3GPSA

Crystal structure of the f87m/l110m mutant of human transthyretin at ph 5.5
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
115
structure length
115
Chain Sequence
CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPMHEHAEVVFTANDSGPRRYTIAAMLSPYSYSTTAVVTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transthyretin
publication title Novel Zn2+-binding sites in human transthyretin: implications for amyloidogenesis and retinol-binding protein recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 27
structure length 115
sequence length 115
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 3gpsA00
3IMTA 5E23A 1BMZA 1DVUA 2FBRA 3OZLA 3GRBA 5CLZA 4IKIA 2H0JA 3D2TA 4I89A 3KGSA 5HJGA 3IMSA 2GABA 3CFTA 4TQHA 3IMVA 2GPZA 3KGTA 4I85A 1TZ8A 1GKOA 5CM1A 5L4MA 4PWHA 4TL5A 4TKWA 3CN2A 3I9AA 1TTAA 1FH2A 4MASA 5CR1A 5FW7A 2H6UA 4WNJA 4Y9CA 1DVTA 2FLMA 2F8IA 2H1XA 2ROYA 1U21A 1TSHA 3GS0A 4HJTA 4TLTA 2G5UA 3DJSA 5AYTA 4PMEA 1TYRA 1RLBA 3GRGA 5BOJA 2B77A 4IKKA 4TQ8A 3BSZA 5CLXA 4FI8A 3ESNA 1SN0A 5AKSA 3GS4A 3DJTA 1THAA 1F41A 2ROXA 1IJNA 5A6IA 3DGDA 3U2IA 2WQAA 5JIDA 2NOYA 4IIZA 3NESA 2G4EA 1SOQA 4ABWA 3ESPA 3OZKA 2G2NA 1BM7A 3P3SA 3HJ0A 1IIKA 1KGJA 4PWJA 3TCTA 4PMFA 1BZDA 1TFPA 4PWKA 5FW8A 4AC4A 3GLZA 4PWIA 4HISA 4IK7A 4ABVA 2B15A 2B14A 1THCA 5AL0A 4ABUA 4KY2A 1FHNA 3IMUA 4N85A 1DVYA 4QYAA 3IMWA 4TQIA 1ETB1 3IWUA 4WNSA 1TTCA 4TNGA 5JIMA 4PM1A 4FI7A 1X7TA 5DWPA 4WO0A 5AKVA 4TLSA 4Y9GA 2B16A 3CN3A 2H4EA 5FW6A 3P3RA 4PVMA 4Y9BA 4TL4A 5AL8A 3KGUA 4DERA 3DIDA 4PVNA 4Y9FA 1TTBA 3NG5A 3CFQA 4IKJA 4IKLA 4TLKA 5IHHA 1ZCRA 2H0EA 3A4FA 3FCBA 4N87A 5E4AA 4ANKA 2H0FA 4L1TA 4N86A 3CN1A 3NEEA 1ETA1 5CNHA 3DJZA 1DVQA 5EZPA 4TM9A 3CFNA 5FO2A 1IE4A 4IK6A 4TLUA 5AKTA 5E4OA 1SOKA 5L4IA 3IMRA 4QXVA 1E3FA 1F86A 5CN3A 4Y9EA 2QGBA 3ESOA 2G3XA 3Q1EA 1QABA 3FC8A 4MRCA 3P3UA 1Z7JA 1DVXA 3M1OA 4HIQA 4DEUA 3D7PA 3I9IA 3DK0A 1ICTA 1BZ8A 3QVAA 4D7BA 1ZD6A 2G2PA 4QRFA 1SN5A 3CFMA 4DETA 3GS7A 1X7SA 3A4DA 3P3TA 4TNFA 2TRYA 1Y1DA 2G3ZA 3NEXA 4TNEA 1DVZA 4YDMA 4PVLA 1SN2A 1BZEA 2G9KA 3CN0A 3SSGA 2QGEA 3I9PA 3TFBA 3DK2A 5L4FA 1GKEA 2QGDA 5EN3A 5JIQA 2QPFA 2F7IA 5K1JA 3CBRA 4I87A 4YDNA 3GPSA 2IGLA 3CXFA 3IPEA 1DVSA 1KGIA 3DO4A 4MRBA 1E5AA 3CN4A 4FI6A 2G4GA 1IIIA 1TT6A 4ACTA 2QGCA 3U2JA 4PWGA 3DJRA 1G1OA 4HJSA 4AC2A 4TQPA 5TTRA 5K1NA 1QWHA 3BT0A 4HJUA 3W3BA 5L4JA 1E4HA 2PABA 3NEOA 2B9AA 1OO2A 1TTRA 5DEJA 4DEWA 5CLYA 4PWEA 4DESA 4Q14A 3A4EA 3IWVA 3IPBA 2QELA 1TLMA 2TRHA 4ABQA 4PWFA 4L1SA 3B56A
chains in the Genus database with same CATH superfamily
3N44B 2A38A 3D2TA 5MEPA 1L5GB 4U6HA 2YAHA 5L2JA 5DR5H 4OCYL 5HGDA 1AOZA 2AJ3A 2R0LH 2XC8A 4K7PX 4XNQB 4R8WL 4YBQD 5FKPA 5FFGA 1E5CA 2N1TE 1N12A 3DRTA 3H8NA 3VE0B 3MTRA 3MFFB 4WTZA 35C8L 5EU3B 4QJ5B 4PMEA 1NKOA 1TETH 4CA4A 4OF8A 4LAQH 3DECA 1R5IB 3QWQB 1BQHB 2YS4A 5I75C 2F19H 1IAOA 3NAAL 5C0CD 2Z7YA 3GSOB 3O9WA 3ATBA 3FQTA 4NO0D 3U2IA 1MFCH 2AJZB 4LCWE 4GW5A 3V6OC 2WXPA 2WWNA 2NY0B 43C9A 3X3GH 4WEUD 4KI5F 2QZ5A 4XWGL 3S3DB 4PJ9D 1VGEL 2WO3B 1KGJA 2ADJA 1P6AB 1N5YH 1VESA 5GSVA 2BFVL 5G4MA 1FPTL 3V6OE 1AGFA 4G8AC 1MG3C 2YGQA 2P24B 2H9GB 3A6OA 5C86A 2H32B 4GG8A 1IEAB 4XNUH 1AAJA 2D4FA 2F1BA 5E00A 3WHE0 3CFKB 4CNIA 3BQUA 1UB6B 3GGWA 4OLXL 2B3IA 1NSNH 2VABB 1HH9A 4M9OA 4E9TA 2OMUA 4LLYA 1V27A 4PRIE 3OGOE 3JT0A 1M71A 4DKFL 5KYXB 3NCYS 3UG3A 4EKXA 3G7TA 2CK2A 2GIYA 1XL4A 2K45A 1AXSB 3QEGL 4YUEH 3FC8A 3MLYH 1QWNA 1UXMA 4PJBB 4DEUA 4AQAA 2FSEB 3MV9B 4FNLL 3Q5YA 3AS2A 1X44A 5E8DH 1BQUA 5DXWA 3DTXB 3GIZL 2EQDA 4FLQA 5DU7A 4CJ0A 5IOPA 4ETQB 3S2AA 3MJWA 1J12A 2F54D 4P23B 1S9XA 4AEFA 1NUNB 4FQHB 3ULUH 1RU9H 1K8IA 4WI7A 1RPKA 3IFPB 3N40F 4MMXA 5DMYA 1FJ1B 4QF1A 3CXFA 3E7JA 1NGQL 3HG5A 2ZOLA 1OGAE 3BAEL 3LNHA 3EF7A 3FN0H 3QZWG 2WN2A 5GGVH 1CICA 2ZE0A 1TQUA 1W80A 2BCMA 3RVXC 3SE9H 5I15L 5SWQB 4L4JA 4DGVL 1MNNA 3GXTA 2X1XR 4ZMZA 1AE6H 4LE8A 3L4XA 4NI3A 2V5RA 4MMYA 4NKMB 4LQFL 4OJFL 4GG6A 3QDGB 4M7JH 2VN5A 2GAZB 2D3LA 2W95A 4UT7L 1DBML 4DEPB 4X99A 4WAFA 1YEJL 1C16A 1TVDA 2C4FT 1FH5H 1PQZB 3OZLA 1GRWA 1S9VA 4K3EL 1EO7A 2G5RA 5IF0A 1MFEL 1RZGB 2YLKA 1KBGH 1XT5A 4ORZC 4XO4A 5D5MA 1FVCA 3VFMB 5FGBA 2OTWB 3CFBB 1DYZA 3RU8L 4AH2A 3T0DA 1TTAA 2Y07H 4H26A 1G7HB 2OYKA 4EJ1C 3CH1B 4FRWA 2CK0L 1R3IL 1Q9LB 1KBWA 1CLYH 4JRXD 4L3CA 1IT9H 1YPZE 2DTMH 3DHMA 2CNZA 4ZO7A 5KBPA 4JM4L 2EDOA 3MLVL 1JRHH 2ZCKL 4WW2C 4Z3FA 1P1VA 2GY7B 3WFCL 1PG7H 5HGAB 2DWDB 4WHTB 5I0ZA 1QRND 2M2DA 2JI1A 4IGBB 2AK4E 4FXKB 2JLPA 2X44D 2R2BA 2X4SB 3N50A 4ONFL 1P4BH 4QR7A 2CGRL 2X4NB 4ADJA 2BVQA 3D18B 1CIDA 3W9EA 1DVYA 2V5TA 3SDCA 4WU7B 4PS8A 4OZIE 3H2WA 5D7SH 4AMXA 4ODWB 4LCVA 3VH8B 4I0KA 3LRHA 4JFEE 5EZJA 3RB7A 2JJWA 5ICXA 3KPSB 1KCWA 1EJFA 4N3UA 5F0MB 4EDXB 4F7CA 1K5NA 4PRHA 4WGWB 5EO9A 2G60H 4WY7H 3MRRB 4I4WB 1CVRA 2XX1A 5T1LD 1LQBC 1W8NA 3KH4A 3LH8A 4JM2C 4PG2C 4MKMA 4ELME 1NLDH 1SOKA 4K8RD 4XB3A 5HGGS 4UNUA 4AGOA 3X13A 1AC0A 4KUZH 1R4XA 2YK1L 1IM9A 5CP7B 4AIZA 1D9KD 1YCSA 4AK1A 1LEIB 1CLVA 1BYOA 3MCKB 4YDIH 1HNGA 1PTZA 1UKTA 4FTVB 5H8DA 3LXBA 1JOIA 1Q72H 3QXDA 4G7RB 4JCLA 3FNKA 5KTEH 