3GQHA

Crystal structure of the bacteriophage phi29 gene product 12 c-terminal fragment
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
163
structure length
163
Chain Sequence
DFAEYFESLGGQVIETGYLVTLEKGKIRKAEKGEKIIGVISETAGFVLGESSFEWQGAVLKNEFGGIIYEEVTTEDGVKFKRPLPNPDFDPNKNYIPRSQRREWHVVGLLGQIAVRIDETVKQGHSIDAVGGVATDGDNFIVQEITTPYTKEKGYGVAIVLVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Preneck appendage protein
publication title Crystallographic insights into the autocatalytic assembly mechanism of a bacteriophage tail spike.
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Viral protein
total genus 24
structure length 163
sequence length 163
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.300.10 Mainly Beta Beta Barrel Virus Head Decoration Protein; Chain: A, Head decoration protein D 3gqhA01
4.10.80.40 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 succinate dehydrogenase protein domain 3gqhA02
1VD0A 3AE5A 3SFDA 3AE9A 3AEEA 1KFYA 3AE8A 1TD3A 2WDRA 2FBWA 3VR8A 4YSXA 1YQ4A 2B76A 3AEFA 3AE4A 3AE3A 2WP9A 3ABVA 2WU5A 1NENA 1L0VA 4YTMA 1KF6A 5C3JA 2WU2A 3AECA 1NEKA 1TD0A 1ZOYA 3CIRA 1TD4A 3P4SA 3VRAA 4YT0A 4YTPA 3AEDA 3GQHA 4KX6A 1C5EA 1TCZA 2WQYA 3AE7A 3P4QA 5C2TA 3SFEA 2H89A 1YQ3A 2H88A 2WS3A 4YXDA 2WDVA 3P4RA 2WDQA 4YTNA 1ZP0A 3P4PA 3VRBA 3AE2A 3AE1A 3GQKA 3AEAA 3AE6A 3VR9A 3AEGA 4YSZA 3AEBA 2ACZA 4YSYA 3SUCA
chains in the Genus database with same CATH superfamily
2R044 1RUF4 1EAH4 2PLV4 3AE5A 3SFDA 2RM24 1PO24 1RUE4 1NENA 1KF6A 3CIRA 1TD4A 3GQHA 1HRV4 5C2TA 1POV0 1NA1D 2PYLA 2H89A 2WS3A 1XHZA 1PO14 2R064 1H8TD 3VRBA 3AE2A 3FI7A 2PZSA 1NCQD 1AR64 1R094 2EX3A 2PY5A 1KFYA 1HXS4 3AE8A 1TD3A 1RMU4 2FBWA 3VR8A 4YSXA 1XI1A 2WP9A 3ABVA 4PDWD 5C3JA 3AECA 1ZOYA 1BEV4 4YTPA 1R084 1XHXA 3AEDA 1C5EA 3AE7A 1COV4 1HRI4 1VBD4 2H88A 1YQ3A 4YXDA 1PIV4 2WDVA 1VBA4 2RS54 1ZP0A 3J8F4 3VR9A 3AEGA 1D4M4 4YT0A 4YSZA 2ACZA 1VBC4 4YSYA 3SUCA 1AR74 1OOPD 3AEEA 1MQTD 2WDRA 1YQ4A 2B76A 4GB34 1RVF4 3AE4A 3AE3A 1RUI4 2WU5A 1VBE4 1K5MD 4YTMA 3JD74 1PVC4 2R074 2WU2A 1NEKA 4KX6A 1Z7S4 1TCZA 2PW9A 2WQYA 1AR84 3P4QA 4Q4V4 3P4RA 2WDQA 4YTNA 1VBB4 1RUC4 3AE1A 3AEAA 4Q4X4 1VD0A 1RUG4 1AL24 3AE9A 2PYJA 1EV14 3AEFA 1RHI4 2RS34 1L0VA 1ASJ4 1TD0A 1VRH4 1RUH4 2RR14 3P4SA 3VRAA 4Q4Y4 2R7FA 1AR94 3JBG4 4Q4W4 2HWB4 2RMU4 3SFEA 1RUJ4 2RS14 4RHV4 1RUD4 3P4PA 3GQKA 2X5ID 2HWC4 3AE6A 3AEBA
chains in the Genus database with same CATH topology
1VD0A 3AE5A 3SFDA 3AE9A 3AEEA 1KFYA 3AE8A 1TD3A 2WDRA 2FBWA 3VR8A 4YSXA 1YQ4A 2B76A 3AEFA 3AE4A 3AE3A 2WP9A 3ABVA 2WU5A 1NENA 1L0VA 4YTMA 1KF6A 5C3JA 2WU2A 3AECA 1NEKA 1TD0A 1ZOYA 3CIRA 1TD4A 3P4SA 3VRAA 4YT0A 4YTPA 3AEDA 3GQHA 4KX6A 1C5EA 1TCZA 2WQYA 3AE7A 3P4QA 5C2TA 3SFEA 2H89A 1YQ3A 2H88A 2WS3A 4YXDA 2WDVA 3P4RA 2WDQA 4YTNA 1ZP0A 3P4PA 3VRBA 3AE2A 3AE1A 3GQKA 3AEAA 3AE6A 3VR9A 3AEGA 4YSZA 3AEBA 2ACZA 4YSYA 3SUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VD0 A;  3AE5 A;  3SFD A;  3AE9 A;  3AEE A;  1KFY A;  3AE8 A;  1TD3 A;  2WDR A;  2FBW A;  3VR8 A;  4YSX A;  1YQ4 A;  2B76 A;  3AEF A;  3AE4 A;  3AE3 A;  2WP9 A;  3ABV A;  2WU5 A;  1NEN A;  1L0V A;  4YTM A;  1KF6 A;  5C3J A;  2WU2 A;  3AEC A;  1NEK A;  1TD0 A;  1ZOY A;  3CIR A;  1TD4 A;  3P4S A;  3VRA A;  4YT0 A;  4YTP A;  3AED A;  3GQH A;  4KX6 A;  1C5E A;  1TCZ A;  2WQY A;  3AE7 A;  3P4Q A;  5C2T A;  3SFE A;  2H89 A;  1YQ3 A;  2H88 A;  2WS3 A;  4YXD A;  2WDV A;  3P4R A;  2WDQ A;  4YTN A;  1ZP0 A;  3P4P A;  3VRB A;  3AE2 A;  3AE1 A;  3GQK A;  3AEA A;  3AE6 A;  3VR9 A;  3AEG A;  4YSZ A;  3AEB A;  2ACZ A;  4YSY A;  3SUC A; 
#chains in the Genus database with same CATH topology
 2R04 4;  1RUF 4;  1EAH 4;  2PLV 4;  3AE5 A;  3SFD A;  2RM2 4;  1PO2 4;  1RUE 4;  1NEN A;  1KF6 A;  3CIR A;  1TD4 A;  3GQH A;  1HRV 4;  5C2T A;  1POV 0;  1NA1 D;  2PYL A;  2H89 A;  2WS3 A;  1XHZ A;  1PO1 4;  2R06 4;  1H8T D;  3VRB A;  3AE2 A;  3FI7 A;  2PZS A;  1NCQ D;  1AR6 4;  1R09 4;  2EX3 A;  2PY5 A;  1KFY A;  1HXS 4;  3AE8 A;  1TD3 A;  1RMU 4;  2FBW A;  3VR8 A;  4YSX A;  1XI1 A;  2WP9 A;  3ABV A;  4PDW D;  5C3J A;  3AEC A;  1ZOY A;  1BEV 4;  4YTP A;  1R08 4;  1XHX A;  3AED A;  1C5E A;  3AE7 A;  1COV 4;  1HRI 4;  1VBD 4;  2H88 A;  1YQ3 A;  4YXD A;  1PIV 4;  2WDV A;  1VBA 4;  2RS5 4;  1ZP0 A;  3J8F 4;  3VR9 A;  3AEG A;  1D4M 4;  4YT0 A;  4YSZ A;  2ACZ A;  1VBC 4;  4YSY A;  3SUC A;  1AR7 4;  1OOP D;  3AEE A;  1MQT D;  2WDR A;  1YQ4 A;  2B76 A;  4GB3 4;  1RVF 4;  3AE4 A;  3AE3 A;  1RUI 4;  2WU5 A;  1VBE 4;  1K5M D;  4YTM A;  3JD7 4;  1PVC 4;  2R07 4;  2WU2 A;  1NEK A;  4KX6 A;  1Z7S 4;  1TCZ A;  2PW9 A;  2WQY A;  1AR8 4;  3P4Q A;  4Q4V 4;  3P4R A;  2WDQ A;  4YTN A;  1VBB 4;  1RUC 4;  3AE1 A;  3AEA A;  4Q4X 4;  1VD0 A;  1RUG 4;  1AL2 4;  3AE9 A;  2PYJ A;  1EV1 4;  3AEF A;  1RHI 4;  2RS3 4;  1L0V A;  1ASJ 4;  1TD0 A;  1VRH 4;  1RUH 4;  2RR1 4;  3P4S A;  3VRA A;  4Q4Y 4;  2R7F A;  1AR9 4;  3JBG 4;  4Q4W 4;  2HWB 4;  2RMU 4;  3SFE A;  1RUJ 4;  2RS1 4;  4RHV 4;  1RUD 4;  3P4P A;  3GQK A;  2X5I D;  2HWC 4;  3AE6 A;  3AEB A; 
#chains in the Genus database with same CATH homology
 1VD0 A;  3AE5 A;  3SFD A;  3AE9 A;  3AEE A;  1KFY A;  3AE8 A;  1TD3 A;  2WDR A;  2FBW A;  3VR8 A;  4YSX A;  1YQ4 A;  2B76 A;  3AEF A;  3AE4 A;  3AE3 A;  2WP9 A;  3ABV A;  2WU5 A;  1NEN A;  1L0V A;  4YTM A;  1KF6 A;  5C3J A;  2WU2 A;  3AEC A;  1NEK A;  1TD0 A;  1ZOY A;  3CIR A;  1TD4 A;  3P4S A;  3VRA A;  4YT0 A;  4YTP A;  3AED A;  3GQH A;  4KX6 A;  1C5E A;  1TCZ A;  2WQY A;  3AE7 A;  3P4Q A;  5C2T A;  3SFE A;  2H89 A;  1YQ3 A;  2H88 A;  2WS3 A;  4YXD A;  2WDV A;  3P4R A;  2WDQ A;  4YTN A;  1ZP0 A;  3P4P A;  3VRB A;  3AE2 A;  3AE1 A;  3GQK A;  3AEA A;  3AE6 A;  3VR9 A;  3AEG A;  4YSZ A;  3AEB A;  2ACZ A;  4YSY A;  3SUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...