 4MSWA 4YE4H 4CA4A 3ARDC 2Q86B 1HJBC 4XTRC 1N68A 3MV8E 5JDJA 3T6WA 2A9ML 4UZSA 3W2DH 1CN4A 1NUDA 1JPTH 1YEFH 2R4SL 2Z92B 1JUFB 3QC5X 4EAEA 5BXFA 2IOIA 2TRYA 5DEJA 1AGEA 3DSFL 1F42A 5E2VL 3NJLA 5CWSA 3B7RL 1NUFA 1Z3GL 5I23A 2HRGA 3G3LA 1VFAB 4NQDB 3WNIA 4BXVA 2AXJA 4PJEF 2VAAB 3OKNB 3SCMC 3UTSB 2A9NL 1J10A 3ETTA 4NUJA 1YY9C 4GSDH 2VTFA 3PP4L 3QDMB 1YZZA 4F7PB 1OZUA 4BHUA 1JZ5A 1TU2B 2BOBB 2AEQH 1A6VH 3EW3B 5ISZD 3VMPA 3BVTA 1H9VA 1FYHB 3QR0A 1PKQB 4FQ2H 1R5WA 1BOGB 3WU1A 1W0VB 4M6NH 2WXKA 2V9QA 4CSSA 5T33L 4LXFA 3CLEH 1XR8A 2Y6SD 2BSTB 4F20A 1ADQH 1FFOB 1TETL 4BK4A 1NAML 1NMBH 2DWTA 3PF2A 3R4DA 5HDQH 3GBEA 1X4YA 5GS0L 1O7VA 1JK9A 5D2NA 1OAYL 3SKNA 3CVHH 3NCJH 3UTZB 2MFNA 3DUUB 3KPOB 1PAZA 1FHNA 2YZ8A 3II2A 4IKJA 2WZ0A 4D3CL 1BLIA 6PAZA 4FQQB 3NPSC 3KAAA 3LRHA 4DP0X 4LNVA 2IWGA 5T1JA 2ATPB 4G83A 4HAFA 2O5ZL 2L7UA 4TS6A 1S5HB 1FL6A 3HZKB 4KI5F 3RPIB 3FB8A 1MG3C 1AR1B 2NY7L 4C59B 2CIIB 1IGCH 3MOAL 3QEGH 1KUMA 4HKJB 2FJSA 4YHML 4MASA 1CWVA 2K8QA 1CGTA 1ETZB 1ZV5A 4J8RB 4M6ML 3CVCA 4KTDH 4XPHL 4LBEB 3U9UB 1L6ZA 4LCVA 1ZKAA 1JZFA 4FYQA 5CSGA 3DDFA 3BP7A 5F3BA 1D5IL 1FZMB 4OT1L 3C9NA 3JV4A 1YEDB 2D7NA 2JH2A 1MAML 4IU2B 4UV4L 2OYKA 3UTQA 2J5WA 3KBPA 3RJOA 3VX1A 2ILLA 3ARFD 3C8KB 3HE7D 3N55A 2C1OB 4NDMB 3EYUH 3D0LB 3MKKA 1AHWB 3MOBH 4WI8A 4KXZI 2JCCF 3VGEA 4AKQA 4E41B 1AGCA 2WB1A 2IPUG 4GW1B 1MW0A 3TT1L 3PFQA 3LQZB 1WYJA 1DLFL 2NY4D 3QEQD 4M00A 1T7ZA 4LEEA 1FZOA 3VSVA 4AEIL 5EFIA 4AJYV 4I5BA 4ZO6A 2Y1AA 1ZPLA 1OF0A 2IBZY 5DEZA 4MX7A 2EXYC 3SYAA 3D39D 1CZ8L 1XGTB 4Z6AT 1K4CA 1L7TH 3BUBA 2W94A 2WLNA 3HG0A 5DK0A 1F4XH 2ZF8A 4A6YL 5J06A 1P9MA 2BH0A 3IRCA 4W68A 4H0IA 4ODTH 1R46A 5PCYA 4KDTA 5IQMA 2R1XA 4EQ2A 1SEQL 2AJSH 2CLVB 3CVBA 4YLCA 3RIFF 1DFXA 1TVBA 3AM8C 