1G84A 5E03A 1U8LA 3NFNA 1SVCP 4Z1PA 2IWKA 1WHOA 3O2VL 1VFBB 3PL6D 4YBQC 1MFBL 4LLUB 1TTGA 3I6SA 4FYSA 4WUKH 5TF1H 3TO4B 3MRMA 4PV9B 3FU6A 2X40A 2I69A 3GK8L 1INQA 3HI5H 4MCYA 2AITA 5IMMA 2H8PA 4PJGF 2E9IA 2EIDA 1CFTB 2ZUQC 1HHGA 4WENB 3U2SB 3QDJB 3PWVA 5EC1A 1U30A 2OR9L 3AWEA 3VGBA 4QEGA 4N2BA 1JCKA 3BSZL 3QUKA 4XR8C 4AYEC 4EVNA 2NY2B 2DIAA 1XBRA 4Z76B 4QTHA 4YX2L 3V4UL 1BQSA 4HCFA 2ROYA 2Y6SC 5TH2A 5DJYA 3NJIA 1YNKL 4FFYA 4UOZA 4EI5B 1G6RB 1M2VA 1WISA 4EIBA 2W0FA 4J2QA 3FQWA 1J0YA 3CJJA 3WEOA 1KEGH 2VQUA 4Q7DA 4N8VG 1I3UA 2G4EA 5J6HA 3UTQB 1B6DA 3E3QE 5I17A 2QHRL 3INOA 4FN0A 3AREB 4M8UA 2E6JA 3ZLQC 3D0LA 1A3QA 2X0UA 4G9DB 1GYUA 1IBBA 1SRDA 5H94A 2CDGA 1S78C 3KYKH 4JM0A 5EO0B 1L7TL 4KY1H 3IDMA 1KJ2B 4NJAH 1CL7L 3QUZA 3GRWL 3AY4C 4HKBA 2DLIA 2GQHA 3Q0HA 3GZKA 4NUMA 5KSAD 2I9LA 4XN9A 2BSEA 3MRNB 4NQCB 1XSJA 2DICA 1HTYA 3MV11 2BIOA 3QZNA 1ECYA 5AL8A 5F88A 1LEGB 4I13B 4GUCA 4GKZB 2ICWJ 2JJUA 1ZLWH 3VAEA 4Q9QH 1WIOA 5C0AE 5E24E 1DVQA 1WJ3A 1IAIM 2D7MA 2VTFA 2VE6A 1TJGL 3PHOB 5EU6A 2D7NA 5I1KL 1NMCB 1PG7X 2IPKA 1RZIB 5C08D 4WJ5A 2KZWA 1QSFD 3KS0J 3UGEA 5CCKH 3EBGA 3FTGB 3IJSB 2QFRA 3GTVA 3U0WL 4MX7A 4CAGA 1ZDSA 4O02B 4FHBD 1XB3A 1NMBH 2VDQB 3PHSA 2B1HH 1F8TL 4MXQD 1RMFH 1ZRUA 2VITB 3SDXB 1IKNC 3VRLF 3S5LB 3AQZA 4ATTA 4R7NA 3NIFE 2J1XA 4EOWH 1P2CB 3NJMA 1BLIA 3ILQD 5LNGA 3IMBA 3GBLA 1LMIA 3V5KB 3A47A 2JH2A 4NQEA 4GQRA 5EUKB 3L7EB 5CCHE 3HJEA 2VDMB 4M61A 2ZUXA 4Q14A 5DHVB 3L5WA 4U1LB 4GRWF 3G5VA 5IR1B 4M6NH 5GGRB 3V4VA 1ZKAA 2DY2A 3UPCA 1ITCA 4WV1A 1YAIA 1O75A 4Z3TA 1K8DB 3L16A 1GKOA 1QYGH 1ZJBA 3WNNA 3VFVA 3T0BA 1XF3B 5CR1A 1NC4B 4WI2A 2RTTA 3IJHA 3RPIB 1RZJH 4IBZA 2FLMA 2EYSB 5GGTA 1IAIL 4G1MA 3ZW3A 4BWTA 1G9ML 4PJEA 4Z7WB 4BFOA 1T6VN 3JWNE 3ZSSA 2CQVA 1B0WA 1IBDA 2Y06H 4KKNA 1N8OE 1H15B 2GJJA 2X6CA 3NRFA 3ZKXC 3LQZB 5JO5A 1UWXH 5A16A 1F42A 1FRGH 1X7QB 3H7BB 2NOYA 3JVGC 4AYID 1SOQA 3TEYA 3P4MA 3EKCA 3GXDA 4JKKA 3SBPA 1OY3B 3FUIA 2DBJA 3KDMA 1B6UA 5FWRA 3HZKA 4ZW7A 1CQKA 2E47A 2FLBT 1AS8A 4PRPA 5FW8A 2GB2A 1GZPA 4H40A 4QRQA 3RDTD 4P9HL 4K8RC 1EH9A 4JN1L 3P4OA 1A4BA 1ZV2A 3VDCA 1BZ7B 1HIMH 4ODSH 5CBAA 2V33A 2CA4A 2ZUUA 5I1GH 4KWUA 3BCFA 4RAHA 4HZAA 4YHYB 3OHMB 1NOAA 4MNGA 4Y5XA 5HYJD 5BMFH 3MRFA 1KT2A 3FUKA 5MEOB 4E0RA 1Y6KR 1IC4H 1TTBA 3JWDL 1FZJA 2NMSA 2X42A 1RJYA 1F58L 1IKFL 5GGUA 2DM3A 12E8L 1EHKB 3Q8CA 5EEWA 4PJXB 1XGPA 3K74B 3T0EE 5K59E 1DANU 1JHLL 3QEUA 5L0QB 3PY9A 3ZSTA 1BVLB 1WQVT 4N2AA 3BHBB 2XRAH 1OOAA 1GYAA 5JPNA 1NFIA 2JCCF 3O2DL 5IROA 5GRVL 5J3HD 4FQCH 1MPAL 2CKBH 1N3NB 1J8HA 3BVUA 3RGHA 4G2AA 2BERA 4PH8A 2Y2WA 4M1GL 5DRXA 3ETBF 4YDLB 3U4AA 3IS0X 4FQXB 5BZZA 3W81A 2QEJA 3WN5B 1TKWA 3UACA 4PJFB 3QNYA 2IGLA 4XPHH 4ECNA 1WZ1L 2COQA 2BCKA 5JR1L 2QSTA 4HAGA 4BSVA 4X5XA 3HW7A 2AQ1A 3BOVA 4XC3H 1FFOA 2FYYB 3TZVC 4N24A 1QWHA 1UUSA 4HETA 4AMKH 3GJFB 5MERB 1MVFA 1U8MB 4NUQA 4J3OG 5JNYA 1BBJA 1Q9KA 3HN8A 5LCVH 2FECL 2OULB 2NNRA 3OKMA 5DUBB 3RURA 1R3KB 2L8AA 3FT3B 3G6DL 4HG4K 4ODUB 4PW9A 4KVPA 4M6OL 2GJZB 3KR3L 1LE5B 5L2KD 4PVBA 1NBYA 1URIA 1KIUB 2QKSA 3U25A 1MCBA 1I9RL 2QDWA 2UWEF 1QAWA 3U1SH 1XGUB 5IB5B 4KJQD 4ZMPA 1N64H 1JDCA 4HS8H 2VLJD 4UV4H 1LO2H 2VDRL 2PPFA 1K72A 2P5WA 2R39A 3VWKA 3Q5TA 5AYTA 1E43A 1MWAB 3EF4A 3WHE1 5DJXA 1EXGA 4MCZA 1M6OA 1DVFB 4Y5VB 3F05A 2F74A 1FL3A 1D5ZA 1U8CB 3HMWH 2IGFH 2CU9A 1W0WB 5JHMA 1BQLH 3FSOA 5ELIA 3VFPB 1NIAA 1RQ5A 4GINA 4NHUB 3V6OA 1WS7A 2AQQA 3APFA 4ZK8A 2Y3NA 5FB8B 4F24A 3NMEA 1KGCE 2W0KA 4X9GA 5GGSY 3FRPG 1S4IA 1AO7E 3RFZC 5CGTA 1II4E 3MNVA 1UXSB 4PJ5D 6PAZA 4JO8A 1CFSA 3GBDA 4Q9RH 1I7TA 1ESOA 3SHSA 4MA7H 1H9VA 1TSRA 3VFNA 1L3NA 3OAYK 1OZUA 2WCGA 4JVWA 4A68A 1MH5A 3CN3A 1UC6A 1XFPA 5IHUL 1UURA 1U6AH 3MLXL 1ZWIA 2CKBA 3FBQA 3LKRA 3SYQA 3UTSA 1HEZA 3OKEB 1HH6B 4O51B 5CD5D 4L1TA 3BPNB 4NC1C 5CMAA 5T1KB 4AKQA 1M4KA 1JK9A 2IGTA 4XGZA 2H45A 4X5RA 3OB8A 3TNMB 1UM5H 2ZUWA 3UMNA 1ZMYA 4LVOB 4NC1E 2CXGA 3U46B 5BRZB 3VXSB 5FO9A 2H3NA 2QR0B 2ZOOA 2UXTA 4UIKL 4TSCH 1X7SA 4LEXL 4DAGH 1S7UB 4Q9BA 2HN7A 2OCJA 1JNLH 3EOTL 4OB5L 3CFCH 2I32A 2A6KA 3ZMEA 1MAJA 2UY7B 3I50L 3MC0A 1GKEA 1RK1A 4AYFB 1BAFL 1OGAA 4W9ZA 4GLRI 4U7SA 3ZBMA 3RPBA 1Y07A 3ZMNA 3SDYL 4ODHL 4CDHA 4LVNB 3ILPB 1F18A 4UNIA 2IDSA 4UIMB 1RERA 3PWUA 4YWGH 2FT7A 3E6FA 5IB1B 3V5HB 3AG3B 5IFJB 4H88L 2BVPB 4I77L 4DEWA 5E6YA 2OL3B 1NUDA 1KNOA 1LXMA 3TT1L 3HUJF 5A7BA 2P5EE 4L0PB 5JUEH 5DHXB 1TQTA 3MGTA 2FT6A 2EDJA 1PZSA 3ULVC 2H6PB 4BZ2H 2ORBH 5EU4A 2MPAL 4UQBA 3EO1B 3QUMB 4GP4B 3QDMD 1CG9B 5AB0A 4AWJC 1QRKA 1AY1L 3RDTC 4MD5A 1U21A 2VZUA 3N2JA 4G3YL 5F7KC 5CD3B 3ULVE 2G5UA 3LPFA 4NN5B 1ZHKB 5FM8A 1YJDC 3GNML 1KN2L 3DYMA 4B9KC 4HZLB 4C59B 2IALB 1ZGLB 2VDOH 1N0XH 4X6CE 3UCRA 4L3EA 4ALAC 2PW1A 1UEYA 3SODB 3ZZSA 2ZWZA 4P4KD 3H9ZA 1E6OH 3PAZA 2J20A 4ZO9A 5CEXA 1NPJA 1BW8A 1KMGA 3NH7L 3RNQB 1CDBA 1V3LA 4AYMC 1A6AB 1FFTB 4F1ZA 1W2KT 2NZIA 3C5XA 3L3HB 1SJHB 3V0VB 2XBTA 1JGUH 3GSXA 4OZIA 2AZUA 3HLAB 2BSRB 2YMXH 1M7IB 3F5WB 3PGDB 2WWOA 2VCOA 3IGAB 4JFEA 5HDLA 3LYRA 3UAJA 2Z4QA 1HEJC 1YYML 5DHYA 4Y2LA 5D7IF 1AHMA 5GS0C 1R3LA 4Z78A 4Q0XL 1Z9SA 1U8NB 1E9OA 4FQLL 3ALPA 3DX9B 1KBBA 