3GPSA

Crystal structure of the f87m/l110m mutant of human transthyretin at ph 5.5
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
115
structure length
115
Chain Sequence
CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPMHEHAEVVFTANDSGPRRYTIAAMLSPYSYSTTAVVTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel Zn2+-binding sites in human transthyretin: implications for amyloidogenesis and retinol-binding protein recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Transthyretin
total genus 27
structure length 115
sequence length 115
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 3gpsA00
1GKOA 4PVNA 3CXFA 3P3UA 4Y9EA 5DEJA 5FO2A 5AYTA 5CLYA 1KGIA 1DVTA 2B9AA 4MRCA 4TLTA 5L4JA 3W3BA 4ABVA 2TRHA 4PWHA 2G3ZA 3CN2A 5CNHA 4ACTA 2QPFA 3GRBA 3I9IA 5CN3A 4TLUA 4L1SA 1DVZA 2F8IA 4D7BA 1DVSA 4FI8A 3IWUA 4PMFA 1TZ8A 3CFQA 1DVUA 4MRBA 4PM1A 4DEUA 4HJSA 2WQAA 4PWIA 3IMSA 4WNSA 4FI7A 4PWFA 4YDMA 5AL8A 1Y1DA 1IIIA 4N87A 4WO0A 5L4FA 4IIZA 4IKKA 2F7IA 4ABWA 1Z7JA 1BZ8A 2H0JA 2TRYA 2FBRA 4N85A 4Y9BA 3NEOA 5E23A 4HJTA 1TT6A 5CLXA 2NOYA 4PVMA 1E3FA 2B16A 2G9KA 4TNGA 1TFPA 3KGTA 4ANKA 5CM1A 1BMZA 3IPEA 4PMEA 1ETA1 4ABQA 1GKEA 1G1OA 1TTCA 3CN4A 3FCBA 4IKLA 3B56A 5CR1A 3IMTA 1IIKA 5HJGA 5JIDA 4HIQA 3OZLA 2G2PA 2H4EA 4QXVA 3Q1EA 3P3SA 5K1JA 3GLZA 2H0FA 5L4MA 3QVAA 4Q14A 4Y9FA 4Y9CA 4TQPA 4ABUA 1TSHA 4AC4A 3DGDA 3IMUA 3HJ0A 3D2TA 3KGUA 3TFBA 2G5UA 2ROYA 5DWPA 3NEEA 5K1NA 2QGDA 1ZCRA 3IMRA 3DIDA 1ETB1 3CN3A 5L4IA 1BM7A 1FHNA 3A4EA 3FC8A 2GPZA 4I87A 3BSZA 5IHHA 4IK7A 3TCTA 1IE4A 3CN0A 1QWHA 4QRFA 1SOQA 2H6UA 5FW6A 4TL4A 4L1TA 3CBRA 4QYAA 3GPSA 3I9AA 4PVLA 4TLSA 5E4AA 1F41A 5A6IA 3A4FA 4WNJA 4Y9GA 3DJSA 3DJZA 1SOKA 1DVQA 5BOJA 1TLMA 1BZEA 1E4HA 5AKTA 1THCA 3U2IA 4TM9A 1DVYA 3KGSA 4IKJA 5E4OA 3NESA 2G2NA 5JIQA 4HJUA 4AC2A 2H1XA 1IJNA 2GABA 3CFNA 3ESPA 4DERA 4TQ8A 2G4EA 2QGBA 5JIMA 2QELA 5CLZA 1TTBA 4KY2A 3P3TA 4IK6A 2G3XA 2QGCA 1OO2A 4PWEA 3DJRA 1BZDA 3DO4A 3IPBA 5AKVA 3U2JA 4I89A 1SN5A 5AL0A 4DETA 3NG5A 1TYRA 4TNFA 3DK0A 3IWVA 4TKWA 4I85A 5EZPA 1E5AA 1X7TA 3ESOA 4TQHA 3GS0A 1DVXA 1SN2A 5FW7A 4TQIA 3GS4A 1ICTA 3DJTA 4TL5A 4PWGA 5EN3A 3SSGA 2FLMA 4HISA 2IGLA 4YDNA 1RLBA 2ROXA 3GRGA 3ESNA 4PWJA 3M1OA 1TTRA 3IMWA 2B77A 3CN1A 1KGJA 2H0EA 3IMVA 3NEXA 4IKIA 4MASA 1X7SA 4PWKA 4TNEA 4DESA 2QGEA 3D7PA 1SN0A 3P3RA 5FW8A 3GS7A 1TTAA 3A4DA 3DK2A 4TLKA 1QABA 2B14A 2G4GA 3CFTA 4N86A 1U21A 1FH2A 5AKSA 1THAA 3I9PA 1F86A 5TTRA 4DEWA 2PABA 3BT0A 3CFMA 1ZD6A 4FI6A 3OZKA 2B15A
chains in the Genus database with same CATH superfamily
1H5BC 4QKTA 2Y1ZA 2OL3B 3D85D 3Q2VA 4KTEL 5AYTA 3ZKQD 2O61B 5DR5L 5CAYB 3ATBA 4N2OA 3RKDD 1BZQK 3CNKA 4KK6C 4H26B 3VFSB 1KXHA 1ORSA 1G43A 3A47A 2IQ9H 3GF8A 2MSPA 5EWIH 4H8WC 1CFTB 2MNUA 4HIXL 3VQLA 2BP8A 1O9ZA 2Z4QB 3IDXL 3BPCA 3WIFA 1G9NC 1WIOA 1TENA 5SWZE 2FUTA 1CIUA 1J86A 5IW1A 1FNGA 3CZJA 1NGQH 4R5XA 2QKSA 1KIRA 1MCEA 1X7QA 5JHDB 3BFQG 3MNVB 1OB1B 4LCWE 4XCFH 3VCLB 5JOFB 3EO0A 2P44B 5KG9A 1T66D 3QUGA 2YN3A 1EWHA 2OM5A 5CIPA 4BFNA 2AQSA 4CBZA 4HWZA 1LEKA 1MVUA 1VERA 4UV7L 5HJBA 3WFCH 3TL5A 3WKYA 1BIIA 4CADB 4ODWB 1SHWA 5TE7L 4IGBC 1ERNA 3HHSB 4DZBB 1P69B 2FH6A 2SEBA 1PZ2A 3V0JA 3VM7A 4XNAA 4KQ0A 3H1ZA 4GAGH 1XDTT 4RGNE 3ZQWA 5IFHL 1KLGA 3VFRB 4Q6IA 4EOWH 1XT5A 4NZDA 4QTFA 1IGJB 1RVFL 3CN3A 5I15L 3FRUB 4NLAA 1ZLWH 2R0ZH 1NICA 4R5TA 3GIVB 1T83C 3Q9QA 5CBEB 3PRZA 4W70A 4KZ0A 1IE4A 2PYFB 1HNGA 5FO7B 2E7BA 1LXMA 4M7ZB 2GY7B 1NKRA 2B3RA 1CYGA 4H8UA 3F8UB 1FBIH 1MIEL 2AABH 4FJ6A 1QMUA 2KDGA 3WY3A 4L1BA 4OGAD 1CJYA 3OKOB 2FZ3A 4RMVA 4K8RL 2FO4B 1J48A 1I82A 3OKKA 4IHOB 3RZCB 2QELA 3QI9C 5I0ZA 1IAII 1OW0A 2XC8A 4NO3B 5I71B 1MLBB 4O4YH 1WFJA 1MAMH 4NQDE 4BZ1H 4HT1L 4BH7B 1PEWA 3KLKA 4X4XA 2C7UB 3O11B 4O02B 3WOVA 3L1GA 4IW4C 4MD5A 2DIEA 3GXIA 4QTIL 4DKAA 1SLUA 4ZO9A 1JF6A 3LTVA 3WS3B 4S1SH 3VRJB 2E27H 5AVWB 3K91A 2DYPD 4U6TA 4GPVA 2D03L 5F89A 3SDDC 3T6QC 3NJKA 4HIPA 4FP8H 2VLJE 3GRWA 4AQOA 1A22B 1TTAA 2V2XA 4PJHB 4YSPA 3RURA 4FG0A 1ZLVH 5IMMA 2E7LC 3AREA 4ATTA 3JBG7 4PJXA 5FWQA 5I8CB 4PJGF 1ZOXA 1MFDL 3FTVA 4QJ3B 4UAHA 1IGFH 3WN5B 1DJGA 1T5WA 3MLRH 2C9UA 2EXWC 1CD1B 4J3OH 3NK3A 4OCSL 4TUOB 1UA7A 3IJSA 2FWLB 5IEHB 4R4ND 3TN0B 3BVXA 3HB3B 1FFNB 4M29A 3RGVC 3VSUA 4B60A 1SVZA 1SEBA 1KYAA 2X05A 4AYSA 5CUSH 1L3NA 4PJBF 1HEJC 3MLVH 3V0VA 3DNKA 3FTZA 1FVDA 3A6BH 2VITA 3S6CA 2PF6A 5FO9A 1BREA 4P5MA 4X6DA 3TT3H 4JM2A 3WJMA 4F3FA 1MJ8L 2VCOA 4AMXA 4K7PX 1A7OH 2Z6FA 2EVHA 2YD3A 2QVMA 3TWYA 5DMKB 4HJIA 1L9QA 4JBSA 2VAJA 4ZUWA 1LEIB 1QFWI 4IRJC 1S5IH 3ZJAA 3CZLA 4KKCC 1JPGA 3QPXL 4H8QA 5EU6E 3T65A 3TIEB 3OZLA 2AJYH 2DYPB 2ATPB 1DHKA 1G1YA 1VGKB 4ZUUB 2HT3D 2ZCLL 3EUUA 2VQUA 2ZKXA 2BWIA 1H0DA 2XWJA 4U3XA 2SODB 4KTYA 5EORH 4PGBA 5DO2D 1AFVL 2C1OA 4AL8H 1C12A 1RQ5A 5EOCL 4NI6A 4R0LC 1Z9PA 5E8DH 4C4KO 4AIZB 4PG9B 4HUXB 3S37H 1VEPA 5FB8B 3WEOA 1X6LA 4B0MM 4RIRA 2X6UA 2X4TA 1GGBL 1QWHA 3BLKA 3BPOC 2UYLA 2Y2TA 4G9FE 3FO9A 4FQXB 4XPHH 5B3JF 3C6LD 5A2AA 3EJYD 3UIYA 2HLFD 1V7NH 4PGDB 5HBBA 4UOJA 4ZW7A 2AK4D 3MSPA 4IKJA 1HHGB 4HBQA 3LOWA 3VU2A 1YEEL 2H41A 4I3GA 3BVDB 