1WSST 5E8DL 2PF6A 2ORBH 1QI4A 1U8MA 3UZVB 1SJHB 1W80A 2GJZA 2YJQA 4TQ8A 3GF8A 5AB2A 5HJDA 3DJRA 3NCWA 4O58L 4U1GB 1TOXA 2Y3NA 1WT5C 3QNXB 5BRQA 1GGTA 1ADQL 3ZDZB 4LLMA 2OP4L 3MV8B 5ESVB 3GJFK 1NMBL 1BZ9B 1UGNA 5I8OL 2DQCL 3NT0A 2FEEL 1JZHA 2F7PA 2MOQA 3LMJH 4BD4A 2WLIB 4JRWA 4ZNCD 1QFWI 3PWVB 3WS3B 2IDUA 3DPBB 5GXBB 4W9JC 1OGTB 4L4TD 3FQNB 1D5IH 1KN4H 5L6YL 3BAJA 4N0YL 5L7XL 4CAGA 1YN7B 3U9UA 3N0PB 4NHCL 4PW4A 4ZI8A 3W3BA 3FO1B 4URKA 1EERB 3D39A 3EHBC 4JM2B 1FP5A 3ZYIA 4KY1L 3DDGA 5I6KA 3KYMA 4PQXA 3DXAB 5D96C 1L9MA 3WDIA 2AJ3A 2H4EA 1W72H 4UBDC 3MODL 2FYVA 3GSXA 3O4OB 3PPEA 1ZDSA 3N1GC 4KJWD 5BVPH 3UPAA 4U3CA 3DRTA 4D9RE 4A66A 5CEZH 4LF3B 1PFOA 3MREB 4IRZA 4LQ1A 4NQQA 4BFFA 2Y2YA 4IS6A 2J20A 5DGQA 2LLNA 2LFEA 4TQEL 1YECH 2Z7YA 3SY6A 3D4YA 1UH2A 1O9VA 3O6KL 4AGMA 1LK3L 3GNML 4GO6B 1XB6A 3WKML 1TYRA 5IFAL 3CVHB 4HD9A 5ERWB 5BW7C 3MJ7A 3BGFB 3PWNA 5DMJB 4LIQL 1JP5A 3QJHA 3L4CA 1VPOL 4NPKA 1MRDL 1CDYA 2F7RA 3S0PA 1ZA3B 1DBAL 3NRQA 3QQDA 3C8DA 1JUFA 3WEBA 4P2OB 2WANA 4HKBB 1R3HA 3AZUA 1D7BA 4MXWL 5INCB 3TT1H 3MNWB 3SKMB 4WI4A 5ABZA 2CHXA 1IQDB 2GCYB 3EOBA 4JKWA 3VNYA 2DM3A 3WLBB 4RMUA 1EV2E 4FMFA 4N2LA 1SY6H 4FQXC 4R7XA 1T83C 4KH9A 3MO1B 1KJ3H 3L4VA 3WFHB 3T1WA 1A7PL 3DYMA 4R4ND 1F2QA 2J8HA 4IRSA 2DRUA 2NTFA 4IRJA 5CJ5A 4HGKC 5I9QC 4WWKD 3BKCL 4QRQB 5CJXC 1I7RA 3GMPA 3MLSH 3PAUA 1G7QB 4KNUA 3H9YA 4LP4A 3ZE2B 3QB7C 1G0DA 3NOIA 3LKQA 3LPWA 1H8NA 2EDHA 4MA3B 1XAUA 3QEQA 3PWVA 3ARGA 2ZWLT 3D1MC 4O58H 4E9QA 4WO4B 2EIZB 3V4UH 2V7HB 3RQ3A 4Y9CA 4Z7VE 1NCHA 1NGZA 5G4OA 3ARED 5DQDL 4WENB 1GPOL 4EEEA 2SODB 1P6WA 2V2TA 1CG9B 4P57A 3EYOB 4IRZH 5T1LA 2PYFA 5DHVB 3BUPA 2GIMA 1DDHA 1FYTA 2ADGA 1AGCB 2CO3A 3C5ZB 1EFXA 1OSEA 1UM4H 1RUML 1UB6A 2L4OA 1ZS8A 3C6LB 1S3RA 