3GQKA

Crystal structure of the bacteriophage phi29 gene product 12 c-terminal fragment in complex with atp
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
163
structure length
163
Chain Sequence
b'DFAEYFESLGGQVIETGYLVTLEKGKIRKAEKGEKIIGVISETAGFVLGESSFEWQGAVLKNEFGGIIYEEVTTEDGVKFKRPLPNPDFDPNKNYIPRSQRREWHVVGLLGQIAVRIDETVKQGHSIDAVGGVATDGDNFIVQEITTPYTKEKGYGVAIVLVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Preneck appendage protein
publication title Crystallographic insights into the autocatalytic assembly mechanism of a bacteriophage tail spike.
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Viral protein
total genus 23
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2009-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.300.10 Mainly Beta Beta Barrel Virus Head Decoration Protein; Chain: A, Head decoration protein D 3gqkA01
4.10.80.40 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 succinate dehydrogenase protein domain 3gqkA02
3ABVA 3GQKA 3VR9A 5C2TA 1TD4A 3AE2A 3AE4A 2WDVA 3AEDA 1YQ3A 3AE6A 3P4QA 3CIRA 3P4SA 4YSXA 4YTNA 3SUCA 1NENA 3AEGA 3P4PA 2WU5A 2FBWA 3AEEA 3VRAA 3AE5A 3AEAA 4KX6A 3P4RA 3AE1A 3AEFA 2H89A 3AECA 3VR8A 1C5EA 1TCZA 1TD3A 2ACZA 2WDQA 1L0VA 2WDRA 1ZP0A 2WU2A 3SFDA 2WQYA 4YTMA 3AEBA 3SFEA 4YT0A 4YSZA 5C3JA 1KFYA 1TD0A 3AE3A 3GQHA 4YSYA 1YQ4A 2H88A 3AE7A 2WS3A 4YTPA 1ZOYA 3AE9A 2WP9A 3AE8A 1VD0A 4YXDA 2B76A 1NEKA 1KF6A 3VRBA
chains in the Genus database with same CATH superfamily
2R7FA 3CIRA 4YTNA 2PW9A 1HRI4 1K5MD 1R084 3AEAA 2PYJA 3AE1A 4Q4W4 2RM24 1C5EA 1TCZA 1ZP0A 3FI7A 2WU2A 4YTMA 1RUH4 3SFEA 1HRV4 4YT0A 5C3JA 3AE3A 2EX3A 4YSYA 1YQ4A 1RUE4 2RS14 1ZOYA 3AE8A 1D4M4 4YXDA 3JBG4 3AEEA 1KF6A 2HWB4 1RUD4 1TD4A 5C2TA 3AEDA 4YSXA 3JD74 1AL24 3SUCA 1XHZA 3P4PA 2WU5A 3J8F4 4KX6A 1RUI4 3AECA 1AR94 2ACZA 2WDQA 2RS54 2PLV4 2RMU4 3GQHA 1RUC4 3AE7A 4YTPA 2R044 2WS3A 3AE9A 1COV4 3VRBA 2X5ID 1PIV4 1RUF4 3AE2A 3AE4A 3AE6A 3P4SA 4Q4V4 1NA1D 1XHXA 1VBE4 1VRH4 2FBWA 2RS34 3VRAA 1ASJ4 3AE5A 1BEV4 1HXS4 1VBD4 1EAH4 1RUJ4 2H89A 2RR14 3VR8A 1VBA4 2WDRA 1MQTD 1AR84 1VBB4 2R074 1Z7S4 3AEBA 4RHV4 4GB34 2WP9A 1VD0A 1PVC4 2PY5A 2B76A 1VBC4 1NEKA 1H8TD 3ABVA 3GQKA 1XI1A 3VR9A 2R064 3P4QA 2WDVA 1YQ3A 2PYLA 1NENA 3AEGA 1R094 3P4RA 3AEFA 1RHI4 2PZSA 1TD3A 1L0VA 4Q4Y4 3SFDA 1PO14 2WQYA 1EV14 1NCQD 1PO24 2HWC4 4YSZA 1KFYA 1TD0A 1OOPD 2H88A 4PDWD 4Q4X4 1AR74 1POV0 1RUG4 1AR64 1RVF4 1RMU4