1ZGLM 1J5IA 5LNDA 5IFJB 1K8DB 3JXAA 5BRZD 4G6KL 1T0NB 3DJRA 1O5DT 3ZK0A 4NFCA 3RAJH 2ARJA 1VFBB 3FUJA 5LHDA 3UTZA 1F56A 2FH8A 3SGEH 2IADA 5KYWA 2OJZL 3HE6B 3NFPB 4HPOL 4PJEE 4K4KA 1OY3B 4N90E 4XO4A 1HINH 1RJYB 1YHPA 3KL3A 3TZVA 5LG6A 3IJEB 2YOCA 3NIGB 1ZEAH 2WXJA 3U36B 4F8NA 4EUPA 3EJTA 5IT2L 3AU1A 3O2DL 4Q97A 1JHLH 4EMZA 3C2SA 2WAQA 3BUYB 3QIBA 4MA1C 4RWHA 5EOQH 5AKSA 2IBZX 3NIGE 2EXTA 3MBEC 4FXGA 3IGAB 1HH6A 5HJDA 2JH2A 2ZUVA 4UV4L 2DH3A 4YZFF 5HVHC 2NW2A 3ZSTA 4S2SB 3DRTA 4L4TD 4PGEB 5DFAA 4BA8A 1GYWA 4N0CC 3NSDA 4DJMA 3I9GL 3T0BA 3EAKA 3L4XA 3T4YA 4ZD3L 1KYOK 1G4RA 3VXRE 4OQ1A 4HGMA 5IJDC 3WXWH 2H0JA 2ICWJ 2XVKA 5DVMA 4OGYH 4E5XB 1JYVA 2FSEA 1KIPB 2KLSA 1XR9A 2EADA 4YBQC 3NABH 3D09A 5K93A 1NGQL 4X50A 3CN4A 4JQVC 3QHZL 1I1FB 4J27A 5DJAA 2CKNA 3ZHLA 2CIKB 3AVEA 4B41A 1UM5H 5LAXB 2YAPA 1FRGH 1I1RA 4NCC2 4U6YB 2N7SA 2ISDA 2V2WB 2HJLB 3BGFB 1S7TA 2FSDA 1DLFH 4Y9FA 5D2NE 5I1LA 3NZSA 5I76A 2UZXB 4U2ZA 3ZDYB 4P2RB 3B6SB 2P24B 2PW1B 3SCMB 4A39A 3VYPA 2MMXA 1ORQB 2VGLM 5E4EC 2PWDA 2AMUA 3OL2A 4QXGL 3RL1A 1TNMA 4JFTA 1T04A 1T4KB 5LWYL 4I3RL 3QWRD 5FF6B 2BHZA 1TEGA 4U1NA 5KZCB 3MC0A 4GEIA 2CUMA 1MWAA 4AJ0A 2JE8A 4J4PC 3FQTB 2BRQA 4FFZL 5FS5A 3ZE1B 3H3PH 4K5NA 4XPBL 2XG4B 1PJWA 4FD0A 4P57A 3CZEA 3ULSA 2NY0C 1KB9K 4L3CB 3FCSB 1F4XL 2W60A 1XTLA 5JIMA 4NZ8A 3VGBA 5ALCL 4PJCE 3RWGA 4KY2A 3FONB 1A6VH 4Z77B 3QZNA 2ZUQB 5HJ3B 3L7FB 1X5MA 3U2JA 3VSVA 1GC1H 2FUQA 2ZF8A 5J1AB 1ZPLA 2ICWB 1QO3A 3N5AA 2Y3NA 3FQWB 1G6RB 4UQEA 1J88A 5DU7A 3CAFA 2XICA 5CCKL 1EXGA 4JANA 1Z6JT 3IJYA 3HZMB 3V52H 3DECA 5MERA 1HQ4B 1ZSDB 2TAAA 1U3NA 1P0SE 4YHYB 2G60L 1KGCE 1QSVA 3V8OA 3NCCB 3ESUF 2FWUA 2CIIA 3JZ7A 5LNGA 4QHKI 2A9NH 4KVPA 5F9OL 1FO0L 1KNOB 1THAA 2V7HA 2W65B 3TBYA 1H5BA 1JWMA 2X4UA 3B1TA 3SYOA 4MQXD 5TGBA 3NQIA 4BZ2L 3F7LA 1DVTA 4WW2C 4Y1AA 1IEBB 2XQ0A 3GK8L 5LXVA 5A7EA 3BSGA 4RZCA 1NIDA 4E0RB 5ITFB 4ZMAT 4YZFE 3PDDA 1NBQA 2XKSA 4DUVA 3NH7L 5T1LA 4QAMB 4GMSH 3P0YL 4BKTC 1XFPA 2OLDA 4XP9H 5HD8D 4C54A 2NY6D 1IB5A 1NCWH 3NIGF 2F08A 2CR6A 1RL1A 2QVIA 3FTYA 2VWEE 1GGCL 3ATAA 1E3FA 5C3TA 3UG4A 4DN4H 2ZUYA 4AM0Q 5TF0A 3EGSA 2IV9A 1MLCB 3GBLA 3M17B 4WUUE 4Z8FL 1F11B 2WVVB 2FE0A 1A2YA 5JYMA 5KBPA 1IBYA 5AB9A 1YCSA 4OQTA 5H94B 3P77A 3VXOA 4I0PB 1D5ZA 4PY7B 2YAQA 3KCPA 4IEFB 2C9PA 1S8DA 3NCEB 1JXGA 1OT4A 1ZE3H 5DJDA 1ACXA 1I9IH 3U0TB 5IBLD 3P9LB 3KPOB 3FXIC 3N85H 1MW3A 4G7YH 3CDZA 5IW6B 4XCEB 2ODHA 4KJYB 4L8DB 2Y6TE 3O3EB 5DC9B 2EUXA 1B4JH 1I7RA 1SYVB 1P5UA 4N3UA 1BAWA 4N5ED 2DLGA 1PU0A 5C0DB 2DL9A 2RCSH 1XCTA 3V6OE 2H32H 1J0HA 5JDJA 4HUCA 4WFFD 5T1LD 3HNSH 1Q9WA 3C08H 5FW6A 3MOQA 4MJID 4MKMA 5E1QA 4YWGL 3O2WL 3BP4A 4ZYKB 1IVTA 1A8JH 5KVDH 1KJMA 2WYHA 1T20B 1V7NL 3G5VB 3QEGH 5DJ0B 3KGSA 5DK0B 5AZEL 1WUZA 3T2PA 2X6BA 4LDEB 4DERA 2X44D 3FCUB 2OP4H 4Y19D 5DF0A 5IFAL 2IOIA 2ZUTA 4PJCF 1O5PA 5FGCB 5CSZA 4KI5D 4B9IA 2CXKA 5HHPA 4HUWB 2BINA 9PCYA 5DJZA 4M93C 3ZL4H 4XPAL 5GGUA 4EDXB 1V8HA 3C5JA 2A4CA 1EMTL 1J8HD 1WBXA 2ATKA 3ELQA 2ZP8A 4OFYA 2FJFB 2NXZB 3BLBA 3I3EA 4PJDE 3OXRA 4JZJA 4HBCH 3MNMA 5GRUL 1D6VH 4NKOA 2E6JA 1YZZA 1ZT1A 2ADJB 2F54E 1HX0A 3UACA 4N86A 4HUNB 1AZCA 4LCYA 3UYOD 5TF1H 3WFBL 3ZRFC 2XJKA 6PCYA 1S78D 1UB6A 2CM6A 4DO4A 4FAAB 1KBKA 3G9VA 3V0AC 1EK3A 3KYOB 3QA3B 5H2BA 3R7RA 4PRHE 3RKDC 2WXNA 2GCYA 4GUPA 5K39B 2F53A 4F8TA 2Q8AL 5DD0L 2BFGA 4F58L 3QJQB 4NKIL 4NBZB 3HAEG 3QQDB 3RNKA 5DD5L 3CZUB 1Y1DA 1W91A 4H88H 5E2VL 5F9AC 1OWRM 4UM9A 2BNRD 4FYSA 2CGZA 2YRLA 3MGAA 2D3VA 4GMTL 4LAQH 3FRPG 1YN6A 3NCYP 2YXFA 5KANG 1N7MH 4JN1L 4DNLA 1ZT7A 4XHQA 4NB7A 2Y2WA 3TYGH 1E90A 4U1LA 5EBMB 1AQMA 3TM6A 2E7CA 3KR3L 2AJZA 3ZHNA 2EC8A 2R4RH 2PW2B 2VR5A 2D7OA 5MI0B 2Z31C 1UM5L 5ICYB 1NLBH 4Y5YC 3NACL 1ILSA 1WS8A 2M26A 4WV1A 3TFKC 2VDLH 1JXKA 1Z0NA 3FTSA 4M7LH 5C09B 3ZQXA 5DUMH 5GGVL 4KK8D 2JVUA 3VXTB 4CAGA 1UZGA 3FQNA 2OZ4A 4GIPD 1KFAL 2LU3A 2NNFA 2PETA 1EJOL 4U1HB 3TCLB 3UTSD 5DRNB 1SEQH 5FYKE 3WFHB 1YY8A 2EH7H 2WQ8A 3BH9B 4FZEL 5D7JA 3NZUA 4A63A 3IXAB 4ZMVA 4F7MB 4TNVF 1J8SA 3BE1H 5ESQA 5DA0B 2CLVB 3PREA 3V55A 5DUBB 2CCWA 3PXJA 1UA6H 2X10A 4MAYB 2K6YA 1SUHA 2PP8A 3CWGA 4X98A 4HGWB 3TTYA 1YECL 1D2OA 2DQUL 5DS2A 5I0YA 4JDEA 3S35L 2VDNB 4U6VH 4AC2A 4WDIA 1OIOA 4NUGH 4DW2H 3FB8B 1OAQH 4IMLB 4I8DA 4BIKA 2PCFA 2VDOB 1K4DB 3KPMB 3X14B 5MEPA 3IPBA 2VDPL 3HZVB 5DZPA 2QKIB 4OM0L 4YK4C 4I9WD 1GC1L 4XN4A 1KC5H 2ESVA 3MRKA 3ZX1A 2FHBA 1NDMB 1UC6A 2DWEA 3QISA 2JJSA 3TZVD 3DX8A 1GSMA 1BW8A 3LH2L 5D1ZD 2WLLA 3DPBA 4YLQT 5E7FA 4Z7VE 4PGCB 5C9JB 1C16A 4XZUA 3FU9A 2H0EA 4WU5B 3BUTA 1HK6A 2H6PA 5JW5A 2QPUA 3L13A 4NZFA 3ARFC 3PGDB 4UOQA 3Q6FA 4NRXA 3SYPA 5E5LA 3AY4A 3RILA 1MQ8A 4PWFA 2OI9C 5IIEB 4PAZA 3CXFA 5A6MA 5CLYA 1KTKE 2OMNA 1K85A 3HKZA 4E41B 3UTPE 2Z1KA 4UQIM 1NCDL 1U95A 4ZS6C 1J10A 1G87A 5DS8A 4KRPD 3EO9H 1K5WA 4UTCA 1NEZG 1FH5L 3JTTB 4KKRA 3SD2A 4ZTPL 4PPTA 2KBGA 3EADA 5IVNA 3NTCL 3ZDXE 5FLVA 4X7FC 1QLEB 4ZTEA 3CHQA 2VNCA 5D7EA 3DMMA 4UQ2A 1AI1L 1IC5H 3KLDA 4PR5A 3CE1A 1VCAA 4G8GD 5IMLB 1MW0A 5JPMC 1ED3B 1ZK9A 3U9UA 3HMXA 2EYTA 3WS6A 2D3LA 4JFFE 3WYRA 4LHQB 4F91B 1QFUL 1CICB 2P5ED 3HKFA 5T5FH 2FBOJ 2WXMA 