4TV3A 4NO2A 5F89B 5F0LB 3DJ9A 4A7GF 4F92B 4Z7VB 1I82A 3ZDZB 3D1MC 4JR9L 4KK8D 4JM2A 3DWTA 4PG2A 3ECUA 5CINH 2QADC 1JV2A 3F6IA 3FQNB 1ZSHA 1QOKA 2B0SL 3FU9A 4TTDD 5F7FA 4FNQA 1J5OL 2CDFB 4RFNC 3BUIA 3MRHB 1ES0A 4P9HC 4NKOB 3U79A 2JIXB 1A5FH 1WFIA 3DA0A 4CADA 4FYTA 1K5WA 3TVMA 1XAUA 2EEBA 35C8H 3P30L 3MRJB 1MXGA 3QK0A 3HNTL 1NAMA 1WT5C 3WLWD 2PO6D 4BH7B 2G5BA 4XP6L 5B1JA 3V0WL 4JFPA 3IETA 2CLZB 3E0GA 4HEPG 4D8PA 2IMMA 3IJ8A 4OZFH 3O3AA 4XWGH 2F5AL 3T3PE 1VGEH 2YOAA 3QDGD 5JQIB 1YDPA 1CBJA 2R15A 4RQQB 5GPRA 2BFVH 1WPCA 2V9TA 1FPTH 2QVTA 2YAEA 4GQQA 4ENED 4U0RB 2BXYA 3S6CA 3M1CA 4OCWL 4HOMA 1CVSC 3C6EA 3WS3A 1RI8A 3D05A 5C0CA 2CA3A 5AENA 3PABB 2P8PA 1XF5B 2YFOA 4G6ML 3IMSA 4NO0A 3V6ZB 4ORGB 4GUPB 3QEQD 4YGAB 1D5RA 3MNZB 4PJ9A 3I6KB 1KFAL 3BUQA 3EFDL 2C7UB 3VD1A 4GFTB 1PZBA 3MFGB 5C6PB 2WWKO 4HIPA 5LG1A 4X5LA 4F7EA 3X1NA 3QHZL 4GKNB 4EPSA 2IFFL 4GLRH 3D39D 1SN0A 3EDKA 2RR3A 1WC7A 1MJJA 4QRTA 4IGBD 2W9DL 1C9SA 1YQVH 4WGKA 3O6FB 3Q3GB 3V52H 4AW4A 3FU8A 4U0QB 4FYRA 3GIZH 2GVYA 4Z18A 2JQAA 5CSGA 5DD0H 4KZEL 3C09C 3N41B 5DK0A 1RP8A 3BP5B 5IQNA 3MI6A 5ENWB 1WCQA 2V7HB 5FYLD 1BMWA 5K69A 1J1OL 1NBZB 2A77L 1WTLA 1WZAA 3BKJL 4GT7A 1JWSA 2PF6A 4V1DD 2R59A 3P11H 4AJVA 1MLCB 2ZKMX 1NGQH 2OMVA 3KPSD 3BAEH 2OCCB 1DQTA 2PYFB 2HKFL 5FW6A 4MVBD 4O58L 3TCLA 5FM5M 4M8QB 3AAZB 2EC9U 1A3LL 1S5IL 2R23B 1G6RL 5E4AA 2DLEA 1LTXA 1N5AA 4JFXA 4Z0XA 2F54A 2EUWA 2FH6A 5AD0A 4NQSB 4ONGH 1DBMH 2AEIT 5GISL 2NXYC 3BH9A 1OPOA 4M7ZC 2XETA 2DF3A 4ZMQA 3QZLA 5DUPH 3RL1B 4K3EH 1P6FA 3IE9A 4L37B 1MFEH 3MKGA 4M48L 3BAYA 3E8UH 2WZ5A 4OD1H 2DQGH 3KGRA 4P46C 4JG9A 3RU8H 2BVEA 2H26B 4MS6A 3H1ZA 4KKQA 3BN9C 3DIFA 3BP4A 5GS2D 4XN7A 2BOBB 1KJ2L 1NGYB 3B4NA 4HBQA 5CJXC 5KSVB 3V55A 2ZXGA 4WFFD 1F4WL 3EDDA 4HJGB 3MLVH 4DP8X 1U33A 3VXNB 3QP3A 3IPEA 3QWNA 5C7ZA 3WMQA 4D0BA 4XMWA 5DEGB 2FD6L 3WEBA 3TURA 3BKYL 1Z9MA 3BUDA 1FA4A 1IKNA 1IE5A 1IL1A 1WG3A 1ZTXE 4RETB 4KXAA 1I9JH 5IK3B 2CGRH 2GFBB 3ZRSA 4ZDHB 3OZ9L 4ZUTA 3QDJD 5I8OH 4IU2B 2NY0C 4JRXA 3V0GA 1T1XB 4QHKJ 5F1IB 3U7YH 1N7ML 5C0RH 2AVGA 2NY2D 4PEEA 3U30B 2A5UA 1T66D 2FL5A 1IGFL 5CZRA 5HTSA 1LK2B 4RWHA 4XO5A 2DQJH 3W11D 2ATPB 2QTVA 4N20A 3TIDA 4O02L 1QRNA 1AD9A 3L5JA 4NC0B 1FH2A 3VYPA 4E42A 3AB0B 2VDQL 3RZWA 1B0RA 3U82B 4BE5A 5BVPH 2HMID 2X0WA 4N2NA 1JV5A 3AZUA 4JFFD 4OGYL 3D50A 2NZ9D 3HZMA 5E1AB 4DWHA 2GK2A 1SDYA 4OF3A 2YK1H 4OIAA 1EIBA 3DX6A 2BW5A 2WZPD 3DGGA 1XR8B 5T1MA 2Z65C 3EJYD 2VDML 1GW0A 5JPMB 4BA8A 3JVGA 5E8PA 4NS0A 2I7OA 2YAPA 3BCDA 2APSA 2EC8A 1RUKL 4KK8C 4KJWC 5T1LA 1DE4A 4HGWA 1SBBA 3FQ1A 4I9XA 4WTZG 4S1RL 3L81A 3TO2A 3OQ3B 4U1MB 4PJBE 1KCLA 4TTDC 4P23C 2WSPA 3MV9E 4I18C 1D9KA 2FH8A 4G42B 4H0HB 5HJ3A 2EVIA 1V3MA 1CB4A 3BEVA 2NSMA 3GK8H 3KCWA 3QG7L 5DQ9B 1ZLVH 3GZOA 1MLBB 4ICWA 5DO2D 3UX9B 5L9DL 5DZLA 3WLWC 4C56D 1YEFL 2F9BT 3O4OB 3WELA 3F7YB 3T2OA 3C12A 4I2XA 2FJHA 3D7PA 3BSZH 3PL6A 4QT5B 1L9QA 3S48A 4L05A 5J6SA 4JVUA 4DEPC 3GS7A 3LEXA 5DQJA 3KJ4B 3W39B 1PNCA 5IEHB 5J6GA 1PYWA 4MAYB 3GXIA 1YNKH 2ENSA 3BWZA 3CN0A 3TPUB 3QDGE 5KYWA 1PZUB 4TNVK 4ZXBD 3V5DA 2BWDA 3O11B 3LIZL 4K4KA 3RVVD 3RDJA 4OUOA 1CE1H 4J1UB 4GXUM 3CLEH 1G7JA 2OFQA 3BD4A 2XQYA 2V3FA 2YD8A 4PGEB 4BFFA 2BSSB 5IFHH 4KKRA 3CFDB 3INUH 3A4EA 3MREA 3ZDWA 2EIMB 3KHQA 4U2YA 4YZFE 3GRWH 5K9OA 1E4JA 4IGBC 3NCMA 3D0AA 4GMTH 5IESL 5CP3A 3MBEB 4EBQL 2QQLH 4G8GB 5I1CH 1KLGB 1DQKA 4N2OA 3MJ7B 2AK1L 3P0YH 2NYZA 4F37F 4WI9A 3RWJA 4J39A 1L3WA 3B9EA 5F3HB 2BNQD 2GBAA 3HG1B 4NQXB 3UP1A 5KYUA 3OGCB 4FFWC 1U3YA 4I1RA 3V0JA 5KSAA 2A4CA 2CWRA 1E2ZA 4O2EA 2ICCA 5LWYL 2B8OT 2L7JA 3C75A 3MDJA 5BO0D 1AO7A 3KPSE 2WUBL 1I1AD 3ULVH 3L1OH 1GJIA 5AVUB 4WSJA 2VDNB 4I9WE 1FGVH 1HI6A 3BN3B 4Q52A 4GSDL 1VENA 4V2CB 3T77B 2AANA 3RFZA 5ICZB 1BDYA 4N85A 5ESQB 5FXCH 4AEHL 3BVNA 3KYOB 1F6AB 1U95A 1K6QH 1YJDH 4YHNA 1NCWL 5JHDB 1GJUA 1SNRA 2R8SL 5CEZL 4G7SB 4R2GB 1QSFA 4ALAH 5IY5B 4FTVE 1ZS2A 32C2A 5F71A 2WYIA 1Z9OA 4BGLA 2ZKYA 4XVJL 1W8OA 1UQSA 3MSPA 1T83C 3LNGA 1XCWA 5ICUA 1BG1A 4TLUA 1LVEA 3QXVA 1PFCA 4X8JA 2W07B 5H35A 4NO5A 4Y2DB 5KVFH 3AMLA 1WAAE 2VQTA 2FBJH 4ENZA 5DYOB 2MH4A 3DK0A 4FFVD 5DJDB 4OLEA 4LU5L 4RMVA 5LKNA 2GITB 4FQXD 3V95A 5BUGA 5GS0H 1VCBC 1IAIH 2C34A 3S34L 3F7VA 1JYVA 4BHUA 1R75A 3EYVB 1IEBA 5FV1L 1A1OA 2NY2C 3BW9B 1PD0A 4NNXA 4UQDA 2IANB 5CEYB 4ZMWA 3T6XA 4DP0X 4XAWL 2VXQL 1KGIA 3QDJE 1E4WL 1YMMB 1UOKA 4NQDB 3CSGA 4HSCX 1QNZL 1DN0A 2A83A 1EXUB 4EI5C 3D69A 2KZBA 2IPUK 3QJZA 2P5EA 4MB4A 3IDNB 2WNKA 4PWEA 1DQML 4RBPK 4P9HH 1IBYA 4A7SA 4FNTA 2O6DA 3HVDA 2NZ9C 4BQ9A 2C9UA 4LOUD 3CSFA 2CBOA 4XX1G 1BMZA 5DZPA 5KUMA 1Q4NX 3AREC 4CDGC 3QWOA 1EMTL 1MW0A 3EJYC 1E8YA 4IW4C 5E4IA 5FEBA 4BFBD 1MIEH 4L23A 4JFZL 3JWDH 4OQ1A 2IOIA 4L8CA 1OCCB 3KL5A 1KF9B 12E8H 4OZ4B 2WB7A 2WKOA 2DL9A 3PWJB 5CUSL 2NQCA 3TESA 2KUTA 5J1TC 1TYRA 3RDTA 3BZEB 2EZ0D 1ED3A 3QXAA 1JHLH 1V8HA 4LEOB 4RRPM 3EYUL 4F2FA 3AQYA 4EE2A 2DDQL 1Z0NA 5FKAB 4NQCE 4D9LL 1A0QL 1GZHC 3RWFB 5HYJA 1ZT4A 2Q6WA 2OL3L 7FABL 2NUPA 2BPBA 4HGMA 1AGEA 1NMCC 1E27B 2G2RA 5DZVA 5DD3H 1XB6A 1NEZB 1RULH 3S5ZA 4CVXB 5HHPB 3STZB 1EEYA 2Y1VA 2V9RA 2YD9A 1ETB1 