2J2ZA 3F6JA 1M1SA 3IMRA 5IB4A 1J12A 2BSRB 1FGVL 1K4CB 3H6AA 3S2CA 4O00A 4XP5H 3MRJB 3O3EB 4IKKA 3C2AL 4TQIA 1ET8A 4Y2LA 3IU4H 3ETBJ 3ZT5A 3NEXA 3DVNB 2ADIA 4WY7L 5TH2B 1PZ2A 5JO5B 4NKQB 3K0WA 2V4LA 1KLGB 4M1CD 4UM9A 2FX9L 4HT1L 4HWNA 4X6BA 3CHOA 3K91A 3RU8H 2ICCA 4JY5H 4MDJB 2XN2A 3GS0A 3JVFC 1PL3A 4OCLC 5F9WC 3RWGB 1CVSC 3FFCE 5JXAL 3EJSA 4XVSL 4DO4A 3R1GL 2C9XA 3T04D 2AV7A 5FYKH 3PRZA 2HG0A 4IHBA 4X7TA 2WCGA 1YEEL 5I1CL 3ZHLA 3GSQA 1SBSL 1NCWH 1NOAA 2RHEA 2ZJSH 3S48A 1F0LA 5TPWH 5BS0B 4UIKL 5B38A 3FONA 5A2AA 4ICXA 1IEAB 4FKHA 1O75A 4XCFL 3VGFA 3CFIC 3GMMA 5FYLE 3DNKA 2OCFD 3T0EB 3CVIH 3GRBA 1LO0L 3M8OH 1M6OA 4M7JH 5DHXB 1SEBA 5IVXB 3MROA 3V2AR 4OLEA 2XIBA 4F7MA 4KTDL 3RZCA 1NGWB 5BOPA 1RJLB 1HCFX 2C5DC 2P44B 4L4VE 2BOBA 3ZN6A 3CZUB 1GZHC 2ZNXA 2QPSA 4AWJC 1XIWD 3Q43A 1P5VA 4QR7A 4O9HH 4AYFA 4B9PA 5B7MA 1U2CA 3ZDYB 4BHUI 3IXAB 4MVBD 4GEJA 4XP5L 5GZOA 3B37A 4HK3J 4QHUA 3VXUD 5BJTB 3UGXA 2H6OA 2DIJA 2CWRA 5DVKA 3RKDC 5KVDE 5KJ4A 3N1PC 4M43L 1AXTL 5DMIH 5TJWK 2EYSB 1WEJH 3UAAA 1D2OA 2JCWA 4L3FA 2CD0A 3KPLA 4YFDB 5EU5B 3TO4B 3BXNA 4ZNEA 3AFLA 1U8KA 3N5AA 4RZCB 1HHGA 4HIJB 1MJUL 4Y5YC 4ANVA 1RIVH 3KYOB 2OJZH 4NI6A 3FU7B 3RVTD 2GCYA 2OTPA 2YPLA 1P4LA 2GPZA 2LV4A 4BK5A 5TDNA 1X5YA 3JT0A 4LASH 1UM5H 4DN3L 5BS0E 3NMEA 1X7QA 2YAPA 1V27A 2NY2C 3QUYC 4UT6A 1C12B 3KNBA 2F5AL 1FFNA 4FTVB 3QUMA 5T1LD 2B16A 1MVYA 4K5LA 2R2EA 1JI1A 2MJWA 1A2YB 2A99A 2GABA 1LQBC 3A6CH 1WF5A 1QEWA 1E2VA 2E7HA 1XIWA 2ORBL 2GUYA 1BZ7B 2COQA 4F37F 5EWIL 5EH1A 5T3XE 3HC4L 1N6UA 1NDTA 1T3FA 4K15A 5AVWB 5GPRA 5EC2A 5DJDA 3BEVA 4L2YA 2C9VA 5KS9B 1DQLH 1YDPA 2R69L 1TLMA 3Q8AA 3STZB 3EH4B 1YCSA 1C1EH 2A4ZA 2OV0A 3MLZH 3U0PA 3U6XS 4FLOA 2AJYH 3ROOB 4JFXB 2I9TA 2K3HA 1DBMH 1FG9C 4PB9H 1ANUA 