3BZ5A 5E0QA 1U2CA 4AXWA 4HFUL 4QRSA 4Z7VB 2YPLB 3QEQA 1EZLA 4X9GA 4MS6A 3ZHFA 3JTSB 3ARDC 4GP5B 4UNIA 3SO3C 5GISH 3KBFA 2EXWD 4QPEA 4N4YB 3OLIA 1NGWA 2CO7B 1J9SA 4MNQE 4A67A 1B0GB 1QA9B 1TVHB 4NRYB 4XPTH 1BPLB 2OXHB 4TSAL 4WNQA 3RWIB 3W9DA 5PAZA 1DBAH 5A16A 2ZXDA 3L1FA 4OZ4B 3R4DA 5HYSA 3QIUD 3BQUD 3HMWL 2GIMA 3E6FA 1WWWX 3UGEA 2H6UA 2NNCA 4Z9KB 3Q3GA 3ULUL 4TUJA 3BJLA 1WA1X 1JPSL 1MRFL 1PMYA 2HTLC 2NT1A 2RQ8A 2XU9A 4J28A 5ESAA 4RMSA 4A04A 3CU1A 5CBAB 5K9QG 4M6OH 1I4FB 4BRVA 2D7NA 4Z3IA 3FRPA 2J6EA 2MCG1 1NCCL 3JVFC 3QO0B 1P9MA 2X40A 2KI6A 2G5BA 1TTBA 5KVDE 1R33A 2H47C 1ESOA 3QDGD 3WIHH 1A9VA 2YBGA 4Y8DC 5ITBL 3QZOA 1CZ8H 4MB3A 1UFGA 2JCCB 2GHWB 1FNGB 3C09B 5JHDA 1E43A 3MFFA 3MNVA 2QHRH 3SN6N 1CXIA 1IL1B 5DK2A 2GBVA 5CIPB 2ADFL 1S2EA 3FO1B 3GZQA 4MZRA 4OGXL 1LEKB 1EMTH 4ICWA 3M1OA 2GBUA 4KJPD 4ZS7H 1IM9A 1EAPB 4OIFA 2DY2A 4ODWA 3S34H 4F2MB 1D6VL 3UTTD 4JM2F 4M43H 2A38A 5FGBA 4X6CF 1QSFE 2OFQA 2YAOA 3B1UA 4LL9A 1KCVL 2P49B 4IRSD 1BAFL 4WLCA 4FXKB 1IGJA 4MXWL 2VH5L 1VFAB 1VPOH 1WIUA 4X80L 4HEPG 4MAYC 3R8BB 3B7YA 4CVXB 1T2QH 5EUKA 2V17H 4HU2A 4Z3JA 4ZFOA 4PHZA 2C3WA 1Z9OA 2PYFA 4NNXB 4QHKJ 4E41D 3DBSA 3U2SB 3E8UL 1Y0LB 4JHVA 4XP5L 3QQ9C 1N59A 4L4VB 4OSUH 2W81C 1S9YB 1BQHG 4KMQA 2PWFA 2EIEA 4K3GA 4MDIA 3MRQA 3GHBH 3K6DA 5J12C 4P23D 2Z7ZA 1HHHA 3VDAA 2YD7A 5EV7A 1BZ7B 2FO4A 3RZCA 4JHWH 3KM2A 1J0YA 4MZ3A 2Q8BL 5CIPH 1HI6B 4HSQA 5ID0A 2VYRE 4P9HL 4YDIL 4R7NB 4YSDA 4BFRA 4HVBA 5JW4N 4HD5A 3LZQA 1PLAA 2FL5A 5EU3B 5T1DH 1PCXA 4AGOA 2YUWA 3CLFH 2E8YA 4PJDB 5L4MA 5TQ2H 4XMKL 4DK3A 1A7QL 2EUWA 3ULUD 2F18A 4KQ4H 4A7QA 2O5ZH 2EDKA 4EOWL 1EZVY 4Q9QH 4QCIB 1IAMA 1XSIA 3UC0H 1E2ZA 4FTVE 4OLYL 2DI7A 5EEZA 2XZAH 3GD1C 2JJTC 4KOCA 5IMMB 1R5IA 2YLHA 1KV7A 3PGFL 4PJ9B 1TPXB 5HDOA 2PCYA 3GWJA 4TTGA 2NY4D 2BVOA 3VU1A 3U4EB 3UJIL 3FH5A 3SJVE 3SYCA 3WN5A 1W2KT 1T5WB 4DKEL 4HIHB 3VFWA 5MP6L 1UA6L 4QRTB 5KAQF 2QBWA 4OJFL 1BGXH 2BVTA 1KPRB 3SDCB 2X4PA 1JGUH 2EDBA 3ARGD 5AYUH 4EQ2A 3GMNB 1FNFA 2VDKH 2Q7AA 1P9MC 1XGZA 4NOFA 4KAQL 1FNSH 5L7XH 1A4JB 3QJHA 3TC9A 5KYXA 2LLGA 3CUPA 4UB0L 1DZ0A 3T1FB 3L2NA 3V4PA 3H2PA 3EOYG 4HW6A 5T1JA 4NP9A 1XIWB 3TF4A 1KC5L 3MVSA 2X4QA 5HSFA 1OARH 4NN6B 1JPGB 3G6AB 2JIXB 4OUOA 3DUSA 3LVEA 1A8ZA 3PLYA 4FA7B 5C0AB 2FYVA 4RMUA 2H32B 1VEOA 3RY6C 2W9EH 4FLQA 3RWFB 2WZ6A 4KDTC 4ZFFA 4J8RA 2ZZUT 1BAGA 1P5VA 4RGMC 3EBIA 4JRXD 2DDQL 1YNTA 2XV6B 3GDCA 4FLRA 3OKMA 4HWBL 1Z7JA 2UX7A 3V6FA 2H1PL 1TU2B 5C0JB 1VGEH 2B9AA 4YXLL 3II3A 1AOHA 2XT1B 4JVUA 5GJSL 4JKLA 3KPLA 1UT9A 2P3YA 4PJHF 3BT2L 4H1LH 3G6DH 3KPRD 3FFCE 1A4KB 3MOAL 4YDMA 1TZGL 2D31A 3CVHL 1AZVA 3O6FD 4OTXH 5F7KC 2QDWA 4RDBA 2ZX9A 3O4OB 3R1GH 4NYLB 1NGPL 2P47B 4QF1B 1BZ8A 5F3BA 3I6KB 4RA3A 3T4AC 5JHLL 4JPKL 3WG7B 1UXLA 1OPGL 5ETUB 3HI6H 3HE7C 1Q9KA 3FOMA 4NXKA 3CPUA 2FEEI 4HFWA 4Z7QF 1OF2A 2QQNH 4KKBD 5L6YL 3IPEA 4DPAX 3GNML 4YXKH 2IBZY 3OKEB 4R9HA 4HCRH 2ARJB 3HFFA 4JRYA 4LHUB 2F7PA 4ONGH 5KYWB 2EZ0C 3IRPX 3QS3A 4OB5H 2OYPA 3V0FA 4G8FA 3D4CA 3I74A 4G7RB 4LLQA 3HUJE 3L3KB 1HDMA 3IJEA 3HR6A 3CFDA 4AUYA 3VGEA 1TZIA 2BDNL 2HKHL 3BAWA 5DQJB 2I9TA 3QUMB 1JWSB 4JY4B 1PL3A 3VG9B 1JVOA 2VLMD 4JDTH 2XDHA 5B4MD 1HKLH 1OZTG 3U9PH 3U30B 1J5CA 4TSAH 2O93L 3CHRA 3M1BB 1LLAA 3KPSB 4N22A 3QUHA 1PKOA 4ZXBA 3PHQB 1GYVA 2DIJA 2FIRT 3QULB 4KXBA 4DP2X 2D7TL 5KAQG 1I1AA 4WCYL 5ADPL 2NW2B 3ZE1E 3X1GA 3DRTB 1WISA 4ELMA 1BD2D 1NCAH 2J56A 3BH8B 2VKXA 4OLVL 3T4YB 4HS8H 5F7DB 4X83A 1FFTB 1MH5B 1Z2KA 4LLMA 5HP5A 4KI1A 2VLJA 2VDLB 3GMOB 2BY1A 5EO9A 4DOHE 3MRRA 5C9KA 2XTJC 2B0SL 2WSPA 2FK9A 3WFEL 4B9ZA 5GGSY 3ECBB 2Z9TA 4R8WL 4PRPA 2WGXA 1FGNL 4JGUA 4PN6A 5D7KD 3FPXA 2I7SA 3OM3B 2Q3AA 1HNYA 1KTDA 4O51A 4EI0A 1CLOH 4O2FB 3D0VB 3IMWA 3LXAA 4U6YA 3P9MB 1SXBA 1ZVYA 3FFDA 1JHLL 3N55A 5EBLA 2B39A 2WZPD 1S7TB 3MV8D 1NCHA 4Z1PA 1JHTA 4R26H 1NIFA 4AMKL 5CEXB 2AQ2A 3AQXA 2X9YA 3HFML 2K45A 2W1NA 2IJ0C 3MBED 2ETWA 1L6XA 2NY6B 1AO7A 2RB8A 1MRCH 4AYFB 1KPVB 4HKXB 1NL0H 4G83A 3N9GL 1BZOA 5I74B 4FNLL 4F1SA 2GSGA 4YHZL 3G6JF 4GQ9L 1JPEA 1YY9D 2DQFB 4CUCA 5J7CC 2IFFH 3ZOAA 4MMYB 2AI0L 1MCWM 4HJSA 1XB8A 2JKRM 2N7AA 3IMSA 3L5WA 4JZOB 1X5XA 5AL8A 4HJ0D 1QSFB 1IIIA 4DP6X 5IBUG 2R7EB 3BVNB 2VXQA 1IEAB 2EDHA 1EO8L 4GSDL 3D08A 4PJGB 1JUFB 4UU9A 2VUYA 1AD0B 2Q3XA 2R1WB 3RWGB 1RULH 2E7MA 3FONA 4NN5B 4F8PA 1PCSA 5ENWA 2AS5M 1RPUA 1F3DH 4RDQG 4AUJA 5ACZA 1WITA 3OC8A 2M2DA 2OA9A 3LNEA 5FA3B 1ZV2A 4L4VE 3T0VA 1OAXL 4JGNA 2QVFB 3QVAA 2DBLH 3HG1E 1EZUA 4UT9L 4XXCC 1ZSDA 1ECZA 5CEZD 1IT9H 1S7SB 5BZZA 1BOGA 4N68A 1E3ZA 3DURA 1G6RL 3QCTH 5EZJA 4KQ4L 1INDH 4XX1E 1GTNA 5EUOB 1DBJL 4L8BB 4X9IA 5I0VA 3FMGL 4OLYH 1OQOA 5ICXA 1CDIA 3N41B 2W65A 4W9DC 4QT5B 1HQRB 5T1KD 5SWQB 1EFXB 5DQDL 4OKVB 4BQ9A 4TLSA 5F3HA 5KYUB 1FPTH 1TO5A 2X70B 2CQVA 2ZSWB 3MV7E 3L9EA 4QRQB 5F0JB 1GR7A 3OJDB 4RWYL 4FQXC 4LOUC 3V0HA 1P7QB 2N59A 2ZKHL 1NAMA 2HRPL 3D18B 4Z7AA 1R1CA 1XGTA 1JGUL 4G9FB 5F0LB 4JVPA 5AYUL 2WANA 1EJ6A 4LCWA 4GXVH 3O3AB 4YDJA 1FNSL 1L6PA 25C8L 1L9SA 4GO9A 4P4RA 5TFSH 4IRJB 4N2LA 2X2JA 1UYWH 2XIIA 5DHEA 5E2TH 1NUGA 4XNYL 4G80A 1MFBL 1EVTC 4ZMOA 2ODIA 2BRRL 4IRZA 2PWGA 1OAUL 