2Y24A 1ID2A 4GMSL 5GJSL 5JR1H 1QLEB 2R69H 1RZ8B 1DQDH 5K9QI 3L4UA 4PCKA 3PJSB 3ZKSD 1IFHL 5T1KD 2XN0A 3JQOB 2I27N 3REWB 4AYGA 2A6DA 3CSBA 3MNMA 4L5FL 2WINB 3K5RA 3R7RA 2CR6A 2QVFB 1KTLB 3TBBA 4M6OH 2FT8A 3VFRA 4ELKB 2XYBA 1DBJL 3MBWA 3SDXE 2MQCA 1NCBL 4Z7AA 4JPKL 1MG2C 1T0MA 1I1YA 1Z7JA 1R24B 2BMKB 2O6FA 1FFNB 4ZI8A 2VOTA 2PLTA 1JZJA 1YMHA 3IXTB 4NUGH 1UB5B 1HVXA 5F1SA 1JGDB 3DUHA 5HVWA 5I19L 1USZA 1JZEA 4UV7L 4NWTL 2J5LB 4TNEA 1OAKL 1F4YH 3R7QA 5T3XE 4OD3H 4P3DB 1ZHBA 2WHVA 5KEZA 1JWUB 2IBZY 5JYMA 3RVWC 2F7IA 2E7BA 4OM1L 1WT5A 5J1AB 2G9HB 5L2KA 3C2AH 2ZJSH 5DMKA 3KPNB 3P77A 4LHQB 2B2XH 3VACA 4G8FA 5C71A 3GYRA 2BVOA 3LNIA 4ZUWB 3FU5A 4YXHL 1ZT7B 2VLJA 4L2YA 3UOAB 1TCRA 3MRPB 3T1WA 4Z7WE 4R83A 4XHQA 3FXIC 3SYAA 1E7UA 4PY7B 5F93C 3RTQB 3IMTA 5FYKD 2NRDA 3WAJA 3VRIA 1DVUA 1DBBL 4DP1X 1TMCB 2YWZA 5AW0B 1ZTXH 1H6UA 3KPOB 1CDUA 1WFUA 1XH1A 2ARWA 2X2HA 1ZS8B 1IGTA 3P9MA 2XWBA 3QSKB 4TULH 3VGFA 1F90L 4U1KB 5ADPL 3T2PA 7PCYA 5C0ND 2P48B 2AMUA 1GAFH 1VSCA 5IHLB 4WTXA 3X11B 3ARYA 4JDTH 3HZVA 4BCYA 4YHYC 3U7WL 3VQ1C 4PJ5A 4R4BB 3R4RA 1ROWA 5T5FH 4B9ZA 1XGTA 4DP5X 1P1ZB 1FDLL 1MHPL 1P7QB 2R69A 3ABLB 1ND0B 1JGVL 3IFOA 4JO3L 5FO7B 4E41B 4ZFFA 3HIZA 1U91A 1TZAA 4FNRA 3FQXA 1NDGA 2IBZX 4UIKH 4LEXH 4HK0B 2KPNA 4LSRL 2HT3D 3TCTA 1I3GH 3HCVA 4BFJA 2CPUA 2H32H 3GC3A 3ZGIA 4MS8D 4CGTA 1G7QB 1BAFH 4E5XB 4H1LB 3NCXA 3CDYA 1TTCA 3B7YA 4TNGA 4POUB 4O4YH 4FFVC 2C3WA 4OIIH 3GSVA 4ODHH 3PFUA 5LXGH 3K72B 1OGPA 4YDLC 1QBML 2OMZA 2ZD0A 3DGCR 4FQXC 2E9GA 4PVNA 5IV2B 3L3JA 3IJ9A 1N4XH 4H88H 4N87A 4R90L 1VEMA 4K5PA 1R9FA 5ISZD 3IDXL 1F3DJ 2IAMB 1Q9WA 1BXVA 1PJ9A 4JRYB 1RIUH 1OT2A 3IMRA 4YHOL 5E2WL 4LLDB 3WTTA 3QCTL 4PJFE 1IBGL 2A9MH 2EDBA 1XGQA 5FECA 1MRCL 3NJKA 3UDWC 4EZLA 2BHZA 3TT3H 3TBVB 2JB5H 5A2CA 1OP9A 4RNRB 1GJWA 1LHZA 4P3CH 2X6MA 4P46A 1AY1H 2G3ZA 3GSUA 4PJ7F 3LZPA 4G3YH 1KB5H 3KYMA 3IDUA 2BP8A 1I4FA 1OF2A 4P05A 4KHTH 4OFYD 4WCYH 5EBMA 4HIEB 5JIHA 2UXGA 4UTAH 1KN2H 4QJ4B 2OSLA 2VWEC 5E8EB 3CSPA 5F7UA 4N0FB 5CJXA 1J0IA 1PG7W 2Y72A 4FNUA 1O7SA 4PJGB 3WV0A 4HFUH 4POZD 3FH8A 4KKLD 3QO1A 4FYQA 3MLRL 4JPIA 4YHML 3VE0A 4R4ND 1PD6A 3K1DA 1DVFC 1OAQL 3QDMA 4CMHC 4Y5VC 3IDJA 2CKNA 1C5BH 2C26A 3H2QA 4E9SA 2R0KH 2EZ0C 5J4MA 3GSOA 3Q01A 2NQDA 4CBZA 2AJZA 1O6SA 3WNLA 5E2TL 1RJCA 3Q7JA 1U8JA 4AI7A 2VM3A 4FXTA 2FX7L 2ICWB 5GXBB 1YYMH 2W80C 1YNTA 3ULAB 2APFA 1MHCB 4NOFA 5E4EB 5KOMC 4P4KA 3VGEA 4FQLH 5KVDH 2F8IA 4XC1L 3TH2T 1U3HB 4WIQA 5INCB 4NN6B 2DLHA 2FZ3A 3QQXA 3TASA 4WW1A 1JZ2A 3CFKA 3MGAA 5FWQA 3VI4F 1KJVA 1SLXA 1UB6A 3B3IB 3I84A 3CC5A 4KNSA 1FE8H 4N6RA 2AXFB 5A6IA 5FDWA 3LSOB 4MSWB 4HW6A 4ES9A 3BPNC 1IAMA 1IQWL 1UH4A 3QRLA 2L04A 3IDGA 3Q2WA 4Y4KB 1JF1A 1KDJA 2PCFB 4NPKA 4OGZA 4OLUL 1KY7A 3P30H 4LVOC 4OZHF 2X9YA 4ISVA 4NKDA 3SOTA 4PB0L 3C60D 1G5GA 1FHNA 5IVZB 2H2SD 5F9OL 3OR7B 5E08L 2ZNWA 4Y4HB 5IMKB 3V0WH 2R2EA 3MJGX 5DZAA 3FB8A 4E9YA 1G9HA 4X6FA 5BRZE 3VXSE 1ZLWK 2PWEA 2F5AH 3RGVB 2N3JA 4L29B 4ZJ9A 2YXWA 4ETQA 3Q44A 4I18A 4XCEB 3HBGA 5MHSE 1KB5A 1PZAA 4MWFB 4ZSOB 5DRNA 3PV6A 1P53A 1SHXA 3DV6B 4P48A 4UTAA 3IU3A 2JQZA 2PO6A 5I75B 3BVTA 4JRFA 4ZMTA 3JV4B 4H25B 5SWQA 1HDMB 1AC6A 4G6MH 4DUVA 1L9PA 1AS6A 4OFVA 3GO1L 2ADFL 1HZHH 5AAMA 4QDGA 4GI9A 4Y16D 2XKNB 4OLVL 5ANMA 1KFAH 3EFDH 3QDGA 4FQ1L 3MR9B 4FQJL 2GAZA 3NABH 1LJMA 3KLKA 1I7UA 2Z92B 3LVTA 3CMGA 4XBGB 5E6IB 1PQZA 1PDKB 3QHZH 1FHGA 2WZAA 4HIHA 4HLZH 4K71B 2Z31D 3KYNA 4M5TA 5E7FA 2KZ1B 5EBLA 4GRWB 2AC0A 2CUHA 2YD4A 2W9DH 2OTWA 1R3JB 3OKNA 4WSKA 3SPVB 2ZOKA 4MJ6B 3QR1A 4WHCA 2UZYA 3L6FA 5C0NC 1IO4C 1BGXL 3ZYJA 1MRFL 2Y7QB 4AC2A 3QEQA 3GWJA 4YL9A 4ZUVA 2MCMA 5HBBA 1U8IA 2PABA 2WV3A 2EIEA 4MDJB 1URLA 2PP7A 2E0PA 3QIUB 4FEMA 2CBMA 2N4IA 4F33B 4M5SA 4PWFA 1FFPA 1J1OH 4ZZFA 2A77H 2MEJB 3TWYA 2QSCL 1WUNT 3QPQD 2DWDA 3VXMB 3D39A 3BFWA 5GRXG 3N91A 1I8AA 1QI5A 4IGBA 2XQBH 5HPMB 2PWDA 2X4SA 1AS7A 2DQFB 1VFUA 4KBPA 5DHDA 2IIJA 2XNAB 1A3LH 1RUQL 1G6RH 4XXDA 5JOFA 3GS0A 4MS8C 4N9GB 4GFXA 2VMDA 3N04A 1UWXK 3KL0A 1ZLSL 2MHAA 4DO6A 1C5CH 4HWBL 5C09D 1LNUB 2C9RA 4V1DA 1JPST 3W9DA 1THAA 2J6WA 1NBVL 2JE8A 2B1AH 3EOBB 3KPSA 4M48H 4Y8AA 1OZTG 3VFGH 4LLWB 5AEAA 4D3CH 3PDDA 5ITBL 4XMKH 1Z3GH 3TBYA 5HY9B 4WNQA 1A9BB 1BFSA 2FRGP 1ONQA 4BFIB 3GUTB 1NCDL 4QKXB 3E38A 3S97C 3KWXA 3R8QA 3ZDZE 1S9KC 4K3DL 3DVIA 4Q56A 3K81A 3MCKA 2J88L 2C3VA 2P80D 3WFZA 1TENA 2D2CC 4NQVA 3H9HA 3OXSA 5DHMC 4U6VH 4OKVA 2JCCB 1GOFA 3A4FA 1A3ZA 5IM7B 1ZIBA 2IOMA 3Q2NA 2A0LD 4OLZH 4X42A 1FZOB 1QTSA 3GMNA 1VFBA 1MI5B 4POZC 1T83A 1JWMB 4KKLC 3NSDA 1G43A 4YOKA 4YHZL 3ARTA 4LCYB 5C0EA 3QJTB 3KLQA 1G7IA 2DQTL 2F68X 4R4NC 5HI3D 2QFPA 4LLQB 4O02H 4RGOL 3HS0A 5FGCB 4K94L 5EZOL 2ZPKL 4EN2A 2VDQH 3CDZA 1ACZA 1MCPH 1PU0A 4LPCA 1YY8B 3SD2A 3LKOA 1XCTA 3U2SA 1MCLA 2DQIL 4R3SB 4P2OB 2XKSA 1UZGA 3QDJA 4PHZA 2VAAB 1EDQA 1ZOXA 4X7TB 2DLFL 4XAKE 2IEPA 1FNFA 1NGWB 3MA7B 3WTWA 5EC2B 1DLHA 5EOCJ 2A9NL 5K33A 4I7ZC 2VDMH 3BAKA 4GAJH 5T3XH 2UWEB 1E8XA 4MXWH 2OYMA 3QDAA 3WL9A 5HSFA 1J5DA 3RJDA 3FTYA 3FQRA 3L2MA 3O6FC 4K2UH 4UDUB 2XX0A 3G6AA 3BIAX 4M93B 4L18A 4JFFA 4HQQH 2YAOA 4G8GD 1Z9PA 4JPWL 1QATA 5FAAA 