4XNAA 1QFHA 4UF7C 4V1DE 3JXAA 4XNMA 4EZJA 1OWRM 3DBSA 2D31B 3QG7L 4IKLA 1NIEA 3WS6C 2IADA 3GQFA 5E2JA 1JK8B 1ED3B 1KJMB 3CXHJ 4MJJA 2MQCA 2O30A 4J2XA 4APQA 1ZHBA 1V8HA 5AVRB 1ORSB 5AW3B 5HHQA 3T6XA 2DQEH 3BQVA 4LLUB 1MCWW 5EBWB 3G04B 1RUQH 5EU3B 4QY8B 4YDLB 1WA2X 1CD9B 1QPKA 3H9HA 3QQ3A 1IC7L 1NKOA 2BP8A 3OKYA 4WTZG 4XCEA 1O7DE 2GTWB 1IARB 3PWPB 1E7VA 5D7IF 5BRZD 1CLYH 2GJ6A 4I0PD 2X4RA 5D4QA 3VW3H 2P5EB 4WDIA 3WUZA 4JJOA 3SYQA 2F58L 2BFGA 2IADB 4KDWA 2KLSA 4Z7UB 4ZMAT 1JYNA 1GYWA 5DJXA 4PTUB 1ROCA 1LDPH 3FT0A 3OAYH 5I75C 5D9SA 5HJBA 5C7ZA 3VCLB 1B0RA 1OO2A 4HGWB 2O26U 3O11A 5DJCB 3RY6A 5F1KC 4M7KL 3UC0L 5C0EB 2VZTA 4RQQA 5ANMA 4JVUA 4QRAA 2P49B 2YGPA 3FCGA 2WYHA 5CKAA 4JEGB 1F00I 2A73B 3LEVH 5CIPA 5JIKA 1Z66A 5AAMA 2NXYB 5ISZE 1SOKA 4JRXE 4N3TA 3FT4A 3PXHA 2VXQH 5DUJA 4Q52A 4B60A 3FRUB 4X5XB 2ICWI 1ZD6A 1ZLEA 3T0BA 2F5AH 3DTDA 5LCVH 5GS2H 2WTRB 1KXVA 2KQMA 4GRWH 2R1XB 2BW4A 4ONHA 5FUCC 4HVBA 4IBLT 5K9JH 1XSOA 3WEOA 4UDUA 4PGDB 4FFZL 1QW9A 3IETB 4B5ZA 3FN0H 4QRTA 4BCZA 4DK6A 3VVWA 1OT4A 1WWWX 1EMTH 2NY2D 4LKXA 4N68A 5DWUL 2APXA 4TMPA 4UV4H 3BP7B 4S1RH 5CEZD 5J6SA 3N40F 3SDXB 3TBCA 4Y4KA 1QTSA 2AJUH 2YKKA 2DWEB 3GMRB 3HRZB 4UAOC 4F91B 1H0DA 5BS0D 1XF3A 2ED6A 2G5BA 2YGNA 3G08A 5F3FA 5F7KC 4YXLH 5FFGA 3H9SD 1ZANL 1ZHNA 3O6FA 4NO3A 4NFCA 4UDTA 4B50A 5MHSD 4L29A 4YSQA 3GSVA 4ZTOH 4GUOA 2AQTA 1DQVA 1QFUL 1R19A 4PCKA 5CEYB 4XHJC 3CQFA 4LDOB 1B4TA 1BAFL 1NCAH 3HI1B 4P23B 4EDXB 3LKSA 4Y2DB 4A7VA 2DQDH 2VXVL 3Q7JA 1QBML 2GITA 2ENSA 1A6AB 1EEYB 2QGCA 1VERA 3SKMA 4H8WC 3CDZB 1HH9B 3WN5B 2WW8A 2A6JB 3AS1A 4EKXA 5I1HH 1XL4A 4L8CA 3VD4A 1NAKH 2P9RA 5INDB 4XN2A 3AUVA 3V10A 3KPPB 2QGBA 3NIGE 4Q0XL 4Y1AB 2Q10A 4HV8B 4LSQH 1IKNA 2XN9D 2BVQB 2PPAA 1QNIA 2KZKA 1REIA 