4ALAL 5D2LF 5IB5B 1HZHL 3VYNA 3O2DA 2FX7H 1BQSA 3BSZH 3O81A 4K8RC 2LAGB 3BAYA 1ET7A 4PY7A 4NHCL 5DJ6B 3CN1A 4PREA 1S8DB 2NY2D 1F1DA 2OL3H 1YQ2A 4PRAA 1EGJH 3U0TA 3A6OA 3VG9C 3GIZL 1JXJA 4L8DA 1MHEA 3RFZB 3PHSA 3RDTB 2EC9T 4KVCL 1EFQA 1P5UB 1PKQE 2WQRA 5D9SB 1BEYL 1F6LL 5JXAL 3QFDB 3Q2NA 5HVHB 4GAAA 4WWKB 4Y5XA 4NENB 2D0HA 3KVPA 3MA9L 1MCQA 1YUHA 3QJXA 2JKJA 2O1AA 1EH9A 4L9LB 4I7ZC 5CGYD 5D1XE 3LXUX 2FWSA 4DP1X 1NC2D 3GXUB 5IP4A 2O6FA 3L1OH 5EEVA 1TR7A 1NDGB 3W11C 2VKWA 2XZQH 3LB6C 4JFFB 4WW1A 5JO5B 4K9EH 4LLWA 3VFGH 5EF1A 3IJHA 5BOPA 5LCVL 3WTVA 3BWAB 5EF0A 1JNHB 3DDFA 1KSRA 4PJHE 5IHUL 5SWZB 4X4YB 3PQYB 5HHPB 1NC4D 2AEPL 3KPNA 4YPGA 3GLZA 4UZSA 3Q01A 3QBTB 1MAJA 3HAEH 5JIPA 5E08L 3SQRA 4JO4L 3MACL 3OGCB 1DJYA 5GS0D 1COBA 4YL9A 2V33A 3W11D 2FJFA 3ZDWA 5JTWA 4I77L 4JKPH 5L0QB 3EHBD 1J1XL 2X7LA 1KIQA 4K3EL 1O7VA 4PJ8D 2YAFA 4XOCA 4WGWB 3PUUA 2AV7B 3RVXC 3UZQA 4M56A 3VI3A 4Z3HA 3BPNC 2EYRA 3EYOA 3HNSL 4I88A 4IIQB 4FKHA 4LGSB 2AJSH 4L37A 5IKCB 5EEUA 1VEMA 1T6BX 5CFAA 1SF5A 1NLDH 1YYMH 5EEYA 2X9ZA 3ALPA 3JSSA 3LHAA 5JW3L 3ARGC 4RVBA 1OSZB 2GSMB 2HPOA 4WW2F 4M3HA 4KZDH 4JPWH 2BCMA 1CFVL 2WBJB 1GJIA 5E0FA 4PW3A 4R97B 2WCPA 5J1SC 3PQYE 4YXHL 3ZTCC 1XZ0B 3I02B 3MGOB 5E8NA 2DQGL 3GUFA 5CLWA 5LBSH 1FGNH 1NOLA 3H42L 1N2RB 4G9DA 1ZVNA 3NIDF 4QHLB 3X11A 2EQDA 2ZOLB 5CR8A 5SX5K 3HNTL 2OYLA 4OZFH 4CMMB 1TQVA 4KROC 2WWOA 4KDTA 3RY5A 4Y1SA 5DJXB 1HZLA 5CJOH 3NVQA 2PXYC 3AM8C 4QHNB 2CU9A 1UH3A 5FX3A 1HTYA 3B5TA 1M6UA 1ZDSA 3QRBA 4BCXA 5FOBA 2I60H 3AY4C 2J12B 4FHKA 1QRKA 5DRNA 3AXLB 1OGSA 2VLLB 5G4OA 2NDFA 2EDYA 5E2UH 3N41F 2VDRL 4FNLH 1BFSA 4I48B 5BO0D 4JHAH 2R15A 2OR9H 4AM0A 4NQEE 5C09E 2X1XR 3NIFF 1F97A 5D8JL 4OZGF 5BMFL 5TD4A 1DO5A 3ZE0F 3DTDA 3CDCA 3MRMB 1EAQA 3NN8A 3POCA 2G75B 4HGWA 3WUZA 4N2AA 2OYMA 4JDEB 5EO1B 3KNBB 1IKNC 4WDIB 2C7FA 4YHNA 4WTZG 3TBBA 3O41B 5H37H 1K4CB 2IBBA 1TNNA 4QNPE 1EA9C 2JIXD 1C1EH 4UTAL 1N26A 4OAWA 4AGMA 3LS4H 4NKMA 1XIWD 3Q8BA 4XTRC 5JNYA 3V4VA 3IETA 1DZBA 5I1KL 3BESR 3FB7B 1S5HB 2F5AH 3UAAA 2IANE 4LSRH 2HCZX 5IVXE 4GY4A 1FVEA 3A22A 2Y06L 4P3CL 3FF7A 4KUZL 1EBPA 4YVUA 3SE4A 4O02L 3LXBA 4LSSL 3QCTL 2EH7L 2Y7SA 3QARA 4FZEH 2J57A 3LS5L 1T7VA 2WV3A 3Q6FB 1TUPA 3U1SH 1Z9SA 5KSAD 2WQXA 3SO5A 2AZAA 1G5GA 3ROLB 4HXBL 5D6DA 5SWSE 3KMDA 1I8IA 3EF7A 1EHAA 4R4BA 4MJJA 1B0IA 1U95B 3VDCA 1E4HA 4KX9A 1BF8A 3JV6A 3NCJH 2EKJA 4J2QA 2RHEA 3HS0B 1OAQL 3VWJC 4C4KT 1KIRB 1CGTA 1M1SA 2AZUA 3QIBD 1HNFA 1OB1A 2Z0UA 2QADC 5CMAA 4UQ2B 3Q6GH 1OANA 5KVFL 2A5UA 3LKRA 5AL0A 3V0EA 4B9FA 3UTQA 3RA7L 3JWNE 4H8WH 5E9DE 3D5OF 4ES8A 2EYTB 3W56A 3ALXA 4M6AA 3DV4A 2VMFA 4V1DB 1CFQA 4WFFE 2BFVH 1V7ML 1HJBC 1JHKH 3G3LA 4WO4D 3ARBC 4HKJB 1TETL 4XCNA 2ADYA 5CP3A 3GJFA 5L8LB 3FH8A 4Q6IB 1HH9A 1YQVH 4TSBH 3W9EB 5HDBF 2R83A 3NSXA 2EVFA 1EUTA 3MJ7A 1SYSA 2WO4A 1RIUL 1CF8H 3BO8A 4IIQC 4RDQF 3MDJA 2CD0A 4H20L 5MENA 2X41A 4HKBB 4UTBH 5A16B 2F8IA 4BZYA 4DP4X 5D6DC 5DRWB 3ZYIA 1MNUH 4UTAA 3QEQD 2PO6C 2DJSA 1VHPA 4JO3L 5ESAB 3BDBA 2F6AA 1E9QA 5TQ0L 5CBAA 4F33B 1LJMA 2AVGA 2VXSH 5I5MA 5C3LD 4PJ7B 4UIMA 4PBXA 5CCHE 3ZKND 2Z7UA 2J5LC 3OR6A 3HG5A 4K9EL 1P7HL 2UXFA 3O11A 4FDWA 4KO7A 3ULVF 4HQQH 1WIPA 2PPAA 3UZEA 4Y4KA 3S3DB 1HE7A 1L9OA 4DGUA 2ZICA 4M1GL 3WJJA 5J0BA 5KVGH 4PRBA 4UT7L 4S1RH 3IFOB 3PP4H 2NTSP 2IAMD 4JFED 1IL1A 5DK2B 4Z3FA 4G42A 3LKOB 3FO1A 3CC5A 5CEZH 2F7OA 1TJHH 3MACH 3QDGB 5ID1B 4B3EA 1UWEH 4FQ2H 1KENL 2CPUA 4PJXB 2Q2LA 3TOPA 1K6QH 5AAWC 3WXVH 4EZKA 3QP3A 4HS6A 4E9QA 3L3OB 2B7DT 4E9LA 1TYJA 2H8PB 2Y1VA 3VX0A 1J1XH 3O3UN 3F62A 3IJSB 4K3EH 2J55A 2X6AA 3QIWA 1QLFA 1JGLL 4NO5B 2CO4A 4MZIA 5DHDA 4JJOA 4WHDA 5DJCB 4K5MA 2WOYA 5SX5H 4HA1A 5E8EA 2CDEA 3KZ8A 3P0VH 2VITB 3MJ9L 3CMOL 5FO9B 5I6NA 4K23H 3TBWB 2MKWA 3K7UA 4WHTB 2AF2A 2AXGA 1RHHA 1MW2A 4LNVA 1FZMA 1R3HA 2XPYA 2QGBA 1S9YA 1TJIH 4UTBA 4OCXL 1S7QB 3MRQB 1Y6KR 3VH8G 3CFKA 3WE1A 4DFHA 4KZDL 3OHXC 4CSTA 1J1OL 4LMQE 2AEWA 2XPZA 4UQ9A 1XGYL 4YOKA 5FGSA 3SE8L 4Y5YB 4NPKA 2AEIT 2EVJA 2XWJB 1H0DB 4K9JA 3NGBC 5ECGA 3DSNB 1I7ZB 4YLCA 2J8UE 3IJ7A 3H0TA 1A6TA 2GB2A 2NXYB 1TVBA 2ARWA 3SQOL 1BBJA 2AK4A 2EDMA 2CJ3A 2VM9A 4LPXA 3EJZC 1C7TA 3V4UH 1AAJA 3T2NL 3KBPA 3PNWA 4MWFA 2OKMA 3A3YB 2UYLB 2X3CA 4LASH 4XMZA 5DVOA 3UTSA 3EG9B 4Y2NA 1L0XA 5ABZA 4HHAB 4LVOB 4XOAA 5D1QB 1NCGA 2UUDH 2YBRB 5D96C 1FSKB 3VFWB 4LCWD 2Q20A 3WNIA 1M7DB 3NP4A 5PCYA 4NUMA 2NOYA 1E40A 4JHWL 1RJCA 5HGDA 1LD9B 5CJBA 4ZX3A 4MMZB 3ZYJA 1NBYB 4L8CB 2IADB 3HE6A 1KN4H 4O9HH 5ABAA 3FCBA 1YC7A 2CK0H 1QASA 3VXUD 1KLUB 4FQQA 2IWGA 3PWLB 4PLJC 5TE4L 4JQIL 3TZVB 4Y2DB 1OP5K 4KXDA 1IC4L 3HVNA 4WI3A 3U36A 4YAQA 1OAKH 4EUPB 4GP4B 1JYXA 4RGMB 1EV2E 4YVNA 2BY2A 3STLB 4HC1H 3PFUA 2FJSA 3Q8CA 2QR0A 4O5LH 1Q0YH 2CDFB 5K33A 3TT1L 5IR1A 4Q9QL 3Q1SH 1UACH 3ZDYE 4K7PL 3EBGA 1GMIA 2BP3A 4UT6H 3H2WA 4P46C 4MA3B 4I87A 1E4WL 4JFVA 2PCXA 3NCBB 4I5BA 3VRIA 5C0NC 4RGNC 3SB3A 1CXEA 2F8VA 3CD4A 2C34A 2NNRA 2YRBA 3T0WA 1RURH 5A6IA 2NY7H 4MXVE 5DHVH 2D4FA 2DM7A 3MRIA 3SGJC 2IDCA 2FSEB 4WKZB 3KPQB 1FLRL 2H26B 3D50A 4G6JH 4JJHA 5HPOA 2QSCL 3UYPA 5J57B 3IDMA 4MNQD 3OHXA 1M1XB 5E4IA 1D5MB 1OE2A 