4BINA 3UTQA 2YD1A 3T2NL 3K7UA 4PJAF 2DQDH 1K4CB 4N0YH 4PU2A 3HI6H 3RG1C 1VIWA 1E42A 1RFDL 2J71A 4FP8L 3VCLA 8FABB 3PHQB 3GMPA 5C6WH 3S8GB 2JB6A 4B9FA 2GEEA 3N42F 3IAGC 3C60C 1SJMA 2H2SC 5DUML 3VSUA 3OAZH 2W5PA 3K6SB 1HFUA 2CBTA 5JMOC 3VA6A 4HPHA 1BXAA 3C08H 2Q76B 4KTGA 2FWSA 1LEGA 1JXJA 2UY6B 2HVBA 3UADA 1KCKA 5AOMA 4IIZA 3ME0A 2J2ZB 4R7XA 1NZRA 2PTVA 2W1NA 3MTXA 4CW1B 1S7XA 1BCIA 3QJHA 1I1FB 3AU1A 4B6ZA 3PPEA 1UFUA 3TN0B 3GLZA 1NDTA 2BW4A 3DX4A 1YVLA 2N0MA 2AGJL 3PJLA 2W65B 3I9GH 1RZIA 1I7RB 1SJEB 2IXQB 3DOIA 2FQDA 3IWUA 5C9JA 3LIZH 2YQ2A 3V7AE 1FO0A 5HYSB 3GXNA 3KM1A 1VZIA 3QIWD 3VB9A 4HCIA 4BFEA 1VERA 1A1MA 4PTTA 1SLUA 5AW5B 3IRPX 5AUMA 2Z31C 4AIOA 1QUPA 5KAQG 3BX7C 5L4IA 4ZXBA 1N2RA 1TQBB 5AVXB 1CI3M 3S5LA 3QG6B 3GI9L 3SKOB 2K7QA 1P2CA 3ZL2A 3CXDH 4MQ7B 2VXSL 1RIVL 2EADA 2PN5A 4BQ8A 2FUTA 2EH8L 2VMFA 3TF7C 4AM0Q 5IQ7L 5I82A 3RBGA 4R96B 4U1LA 2PYEB 4DVBA 4KJPC 3U30C 1U3JA 1XZWA 2ADIA 4N2EA 5DEZA 3QPQC 3AXLA 1A64A 1XQ4A 4GRLB 1T3FB 3HUJB 2FO8A 2BSBA 3W5MA 5D7LB 4U49A 5GGRY 3AB0C 2E7LC 5JYLA 3GSRA 1HHIA 1XF3A 5A3ID 3L1FA 4H8UA 2KMWA 2VISB 3MAWA 3GJFH 3U2JA 2EYSA 3VFSA 4XN2A 1J5HA 4TQPA 4Z7WA 2WUBH 2ISDA 1DBAH 3CU7A 2B9BA 5DC9B 4XXWA 1W16A 2YQBA 1D5MA 2NT1A 1E9PB 1WAEA 3CFEB 4JKNA 3HBQA 2CO7A 1DEEB 2BNQA 5BRPA 4YN3A 1MVUA 4IKIA 4B53A 4DF9A 2JFCA 4S1DD 1VEOA 1KXQA 1M05A 5E5LA 3C5JB 4I85A 1RHHB 5SWZB 2ALAA 1UH2A 2IDQA 2YC1B 1A4KB 1HSAA 1MWAH 1I1AA 4MJ5B 3OLDA 4FMVA 4EQ2A 1RPQA 3FOMA 3QT2A 4R4FL 4XVJH 3DJSA 4ZUSB 2LW3A 3H0TB 3K2IA 1JNNL 4HXAL 4DHLA 1X5KA 2F2HA 3H4HA 1J9RA 3FQ2A 1JMZA 2WTPA 4AQ1A 1G9EA 5F6HJ 3BP7A 2PR4L 1E9QA 5DFVD 2Z3FA 5MEOA 3BZ4A 5DSCB 1VRSA 4P2RB 4Z77A 4OQTL 1IC7H 4C83B 3PWLA 4NZRL 4LU5H 5HJBA 5D7IB 1YZZA 3S34H 4N8CH 4NP4L 4XVTL 4J3OF 3M46A 1OB0A 5DVLA 4V11A 5J13B 1CK0L 2Z7ZA 5ESAA 1NWPA 2ZKHL 3ROOB 4X6DA 1P4LA 1CGVA 4YBLB 3U4EB 1J0ZA 1ITBB 1A7RL 1HNFA 1U58A 1JZ5A 5FA3A 3ARDB 3KJ4C 4TSBL 4XPGL 1VFAA 5E2VL 3BE1H 3BWAB 2P47B 4G1EA 4M9PA 5BV7B 4NKIL 2O61A 1HU8A 3WY4A 4Y4FD 4ODVH 4FQXA 3X1GA 4WTWA 4P5RA 1DQMH 4X9FA 3F01A 4HJJH 4PJFA 1A6WH 1LO4L 3WFBH 2GTZA 2JWYA 3KPQA 1UJ3B 2FQGA 3FQUA 3O3DB 5L6YL 2XV0A 3HMXL 4YXLH 1ACYL 2DV6A 4FF9A 2OJEA 4LRNL 3PP3K 5MERA 1U8MA 3QUYD 3FTXA 3MV7B 3CFMA 3BAJA 3UDWA 4QRSA 4JN2B 4JFZH 3FT3A 3VNZA 2AFNA 2XQ0A 1MCOL 1AYRA 1T4WA 5CUSH 1Q8MA 3ES6B 2QPFA 4YHKL 3WDIA 1L9TA 5TF0A 2XV6B 3VG9C 3VNYA 3BP6B 4G8GE 4QLWA 3D3VB 2Y5EA 3HZYA 3OMNB 2K3TA 1HJCA 4WHYG 3RKPA 2OL3H 1MREH 3PREA 7FABH 3E6HB 4QRRD 1MWAA 5JORB 4XP5L 4QHMB 2PPAA 3HS9A 1WD8A 3IPBA 3GUFA 3TFKC 3UIZA 5GGQH 4ODXB 3HG1E 5TDPB 4JRLA 5FGSA 4DQOH 1QO3B 1E2VA 2IBBA 3DYOA 4HH8A 3QUMH 4MJIB 5HJGA 4W9FC 5LGHH 1LO5A 2XPGA 4K94C 4BK5C 1J1XH 1SEBA 3GXFA 4OFQA 4TKWA 2K7PA 4BQCA 2MSPA 1UXSA 2EXWD 3SPCA 3GI8L 3MLZL 4I5BA 1FORL 5I16B 3O41A 1WWWX 1X9QA 3UAAA 5HHVL 3KVPA 2Q7AA 4R2GC 4Z8FH 3GD1C 4Q4EA 4E41D 5FR3A 2APXA 1RJZB 3O8XB 1GOGA 1DBJH 5AKSA 5I1DB 1NCBH 2Z0BA 4JPKH 4JY4A 5JHDE 5K39B 4K9EL 2VZ1A 3N0AA 4HDIB 3BKML 5BVJA 4M7LT 5T1KA 5E70A 4M43H 4UV7H 4Y2DC 3K3QA 1DFBL 1Z5YD 2ERJB 2I07A 2YGVA 3AFLA 3P3YA 5F7YC 1THCA 3Q5OA 2WQSA 5I76B 2YMTA 3MV8B 1MW1A 1ZPUA 1YLBB 3SPGA 1PZ2A 5EWIL 1T20A 5CJOL 4EMZA 1GMEA 3F85A 1QKZL 4MA8H 2XZAH 2D7TL 4IJ3B 2IAMD 4DFHA 4OF7A 1CURA 2OMYA 3RKDD 2UY7A 2OMXA 2IH1B 4MNQB 6PCYA 1NGXA 4U1SA 4UUJA 4U4BA 1NJ9A 3SKMB 1KDIA 1PL3A 4LHJB 3F84A 4IS6A 3MOBH 2IDTA 3DI3B 2YPLD 2DJUA 5CWSB 3HE7D 3BT2L 3SE3A 2DQHH 4JHAL 2G3XA 2QL1A 2X70B 1YMME 4K3JH 4NQDE 1GC1C 1UWYA 4N5UA 1RAMA 1BZ8A 4LT7A 3UBGA 4BCZA 2F5BL 4KHXL 2X4TB 1Y1DA 3GB7A 1TZOA 4CU8A 4AQ8C 1WFNA 3QJOA 5IP4A 3SGEI 1JN6A 2J8HA 5T1DL 3TFBA 3U7WH 4UTCA 4IRSD 5ADOH 1QHQA 2LE9A 2WXIA 5HP5A 2Y5QA 4RIRA 4QY8B 5J89A 3IFLL 1FDLH 3QUMA 1W72A 2FJFB 1T7YA 3S4SB 4ZMAT 1OM3H 1HC1A 1X4YA 3QUXB 3DJRA 3KPRB 2XG4A 5CD3A 1BPLB 1P4IH 1OTSD 5BO1L 4N28A 2MCG1 4F8NA 2BSTB 4MD0B 4KI5E 3W82A 5C6TL 4B7LA 3GEWB 4P5MA 2ZF9A 5IVXB 2HPOA 1FFRA 1ZGLA 4ODTL 4DP6X 1OAXH 1HXMA 1ECZA 4U1JB 3L7FB 1JI1A 2ICES 2F08A 1KLUA 1RL1A 5DFVC 1XZ0B 2NY3B 3ABZA 2ATAA 3NA9L 4R26L 1L0QA 2J8UA 3C5ZB 3US0A 3CHPA 1XCQA 1YYLH 3RNQA 3FQYA 1NANH 2DOCA 3WI9A 1OPGH 2NNAA 1SJHA 3HLAA 4G80B 2BSRA 5D2LA 3ZGHA 2BS8A 3BIBX 1H3PL 4KDWA 4YH6A 2EIZA 2X9WA 1EK3A 3IGAA 3BUTA 4JO4L 2FSDA 5D1XB 1KTBA 1KV7A 2JJSC 4H0GA 4HJ0C 2BHFA 3QFDA 3TBTB 1QUNB 2X1OA 3TYFB 2VH5L 2AQPA 1LILA 1JZ4A 3AG1B 2YPKA 3ZN6A 2L3BA 5F7AA 1FP5A 5EU7C 3KE0A 4QHNA 3Q8AA 6FABL 4W70A 5FYLL 3VWJD 2A4EA 3HFFA 3G08A 3HB3D 2KDYA 2GHWB 4HUWB 1XR9B 4PMFA 5C1MB 3ZIYA 3D0VA 3UYRL 1YC8A 5EU7E 5ISZA 5I1LB 5HHXH 5HVHB 1B0GB 4KNQA 4X6BA 1FG9C 2YA2A 4Y2NA 1MFDL 5ID1B 2GBUA 3A6BL 3X1FA 5JZ7D 1U0QA 1FV1B 2CDFA 4FULA 1OVZA 5E5MB 3MLRH 4YHMH 3TEXA 3MACL 1CQYA 2V2WB 4B5ZA 1ZLVK 3PUCA 2FB4H 4CL7A 4ZTPH 4FLSA 3RY4A 3U9PL 2NY7L 4CC0A 5GZOD 3TH3T 4OD2A 1EWHA 1A6VH 3F6LA 5B38B 2P42B 3GHBH 4OFYA 3UYOD 5IJKC 3PS6A 4GOSA 3QCVL 2WMPB 2CLZA 1BF5A 2QV4A 3PFQA 3QH3B 2J25A 4J23A 4FHJA 2UZXB 1N8ZA 4Y19B 3WXWL 2Q3AA 2FX7H 4M7KL 3SOBL 1AKJB 1HYRC 5FLUA 4XOEA 5E6ID 3RTQC 2JKNA 2VLKB 3CZLA 2NY5L 1NFDF 3OPZH 2ZSWB 5DFWH 