3PJLA 5GRYA 3GXDA 1BGXL 4YHLL 4UQIM 4GRMB 3EJYD 3LPOA 1NMCB 4K3EH 1FFTB 1JPEA 4GKSB 4TQPA 2OPCA 5D7IE 4KRNA 4CC0A 5BVJB 4LIQE 2DIEA 3F6LA 4EN3D 5F7NC 5CD5D 3CDYA 4HUCA 2HFFB 3WBDA 4CVXB 1DLHA 1TVHB 5CLXA 1INDH 2WQAA 4RMVA 4UOZA 4M1DH 2WQUA 3VSQA 4PJDB 3WLWD 2P1YA 3FSVA 3KPRD 2VDKL 4LNRA 1TSHA 4XX1E 1NBZA 4F7EA 4N5ED 2WD0A 2YEZB 3GPEA 2V6HA 1PYWB 1RJCA 1IAOA 1AO7E 1U8OA 2CNYA 1V55B 2ZKHH 3NYKA 4HD5A 3TASA 3TO2A 1A9VA 3PQYB 4APXB 4OLYL 3GDCA 2OW6A 3ASWA 3JWDH 4GW5A 1VFBB 4HS3B 4N90D 4QO1B 4ENEC 5LDSA 2XVGA 3HZYA 1B2WL 1JGUL 1XSIA 2R0WL 3OHMB 5D55A 3RGVD 4ANWA 3MUGA 2ZJSL 4JRXA 3L3OB 3V0WH 3NIGF 1PCSA 1QRNA 3QORC 4JW3A 3KYMB 5IROC 2IQAB 3QUXB 1CE6A 4X6EB 3Q05A 4UT9L 4CVZB 3MR9A 1IEBB 1A7BA 2G60L 4GXUN 4W9CC 4L0PB 2DI7A 3WLWC 2IPTL 2MCAA 3EJTA 2EIDA 1W72B 4KROB 1KYOK 3VFPA 5CGYD 4FZ8H 5A3IC 1O6VA 3ORJA 3P30L 4U1SB 4X7SL 2WUCH 2CBPA 2UZXA 3HHSB 4NNPL 3ZQWA 4FFVC 4B5EA 1B3JA 5E6ID 3PGFL 1E5YA 2R23A 5SWSA 1IEHA 1ZVSA 2CG9X 3RVXD 5B3JE 2MPAH 3B2XA 1G7LA 4DGVH 1OIOA 2PYEA 1OARL 4ZFFA 4ZTPL 5KUMA 5DD1H 3GMNA 4I77H 2J55A 1MFEL 1QBLL 1BX2A 3R7QA 1IM3D 1DJYA 1E5AA 3OXSB 4LLMB 4JRXD 4MAYD 3V0VB 4ZQTA 1PEZA 1QRND 1CFMA 1JV5A 4JMXA 1K5NB 5IK3B 5AW0B 3SGEI 2Q7YA 3GMOA 4GW1A 1MFVA 4LASL 1HHIB 3G9VA 4R8WL 3TF4A 3L5XL 1GTFA 2V2XA 2VSDA 4FX5A 5FEBA 1OE2A 4IRJC 3APMA 3B1UA 4Q0XH 4YSEA 4DZ8B 3CFEA 3PP3K 3VSTA 3TESA 4BWWA 4MXVE 2CR0A 5CZKA 4N9GB 4XBPA 3S3CB 4AV5A 3GM0A 5DK0B 5K1JA 1EGJH 4BFKA 5CJOH 5IHUL 2XX1A 4MJ5B 2GAZA 3D5OF 4WWKA 1EO7A 1HQ4A 3UYPA 1I75A 2AANA 1K9TA 1ASOA 4BEIA 3UPRB 3VRIB 2W07A 5DFVC 5F71A 4FQJH 1ZVYA 1MJ8L 4KMTH 3T3PF 4HJ0C 2DLFH 4BZ2L 3SPGA 2FWOA 4P49A 3NIFB 3HCVA 4JVWA 2DH2A 4IBZA 2ZUYA 4YC2C 2JQMA 4HJ1A 4QRPD 4X7SH 3HBPA 5A43C 4MZ2A 1A6ZB 5HVHC 4P2CG 