3T71A 4GG6E 3VXMB 2L0DA 1CC3A 4JCLA 2CUIA 2PR9A 3OB8A 5GGRB 1YEKL 3VXSA 4F57L 1HN1A 3C09C 4B5EA 5EEXA 1IX2A 2W0FA 4GKSA 5TE7H 3CMGA 4RSYA 4JZNA 4FL4C 1A7RH 3MGTA 2H2SD 3LN9A 4OZIE 1QHPA 4UAOB 1EXUB 3VQ2C 1A25A 4YDKH 5AAWA 3EBAA 3ZKXB 4APQA 5FYKL 2FJHA 2EDQA 5DZNA 3CFDB 5LGHL 3QJVB 2FCBA 5EG6C 4GSRA 4ZFQA 1JWSA 1SFHA 2HB0A 1H6UA 3QC5X 4RAVA 4TNWF 1RIUH 1V55B 1AP2B 1Q1PA 5TDNB 3U0WH 4BGDA 2BIPA 3FQTA 1R75A 2WYIA 5F9JA 1J05A 4C8XA 3E8VA 1IUZA 3L95A 2XG4A 5IBTL 4UQDA 2VDOL 4L3CA 3NP3A 2W60B 3O0LA 4KH2A 4E2OA 4YE0A 4HEME 1OPGH 2NT0A 2MJWA 2YZ8A 3BH8A 4ZRGA 1T1XA 2X87A 2C8NA 2BOCA 4G7SB 2QQNL 1RPKA 2ICWA 4YN3A 4G6KH 4HT1H 1OGAE 3RVVD 2I5YL 5DD1L 1I8MB 4OGAC 3LPFA 1HYRC 2HTKC 4OFKA 4JANB 4AG4H 3BGMB 4CN4A 3CDFA 5BS0E 3ZO0A 4M3KB 1H3WM 4IS6A 4ONGL 5FKAA 1YEFH 1CR9H 4QXVA 1LL1A 4XHJD 1PIFA 1QPKA 3CTTA 3DO3A 2BJMH 1JGDB 3EH1A 2X4RA 1CG9A 1D5IH 3FU7A 2H2PD 2CIIB 4KVNH 4ZUTA 2ORBL 4MA1B 2IANA 3SCMC 4H25B 4N9GB 4ZBJA 1OM3L 4O51B 4PS8A 2CGRL 2V7HB 4ZK8A 3LRSB 3GKWH 2WINA 2HFFB 4G70B 5H35A 4PJFE 3Q2WA 3P9MA 4FQ2L 4Q6YA 3DX2A 3F83A 3IMRA 3MNWB 1OAYL 5FM4A 4UBDC 4GUQA 1FHNA 5FIEA 1MQKH 1MF2L 2MHAA 1T21B 3TA4D 1BJ1H 4HC1A 3QWOB 3O45B 5GZNA 4YR6A 5AW9B 4UV4H 2ZWZA 4HKXA 4DWHA 1B4RA 2ENQA 1SOXA 2IPTH 2VRKA 2VLRB 3QHFL 1WG3A 4LLVB 4TVSa 1UXMA 3G6JE 2E0PA 3GSWB 2KUTA 3MJ9H 1W0VB 4V2BA 3TONA 1A14H 4C56A 4HJEA 2W80C 4PP2A 2OMYA 4LP5A 4OGYL 2LVEA 1F11A 3BKCH 3BVNA 4I0CC 4LLUB 5EZLB 2YXWA 2B0SH 2YPLE 5MEOB 1RU9L 1MG3C 1D5ZB 3TEYA 2ICEC 1BM3L 4KZCA 3CFUA 3QHZH 4X6BA 1VZHA 1JRHL 4XC3L 3W0WB 3BZEB 3KVQA 2WXPA 2P5WA 5F9WB 5I1CL 4KNSA 5A2JH 2YAEA 4PWGA 1JNNH 4P59L 1ULVA 1HAWA 1L5GA 1TXKA 3GXMA 1LQBC 1AXTL 4KJYA 2JB6A 4J6RL 3SPIA 1DLFL 2Y5TB 4RFNB 4FG6D 4TPRL 1RV6X 1SYVA 5IWLA 5CGBA 4GXUN 1EPFA 4MCMA 3HFMH 1WWAX 1IZKA 5DZ9A 4Q74A 4TQEL 4ETQA 1WRFA 1XF5A 4WI0B 1KWGA 4WK4B 1BVOA 2ALAA 2YEQA 5DRXB 2B5IB 1LYQA 2IG2L 3DYOA 4GYBA 4Z7UA 5EZIH 2DQJH 4JPIB 3STZA 1OB0A 4XNXH 3QR0A 4OCWL 3SIKA 1HQRA 4NQDB 4XN9A 1HWWA 3MRFB 3GJFH 4OKVA 4OD3L 4V2CB 5CSBA 5KSBB 2YRZA 3TX4A 4ISVA 2VR4A 3FU3A 4QRQA 5LB1A 1HVXA 5BVJB 1U8OB 4WHYG 3RNQB 2CBTA 1PLCA 3IEAA 4F8OA 3LV3B 5LKNA 1F4XH 3HR5A 4LE8A 1XHHA 3BPLC 4PLKC 4LCWB 3K81A 5E6IB 1N5AB 2E6QA 5F44A 3BRFA 2YEZB 3O3AA 4ABQA 4NGHL 3QK0A 2NY5C 1MCOH 4HPOH 3C5JB 1QFOA 4A2LA 3NFNA 5IB3A 1UD2A 2O72A 3WHXB 2UZIH 3BYTA 1GS7A 3B2UD 1OAXH 1WGVA 2DBLL 3V52L 5D7IE 2XTJD 1OAKL 2PYEB 3L3HB 1OE1A 3NSCA 2HVKA 5B21A 4RMQA 3P54A 3RVWC 1FGVL 4UYPA 2FO1A 2CJTA 1RKRA 5ADOL 3RDTC 1JNLL 2ERJC 4PJ9D 3BX7C 5DWPA 4ANWA 4ATWA 3WL9B 5DC2A 1WT5A 4MCYA 2H6OA 3LCYA 2I7OA 2X6VA 3DROB 4NT6A 4JM2D 1OTTD 2VN5A 3NJLA 1CDJA 3WI9A 3V2AR 5KVGE 2YLKA 4QWWD 5EU6D 4WFHD 2FJGA 4GBXC 4NAJA 1J5OH 1XEUA 5FXCH 1NGXB 5IQNA 1RURL 3KE0A 5K9OB 1P4UA 1QW8A 3B7RL 2EIJB 2VZVA 3IDYB 3B7SA 5AVVB 1NCNA 1V3MA 3OR7B 5HDBE 4QRPB 3VXUB 4KMLB 5MEND 1E2VA 1NMAH 4I2XB 3U6RA 4L9DA 1DE4B 1YEIL 4OUUB 3P30L 1SN5A 1FZJA 3OZ9H 5B1JC 2DLFL 2DQTL 2E47A 3BWAA 4MBRA 2JJUA 4N0RA 2ZG1A 5DO2C 1HZHH 1EDYA 4MLSA 4X99A 2X0WA 4AEHL 4WJ5A 1BX2B 3FQNB 5KSVA 1D6EA 3SODB 3IXTA 4N25A 2OMZA 4TNEA 1CLZH 4HCIA 3IFPB 1XH3B 1XH0A 3LKNA 4YSOA 1Y18B 2R1XB 3H4FA 3BH9A 4UNUA 3RL2A 2NZ9C 5DUBA 3RX5A 1RZFL 4MAYA 2X7LB 3CHXA 5HDQL 1J11A 1ZLDA 2Y0SA 3CN2A 3SGKC 4X98B 2AV7A 1W0WA 1FJ1B 2WB7A 4LKCB 4ZOBA 1IGYA 3FQXA 5EA0H 1AJ7H 5IKCA 3T77A 4X8GA 3LH9A 4XNBA 1JPFA 3KPTA 4X7DC 1RZ7H 3FKUS 5DJ8A 1TZOA 2YSTA 3BIBX 2B1HH 4XI5D 5GSVA 4FADA 1LP9B 3L4CA 4H7VA 1MCNA 4L2LA 1AGDB 1WS7A 1XR8A 2QT6A 3HZVA 3KL5A 3UL4A 1JI1A 2QKIA 1KBBA 4BSVB 3MJ6A 1S7RB 3MRKB 1PD6A 4H40A 1F4YL 1JV2B 3KYMA 5TDPA 1IJ9A 4IHBA 5HY9B 1BJ8A 4YIQA 5C0BB 3DX8B 4F9PA 4NQEA 3D34A 2HMIC 3T3PF 1E5CA 2G2PA 1KG0A 2WUBL 1R3JA 1NQBA 1FP5A 1HSBB 3T3MB 5K1JA 3S36H 4WU5A 4R3SA 2Y7MA 1IQWH 2BJML 3JWOH 3L3GB 2DTSA 3GM8A 3X11B 4DT2A 4M7JL 3H9SE 3B9VA 2I26N 3DJ9A 3IDGB 4OCRL 5HI3C 4UNVA 1P4IH 5BUAA 3BP7A 5D4HA 4FFVD 4BFKA 3OG6B 5I5JA 2VMDA 1H6TA 1J5HA 3L4YA 4HMEA 2OTUA 3OJVC 4A2MA 5FOBB 2EP6A 3DRQB 1A3QA 3RUGE 2UY6B 2FX9H 4L3ED 1E8YA 4KO9A 2GUYA 3P0YH 3T3PE 1KCUL 3D3VB 4OF8A 4M9PA 32C2B 2Q8AH 4F58H 4OZFG 1MCHA 4I48A 4Z95H 1CICD 3HRZB 4AOFA 4Y4FD 3I6SA 3OWRA 4KI5E 4PR5B 4TSCH 5MEQA 5DEFA 1UZ8B 1PYWA 3VFVA 2WVUA 4IK6A 2J1WA 1QNZH 3TJPA 1SXCA 4HAFA 3SQBB 5IQ9B 1OW0C 3QUXB 4X6CE 3KNBA 4DETA 3NIDE 3QDMA 3O41A 1B4TA 1W6LA 4AXWB 1W72H 2Y36L 4KV5F 3QEQB 5HYJE 1NMCB 3L4UA 3QCUL 1UJ3B 3QGVA 4YS4A 2ZXEB 5IHBA 1B9ZA 1JZ4A 4OZIA 2ERJB 4NWUH 4KJQC 3NCFB 2KH2B 4YJZL 1KJ3L 1HCVA 4FRWA 3U4KA 3OAUH 4WK0B 1ZD6A 3EYUH 3N40P 2X4SB 1AD9A 3E6FB 4QRRD 3A67H 2WZPA 2WTRB 4M6NL 3BN3B 5E2UL 3HB3D 1Z9SB 2AMGA 2C3HA 3LZRA 1AKJB 3LZPA 1TCMA 1I4FA 5D8JH 3T8MA 3MA7A 5DHYB 4DAGH 1I8IB 1XGQB 4WNSA 3MRCB 5I8EB 4H8PA 2G5BB 5I26A 5SV3A 2CK2A 1KGCD 2G3NA 3S35H 4HOZA 1TT6A 4XMLH 3JV6B 2AFNA 2RA1A 1M7UA 2HXAA 4TNGA 4JLRB 5F2FA 4OBSA 4M48L 1SXZA 1RK0A 3HJEA 4AYGA 3L9RB 1AC0A 1GKEA 2J6EL 2PP7A 2W94A 5F6IC 3C8HA 5IROD 3B56A 2M1KA 4PFEA 1DFXA 4JMXA 4XPAH 1LK3L 1AC6A 1W8NA 2EVGA 2CHDA 3ARBB 2Y23A 1MCFA 4LLYB 1CLCA 2NNAB 3REWA 1JJUA 2NDGA 2AAVA 