3GPQA

Crystal structure of macro domain of chikungunya virus in complex with rna
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
160
structure length
160
Chain Sequence
APSYRVKRMDIAKNDEECVVNAANPRGLPGDGVCKAVYKKWPESFKNSATPVGTAKTVMCGTYPVIHAVGPNFSNYSESEGDRELAAAYREVAKEVTRLGVNSVAIPLLSTGVYSGGKDRLTQSLNHLFTAMDSTDADVVIYCRDKEWEKKISEAIQMRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural protein 3
publication title The crystal structures of Chikungunya and Venezuelan equine encephalitis virus nsP3 macro domains define a conserved adenosine binding pocket
pubmed doi rcsb
source organism Chikungunya virus
molecule tags Viral protein/rna
total genus 50
structure length 160
sequence length 160
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2009-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3gpqA00
1LAPA 4ZY2A 3SIJA 4R6TA 4D86A 1ZR3A 2VRIA 1TXZA 5E3BA 5CBMA 3GPGA 3PEIA 2X47A 1SPVA 3SIGA 4ABKA 3EJGA 3GQEA 4GVVA 3EWRA 1VHUA 1BLLE 5HIHA 3H8GA 3EKEA 4UMLA 5CB3A 4IQYA 1BPNA 3EWQA 4GUAA 3IIFA 4JGKA 3SIHA 3KR4A 4ETKA 4J5RA 4R76A 5FSYA 3KQXA 3IIDA 3Q6ZA 4ZY1A 1HJZA 4JLLA 4ZX9A 2LGRA 3V2BA 2L8RA 4TU0A 3EW5A 2ACFA 5AILA 3GPQA 5HOLA 3IJ3A 5CB5A 2FG1A 5FSZA 3EJFA 3KR5A 4J5QA 2XD7A 4JVVA 2EWBA 5DUSA 4ZY0A 4X2TA 3GQOA 1GYTA 1BPMA 5FSXA 4JCAA 4ZX8A 1ZR5A 4KYBA 2FAVA 4ETJA 4ZI6A 2BFQA 1LAMA 4ESSA 3KQZA 1NJRA 2FXKA 2AFCA 4J4ZA 3H8EA 4K3NA 2DX6A 3SIIA 2EEEA 4R7MA 3ETIA 5CMSA 4GVWA 3EWOA 3H8FA 4KSIA 4ABLA 1YD9A 4J5SA 3V45A 3GPOA 3EWPA 3JRUA 5FSVA 3VFQA 4K0CA 1LANA 5D8NA 2BFRA 1TY8A 3Q71A 5FSUA 3JZTA 3T8WA 2J9AA 1LCPA 3KZWA 4ZYQA
chains in the Genus database with same CATH superfamily
1LAPA 4ZY2A 3SIJA 4R6TA 4D86A 1ZR3A 2VRIA 1TXZA 5E3BA 5CBMA 3GPGA 2WCTA 3PEIA 2X47A 1SPVA 3SIGA 4ABKA 3EJGA 3GQEA 4GVVA 3EWRA 1VHUA 1BLLE 5HIHA 3H8GA 3EKEA 4UMLA 5CB3A 4IQYA 1BPNA 3EWQA 4GUAA 3IIFA 4JGKA 2JZFA 3SIHA 3KR4A 4ETKA 4J5RA 4R76A 5FSYA 3KQXA 3IIDA 3Q6ZA 4ZY1A 1HJZA 4JLLA 4ZX9A 2LGRA 2RNKA 2L8RA 3V2BA 4TU0A 3EW5A 2ACFA 5AILA 3GPQA 5HOLA 3IJ3A 5CB5A 2FG1A 5FSZA 3EJFA 3KR5A 4J5QA 2XD7A 4JVVA 2EWBA 5DUSA 4ZY0A 4X2TA 3GQOA 1GYTA 1BPMA 5FSXA 4JCAA 4ZX8A 1ZR5A 4KYBA 2FAVA 4ETJA 4ZI6A 2BFQA 1LAMA 4ESSA 3KQZA 1NJRA 2FXKA 2AFCA 4J4ZA 3H8EA 2KQVA 2JZEA 4K3NA 2DX6A 3SIIA 2EEEA 4R7MA 3ETIA 5CMSA 4GVWA 3EWOA 3H8FA 4KSIA 4ABLA 1YD9A 4J5SA 3V45A 3GPOA 3EWPA 3JRUA 5FSVA 3VFQA 4K0CA 1LANA 5D8NA 2BFRA 1TY8A 3Q71A 5FSUA 3JZTA 3T8WA 2J9AA 1LCPA 2W2GA 2JZDA 3KZWA 4ZYQA