5B7EA 3FTGB 3MGTB 1T0MB 5E7BA 1KELH 2ZG1A 4YSSA 1OCWL 1FDLL 3ISYA 2J56A 3VI4A 3PIQB 1SVCP 1E4XH 4X6FB 2A0LD 1M1XA 2P24B 2V0AA 1GJWA 3QJFB 4FYSA 1U3HD 4L3ED 4APQC 5F1NA 1INEH 2YLHA 4R7DA 1BFVL 1CDGA 2EH7H 3RWIA 3MUUA 3BGFC 4GUQA 2WQWA 2EZ0C 1RUMH 1FGNH 1SJMA 1KBKA 3O2WL 3B3IB 1NCCL 3MRIB 1EVUA 2QHLA 1OK8A 2CBQA 3EO0A 1L7TL 1W8EA 1MI5E 2CO4A 3BH9B 2J7LA 2X9YA 2YWZA 3BZ4A 2D0FA 3ZE1E 4AIZB 3WG7B 1LE9B 3CFCH 4HHWA 5I19H 3NG5A 2FHFA 3QUYD 2A1WH 1EWHA 4KV5E 5F7EL 1JZ2A 5J9PA 1Q8MA 3D7PA 1CMOA 5AW4B 4KI5C 3BRFA 3VD9A 4AQAB 2JTYA 3MCYA 2XQ0A 3W0WE 5GRUL 4X0KB 1AMXA 1E3ZA 1DVQA 3ARBB 3IKCA 3OAYK 5B39B 5BQ7B 2KYIA 5SWZE 4KKBD 2EDYA 4F9LC 3N43F 2FBJL 1I9JH 3OQ3B 3Q1EA 2GK0A 4YDJA 1C16B 1RZGB 4OFYD 4RGOL 3RL1A 1G84A 4JKNA 3L17A 3RKDD 3FOLB 1L7IH 3NCEB 3MBWA 5B22A 3RX7A 5D5MF 4YO0B 1MCWM 4ZBJA 4KTEL 3CPLB 3F62A 2GTWA 3RAJH 4ETQB 3GBNH 7PAZA 3QWOB 4GI6A 2DICA 4HPYH 1HXYB 1MI5B 1ZRUA 3INOA 4DGUA 4BFJA 3M1OA 3IF1A 3UEZA 4PYGA 1PW3A 5CILH 3ULUC 2EYSA 1MNUL 2JCCE 3BH8A 3EAKA 1SPDA 3UL4A 4GRWE 4PSRA 3WL9A 3V0EA 3FUFA 4H2AA 3O2WH 4EVNA 4YIQA 5DWPA 3VI3B 2V9UA 2IANA 4WI2A 3MRRB 5HGBA 2X40A 5HGAA 2IG2L 3UGUA 2CKBB 1KMGA 1AVAA 3ML9A 4OBSA 3QIWC 1Q38A 4XB7A 4P8QA 5HYQA 5I15L 4JFFB 1LO5B 4DO5A 4Y1AD 3ZKMD 3SY0B 5A2KH 2RCSL 4Z7OB 3PGCA 4BIKA 1GCFA 1ETZA 3II3A 3D08A 3FMGL 3L5JA 5D7SH 3OZKA 4WEUD 1FFQA 2A77H 4ENED 3OR6B 3INUH 2NCEA 2CUHA 2Z34A 3H4HA 1XH3A 4X9BA 4UUJB 1IX2A 5SV4A 4J3UA 4AX3A 5E8PA 5E8NB 3GXTA 3CH1A 4K55A 2P5EA 1CFVL 4WDIB 1VAHA 3LZPA 3T65B 1HQRB 3P0YH 2PCFA 1A1OB 5CHNB 3ZE1F 5F9WB 5A2LH 2ESVA 3AAZA 1EHAA 43C9A 2EJ1A 1IBYA 3DIFA 3HN3A 5GS0C 5DEGA 2CA4A 2R1YB 3QUXC 5C0GA 2GJ6D 4I0PA 3V52H 4ZFOL 4JPIB 5D7IB 3UJIL 1OAJA 2X4QA 5GGUA 4UCFA 3BPOB 3UZQB 2K7QA 2VDNL 