4L29B 3RY6A 4NKDB 1ADQL 3DV4B 4V1DA 5J11B 1MCRA 3RWCB 3GSNA 4BQBA 4YUEL 4EXPX 1F4HA 1R19A 1GMEA 4ETYA 2XWEA 3FYEB 5B39A 2E7LA 1E6JH 1JNLH 3GJFB 4EN3B 1JWUA 5FFGA 1ZGLA 3U1SL 5FOJA 4XN7A 3KLLA 4XRCB 5E4EB 3KM1A 1KCKA 3QJTB 4N8VB 2BM3A 2YGVA 2ITFA 2I27N 5HHOB 3GQFA 5DD0H 3ES6A 4JKMA 3TYFA 3FT9A 4PCKA 5D7IF 1CD0A 1Q9LB 1A4BA 3MMEB 4PY8J 3WKQA 1A0QL 1JAEA 4NZTH 4PI0A 2BSSA 4OW6A 3RDJA 1RIHH 3FTGA 3CFCL 4KDWA 4XMVA 5IHZB 5ALBL 3K6SB 2DQHH 4ZI8A 1ZJBA 2WAHA 4GAJH 4M4PA 1RD6A 2EDJA 4W1TA 1B3IA 1FAKT 1ZHLB 1Z66A 1KXVC 3NJHA 5DZVA 4BKSC 1QG3A 4R7NA 5JQHC 1WAEA 2GC7C 1ETJA 4GW4A 1PZAA 3MXVH 2X1WL 3IFNH 1KXQA 1IAOA 4CU6A 2VN7A 2CXGA 3IFOA 4Q56A 5C6WH 4PI2A 4XNQA 3P3RA 5DFVD 2N0MA 4G42B 1CLZL 1N67A 1LO0H 1OTSD 3GJEA 1SJHB 3I9PA 1OHZA 1MPAL 3BKYL 4U4BA 5IQ7L 1MI5A 2IPKA 3LKQA 1NTDA 1A7PL 1BFOA 2B15A 3EJYC 4MCNA 5T1MA 3U4EA 3BWUF 2DRUA 5LDUA 3C60A 3VH8A 4FXGC 4X6EB 3DHMA 1OP9A 2CMRL 2ZYSA 4HF5H 4EIBA 1I1CA 2GITB 3JV0A 3ZTNH 4XH2A 3LQZA 1SMDA 2DQUH 3PWJB 3IKKA 1MJJA 1JPSH 4W9HC 1YEHL 5E8EB 4ODTL 5JPNB 3FK3A 2F7IA 1CFNB 4O2EA 3D0LA 3QJSB 2FNBA 4MXQC 1NCCH 4K2UH 3C6LA 3BZ4B 1S7WB 1X5IA 1XIWA 2WZAA 3APCA 5I1GL 2XA8H 2WOBA 3QIWD 1G9HA 2RBLA 4FABH 2DMBA 1BYOA 4FQIL 4R6UA 2YJLA 4GNKB 3RWDB 4XMWA 3RWFA 4Y8AA 2UV3A 3OHMB 3FZUC 4UDUB 2VLKB 3PJSA 2CDGA 3NJJA 3TBCA 1BQKA 4K94C 2A0LC 1ZRUA 2B08A 3S34L 3V6FB 4P05A 4NPYB 1A6TB 4HJGB 3OMZA 3U4BH 3UEZA 4U1MA 1GZPB 4EIUA 4MDJB 5IB2A 1TVBB 3G5WA 3C60D 4RBPK 3W1ZA 3AS3A 3VA2C 1QI5A 3BHBA 2WYZA 1KYDA 2NTFB 4N0FB 4U1KA 4M7KH 2A2QT 5F7BA 5GGVY 1CQYA 3TF7C 4I18B 2MNJB 2D31B 4ZTPH 4JKNA 2GUOA 5F3BB 3I6KA 3SDXF 3L54A 2AJ3A 3IDNB 2B8OT 3MV9B 4AV5A 1FZOA 4JGJA 4NQCE 2H7WA 1ET8A 2NY1D 4ZODA 3TGXA 1TIUA 3CVHB 3HBGA 3HC3L 3EFFB 1OWWA 1N10A 3VM5A 1U3HC 1TYRA 1WAPA 3Q06A 1CU4H 4IOSD 4PHXA 2VL5A 5EU6B 2BPBA 4S0SD 4B9PA 4HALA 3ILDA 3GEFA 4Y4KC 4RMWA 4Q0XH 5F7YC 3HNVL 4ANVA 3C12A 3ILQD 4UMSA 4OF3A 4LSPH 4TNVK 4HISA 4YL4A 2IGLA 5KSUA 1S9XA 2WIIB 4MJ6A 1TZIB 5L4JA 4LF3A 1KXTB 3M6DA 3OAZH 5TQ2L 1KACB 4E68A 3PAYA 2FHCA 2WNWA 3S4SB 3BW9B 4NEHB 3T2NH 2QR0B 4OY9A 4CVWA 1AHWB 1ZA3A 2WBXA 3QXUA 3UC0L 5K9JH 4CMHC 3T0AA 4ZMWA 3O6KH 3TA3C 5IB4B 3PYCA 4FS0A 2VLJD 2NY2B 2XIBA 2DQEL 4TLTA 3FUFA 1V3JA 4WW2A 1LO2H 4DP5X 3SDAB 3E0GA 5FUCE 3UJIH 2YQBA 3VRIB 3LPPA 1I8KA 2VE6B 3FN9A 5F7DA 1E8XA 4KJWD 1JGEB 5D7LE 5LXGH 4X5RA 4KK8C 2XZCH 5FYJD 4IYKA 2VLJB 4H44C 2V8LA 2JTDA 3JYCA 3MJGX 3UZVA 4FFWC 5FO8A 3APNA 1CZ8L 4Y89A 4O9HL 3ECBA 3PL6C 3BRDA 4PRPB 4AENB 2IQAA 1G1OA 5JORB 5I23A 4GLRH 1RHFA 4PJIF 2J6EH 1M1XA 3K72A 3OGOE 4FL4B 2YKLH 2WKLA 3ULUE 4O2FA 1EHLH 1U8HB 4OCYH 5KVFE 3EYQD 4J4PD 2VXQL 4OM1H 5EBLB 1P4LB 1I85A 3QZLA 3ROOA 4EBQL 4Z7NE 3UDWC 5BJTB 5KZCD 5CEXA 3IU4H 1EEZB 2XACC 3KGUA 5IK3A 1AG6A 1SM3H 3FN3A 4KKNA 1DQJB 4PB9H 3ULVD 1EXUA 1KCVH 3VTTA 4AYFA 3L1EA 5CO1A 3H2QA 4APQB 5LQBH 2P8MB 3WGUB 4P2RD 2V17L 3MO1B 5CGTA 5I66B 1R3LB 1DJSA 1Z9LA 4ZMZA 1O7SA 3RGVA 3GPSA 3E8UH 1NCIA 7PAZA 5HYQA 1HILB 2X2YA 5F9JB 2R7EA 1BQ5A 5K1VA 5IUCA 5F1IA 3VRLE 4FA8A 3LN5A 1THCA 2VC2L 4G1EA 4JFEE 3HZ3A 3UBHA 1QSED 4OLZH 4ES9A 3ZDZE 7TAAA 3UPRB 4JPKH 3B2MA 5ENWB 1IBDA 4FNRA 3RVUD 4ZSOB 2AGJL 4YDIH 3H53A 2CR3A 4NSKA 4TTDC 4AGPA 3AS0A 5TDOA 3C8KB 2ZKMX 2VC2B 3AAZB 3UAEA 1DLHA 5DD3L 2LTQB 5LG1A 3K71B 1CFSA 4X4KA 1S7SA 1IZJA 1BOGB 4JFSA 5I8KL 3DURB 1JGDA 5EZJB 4QXTA 3RVXD 2XKNB 1CG9B 4ZUTB 1H3XA 1MHCA 5FYKH 5I0DA 4L8BA 2K1MA 1F1AA 4H25A 3UO1L 3MBEB 4QTHA 5EMYA 3LRSA 3KLAB 5CINL 2HFFA 4X5PA 3GC3A 2CO6B 4X5WB 2W0KA 2WYTA 5IMKA 4A1RA 4EDWH 3OJDA 5CN3A 1PD0A 3GRBA 3K6IA 2IXQA 5IBTH 1NGYB 1BGXL 1NAMB 1QI4A 2KS0A 3V6ZA 3D18A 4YR6B 2VDPB 1Q94A 1OLZA 1WHOA 2D7TH 5D1QC 3RRQA 3O6ML 2HG5A 3MRBB 5DVLA 5FFLA 5CD5C 4Z7WB 5GZND 1UWGH 4EVNB 5ILTH 2E7DA 4BKLB 4Z0XB 1QACA 3QORA 1L7IL 4YDJB 5IBLC 4JRWA 3ZDYF 4DVBA 5F97E 2GSIB 2L7UA 4LEXL 2B16A 4HWEL 4ZAKD 1FL5A 5E94B 2J6WA 3ILQC 2N1TE 3D39B 4K2UL 4A2EA 4A7GF 4N6RB 4GW1B 4G8GA 3VD3A 2MWCA 1KGYE 1PG7W 4WI9A 5EZLA 5I1IH 3MCKB 5D7SL 3KS0J 2VQTA 1WEJH 4DTGH 2D0FA 2FECL 3O8XB 3MODH 4KK9C 4UOZA 1H8OA 1F6AA 2O4EA 1WCBA 2YUZA 4JZJC 1V10A 2FT6A 1OM3H 3COOA 1E9OB 2XWZA 1L5GB 4JO2H 2G5UA 4E9VA 4PV9B 3ETBF 3MRHB 1B3JA 4OQTH 5D1ZI 5C97A 1DQLH 1B4LA 3QO1B 4R83A 4YXLH 4DKFL 3MNDA 4LZKA 4YHKL 3RFRA 4Q9CA 4PJ5E 2NYKA 3EF4A 2HVJB 2V2TA 2YN5A 4ICXA 3RWHB 4L1TA 4ESKA 4KPHH 5KOMC 4G5ZL 3QZWA 1JPTL 1C7SA 3R06A 1UJTA 1NDGA 3MRFA 2BMKB 1C5CH 1HHKA 5EC2B 3SKUD 5B1CA 4ODVH 3K6NA 2X1OA 3ATEA 4ONHB 3QQ3A 5BRZA 5KBLA 4NP4H 1Q1JH 2EDFA 2N01B 3O9WD 2B4CL 3N1QC 4R7LA 3DGCR 5I17A 1HS6A 2YD5A 2RMNA 3BIAX 1JNNL 1IM3B 1BP3B 3WHXA 2ROXA 3QHTC 3ARBD 4MB1A 4WO4C 1UD6A 2GIYA 5FDYA 3EH3B 2J71A 3AY2A 4LEEA 1TZAA 2CLRA 2YPKB 2PYEA 2HVKB 2W38A 1T0PB 1F4AA 3AREC 4PGJA 5FECB 2YPVA 1AXSB 4OJCA 1K72A 3REVB 5LNEA 3UZQB 2WP3T 3HC4H 1HKLL 2FB4L 2C5DC 5D7JD 4HZLA 1L0PA 1YPZB 2KERA 1O7DC 3FMGH 4IBZA 4JRFA 4NI3A 4NZRH 3DO7B 2R0ZL 3ABGA 4IU3B 2EDWA 1H3GA 4J3WA 3FT3B 4WGKA 4B9JA 2AW2A 2CJUH 3ULVH 3DROA 3IDYC 4NT6B 4QO1B 1NIEA 4OLUL 3B3IA 2JKTM 4Y5VB 5BS0A 1P7KB 4Q89A 1FPTL 5JIHA 3NAAH 1AKJD 4RWYH 3O0RH 4PRIA 