chains in the Genus database with same CATH topology
1LAPA 4ZY2A 3SIJA 4R6TA 4D86A 1ZR3A 2VRIA 1TXZA 5E3BA 5CBMA 3GPGA 3PEIA 2X47A 1SPVA 3SIGA 4ABKA 3EJGA 3GQEA 4GVVA 3EWRA 1VHUA 1BLLE 5HIHA 3H8GA 3EKEA 4UMLA 5CB3A 4IQYA 1BPNA 3EWQA 4GUAA 3IIFA 4JGKA 3SIHA 3KR4A 4ETKA 4J5RA 4R76A 5FSYA 3KQXA 3IIDA 3Q6ZA 4ZY1A 1HJZA 4JLLA 4ZX9A 2LGRA 3V2BA 2L8RA 4TU0A 3EW5A 2ACFA 5AILA 3GPQA 5HOLA 3IJ3A 5CB5A 2FG1A 5FSZA 3EJFA 3KR5A 4J5QA 2XD7A 4JVVA 2EWBA 5DUSA 4ZY0A 4X2TA 3GQOA 1GYTA 1BPMA 5FSXA 4JCAA 4ZX8A 1ZR5A 4KYBA 2FAVA 4ETJA 4ZI6A 2BFQA 1LAMA 4ESSA 3KQZA 1NJRA 2FXKA 2AFCA 4J4ZA 3H8EA 4K3NA 2DX6A 3SIIA 2EEEA 4R7MA 3ETIA 5CMSA 4GVWA 3EWOA 3H8FA 4KSIA 4ABLA 1YD9A 4J5SA 3V45A 3GPOA 3EWPA 3JRUA 5FSVA 3VFQA 4K0CA 1LANA 5D8NA 2BFRA 1TY8A 3Q71A 5FSUA 3JZTA 3T8WA 2J9AA 1LCPA 3KZWA 4ZYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LAP A;  4ZY2 A;  3SIJ A;  4R6T A;  4D86 A;  1ZR3 A;  2VRI A;  1TXZ A;  5E3B A;  5CBM A;  3GPG A;  3PEI A;  2X47 A;  1SPV A;  3SIG A;  4ABK A;  3EJG A;  3GQE A;  4GVV A;  3EWR A;  1VHU A;  1BLL E;  5HIH A;  3H8G A;  3EKE A;  4UML A;  5CB3 A;  4IQY A;  1BPN A;  3EWQ A;  4GUA A;  3IIF A;  4JGK A;  3SIH A;  3KR4 A;  4ETK A;  4J5R A;  4R76 A;  5FSY A;  3KQX A;  3IID A;  3Q6Z A;  4ZY1 A;  1HJZ A;  4JLL A;  4ZX9 A;  2LGR A;  3V2B A;  2L8R A;  4TU0 A;  3EW5 A;  2ACF A;  5AIL A;  3GPQ A;  5HOL A;  3IJ3 A;  5CB5 A;  2FG1 A;  5FSZ A;  3EJF A;  3KR5 A;  4J5Q A;  2XD7 A;  4JVV A;  2EWB A;  5DUS A;  4ZY0 A;  4X2T A;  3GQO A;  1GYT A;  1BPM A;  5FSX A;  4JCA A;  4ZX8 A;  1ZR5 A;  4KYB A;  2FAV A;  4ETJ A;  4ZI6 A;  2BFQ A;  1LAM A;  4ESS A;  3KQZ A;  1NJR A;  2FXK A;  2AFC A;  4J4Z A;  3H8E A;  4K3N A;  2DX6 A;  3SII A;  2EEE A;  4R7M A;  3ETI A;  5CMS A;  4GVW A;  3EWO A;  3H8F A;  4KSI A;  4ABL A;  1YD9 A;  4J5S A;  3V45 A;  3GPO A;  3EWP A;  3JRU A;  5FSV A;  3VFQ A;  4K0C A;  1LAN A;  5D8N A;  2BFR A;  1TY8 A;  3Q71 A;  5FSU A;  3JZT A;  3T8W A;  2J9A A;  1LCP A;  3KZW A;  4ZYQ A; 
#chains in the Genus database with same CATH topology
