3GQHA

Crystal structure of the bacteriophage phi29 gene product 12 c-terminal fragment
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
163
structure length
163
Chain Sequence
DFAEYFESLGGQVIETGYLVTLEKGKIRKAEKGEKIIGVISETAGFVLGESSFEWQGAVLKNEFGGIIYEEVTTEDGVKFKRPLPNPDFDPNKNYIPRSQRREWHVVGLLGQIAVRIDETVKQGHSIDAVGGVATDGDNFIVQEITTPYTKEKGYGVAIVLVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Preneck appendage protein
publication title Crystallographic insights into the autocatalytic assembly mechanism of a bacteriophage tail spike.
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Viral protein
total genus 24
structure length 163
sequence length 163
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.300.10 Mainly Beta Beta Barrel Virus Head Decoration Protein; Chain: A, Head decoration protein D 3gqhA01
4.10.80.40 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 succinate dehydrogenase protein domain 3gqhA02
1YQ3A 1C5EA 2H88A 1L0VA 1NEKA 3VR9A 3AEAA 3SFDA 4YT0A 2ACZA 1ZP0A 2WQYA 4YSZA 4YTPA 4YXDA 1NENA 3AEEA 1TD0A 3AEDA 3SUCA 3AE4A 3AEFA 3SFEA 2WS3A 3AEGA 4YSYA 3AE9A 2WU5A 1TCZA 1YQ4A 3VRBA 3AE7A 3AE1A 4YTNA 3VR8A 1TD4A 1TD3A 1VD0A 3VRAA 2H89A 3AEBA 5C2TA 1KF6A 3P4RA 2B76A 1KFYA 2FBWA 3ABVA 3GQHA 3AECA 3AE2A 3P4SA 1ZOYA 2WDQA 2WP9A 2WU2A 3AE8A 2WDRA 3AE5A 3GQKA 3P4QA 4KX6A 2WDVA 3AE6A 3CIRA 3P4PA 5C3JA 4YSXA 3AE3A 4YTMA
chains in the Genus database with same CATH superfamily
1L0VA 3VR9A 2RS14 3AEAA 1EV14 3SFDA 1AR74 2WQYA 1BEV4 3AE4A 1RHI4 2WS3A 1NA1D 3AE9A 1COV4 2PYLA 2HWC4 3AE7A 1XHZA 2R064 2PY5A 1HXS4 1VD0A 2H89A 3AEBA 2R074 1HRI4 3ABVA 3P4SA 1RVF4 1ZOYA 2WDQA 4YTPA 3JD74 3GQKA 1VBA4 3CIRA 5C3JA 2H88A 1NEKA 2RS34 1NCQD 2ACZA 3JBG4 4YXDA 1K5MD 1NENA 1RMU4 1RUG4 3SFEA 3VR8A 3AEFA 1PO24 3AEGA 2WU5A 1Z7S4 1YQ4A 4YTNA 1R094 1VBD4 2R044 1MQTD 1POV0 1RUC4 4PDWD 1EAH4 4Q4V4 1AR64 1KF6A 2B76A 2FBWA 1AR94 2WU2A 3AE6A 1RUF4 4Q4Y4 2HWB4 4YTMA 2R7FA 2PW9A 2RR14 2EX3A 1RUH4 1ZP0A 2X5ID 3AEDA 1XHXA 3SUCA 1PIV4 1RUI4 4YSYA 2PLV4 1VBE4 3FI7A 1RUJ4 1TCZA 4Q4W4 3VRBA 2PZSA 1TD3A 1PO14 1HRV4 1KFYA 3P4QA 3AE8A 2WDRA 2RM24 3VRAA 1VBC4 1H8TD 3AE3A 1YQ3A 1C5EA 4RHV4 4Q4X4 4YT0A 4YSZA 3AEEA 1TD0A 2RMU4 4GB34 1OOPD 3AE1A 1AL24 3J8F4 1RUE4 1AR84 1R084 1TD4A 1D4M4 1VBB4 2RS54 5C2TA 1ASJ4 3P4RA 3AE2A 3AECA 3GQHA 1VRH4 1PVC4 2WP9A 3AE5A 4KX6A 1XI1A 2PYJA 1RUD4 2WDVA 3P4PA 4YSXA
chains in the Genus database with same CATH topology
1YQ3A 1C5EA 2H88A 1L0VA 1NEKA 3VR9A 3AEAA 3SFDA 4YT0A 2ACZA 1ZP0A 2WQYA 4YSZA 4YTPA 4YXDA 1NENA 3AEEA 1TD0A 3AEDA 3SUCA 3AE4A 3AEFA 3SFEA 2WS3A 3AEGA 4YSYA 3AE9A 2WU5A 1TCZA 1YQ4A 3VRBA 3AE7A 3AE1A 4YTNA 3VR8A 1TD4A 1TD3A 1VD0A 3VRAA 2H89A 3AEBA 5C2TA 1KF6A 3P4RA 2B76A 1KFYA 2FBWA 3ABVA 3GQHA 3AECA 3AE2A 3P4SA 1ZOYA 2WDQA 2WP9A 2WU2A 3AE8A 2WDRA 3AE5A 3GQKA 3P4QA 4KX6A 2WDVA 3AE6A 3CIRA 3P4PA 5C3JA 4YSXA 3AE3A 4YTMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YQ3 A;  1C5E A;  2H88 A;  1L0V A;  1NEK A;  3VR9 A;  3AEA A;  3SFD A;  4YT0 A;  2ACZ A;  1ZP0 A;  2WQY A;  4YSZ A;  4YTP A;  4YXD A;  1NEN A;  3AEE A;  1TD0 A;  3AED A;  3SUC A;  3AE4 A;  3AEF A;  3SFE A;  2WS3 A;  3AEG A;  4YSY A;  3AE9 A;  2WU5 A;  1TCZ A;  1YQ4 A;  3VRB A;  3AE7 A;  3AE1 A;  4YTN A;  3VR8 A;  1TD4 A;  1TD3 A;  1VD0 A;  3VRA A;  2H89 A;  3AEB A;  5C2T A;  1KF6 A;  3P4R A;  2B76 A;  1KFY A;  2FBW A;  3ABV A;  3GQH A;  3AEC A;  3AE2 A;  3P4S A;  1ZOY A;  2WDQ A;  2WP9 A;  2WU2 A;  3AE8 A;  2WDR A;  3AE5 A;  3GQK A;  3P4Q A;  4KX6 A;  2WDV A;  3AE6 A;  3CIR A;  3P4P A;  5C3J A;  4YSX A;  3AE3 A;  4YTM A; 
#chains in the Genus database with same CATH topology
 1L0V A;  3VR9 A;  2RS1 4;  3AEA A;  1EV1 4;  3SFD A;  1AR7 4;  2WQY A;  1BEV 4;  3AE4 A;  1RHI 4;  2WS3 A;  1NA1 D;  3AE9 A;  1COV 4;  2PYL A;  2HWC 4;  3AE7 A;  1XHZ A;  2R06 4;  2PY5 A;  1HXS 4;  1VD0 A;  2H89 A;  3AEB A;  2R07 4;  1HRI 4;  3ABV A;  3P4S A;  1RVF 4;  1ZOY A;  2WDQ A;  4YTP A;  3JD7 4;  3GQK A;  1VBA 4;  3CIR A;  5C3J A;  2H88 A;  1NEK A;  2RS3 4;  1NCQ D;  2ACZ A;  3JBG 4;  4YXD A;  1K5M D;  1NEN A;  1RMU 4;  1RUG 4;  3SFE A;  3VR8 A;  3AEF A;  1PO2 4;  3AEG A;  2WU5 A;  1Z7S 4;  1YQ4 A;  4YTN A;  1R09 4;  1VBD 4;  2R04 4;  1MQT D;  1POV 0;  1RUC 4;  4PDW D;  1EAH 4;  4Q4V 4;  1AR6 4;  1KF6 A;  2B76 A;  2FBW A;  1AR9 4;  2WU2 A;  3AE6 A;  1RUF 4;  4Q4Y 4;  2HWB 4;  4YTM A;  2R7F A;  2PW9 A;  2RR1 4;  2EX3 A;  1RUH 4;  1ZP0 A;  2X5I D;  3AED A;  1XHX A;  3SUC A;  1PIV 4;  1RUI 4;  4YSY A;  2PLV 4;  1VBE 4;  3FI7 A;  1RUJ 4;  1TCZ A;  4Q4W 4;  3VRB A;  2PZS A;  1TD3 A;  1PO1 4;  1HRV 4;  1KFY A;  3P4Q A;  3AE8 A;  2WDR A;  2RM2 4;  3VRA A;  1VBC 4;  1H8T D;  3AE3 A;  1YQ3 A;  1C5E A;  4RHV 4;  4Q4X 4;  4YT0 A;  4YSZ A;  3AEE A;  1TD0 A;  2RMU 4;  4GB3 4;  1OOP D;  3AE1 A;  1AL2 4;  3J8F 4;  1RUE 4;  1AR8 4;  1R08 4;  1TD4 A;  1D4M 4;  1VBB 4;  2RS5 4;  5C2T A;  1ASJ 4;  3P4R A;  3AE2 A;  3AEC A;  3GQH A;  1VRH 4;  1PVC 4;  2WP9 A;  3AE5 A;  4KX6 A;  1XI1 A;  2PYJ A;  1RUD 4;  2WDV A;  3P4P A;  4YSX A; 
#chains in the Genus database with same CATH homology
 1YQ3 A;  1C5E A;  2H88 A;  1L0V A;  1NEK A;  3VR9 A;  3AEA A;  3SFD A;  4YT0 A;  2ACZ A;  1ZP0 A;  2WQY A;  4YSZ A;  4YTP A;  4YXD A;  1NEN A;  3AEE A;  1TD0 A;  3AED A;  3SUC A;  3AE4 A;  3AEF A;  3SFE A;  2WS3 A;  3AEG A;  4YSY A;  3AE9 A;  2WU5 A;  1TCZ A;  1YQ4 A;  3VRB A;  3AE7 A;  3AE1 A;  4YTN A;  3VR8 A;  1TD4 A;  1TD3 A;  1VD0 A;  3VRA A;  2H89 A;  3AEB A;  5C2T A;  1KF6 A;  3P4R A;  2B76 A;  1KFY A;  2FBW A;  3ABV A;  3GQH A;  3AEC A;  3AE2 A;  3P4S A;  1ZOY A;  2WDQ A;  2WP9 A;  2WU2 A;  3AE8 A;  2WDR A;  3AE5 A;  3GQK A;  3P4Q A;  4KX6 A;  2WDV A;  3AE6 A;  3CIR A;  3P4P A;  5C3J A;  4YSX A;  3AE3 A;  4YTM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...