4FI7A 1TJGH 3QORC 2BHYA 1UM6H 2MRYA 4Z6AT 4JM2C 4XO5A 5ICZB 2XSKA 4RAHA 1BSIA 4YHLL 2Q86B 4A2GA 1TJXA 3IAQA 3AMLA 1DJZA 2VW4A 1BVKA 5E00B 4J5VA 2XY2A 3RZCD 2QFRA 4R8WH 5E2TL 1MFBH 4OUUA 1RMFL 3HUJF 1RUQL 5D7LB 5GS1B 3NPSC 5D71L 5C0IB 1Z3GH 1T89C 2XV2A 5JYLA 3F84A 4ZNEA 4OCYL 4S1SL 3X13A 4BXVA 4PUBL 3KPRE 4WJ5B 5DSCB 5H8DA 4WEUD 2E8ZA 4P2OD 4R26L 3ZKXC 3WIAA 3QUXD 4FJYA 4R0LA 4GRLC 3ZMNA 3RPKA 3HG0A 4KTEH 1PZ3A 2VLLA 1ZS8A 4K5OA 4A7GA 5DR5H 1SLVA 5ANMA 4W9IC 3UPCA 1IBZA 3RPIA 2PN5A 3ZDZB 1X5LA 4A7VA 3UBGA 2F8XC 4PJ7F 2J1KA 2Z31D 3L6FA 4GQPH 3LMJL 2HFEB 2CRMA 3P4MA 2QPDB 3DJSA 4ZO8A 3FUNA 1AR1D 1IGYB 1U36A 4BFFA 1AQHA 5EO1A 4WU7B 4NDMA 1FFOA 2ZOTA 5A7BA 3BZDA 4F7CA 4TYUA 3A6BL 4MJIE 4RAUA 2XXGA 3IYLW 5JHDD 3TT3L 5GSVB 4P4KC 4KOBA 2A6IB 4U2YA 3W82A 2VDKB 3OZ9L 3AW5A 3ZMRA 1AGDA 2IGFL 4G72B 2XXMB 3R19A 5JIKA 4M93B 4BSVA 5LCVH 4LRIA 1XCXA 1ONQA 3IWVA 5I71C 4J12A 1JV2A 5AW5B 4P2QD 4Y19E 3BFOA 1KGXA 4NO0D 2XRAL 3QIUB 1JF1B 1ZWIB 2AEPH 4HHWA 3RWEB 4OJEH 1YYCA 2ZUUA 1FCGA 1HSBA 3TWCL 5E08H 3KDMB 4PG2A 2ZT9C 2R59A 2CUAA 1ID5I 2P7TB 4RNRB 2GJ6D 2EH8H 2OMXB 3M86A 5AAMA 4EO5A 1F86A 1MCSA 3BT0A 3ROLA 5IREA 5CINH 3EOAB 1TQCC 5D1XD 5KSBF 1DCEA 5DQDH 3S37L 5IQMA 1NCJA 2P80A 2LFEA 5AW2B 1SLXA 3EJRA 2UY6A 1MEXL 4X8XA 4ALAC 2O6EA 2D7MA 3CHPA 1J87A 4XBEL 4LEBA 1ZTXH 4HOWA 5E03A 4K8RH 4WVRA 3PWNB 5KJRH 2DI9A 5CLXA 2P46B 3JT2A 4FMFA 5TFSL 1RZIB 3HE7D 2BVUA 4ZZKA 5CCJA 3BXNA 3Q48A 1HJCA 5JW4M 5ESVA 2AV1A 4PJ8C 3BN9C 4KKCD 4NAMA 1WJ3A 1F00I 4L5FL 5D7SH 1SY6H 1DQVA 1KBPA 1RUAH 1CYXA 2QHLA 3QXDA 3FUHA 3QDMB 4DTGL 3IGLA 4RFEA 2OJ1A 4XCNB 2DI8A 4NO0B 4X7SL 3SGDH 1L9TA 4P2QB 3T2OA 4JB9H 5B8CB 2EVIA 1HH9B 1Q0EA 3VYOA 3W9EA 2WBWB 2FR4B 4HUUA 4DGIL 1XXFC 2Z92B 2FLRT 2ZXGA 3KJ6H 5EOTA 1XGUA 2FDBP 4MHHG 4JCMA 4P3WA 3NDYE 3V5HB 2XV3A 3IF1A 5CP7B 3OQ3B 4KVCH 4XVOA 1SJMA 2ZWKA 1FC2D 4OFIA 5MENB 5EF2A 4MCZB 4MD4A 1ZHNA 4G1MB 2WBKA 5DRWA 2B3IA 1HE8A 2WTRA 4UI2A 3WO3B 2O26U 2VDRH 2HLEB 2BOLA 5FUCC 5G5DB 3QJOA 3AG2B 3WD5L 2BNUA 3BPOB 1ORSB 4RMBA 2YAMA 5I5RA 5I82A 2H1XA 2V6HA 3M7OA 1URIA 2OXGB 3CXDH 2YQGA 3MRNA 1Q72H 1U8MB 5D2LB 2E6PA 3JQOB 3NJVA 5BZXA 1NPJA 4NCC1 4HMDA 1I8UA 4PRBB 3PAZA 1NMBL 2OQJB 2UUDK 2VSMB 3VCLA 5B38B 3LJ3A 3ML8A 2I07B 4K7FA 2IAAC 3D0AA 2E86A 1NM4A 1FRGL 2LV4A 3QDGA 1MN4A 1QR4A 3MZGB 4F80A 4AYID 3NYKA 3SEPA 5CD5D 1RCYA 5EB9A 1X7SA 1KJ3H 4L29A 4C56D 5EEWA 5ISZD 2ED9A 1CF1A 5EOCH 3RWCA 4G6FD 4N8CL 4BRJA 2PTUA 2VDQB 1XF3A 1R3KA 5A2BA 8CGTA 2VRQA 2OR8A 5B39B 1N6VA 5I0WA 3PGCA 3DVIA 2WWMD 2R39A 3HC4L 3TO4A 4M6NH 1JWUB 4W6WB 5AUMA 2CE6A 3V7MA 3QUYC 2AJSL 1QATA 3G5ZB 3FRUA 2GTZB 1GA2A 3GIVA 1F3JB 4LQFL 2ENYA 5KBDA 3TBWA 1DBBH 2OMWA 3QSKB 1HL5A 3NZHL 3K8MA 4PM1A 5D2LE 4WWKC 2B2XH 4G5AA 3HS0C 1RHHB 2CKBL 4XPBH 4RGND 4XMLL 1YA5A 5C0ND 2KHAA 2Y9RT 5D72L 1WAAA 2ILLA 2JKLA 3CFKB 3OKOA 3HVDA 3QUZD 2ZAIA 4FYQA 1YSOA 1I8AA 2UVEA 1TTCA 1ZHLA 1J1PH 1T66C 4JRYD 4X2UA 5FGRA 5FLUA 3ZLQC 1L4IA 2ZCZA 3FAWA 1MREH 4GW4B 4PJDF 1DQMH 3WEXB 1MCWW 4ZTOL 1ODAA 2R0LL 2FIKA 1Z1WA 3UBXI 3GSRB 3EOBA 1TETH 1IAOB 2OMTA 1IAIH 4R84A 5F89B 4A6YA 1TITA 1ZVSA 3WTTA 4NAQA 2NX5A 2V2XB 3VI4E 1FYTA 2BO0A 2W9DL 3L48A 3MZTA 3UTSB 3EG9A 4F9LA 1CXFA 3MTRA 4WAFA 1NINA 3KGRA 6TAAA 5C0RL 4IK7A 1BFOB 4IBTA 3HI1A 4J3SA 4TL4A 5KS9F 1CD1A 3C9NB 2EILB 2GITA 4Y9GA 2DQIH 1QZ1A 1URLA 4OD1L 3W2DL 3CLEL 4XH2B 1KTCA 1KZYA 2KQMA 1OZUA 1GH7A 5HVWA 3OV6A 4MMZA 4A37A 4NX0A 1SOSA 3GSVB 5F1NA 3AUWB 3J2PA 5ABDE 3WJMB 5IVZB 3LZNA 3MLUH 2QTVA 2IGTA 3O3BB 5ERWB 1PAMA 1LK2B 2JSFA 3A6CL 1AZNA 3GSQB 5EZPA 1VA9A 4KU1A 4FFWD 4L8SA 2ZKWA 2JWYA 2F61A 1FC1A 5EZOL 4NQXA 1J9TA 4PLKD 1JD9A 5DTFB 4FC3E 5F1OB 2WXLA 1LE9A 3I3DA 3V0DA 2ZXWB 3MI6A 4KUZH 2BZDA 3THMH 4KROB 4HD9A 4ODXB 4RISH 5D5MB 3FYIB 4QXGH 3WDJA 1QP1A 5AW4B 3EIFA 3SKJH 3WELA 2GTQA 3F00A 1XTMA 4AKPA 2VZ1A 3N0PB 4BUQA 3P3UA 5F88A 4MDJA 3QEQE 3GLEA 2RCSL 1MG2C 5HHVH 4JL1A 2QPFA 3S4SG 5B1AB 1LVEA 3BHBB 2GJJA 3WNKA 5I6KA 2UY7B 1G0XA 3ELAT 4CSZA 3UAFA 1L9NA 1XSKA 4I18A 1G9NH 4FQXA 2CHXA 4N24A 3VAEA 1XAUA 4K23L 3IU3A 1AG0A 3N40F 3OVUB 5AD0A 5AB2A 5LLIC 2QSVA 3IDMB 5E6RB 3EKCA 3OHXB 5HYSG 2K6WA 3LKPB 2ZX8A 4FQCL 3MV9A 4BFGA 2X0VA 4X4ME 4H8WL 2R0WH 4XO3A 5CCKH 5DYFA 2X09A 3RTLA 3EFFA 5F6IB 3KWVA 4FQIH 4OZHF 1YMMA 2NY1C 2XBZA 1V7MH 5EU6A 5CZXC 1WWCA 1Q0XH 1VFOA 2IAMC 2ZOKB 4NQED 2DD8H 2ZWYA 1WTGT 4PJAE 4AC4A 2PUQT 3UDWA 1NKGA 2YA1A 2FJHB 3N44B 2VM3A 2R69L 4E9WA 3SQOH 2YMTA 4HAGA 4FMKA 2ENJA 3Q13A 1AZZC 5JHMA 4FFYA 1J05B 2A6JB 2C9XA 2DH2A 1LMKA 3IGAA 1EJ8A 5GRXG 1RAMA 5E8OB 4Z5RB 4OZHE 3GXFA 2ZJSH 4KNQA 2O30A 3AABA 5IEKB 2MCPH 1ZLSH 3MHZA 2BNQD 2EXYD 1CVRA 2EUZA 3D3VE 1DVFA 4MSWA 2FHFA 5I1DA 4IRJD 4P9HC 1ES0B 1I8KB 1AQKH 2VE6A 4GAFB 1GGCH 1FZKA 5GGSB 4JKWA 1JGEA 3CLWA 2GVYA 1Z9MA 3BGMA 2QQKH 4LLDB 1PIGA 1PZ5B 1XR9B 4TF4A 4Z23A 2JNZA 2CK0L 1EEYA 3SGEI 3UJTH 4AENA 4QRPE 3KDPB 2X4RB 4MXQD 4CNIA 1YPZE 5DJAB 3R18A 2IANB 3VXRD 2VDQH 3JWNG 2KKQA 2BY0A 2B77A 3WY2A 2BZCA 4M7LL 3SDDA 4H1LA 2HJLA 4PJIE 5I1LB 5I76B 4MYPA 4PRPD 3DDGA 4Q2ZB 2NY3C 2UZXA 5B7FA 4HIJA 3BUQA 4N8CH 4K7PH 2ZXQA 3MREB 5JDSB 