The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
23
|
sequence length |
163
|
structure length |
163
|
Chain Sequence |
DFAEYFESLGGQVIETGYLVTLEKGKIRKAEKGEKIIGVISETAGFVLGESSFEWQGAVLKNEFGGIIYEEVTTEDGVKFKRPLPNPDFDPNKNYIPRSQRREWHVVGLLGQIAVRIDETVKQGHSIDAVGGVATDGDNFIVQEITTPYTKEKGYGVAIVLVK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystallographic insights into the autocatalytic assembly mechanism of a bacteriophage tail spike.
pubmed doi rcsb |
molecule keywords |
Preneck appendage protein
|
molecule tags |
Viral protein
|
source organism |
Bacillus phage phi29
|
total genus |
23
|
structure length |
163
|
sequence length |
163
|
ec nomenclature | |
pdb deposition date | 2009-03-24 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Beta Barrel | Virus Head Decoration Protein; Chain: A, | Head decoration protein D | ||
Few Secondary Structures | Irregular | Rhinovirus 14, subunit 4 | succinate dehydrogenase protein domain |
#chains in the Genus database with same CATH superfamily 4YXD A; 2H89 A; 3AEE A; 3VRB A; 4YT0 A; 3VRA A; 4YSY A; 1KFY A; 3AEG A; 1NEN A; 3AE6 A; 3SUC A; 3AEA A; 1TD0 A; 3VR8 A; 4YTN A; 3AED A; 1YQ3 A; 3GQH A; 2WDV A; 3P4R A; 3VR9 A; 1TCZ A; 3AE5 A; 3AE1 A; 2H88 A; 3P4P A; 3AE8 A; 1ZOY A; 3ABV A; 1ZP0 A; 3AEC A; 1YQ4 A; 2WDR A; 2FBW A; 4KX6 A; 1L0V A; 4YTM A; 3SFE A; 5C2T A; 1NEK A; 1C5E A; 3SFD A; 3GQK A; 1TD4 A; 1TD3 A; 3AE2 A; 2WP9 A; 2WU2 A; 4YSX A; 2WDQ A; 2WQY A; 2WU5 A; 3AE7 A; 4YTP A; 3AEB A; 5C3J A; 3AE3 A; 1VD0 A; 3AE4 A; 3CIR A; 3AE9 A; 3P4S A; 4YSZ A; 1KF6 A; 2WS3 A; 2ACZ A; 3AEF A; 3P4Q A; 2B76 A; #chains in the Genus database with same CATH topology 2H89 A; 1K5M D; 3SUC A; 1TD0 A; 1RHI 4; 2PLV 4; 3VR8 A; 3JBG 4; 1VRH 4; 3GQH A; 1VBB 4; 3P4R A; 3VR9 A; 2H88 A; 1XI1 A; 1R09 4; 1EV1 4; 2RS3 4; 3J8F 4; 1NA1 D; 2PYJ A; 1VBA 4; 4YTM A; 1C5E A; 2R04 4; 2WU2 A; 2WU5 A; 3AE7 A; 1Z7S 4; 3AEB A; 2HWB 4; 1AL2 4; 3AE3 A; 1VD0 A; 4YSZ A; 1KF6 A; 3AEF A; 4YTP A; 1PO2 4; 3AEE A; 4YT0 A; 4YSY A; 1HRI 4; 3AEG A; 3AEA A; 2RS5 4; 4RHV 4; 4YTN A; 1RUI 4; 3AED A; 1RMU 4; 2WDV A; 1TCZ A; 3AE5 A; 3AE8 A; 1RUC 4; 4Q4Y 4; 1PVC 4; 1PIV 4; 1RUH 4; 1VBE 4; 4KX6 A; 1TD4 A; 1RUF 4; 2WP9 A; 1PO1 4; 1AR6 4; 1XHX A; 3AE9 A; 3P4S A; 1RUG 4; 1D4M 4; 1L0V A; 1AR8 4; 3P4Q A; 1POV 0; 4YXD A; 3VRB A; 1KFY A; 1YQ3 A; 4GB3 4; 2R7F A; 1AR9 4; 3AE1 A; 3ABV A; 1ZOY A; 1HRV 4; 1ZP0 A; 3AEC A; 1YQ4 A; 1RUE 4; 2WDR A; 2PYL A; 4Q4V 4; 1XHZ A; 1NEK A; 3GQK A; 1VBD 4; 3AE2 A; 1TD3 A; 2PW9 A; 2WQY A; 1AR7 4; 2RM2 4; 2EX3 A; 2R06 4; 1NCQ D; 5C3J A; 1R08 4; 2RR1 4; 3AE4 A; 3CIR A; 1H8T D; 4PDW D; 2RMU 4; 1BEV 4; 2ACZ A; 1RUJ 4; 3VRA A; 4Q4X 4; 1MQT D; 1RUD 4; 1NEN A; 3AE6 A; 3FI7 A; 1RVF 4; 1ASJ 4; 3P4P A; 2R07 4; 4Q4W 4; 2FBW A; 5C2T A; 3SFE A; 2X5I D; 3SFD A; 1HXS 4; 2PZS A; 1EAH 4; 2RS1 4; 4YSX A; 2WDQ A; 2HWC 4; 1VBC 4; 1COV 4; 2PY5 A; 2WS3 A; 1OOP D; 3JD7 4; 2B76 A; #chains in the Genus database with same CATH homology 4YXD A; 2H89 A; 3AEE A; 3VRB A; 4YT0 A; 3VRA A; 4YSY A; 1KFY A; 3AEG A; 1NEN A; 3AE6 A; 3SUC A; 3AEA A; 1TD0 A; 3VR8 A; 4YTN A; 3AED A; 1YQ3 A; 3GQH A; 2WDV A; 3P4R A; 3VR9 A; 1TCZ A; 3AE5 A; 3AE1 A; 2H88 A; 3P4P A; 3AE8 A; 1ZOY A; 3ABV A; 1ZP0 A; 3AEC A; 1YQ4 A; 2WDR A; 2FBW A; 4KX6 A; 1L0V A; 4YTM A; 3SFE A; 5C2T A; 1NEK A; 1C5E A; 3SFD A; 3GQK A; 1TD4 A; 1TD3 A; 3AE2 A; 2WP9 A; 2WU2 A; 4YSX A; 2WDQ A; 2WQY A; 2WU5 A; 3AE7 A; 4YTP A; 3AEB A; 5C3J A; 3AE3 A; 1VD0 A; 3AE4 A; 3CIR A; 3AE9 A; 3P4S A; 4YSZ A; 1KF6 A; 2WS3 A; 2ACZ A; 3AEF A; 3P4Q A; 2B76 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...