1QSFA 3O3AA 3X17A 1BBJB 3D25B 5HXMA 3ZE2E 4YSAA 2EDJA 3L9RB 2QV2A 2CIIA 1DQLL 4D7PA 4Z8FH 5ALBH 4WFHE 3AITA 3BT0A 3KGUA 2FT8A 4XP1L 5GGQH 3BUQA 4I1RA 4LLWB 1VGEL 3W38A 2QKIA 4AQ1A 5HDBF 3MV01 1SJVA 5DC0A 2ZUSA 1NCBL 1TZIB 3FSZA 1KB5L 4FOMA 4HCFA 3W11C 3SJVB 5EO9A 1SBBA 3VYOA 4QGTA 1DEEB 1DYZA 4GG8A 1WO2A 2XNAA 3A24A 3ZYOA 1QEWB 3LY6A 3DLQR 4MJID 1KCBA 5J3HD 4YDIH 2FT6A 1AO7D 4BFRA 3UOAB 4NZUL 1DJSA 1SHXA 1KB3A 2H9GA 4KK9D 4FLRA 4NAQA 1D5MB 2GSIA 3EYSH 3FZUD 3K6NA 4M93B 2ZUQC 5MEPB 3ULVH 2K70A 5DJDB 3UEQA 3V9EA 2F2HA 3OX8B 4JFUA 1G7PA 4YHIA 2ITCB 2RTTA 3EYVA 4Y4FB 3WN5A 3KVDD 1DQTA 5KJRL 4LCWE 3SPVA 5LNGA 2QMKA 4OLXL 5EU7C 3HFFA 3BVNA 5E8NA 1BFOA 3TVMC 3STBA 3WD5L 4PGCA 4J6RL 4DGYL 2ZX9A 1S8DA 1QSED 1ORQB 1N4XL 1Z0MA 4WO4D 5DJYB 1S7RB 2WBJC 3GO1L 2ZXWB 2G9HA 4PCYA 3WNPA 4OGAD 4X98A 2M2DA 4I0CC 3CV5A 3C2SA 3EGXB 3P4LA 1BAFH 1NCAL 4LP8A 5FO8B 3FQYA 1G7HA 4PS4L 1G1CA 4U3XA 4UTAL 2YEVB 4RGNE 1AZZC 1FLTX 4M4RB 2C3GA 3IDGB 4WUUB 3L3JA 1XCQA 2VLKA 2XV0A 1FH5L 2WLLB 1Z6JT 3BFOA 5CP7B 4FL4B 4NT6A 4NCDA 3IWVA 4MFHA 4OQTH 5ADOL 2WXGA 3T0EA 4XPAH 3EHBD 3JVGC 3A6OA 1U3ZA 2OMYB 3C5ZA 5F9OL 2ENYA 1T22B 3TYFB 5FM5M 1PZUB 5FO9B 1DN0B 2QKIB 1LXMA 3W82A 4AQ1B 3MRPB 5KANG 2XKSA 1URIA 4LGSB 4O2EA 3X3GH 4C4BA 5JW4R 3IDXL 2P5ED 1NGPH 3KXFE 1ETA1 3EBHA 4JRYE 5DC9B 5AZ2H 4HUNB 5H37H 1GZHA 1EHKB 1WBZB 4DF9A 5FHBH 1Z2KA 2ITDB 4U6TA 5AOIA 2AP2A 4IGBC 3RBSA 2A9AA 2HN7A 4P46C 1J5HA 2CKBL 3MTRA 1UT2A 5CUSL 3HE6D 4B9GA 3KPMB 3SO3B 2YUXA 4IQHA 3BPCB 4IEFA 1EJ6A 2F1AA 3LPFA 2VR3A 5J1TC 4Y4KD 5IB3B 4J12A 4RA0C 3Q8EA 5GHWH 5L4IA 1FLRL 4QOKA 2Q8AL 5KJRH 4CSTA 5E99L 4K9EC 4NUGH 4ZDHA 3DX7A 4UZGA 3KM1A 2ZOWA 4PM1A 2ZYHA 3UO1H 3IPFA 1MRDH 2K6ZA 3MV9A 3RZWA 4LQFL 5DTFA 2PABA 2QR0B 4GQQA