2HRLA 3QEHB 3IM1A 2ZAHA 3SDXE 3LEVL 5FK9B 4JFPB 3RL1B 1ZSHA 4PRNA 1CGVA 2YK1L 4FNTA 4GRWE 3MV7A 3GI8H 2P8MA 4CGTA 1XCQA 2KLTA 3H55A 3NK4A 5DJYB 4L0PB 1W0VA 4ONOA 4IMKC 1R3LA 4YSQA 4PWIA 2QSTA 4GEJA 1DUYB 3WNOA 1AMYA 1HILA 3T4AB 2G0LA 1DCLA 3QI9A 5HDBB 4LLUA 2OK0H 3F6IA 3HE7A 4WWPA 4NCDA 3GXDA 1L7TL 2YC1A 4YO0B 5AW3B 5TK2A 4BK4A 1KB5L 3N06B 5JHLA 3ABZA 1J1OH 2NR6D 3P4LA 4X6BB 1N8ZA 3SY0B 3GHEL 1XGYH 2P52A 4JPSA 4OM0H 4U6XB 1U3HA 1NA8A 3SE8H 4NSKB 4F57H 1QHOA 4PP1D 5TDOB 4ZFZB 1G6RA 3C8KA 4LBEB 2HH0H 2MPAH 3OAWA 2I25N 4HBCL 5IJVB 3IJYB 3HPLB 1HEHC 4LAJH 3M46A 1E5ZA 3D06A 1SLWA 5MERB 3ETTA 4AGNA 4KXAA 4ZTOH 3CVIL 1B0RA 2J8HA 4TRPL 1XF5B 3F7YA 4HOXA 1AIFA 1BBDH 4JPIA 3STZB 3ECUA 4QTHB 5CWSB 1IBGL 1PFCA 5TK4A 3BKJH 5TGBB 1IGIH 5GZOD 4P23C 2AVFA 3GEWB 4NKIH 4ZPVA 5DD5H 3TBTA 4LPVA 2IXQB 3F64A 5BVJA 3AQDA 1BZEA 3VXQB 2VN6A 4HUMB 1QD0A 3HR5B 3W2DH 3MRBA 3FDWA 1X9LA 3L16A 3L4WA 2NQDA 5JZ7C 3MCG1 3PNRB 4Z7WE 1AI1H 1MNNA 4DVBB 3IDIA 1BD2B 1F6FB 3H6AA 4OT1H 1JZ6A 2AK4E 2Y24A 3UMNA 3K2IA 1U3JA 1T0MA 3KR3H 3BVUA 5DD1H 4JQVA 1F58L 1OP5H 4N6RA 3IK2A 3B9DA 4BUGA 5HI5C 7FABL 3MCKA 4LU5H 2DEYX 3CZSA 1U6AH 2HT4C 3GSOA 3P77B 3RBGA 3X3GL 4E9TA 5A2FA 3FQUB 3DIFA 43C9B 1KEML 2BIQA 5FUOH 3Q44A 5AZUA 2FJUB 2CGRH 4JO5A 5GISL 4M7LT 1SDAB 4RISL 1OALA 3LQAC 2HKAA 4PV9A 4XPTL 3OJMB 3RVWD 1JOIA 4XCCH 2Z93B 4Z7OF 1VFUA 5I8OL 4W6XB 4NIKB 3S3CB 2FJGB 2HT2C 2O5XH 1VENA 3RJOA 2J2ZA 1JZ2A 4IDLA 2V2TB 1B9KA 1S7UA 3W39A 3V9FA 1UWGL 5ILTL 3KXFB 3I75A 3VXUA 1BQLH 1KT2A 2YD6A 3BP4B 1GC1C 1AGCA 4ZYKA 3V4PL 1AXIB 4CDGC 1DR9A 5AVSB 3BI9X 4HWEH 4P3DA 3G5VA 3FU5A 1TTUA 1HHKB 2VSKB 1MJ7H 4DZ8B 3HZKB 3QQ3B 5BRZB 1LO4L 3WIHL 4MAUH 3FQRA 3ZQ9A 2VXUH 2LQRA 3CVBA 4NWTL 1YEKH 3MPCA 3LH8A 3G5YB 3LYRA 1CO1A 2J5LB 1I1YA 3SKNB 4EI5A 3QH3B 3GUTB 2JI2A 1KULA 1BX2A 2AXHA 2DQDL 3ARDB 3GMMB 3SO3B 3EH4B 5DVPA 2VZOA 1A4CA 3O4LB 4MX7A 1RZGA 1BHGA 1CICC 3QXVA 4NUPA 3RTQA 3U1QA 4EI6A 1WBXB 2ATKB 2XNAA 3IMUA 3T0EA 2VDRB 3RL2B 3AT8A 3OAZK 4LVHC 4JY5H 2WW8A 3LVTA 1KJVA 2C9SA 3T8VA 4YHPA 2YPKA 1ID2A 3AT0A 2JTYA 4PU2A 4HX1A 4OZFA 4AQAA 4LCYB 2ESVE 5HHMD 4XC1H 1FJ1A 4NM8L 2EO7A 1UB6B 3L3DA 2AJXL 4Q9RL 1D7DA 3CBRA 3KYAA 4XNXL 1JPTH 1QOKA 1BECA 2HTLD 5DJ8B 3MBXH 1V5JA 4ZAKA 4Y1AD 2F53B 1NANH 2BXYA 2FRGP 3N91A 4NZUL 1TG8A 3RNKB 1IMHC 2DMKA 1BVNT 1Q1JL 4KRPC 4TQ8A 3MV7D 4UM9B 3KYMB 5TDPB 3VXME 3ISYA 3KHQA 4OLEA 3TP4A 4AT6A 2A9ML 2Q86A 2HVBA 2EO1A 2MQGA 4DQOH 1ZT7B 3CDGB 1X4ZA 2KZBA 4NOBA 5FEBA 1D3CA 3ARDD 4PS4H 1E5BA 3PV7A 4HWBA 3QG7H 5CILL 5E70A 3T6WA 1HFUA 4KVNL 1OV8A 4Y2LA 3IDGA 3TN0D 5KTEH 1BQUA 3WLWC 2P4AB 3PWUA 3HBQA 5AWNH 1H9VA 3FNKA 4WV1B 1QTYT 2BIOA 3TXAA 1NIBA 3KG5A 3KVDD 4DEWA 5EF3A 1MWAH 3FZUD 1Y7VA 1XXDC 1UKSA 1MFMA 1A6ZB 2IDSA 5FYLH 4D9RD 1DQDL 4XVJL 1MFEH 1FYTE 4F7MA 3HRZA 4XHJC 4PIBA 3VXPB 1CYWA 4OFPA 3O0RL 3TH4T 4XN2A 1JK9A 5EC1B 4OJFH 1DJXA 5DEFB 1A14L 5E9AA 4HIXH 4BQCA 5AW1B 1E27B 2OSLB 3HA0A 5HGAA 5DJ2A 3V5DA 1N8OE 3NEOA 4KWUA 3CGTA 5IQ9A 3SQBA 1HCZA 3QUXA 5IB1A 5AVYB 1ZT4A 3CFBB 2ADGA 2WLKA 1P1ZB 2YGOA 1EZSA 4JJ5A 3RWJA 4PRDA 3DX3A 3D2UA 4EJ1C 1K4DA 3HG1D 3KPMA 3X14A 2QHRL 4EI5D 3MJ8B 4WHCA 4D9LL 1O7DE 4F8LA 1RZ8A 2EEXA 3ZXAC 3F05A 1EQWA 2ADFH 2W0PA 4PVBA 4KY1H 2VW6A 4OGXH 4OZIB 2ZE0A 1NDMA 1NAKH 2A4EA 2C3VB 4TPRH 5DK3A 1ZWIA 1ADQA 4M43L 3IVKA 1ACYL 2D2CC 4M5SA 1U2YA 4KBPA 4TQEH 1E8ZA 2OL3A 1JL8A 1KY6A 4RNRA 4DPBX 4HWBH 4MXWH 3NFSH 2QPEB 2ZCHH 4N9OB 1AKJA 1OGAD 3H3BC 3U83A 5IIEA 5HDQH 3MA7B 3NT0A 4QYAA 5GJSH 1AQ8A 5HPMB 3MRCA 3VI3F 1XZWA 4XP5H 2Z4QA 2A74C 3V95A 3WFZA 3KPRA 5FM5M 1JVLA 3JTTA 1DSFH 4HV8B 4N2FA 1TZGH 1OCRB 3CVHH 4OTXL 4JLRA 2P5WD 4DUWA 1LWRA 5HVGB 4FQLH 3DIVA 4ZMTA 3CZFB 5JOFA 4HMCA 1XIWC 2DLTA 3EO0B 4XTRD 5F7NC 2NUTA 1IGMH 5H4ZA 5L6YH 1S78C 1NUNB 4M02A 43CAB 4LLYA 3REWB 1KBGH 1A7NL 3A4AA 1ED3A 1E5AA 3RI5K 1MSPA 4CADA 5E5MA 1DVXA 3CLFL 2X89A 4G7VH 2WUBH 3GSNB 3JUYA 4QTIH 4YDNA 2H1LM 1VJSA 3EJQA 4JGMA 4N5UA 1EVUA 4OB5L 3BP5A 3GBML 3QJFB 4RFEB 1H15A 1KN2H 2DBJA 4FFYH 3B7UX 4Z7VA 3L5JA 2ZF9A 1A1NA 2FWOB 4KUCD 2EH8L 4GIAA 1W0YT 4XVSL 1RUML 1FIEA 4F27A 3K4DA 4W9JC 1ZJAA 4P0DA 2GJRA 5E1GA 3C75A 5CBEA 2L3BA 2X53A 2WTPA 2N56A 1O6SB 3SPVB 5FO7A 1D7BA 1QA9A 4NRYA 3T0XA 5AYQA 3OMNB 3QZBA 2A83A 1MWOA 4XBPB 4OVUA 3HC2A 3R4RA 4RMRA 4OZ4A 1K5NA 1FV1A 2R1YB 3MN8A 4AYDC 3B83A 1DVUA 2R0KH 3J8F7 1QUNB 3BMWA 4WWKD 3BCDA 5CXPA 2OCFD 2F58L 5G5DA 3FH7A 2BOBA 3LNHA 5KJRL 4XP1H 1ND0A 4BA0A 3Q05A 2BNUB 5LCVA 1CDYA 4WTWA 4CGUB 1MLBA 1R5VA 4HS8L 1M42A 4PS7A 3O4OC 2V3FA 3UAJD 3D9AH 4ZPTA 4X4XB 4PGZA 2BNRE 4RX4A 2DLFH 3OKDA 4L5FH 5D2LA 3WFEH 1G7LA 1GS8A 2DWDA 1JZIA 3DARA 4N0UB 1NC4A 1M7IA 3BC9A 4YSUA 1USZA 3BWSA 4NZJA 3UROR 4XP6H 4X6CB 4J3BA 1PSKH 3T6XA 5B38A 5J11C 5F7MC 5CJXC 4TMPA 5LJYH 2KLRA 5IESH 5DDHB 5GS0H 2OTWA 2DB8A 3LIZH 5BV7L 3AREB 2Y25A 4OI9A 3PUCA 2Y07L 5DLML 4YHML 1MI5B 2EJ1A 2IPKB 2VW7A 2Q1EA 3LKQB 5T1MB 1IM9B 1EAPA 3U30C 3FQ4A 3ILPB 3C5SB 1AFVH 1ZCRA 5AAMC 1RZFH 1VGEL 4HZAA 3KYNA 3WIIH 3F7VB 2WIMA 1S7XB 4N1CA 3JWOC 3PGCB 3TO4B 2D9CA 3BAEH 5F7WC 3LAFA 1WBYB 4M03A 4DQAA 1T80A 2GTZA 2ADIA 1R6VA 3V0VB</