5EF2A 4XC1H 1UEMA 4FABL 3W5NA 1F3JA 3JTSA 4QRRE 1K4DB 1AXTL 1XF5A 5BPPA 1JVOA 4ORGA 3CMOL 1CDHA 1R5VB 4PJCF 3IVKB 2ARJA 2YHGA 3MNZA 1J9CT 2V17H 1IQWH 3I6KA 2HP4A 2NDGA 1SYVB 3Q48A 2K0RA 4Y2OB 5E8NB 4BRVA 2J5WA 4WLCA 3FSZA 1P7HL 1U9KA 4GQZA 1SJVA 4OLUH 5BOPA 4X2UA 1WLHA 1UWGL 4FLOA 1Q0EA 2J4WH 4KVNL 1MHEA 2N7SA 2A7BA 2CCLA 2EH7L 3DURA 4M3HA 5TE6L 2ADYA 5BJTB 4QTIH 2AEQL 4E41E 3RZCD 2QKIC 3GMRA 1M3IA 5EU5A 1EX0A 1EO8H 5I1HL 3CX5J 2V7HA 4O2FB 4W81A 2KLTA 3MXVH 4LESA 3SGEH 2VUYA 3UZQB 4F1SA 4YSRA 1VCAA 3C60A 3MYJA 2JXMB 1I75A 5IHBA 5FK9B 3S3JA 4UOW1 5DD6A 4KO9A 3QFJD 3ZO9A 1ID5I 4MA1B 1BZ9B 2IAMC 4ZBJA 2CIIB 1CGSH 4EUPH 2L7UA 3FN9A 3X12B 1CXFA 1JK8B 1U8KB 5DJCA 3KWWB 1HZKA 3GSQB 2RCSH 4NUJA 3DX2A 2RQ8A 3DMMB 5FYKU 3QAZB 5IQ9B 1BOGB 3HE7C 2B14A 3DI2B 3I3EA 4JO1L 3IMUA 4JRYE 4L4TB 4ZPVB 5DWUH 2UXFA 3HE6D 2VZTA 3VI3F 2DPKA 1TFHA 4HUUB 3CZKA 2HG0A 1MF2L 3KJ6H 4N4YB 3EGDA 2DTSA 2BOBA 4XVUD 2X7LA 1MRFH 4NRYA 4XP1H 1HOCB 2E7CA 2YSSB 3VXTA 3EADA 3C2SA 1ULVA 1X5AA 1FG2A 3CN1A 2WXMA 4H20L 4RFOL 2CSPA 2A9BA 4HWZB 2R4SL 4K9EC 2WBKA 4WWOA 2Z31A 2QGBA 4LASL 3V0HA 3VJ6B 5JOEA 4PJGE 3MHZA 2FEDC 2ENPA 2V4LA 3FSWA 2Z35B 3SY0B 1AQDA 3BZ5A 3M1OA 1QSED 1ZA6B 1OTSC 1S5HA 3BGFB 4BSWB 3HLKA 1IC5L 3NFSH 4EIGB 4NAMA 5F97E 2Q20A 3GPEA 3QHTC 1UVQB 4LCIH 5DFTA 5KWYC 5F1IA 5DD5L 4YBHA 2EIKB 1MDTA 5LBGA 5CBEA 3F7KA 2PWHA 5F0JB 1FL5A 5FA4A 5LN8A 1SVBA 1AQKL 5E4EC 4YIQB 5K1JA 3T65A 4HWBH 5L8KB 2ESVD 1QA9B 1NBVH 2FIKB 3CX5K 4NO3A 4QXUL 1IIIA 1NL0L 1U3HC 5TQ0H 4D9QD 3Q2CA 3BYTA 1NCTA 5DJ2A 5KVGE 4DKEL 4XRCA 5ITBH 3R06A 3CUPA 1TTRA 3NCJH 2HG5B 4X5WA 1NCDH 3KNBB 4AEIH 4HD9A 3OAWA 3TYGL 2O30A 1A6TA 1PLGL 1XR8A 5C09A 3DARA 2J88H 5GHWH 4UDTA 1YN7B 2WXGA 3WSQL 4M29A 4WUUD 4EUPA 2V0AA 1T1WA 1A9EB 1P0SE 3VWJC 2IG2L 2ICEA 1HL5A 5F3BB 4RH4A 2OX5B 4LF3A 1UCTA 2WUCH 4YL4A 3FT2B 3OKDB 4Y4HC 3SE6A 4F7PB 1SUHA 5AALA 2XXMB 4QNPE 5CIPB 4RGND 1QSVA 5GRUL 1ZLEA 2DQUH 4C4UA 2IV8A 4G43A 1BQHG 3RGVC 3RWEB 4WFED 5JZ7C 4RZKA 4IRZH 3UEZA 3KLAA 4G42A 4YHZH 5DT1H 5GSRB 4KROB 5GRVK 2Q8BL 3QQ9C 2VDNH 3TN0D 2DLTA 3BZFB 1MLBA 4RGOH 3VXRB 5L7XL 5HGBA 4K94H 5EZOH 2ZPKH 2HVKB 1LWRA 4XNZB 2WXLA 4O00A 5FFOA 5AVRB 4ZUUB 5C07B 5B39A 4PLNC 1ORSA 4IDJH 3RA7H 4PBVC 2NX5B 4ZSOE 1N18A 5C0DB 2DEXX 4NNYB 5AL0A 2J43A 4LLMA 1OTUC 3QIBD 2FHBA 3PDOA 4PTUA 4PJ8B 1CT8A 2CO6A 5I1EL 2DWYA 4BH8B 4N9OB 2D0FA 5MEND 2E9WA 5E6IC 2A9NH 2OQJA 5ANHA 4XPAL 1MQKL 4N0UA 4UB0L 4G5AA 3VRLE 2XT1B 4ZPTB 4KK6D 4XPBL 1YUHB 2A99A 3WTYA 1MOEA 5DDHB 1F13A 3OBAA 4GH7B 3VSTA 1CGXA 1G1KA 3SN6N 2ALWA 5C8JB 3CHQA 3FCUB 2FJSA 3V8OA 3ZTNL 3P02A 4NENB 4CVZB 4IU3B 1BYNA 1K85A 4GRWE 4M4RB 1LE9A 2BY3A 4PRBA 4I0PB 2YUXA 4GG6F 1LDPL 3GJEA 5JOPD 1AMYA 1UA6L 3QIUC 3VFUB 2XTSA 1OKEA 5EEUA 1IGCH 2EICA 3CFDA 3IJEB 3VXPB 4FP8H 4KKBD 4YE4H 4MQXC 1H5BB 1QFPA 5EDSA 1BJ1H 3NSCA 1GTNA 4CJ1A 1KWGA 1GA2A 2X2YA 3EYFB 1KPRB 5D5MF 1T03H 3IGFA 1BVNT 1ZANL 5C0IB 2WWKT 3OXRB 1G1YA 5H4YA 3MGOA 4X80L 4N0CD 4IIQC 2CJSA 1X5MA 4G8GA 1HXYB 4TUKL 3VXUB 3VXME 1TQSA 2X1PA 3BGMA 1XMWA 3LEYH 1DLFL 4JFYB 1GH7A 2ZOWA 4UI2A 2YPVL 3C6SB 2PTTB 1GC1H 1P5VA 3FU7B 3MX0B 5EO1A 5K9QG 3WU1A 1EJOH 1KN4H 5T3ZL 3APNA 1T4KB 4NQXA 1I7ZB 1X5ZA 3GSWB 4O5LL 1C12A 1OT1A 3OAUL 2EDFA 1QVOB 2YBGA 3MJ6A 1CLOL 2AV1A 4F20A 2RFXB 5SWZD 5I0YA 1S9YB 1UD5A 1A6UL 4S0HA 3QI9B 1QFUL 3HPJB 2DBLL 4JQVC 4M5YL 2H1PL 2VJ0A 2GI7A 1FYTD 1AI1L 2EO9A 2A74B 4IOFC 4NPJA 2VC2B 3LZFL 2HJKB 4QRPB 5ICZA 5DF0A 1A9VA 4YDKL 2Q9OA 2ZXEB 3KYOA 2JJTC 4GQ9H 2EDQA 4JFTA 5JHDA 4AGPA 4OCXL 1A2YA 1NINA 1TOXA 3FONB 3HNVL 3GI9H 4WU5B 1EFQA 3T9WA 2VLRD 3L3OB 2F15A 1FNEB 2Z7UA 3FOLA 1H9DA 2O5YH 3Q9PA 3QIWA 3CSYA 2EACA 2JCCE 5T33L 3UTZA 1SXAA 2W07A 1DUZA 1TZIB 4Y2DA 3LX9A 4DP9X 3ARDD 3HRZB 2Z8WC 4PAZA 4WWKD 5DYOA 1QLEH 3APCA 1MI5E 4HU8A 5EG6C 3B3BA 4QWWD 1DEDA 4YHPA 4YC2B 4M62L 4LO9A 5F7EL 4FAAB 4MA3B 2OK0L 3VH8G 3L5XH 2AXHA 4XP9H 4Y9BA 4P2OC 3MJ8B 1XIWB 2R1YB 3IS1X 5FGCE 2EEAA 3QQ4B 5I5RA 1W8EA 2WXHA 4RSVA 1INEH 4JL1A 1IB5A 1QP1A 4UANA 4PJ7B 3I6LD 4F7MB 2GT9B 4RZCB 3SO5A 5E5UB 1YMMA 4Y1AB 3DBSA 1L9SA 2ICWI 3ZUCA 5PAZA 5SWSB 1I9IH 2YN5A 1WIPA 4N8PA 1T2JA 4KO7A 3DC0A 3WE6A 1EBAA 1GTFA 1CLZL 5ECJE 3FL7A 1NAKH 2HWZH 2OJZL 2KT6A 3T4YA 1YEGL 1O7DE 2Q7YB 2UWEE 1UXWA 3CK0H 4JFOB 1NMAL 3NEXA 3AROA 4RAVB 2O72A 3VFTA 4R4FH 1CF8L 1NC2B 1UZ8B 4NZUH 1J18A 1BWWA 5I1IH 1OCWL 1FVDB 4TSAH 3FTSA 1YYCA 3WO3B 1QFOA 1PEZA 1PW3A 3BFQG 4HX1B 5IW6A 3D25B 4HLZG 4DUWA 3OG4B 4YSUA 4NGHH 5F9WB 1S7SA 4OQTH 1IFGA 1OGTB 3GMMB 4OZ4A 5D7JD 4NZRH 4APXB 4KUCD 3BZEA 2OI9B 5FS5A 2VN6A 1U42A 1M1XB 4E9XA 4YQXL 2LR4A 4NP4H 4XVTH 1H3XA 2PCPA 2DAVA 3L3GB 43CAA 1E5UI 3FUJA 4H5SB 1EAPB 1CK0H 1BBDH 5A6MA 2BNUB 4PB9L 1AZVA 3UGXA 3CZJA 3UTPD 1Q0XL 3VI4B 4TSBH 4P57B 4F2MB 3AC0A 3SPHA 1OAJA 3TN0C 1JP5A 2HAZA 4X4XA 3FO1B 5HHOD 4OFPA 1D5XA 4A6YB 1ASOA 5L4MA 3C8KB 1OP5H 3U6XA 1J05A 2N59A 1XF4B 2H6UA 2J1WA 3A21A 2OTUB 4CVXA 3S36L 4N1EA 4AG4L 1JCVA 3STZA 4ZTOL 4ZAKB 4XMZA 1HQ4B 3QIBC 3DPDA 1LD9B 1HQRB 4HWEL 1KGUA 5L6YH 3EDFA 3AQXA 3HMXH 3LRGA 3PJSA 4OZGA 1Y18B 3ROLA 4KH9A 5GGSB 3CHXA 3CZFB 1YEIL 3UGUA 