 1LAP A;  4ZY2 A;  3SIJ A;  4R6T A;  4D86 A;  1ZR3 A;  2VRI A;  1TXZ A;  5E3B A;  5CBM A;  3GPG A;  2WCT A;  3PEI A;  2X47 A;  1SPV A;  3SIG A;  4ABK A;  3EJG A;  3GQE A;  4GVV A;  3EWR A;  1VHU A;  1BLL E;  5HIH A;  3H8G A;  3EKE A;  4UML A;  5CB3 A;  4IQY A;  1BPN A;  3EWQ A;  4GUA A;  3IIF A;  4JGK A;  2JZF A;  3SIH A;  3KR4 A;  4ETK A;  4J5R A;  4R76 A;  5FSY A;  3KQX A;  3IID A;  3Q6Z A;  4ZY1 A;  1HJZ A;  4JLL A;  4ZX9 A;  2LGR A;  2RNK A;  2L8R A;  3V2B A;  4TU0 A;  3EW5 A;  2ACF A;  5AIL A;  3GPQ A;  5HOL A;  3IJ3 A;  5CB5 A;  2FG1 A;  5FSZ A;  3EJF A;  3KR5 A;  4J5Q A;  2XD7 A;  4JVV A;  2EWB A;  5DUS A;  4ZY0 A;  4X2T A;  3GQO A;  1GYT A;  1BPM A;  5FSX A;  4JCA A;  4ZX8 A;  1ZR5 A;  4KYB A;  2FAV A;  4ETJ A;  4ZI6 A;  2BFQ A;  1LAM A;  4ESS A;  3KQZ A;  1NJR A;  2FXK A;  2AFC A;  4J4Z A;  3H8E A;  2KQV A;  2JZE A;  4K3N A;  2DX6 A;  3SII A;  2EEE A;  4R7M A;  3ETI A;  5CMS A;  4GVW A;  3EWO A;  3H8F A;  4KSI A;  4ABL A;  1YD9 A;  4J5S A;  3V45 A;  3GPO A;  3EWP A;  3JRU A;  5FSV A;  3VFQ A;  4K0C A;  1LAN A;  5D8N A;  2BFR A;  1TY8 A;  3Q71 A;  5FSU A;  3JZT A;  3T8W A;  2J9A A;  1LCP A;  2W2G A;  2JZD A;  3KZW A;  4ZYQ A; 
#chains in the Genus database with same CATH homology
 1LAP A;  4ZY2 A;  3SIJ A;  4R6T A;  4D86 A;  1ZR3 A;  2VRI A;  1TXZ A;  5E3B A;  5CBM A;  3GPG A;  3PEI A;  2X47 A;  1SPV A;  3SIG A;  4ABK A;  3EJG A;  3GQE A;  4GVV A;  3EWR A;  1VHU A;  1BLL E;  5HIH A;  3H8G A;  3EKE A;  4UML A;  5CB3 A;  4IQY A;  1BPN A;  3EWQ A;  4GUA A;  3IIF A;  4JGK A;  3SIH A;  3KR4 A;  4ETK A;  4J5R A;  4R76 A;  5FSY A;  3KQX A;  3IID A;  3Q6Z A;  4ZY1 A;  1HJZ A;  4JLL A;  4ZX9 A;  2LGR A;  3V2B A;  2L8R A;  4TU0 A;  3EW5 A;  2ACF A;  5AIL A;  3GPQ A;  5HOL A;  3IJ3 A;  5CB5 A;  2FG1 A;  5FSZ A;  3EJF A;  3KR5 A;  4J5Q A;  2XD7 A;  4JVV A;  2EWB A;  5DUS A;  4ZY0 A;  4X2T A;  3GQO A;  1GYT A;  1BPM A;  5FSX A;  4JCA A;  4ZX8 A;  1ZR5 A;  4KYB A;  2FAV A;  4ETJ A;  4ZI6 A;  2BFQ A;  1LAM A;  4ESS A;  3KQZ A;  1NJR A;  2FXK A;  2AFC A;  4J4Z A;  3H8E A;  4K3N A;  2DX6 A;  3SII A;  2EEE A;  4R7M A;  3ETI A;  5CMS A;  4GVW A;  3EWO A;  3H8F A;  4KSI A;  4ABL A;  1YD9 A;  4J5S A;  3V45 A;  3GPO A;  3EWP A;  3JRU A;  5FSV A;  3VFQ A;  4K0C A;  1LAN A;  5D8N A;  2BFR A;  1TY8 A;  3Q71 A;  5FSU A;  3JZT A;  3T8W A;  2J9A A;  1LCP A;  3KZW A;  4ZYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...