1DZ0A 2OCFD 4Q6IB 5JLZB 1TQBC 2D03L 3BIKA 3NFPA 4JX0A 1KTLA 3WUWB 3PQYD 4Y4FA 1FZKB 1MCOH 2DKUA 4H1LH 5HHNB 3FF8A 2XA8L 3LAFA 4ZTEA 4PJDA 1BFVH 4XVOA 5DFAA 5AOZA 1UOWA 2YEZB 2BMKA 2HJLA 4FKKA 4HEME 2IADA 4WO4B 4YXKL 2WGXA 5DI8B 4NP9A 1C5DB 5AKVA 4Q2ZB 4Y9GA 3ULSA 4KKBC 4YSPA 1C8PA 2O4EA 1GGIH 4XBEL 3BC9A 5D1ZD 2R56L 4GRLC 4QTFA 2PYEE 3IF1A 1DDHB 4XP5H 3T2LA 2H0FA 2HX9A 4LDCA 2GC7C 1UCBH 3SPIA 3U9WA 3T4AB 4NIKB 3U0TB 3HUJE 3SJVB 4I3RL 1I3RB 3VD2A 5D7LE 5AZEH 1P7KA 3S35L 5CF3A 3O3UN 5IJKA 2FO1A 3HC2A 4ZUWA 1ZT7A 1J1PL 1W0VA 2QQNH 3DPBB 3OJDA 3I2CL 3L3IA 1T0NB 3THML 5C3TA 4LCUB 1M7DB 5FM4A 4QRRA 5IHZB 4PY7A 3RTQA 3I02B 5E8OB 4NAQA 5HHVH 1I8LC 1RHFA 3AUWB 3AG2B 3KPOA 1WE5A 4UM8A 1ZS8A 5B7MA 1RUPL 4U1KA 4PJEF 5E1IA 3ZK0A 4NM4H 4K9EH 2E56A 3S5LG 5IB2B 5SWZE 3BKMH 2JJVA 4BQBA 4PREB 4HK3N 3EDEA 5FV2A 1DSFL 1KYUA 1FBIL 4S1SH 2VDLL 1TXKA 1KXVC 3BAXA 5ETUB 3ARZA 3O3BA 1DFBH 1CYWA 1NCHA 3HHSA 4N22A 3VVWA 2Y36H 1OOWA 2CO3A 5I9QC 4IJTA 3GT6A 1P1ZA 5EZIH 3U36A 3K46A 4XHJC 1DTUA 2NXZD 2ENQA 4E41A 1JPTL 4LP8A 5EWIH 3S98A 5KVGH 5CJOH 5TQ2L 5DJ6A 1KGWA 4TOYH 2EKSA 1QKZH 4JKPL 1CJYA 2W81C 4P2RE 1J9TA 4YDVA 5D7IE 2YSTA 5JW3H 2QKIA 1Z5LB 1TQWA 2EDRA 5D1XD 4E5XA 3ARDC 1J7VR 4HJTA 4M8VA 4EIUA 2YUVA 3ARBD 3KS0H 4PUBH 1DJZA 3VXOB 4LL1A 5BV7C 1CFNB 4QOKD 4Z0BL 1FIGH 4A55A 3LS5L 4JHAH 3I6GB 1NCUA 4A37A 2VIRB 3WE1A 4OBRA 3AY2A 2MCAA 2D31B 3LKNA 4K0OA 5JHLA 5BW7C 1T1ZB 4PGBA 2UX6A 1UJ3C 2N1KA 1MCQA 2IAMA 2UYLB 5BS0D 4LPVA 3Q05A 1NLBH 4NPYA 4PRDB 4JRYA 4H8QA 5DGQA 1CFVL 3JV6B 4HKXB 1W15A 1Z1WA 4U6XB 1K3ZA 5T3ZE 3BQUD 3LEVL 4FQIH 4EI6B 5DEFB 1DUYA 2YPLA 1J88A 1AHKA 3HE7A 1EGJH 1G4RA 1ZSDA 3IFLH 4RNRA 4GW4A 7TAAA 5HVGB 5L88H 2NYYD 4NX0A 2WO2B 3O6LL 5I2IA 4JLRA 5BZWB 3MV7E 2FQFA 2OMTA 3RWHB 4XCYB 4HUKB 5C6TH 5IT2L 1EEQA 4N8VB 4HK3J 1IX2A 2H3XC 2Z6FA 3ENEA 4GNKB 4N0FA 4Y19D 5EF0A 4PJGA 1EZSA 4BE6A 2YARA 4IRSA 2MRYA 2OR7A 1NTDA 4JAMB 2XIIA 3NA9H 4X4YA 3IE4A 5T1JA 3QQNA 4GXUN 4YDJB 3GBML 2WLJA 3D3VE 3GSNB 4NRZB 4TVSa 1IEHA 1VADB 3WFHB 4Q89A 2BFGA 2W0PA 1T6WA 1KBVA 3M17B 4PP2B 4G9FB 4AJYV 1H3PH 3UJJL 5G55A 4GRWH 4PJHA 4JO4H 4C4KO 3S96A 4CMMB 3M7FB 2BC4A 1UA3A 2FLRT 3SCMB 4HPYL 4XCFH 3TJPA 1TIUA 2VH5H 1U8OB 4MJIE 3K8MA 3OWEA 4A66A 1KOAA 5GRYA 4PJAB 1A7PL 4LEEA 1OAZH 1U3HA 4BDVB 4BKLA 1MZYA 3UAFA 3BT0A 5HHOE 3B9KD 2PXYB 1GYVA 4FQQA 3OR6A 1PFOA 4ABQA 3N42B 1BVKA 2AXFA 2NR6C 3LSOA 5JMRA 4JO5A 4MSWA 4WWNA 3A6BH 1DJSA 1U2HA 3LN5B 1CGYA 4HKJB 3TBSB 4GRMA 2ERJC 2FATL 3H6JA 3N3EA 3WIIH 3MACH 4DH2A 1AKPA 1SMAA 3GMLB 3RUGA 2QPUA 3FUDA 2ZONA 1AD0B 4XO8A 3VWJA 4LAJH 3RHWK 3REVB 4XPFL 2XKUA 3OAZK 3L5IA 3ZO0A 2KLRA 4LIQL 1M1SA 1R17A 1S6NA 3MV8E 4YO0A 1X5LA 2OP4L 3G5ZA 3N85L 4NSKA 3WXWH 5K9JL 3BPOC 4XN1A 5LNEA 2FHFA 4L9LB 2XTJD 5KBKA 2X2IA 3ZY7A 1INDL 3L54A 3OHXC 4A7QA 5CZVH 1HZLA 2G2NA 4ZSOA 2YQGA 4D0CA 1VA9A 3OKYA 2Y5TB 3C87A 3QO0A 4MNQE 4ZT1A 4EQ3A 1TF4A 5SX4I 9CGTA 2OW6A 1JGLH 1HKLH 5CGMA 4WZ9A 3SKNA 1O5DT 1RZFH 4JUTA 2F1AA 4A2LA 5GZOA 1OHQA 4H25A 1A3RL 1HDMA 1AXTH 3NACH 1KG0B 4L0YA 3S3SA 3CMOH 4JL2A 2R0WH 2FTAA 4NN7B 4OR1A 4ZFZA 1CZ8L 2XKNA 4AV4A 4P2QB 3VX0A 4FQPA 3EHBD 4Y88A 3UZVA 5D8JL 4Z7IA 3B5TA 1CR9H 1HINL 1QBLL 1N19A 1P9MC 2ZWNA 3ULUD 1WFMA 4JGJA 2Z92A 4M5ZH 4D9RE 5E6IA 2Z34A 1IVTA 3PJNA 2EEXA 2HX8A 2CUIA 5B22A 3SQOL 1UWGH 1WBZB 3KEDA 4MD4A 3QUXC 1YEDB 4Q6YA 3A4AA 3ARXA 4QXVA 1N0LB 1F86A 3SPVA 5EA0H 1A7BA 5TE6H 3T0XA 2VJXA 4KAQL 3F83A 3VRJA 2AEQH 4UT6L 5HDQH 1U4FA 1TMQA 1CD9B 2ITFA 3AVEA 1F2XK 5ALBL 1MCRA 3EW3B 4LOFA 2AJUL 3KPRE 3TA3B 4XCCH 4PBXA 4KTDL 3WNPA 5IJCC 3DSFL 5IVXE 4ZX3A 1YN6B 2CUMA 3NZSA 5DK2B 1AZRA 3QJVB 5EIIA 4QRUA 5IWLC 1RSFA 7CGTA 4NBXB 3LPOA 3T5WA 1MJ8L 4IIQA 3GJFK 3NSFA 1WBXA 1PZDA 1ZHNB 3H7LA 1ROCA 4DGWC 3LRSB 2ITCA 5FYJE 3HR5B 3RZCA 2LU3A 2OZ4H 5D1XC 5FUCC 3T6QC 1E4HA 4FJYA 4YNYA 4K55A 4LSTL 1VDGA 4IOIB 1D5IL 2DD8L 1EHLL 1E6JH 1ZXKA 2V8LA 4JO1H 2XN9B 5D1XE 4TUOA 5CU5A 5FUCE 5AVTB 3T1FA 5HD8C 3Q6GL 3MRGA 3HAEH 1JVKA 1GGCH 2EEDA 4FG6D 4WKZB 4KKCD 3QFJA 3OX8B 1FNGA 4IBVA 2NY1B 2OAAA 4JANB 3MBXL 2VZSA 1JHTA 5EUOB 2AMGA 3P9LA 4CKQA 2BP0B 2XWJB 3LKPA 3LNFA 5TPWH 3HG3A 1CCZA 4KH2A 4Q74A 4RFOH 4DKTA 3MJ9L 1E4XI 1V3JA 2JJTA 4LASH 2YMOA 2ZAHA 3QNZA 2WVVB 2NYYC 3HE6A 3MCLL 4HH9B 4S2SB 3TJEH 1MAML 3WN6A 1XEUA 3E2HB 5D4IA 4NDMB 2NX5D 4JM2F 3MLTB 3B6SB 3UZEA 5D7HA 4P9ML 5DCCA 1NCAL 3IDIB 4EN3D 2NY6D 1OV8A 1BWMA 1P4UA 3FB6B 1BD2D 5MEQA 3DOSB 3RILA 2ZCLH 2EE0A 1NBQA 1JGEA 3EJUA 3FCTB 2Z1PA 3QGVA 2HFEB 4GIOA 2HH0L 4HC1L 4N90E 4Y19E 5E6SB 4JGNA 4E9VA 2JCWA 4XNYH 1G5AA 1OAYH 1QSEA 3N5AA 4PVMA 5DRZB 3MODL 2VLKE 1A8JH 4Y9FA 2H0EA 3LZQA 3LZLA 3WS6C 4DZBA 2Y4SA 2PP9A 2NY4B 4L3FA 4PD4K 2RQEA 4X7TA 1S46A 2WKLA 1E90A 5EC2A 1PLGH 4LCCA 2E4FA 1CWVA 2ESVA 3EBIA 3UBHA 5IFAH 2FUQA 5CGBA 1YEKL 1KCBA 3JV5A 3R0NA 2IG2H 5E9DD 2OZ4A 4TNWK 2CGYA 4DIXA 2J57A 1EV2E 2XZCL 5SX4H 2ED6A 3I3DA 4Y89A 5K1VA 3II2A 4BM7A 3K4DA 1H3VA 5JIIA 4B9IA 2HPTA 4ZS7L 3DVFA 2GJ6B 3HAEA 4OAWA 3FRPA 2WQXA 1TNNA 3L3KB 4HSAC 4BZ1A 3WYRA 5C0FB 2XWRA 5LN4A 3PWPD 4JUSA 4XH2B 3UJIH 1KEML 4WUUA 4WSGA 5TFSL 1I8MB 3RP1A 3D2UB 5C3LD 3HKZA 5L4JA 4OF5A 4A7TA 3WD5L 3KPMB 3MRLB 2GEQA 5AB2A 4MZ2A 3CTTA 3I3BA 2NW2B 3S8WA 2XOTA 2CXKA 3F58H 4MA1C 2Q76A 2PTUA 3VGAB 3NP3A 2A6IA 2P8MB 1DJWA 4EKJA 2XTJC 5IB3A 2YZ1A 2QSQA 2XWEA 4CW1A 3DMMC 4JHWL 4CVWA 5DVKA 5IJDC 1CXIA 3QAZC 3RVUD 2WTRB 1ASQA 3VG0L 1C8QA 2Q3ZA 4LSVL 4PBWD 5C92A 3TN0A 1WWCA 2XBZA 4PBDA 4QHKI 5KYYA 3L4CA 3ARGB 3CXHK 5D1QB 2JLLA 3FS9A 3VO0A 2HFFA 2LU5A 3UG4A 2V2TA 2AKRA 3D4CA 2M26A 3P0VL 3WTVA 3GIVA 1UGKA 4JFDD 5HYSA 4L4TE 2F53B 3C5SA 3QIBA 1I1CA 2FWOA 4LP4A 5GIRB 1BLNA 2W38A 5T5NG 1JFHA 1AJ7L 5MENA 2XICA 3QEHB 1ET8A 3NCCB 4AEEA 2B5IC 3G6JA 3DUSB 5FCUH 4XWOC 1HILB 2WN3A 1ZANH 3QQ3B 4HEMA 1Q1JL 5IW3A 1QFHA 3BGFC 2XJKA 3EGSA 3ZE0F 4TUKH 1OCZB 2HX7A 1O9VA 3DO3A 4U3SB 4YZWA 3X2QB 3SDAB 2EYTA 4A6YL 5BV7H 1J0JA 1SDAB 4JZJB 2B16A 1MRDL 3DO7A 2HRPH 2EJ1A 1HHKB 2DQCL 4J8RB 4WEEA 3M8OL 1JNHB 2VLME 3C9NB 1UYWL 3EFOB 2IQAA 3K2UL 4K5MA 2BIIA 3OLEA 4IKLA 4S11A 5IHHA 5HGHB 3PWNB 2AI0L 5T3ZH 2E27L 1DL7L 4O5LH 4V33A 4ZMYA 5D7LA 3KCPB 4YK4C 4RX4D 1YEEH 2Z91A 1KTDA 3O6KH 1CLOH 3WIFB 4DW2H 1ZIAA 2KC0A 1FNHA 5IROD 1OHZA 4DCQB 1KIRA 4MYWB 3X14B 4U1NA 4RFEB 1VAHA 2DBLH 4M5YH 3UAEA 2H1PH 3P54A 4KQ4L 5D9SA 4W9HC 1U2CA 2FHCA 2NUTA 5DVNA 3HOGA 1AI1H 1E9PA 1Q94A 1SDDB 5K93A 2MNJB 4YDMA 3WJJC 1WFOA 3TH4T 2W60B 2CJUL 3EO0B 1GXEA 4U1GB 1HNYA 1JXFA 3CVHH 3DX8A 2Q86A 2YD5A 1I8LA 1OCRB 1IILE 3EOAB 3C5JA 4FG6C 4D0DB 1RHHA 5SWZA 4Q8BA 4P5KB 4L4VB 2DW5A 4MJ5A 1FYHB 2DYPB 2Z9TA 3FFCB 1E28B 3W38A 2XWZA 4HJUA 1SY6L 4B9PA 1FYTA 1BZOA 3NZHH 4U1IB 1HSBB 1OIOA 4KROC 4ZX6A 1OLZA 3ARFD 3KWTA 5BQ7A 1TLMA 5A40E 3NZ8A 4L1SA 3B5GA 4FXGA 4ZW8A 3W0WB 1ZT1B 4JMXA 3VDBA 4XNZC 5HDOA 4AJWA 3KPPB 3N1MC 1U92B 4X7SL 1QFWM 5F7EH 5A2BA 2VLRA 2BOCB 4PLOB 2R7EB 3VXRE 4G6FB 1CN4A 3A22A 4OFKA 5CJ8A 5FOBB 3F3HA 5C07E 4LCWD 5AW1B 4X98B 2NX5E 4OLYL 2MNWA 2VR4A 4KMTL 2NTFB 4OIBA 4XMLH 1KJMA 3P4LA 5B3JF 3ARDA 1O9ZA 5A2JH 2GHZA 4M8RA 4WWKA 2R29H 1KCUH 4Y7MA 4QYOB 1CXKA 1WVZA 1S7VB 3IGUA 3QS3A 5TE7L 4X4MA 1U8QB 1I8IA 2FWLB 25C8H 4JDVB 3VW3L 2SEBA 1NMAH 5BW7A 1XX9C 4EUPG 3DHJA 3V6FB 5KS9A 2IH3B 2RA1A 2ZG1A 2L7EA 3KBPA 3WFEH 3O3DA 1XGYL 1RZKL 1DZBA 4LPUA 1ILUA 2K9UA 1J11A 3T8MA 2A73A 4PRID 5E6ZA 1DSWA 5E9AA 2XN1A 3TWCL 4HS3B 2F1EA 2NCMA 5EF1A 2CO2A 4GEJA 2J3SA 4L3AA 3N1FC 2YIHA 2GC4C 3KPLB 2BINA 4WKXA 4YQXH 1BM3L 4YAQB 1NFDB 4PP1D 3IJYB 1KTCA 3MXWL 2XLLA 1JPFA 3DROB 3CVHA 2VLLB 1YHPA 3AT9A 4JG0H 2CRZA 3QA3B 4X7CC 1QFWL 1EHXA 3RAJL 4DZ8A 1CGUA 3VXUE 4DN3L 1WK0A 5ILTL 3TGXA 3Q1SH 1RUML 2CZNA 3L9EA 3ORJA 4RISL 3S3PA 2P45B 4PJCB 4J3SA 3CVBA 5D7JA 5LQBH 3A4DA 4WWID 3QORB 1OGAD 3RVTD 3S36H 4AG4H 4AZ8B 5DRWB 1HHJB 4C47A 3QI9C 4L8BB 1IGML 5KBMA 1KIQB 2D7OA 4HWEH 5DS8A 4P5TB 2CDEB 3TEZA 2AEWA 4HHAB 1AGDB 4MMZB 3EYSL 1WGOA 4F15B 3RVXD 3JTTB 5CSZB 3VQMA 1YEIH 5HHOA 1EZVX 3VSQA 5MI0B 3D51A 1MEXL 2YGNA 3MLSL 4U3CA 5E2JA 2VT0A 1KCRH 4ICXA 3FO0L 4UQ3B 4QRPE 1ZGLP 4NYLB 1N59A 3L3OC 3V4PB 4AVIA 4QJ3B 2G75A 5GZND 5F9JB 2ITEA 4CC1A 2WLKA 2R29A 4YXKH 5CLZA 1OF0A 3GSNL 3ZZ1A 5FYJH 2YGPA 4HDIA 4I89A 1CGWA 2I9TA 1DCLA 3N55A 5LO7A 3HRZC 4XBEH 4FMFA 1ZHLA 2XFGB 2Y69B 3LV3B 3LB6D 5AG9A 5I76A 3PQYA 5I1AB 2E7HA 3QZMA 2GJRA 2AK4D 2QPSA 4HBCH 4OTXL 2N7BA 1XIWC 4LSSL 2O1AA 4FA7B 4PI2A 3S35H 1GHFL 3KWUA 4X83A 1O0VA 5ITFA 3L48A 5HDBF 4Z3JA 1J1PH 2PW2B 4JG1H 2IH1A 4ATWA 2VN4A 3VI3B 4Z7UA 3I2CH 1HCFX 1TQCB 4WF7A 4F8PA 2E76C 3EAKA 1VZHA 3OHXA 3V4LA 4KZDL 4XNAA 5CWSA 2OXHA 1EEZB 5D72L 4JFED 4PJ7E 4PN6A 2ZYIA 3C6LD 2R2HB 4X0KB 1MSPA 4XO3A 3N6YA 1RUPH 2AAVA 5SWSE 5LGJB 3MUGB 5EN2A 2K4AA 3SKJH 5KN5B 4KRPB 4C4BA 3HBPA 1QQDB 4GAGH 1GY2A 4LHUB 2QPEB 1GOHA 1P9MA 4XBPA 4K7FB 2X6BA 4GAFB 2XHNA 5MEPB 1PSKL 4QY8A 1TZHA 5F9WC 4U6HB 5L2JB 5ESVA 1TDQA 2AJ3B 3ZZQA 2ZOUA 3MPCA 4IRJD 5D2NC 2N01B 3DRTB 3WNOA 1UWEH 3O2WH 5K5YA 4ZFOA 3DXAD 4ZYKA 1ZXQA 2BOLA 3CLFL 2CUAA 5IVXA 3BUPA 4PYGA 4LDOB 3WGVB 1Q9OB 3G5YB 1IAOB 3BMVA 3BAWA 5D2NE 3O4LB 3ARFC 3O9WB 2G9KA 1BZEA 4G5ZL 2GW5A 3FQTB 3FTUA 4UM9D 5LBSA 2VKWA 5G5DA 43C9B 4Z0BH 2DB8A 2ADJB 2WKOF 3S88H 3VI4E 3P40A 3WIHH 4F2ME 5GSVB 4HCRH 4DO5A 5EEYA 1AGFB 3EO9L 4CSSA 4JZNA 4OJDH 1CXHA 1S3KH 4AITA 1BFOA 3WDHA 3HN3A 4NXKA 3A6CH 5B21A 3E80A 2AJSL 2ZXDA 5D1XA 5E00B 1ADQL 3BPLB 2DMCA 4CNIB 1BJ1J 3ARBA 4F57L 2DQEL 2XJLA 3GGWB 1QUNA 2PUQT 2XWDA 3DSNA 3LEVH 1B4JH 2YO3A 4Q6IC 3MOAH 4J4PD 4QOKA 1D6EA 3AXIA 4AVJA 1HH9B 3L45A 4I88A 1PIFA 4WEBH 4LLYB 2IH8A 2UZIL 3G5WA 5JA8B 3A5VA 4N2HA 3JZ7A 2FX9L 3KGTA 1M71B 1XR9A 1JG9A 1DQQA 1GSKA 2Y6SD 3MZTA 3S36X 4BJLA 5BS0A 4BV1A 2EINB 1GGUA 5KZCB 4I3SL 3K4AA 4AQAB 2QBWA 4AKOA 4J27A 3ZL4L 1P84K 3SEPA 3WKYA 3FDWA 5E5MA 4DOHB 4LEBA 3LQAC 1S9XB 1HCZA 1CPUA 1K8IB 2FEEI 4UQ2A 2AAAA 4C8XA 4MMXB 3F7PC 1S78D 3KG5A 4QF1B 1G94A 4PP1C 2BHUA 2ZOLB 2NTSP 1AFVL 1D7FA 2UZXA 4Y19A 4YDZA 3WFDL 5LDSA 1CICB 1R5WB 5ALCH 3EH2A 4N2CA 2DZEA 3RWIA 3SJVE 3VFOA 5C0AD 4UF7C 3EBHA 1VPOH 3G04B 4MMYB 1QHPA 5C7XH 3RI5K 4GG6B 1A7PH 1DJYA 2EYRB 4GI8A 4J3XA 1CXLA 4X99B 2DS4A 3RVTC 3T3PF 4ONOA 1ZEAL 1C16B 2X53A 1XD0A 4A2HA 4QXTA 4BEIA 2AABL 2CHZA 4PGCB 1AG0A 1S9VB 4HOZA 5IF0B 4GSRA 3MUHL 3WS6A 3IVKA 5D5MB 5GS1B