chains in the Genus database with same CATH topology
3ABVA 3GQKA 3VR9A 5C2TA 1TD4A 3AE2A 3AE4A 2WDVA 3AEDA 1YQ3A 3AE6A 3P4QA 3CIRA 3P4SA 4YSXA 4YTNA 3SUCA 1NENA 3AEGA 3P4PA 2WU5A 2FBWA 3AEEA 3VRAA 3AE5A 3AEAA 4KX6A 3P4RA 3AE1A 3AEFA 2H89A 3AECA 3VR8A 1C5EA 1TCZA 1TD3A 2ACZA 2WDQA 1L0VA 2WDRA 1ZP0A 2WU2A 3SFDA 2WQYA 4YTMA 3AEBA 3SFEA 4YT0A 4YSZA 5C3JA 1KFYA 1TD0A 3AE3A 3GQHA 4YSYA 1YQ4A 2H88A 3AE7A 2WS3A 4YTPA 1ZOYA 3AE9A 2WP9A 3AE8A 1VD0A 4YXDA 2B76A 1NEKA 1KF6A 3VRBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ABV A;  3GQK A;  3VR9 A;  5C2T A;  1TD4 A;  3AE2 A;  3AE4 A;  2WDV A;  3AED A;  1YQ3 A;  3AE6 A;  3P4Q A;  3CIR A;  3P4S A;  4YSX A;  4YTN A;  3SUC A;  1NEN A;  3AEG A;  3P4P A;  2WU5 A;  2FBW A;  3AEE A;  3VRA A;  3AE5 A;  3AEA A;  4KX6 A;  3P4R A;  3AE1 A;  3AEF A;  2H89 A;  3AEC A;  3VR8 A;  1C5E A;  1TCZ A;  1TD3 A;  2ACZ A;  2WDQ A;  1L0V A;  2WDR A;  1ZP0 A;  2WU2 A;  3SFD A;  2WQY A;  4YTM A;  3AEB A;  3SFE A;  4YT0 A;  4YSZ A;  5C3J A;  1KFY A;  1TD0 A;  3AE3 A;  3GQH A;  4YSY A;  1YQ4 A;  2H88 A;  3AE7 A;  2WS3 A;  4YTP A;  1ZOY A;  3AE9 A;  2WP9 A;  3AE8 A;  1VD0 A;  4YXD A;  2B76 A;  1NEK A;  1KF6 A;  3VRB A; 
#chains in the Genus database with same CATH topology
 2R7F A;  3CIR A;  4YTN A;  2PW9 A;  1HRI 4;  1K5M D;  1R08 4;  3AEA A;  2PYJ A;  3AE1 A;  4Q4W 4;  2RM2 4;  1C5E A;  1TCZ A;  1ZP0 A;  3FI7 A;  2WU2 A;  4YTM A;  1RUH 4;  3SFE A;  1HRV 4;  4YT0 A;  5C3J A;  3AE3 A;  2EX3 A;  4YSY A;  1YQ4 A;  1RUE 4;  2RS1 4;  1ZOY A;  3AE8 A;  1D4M 4;  4YXD A;  3JBG 4;  3AEE A;  1KF6 A;  2HWB 4;  1RUD 4;  1TD4 A;  5C2T A;  3AED A;  4YSX A;  3JD7 4;  1AL2 4;  3SUC A;  1XHZ A;  3P4P A;  2WU5 A;  3J8F 4;  4KX6 A;  1RUI 4;  3AEC A;  1AR9 4;  2ACZ A;  2WDQ A;  2RS5 4;  2PLV 4;  2RMU 4;  3GQH A;  1RUC 4;  3AE7 A;  4YTP A;  2R04 4;  2WS3 A;  3AE9 A;  1COV 4;  3VRB A;  2X5I D;  1PIV 4;  1RUF 4;  3AE2 A;  3AE4 A;  3AE6 A;  3P4S A;  4Q4V 4;  1NA1 D;  1XHX A;  1VBE 4;  1VRH 4;  2FBW A;  2RS3 4;  3VRA A;  1ASJ 4;  3AE5 A;  1BEV 4;  1HXS 4;  1VBD 4;  1EAH 4;  1RUJ 4;  2H89 A;  2RR1 4;  3VR8 A;  1VBA 4;  2WDR A;  1MQT D;  1AR8 4;  1VBB 4;  2R07 4;  1Z7S 4;  3AEB A;  4RHV 4;  4GB3 4;  2WP9 A;  1VD0 A;  1PVC 4;  2PY5 A;  2B76 A;  1VBC 4;  1NEK A;  1H8T D;  3ABV A;  3GQK A;  1XI1 A;  3VR9 A;  2R06 4;  3P4Q A;  2WDV A;  1YQ3 A;  2PYL A;  1NEN A;  3AEG A;  1R09 4;  3P4R A;  3AEF A;  1RHI 4;  2PZS A;  1TD3 A;  1L0V A;  4Q4Y 4;  3SFD A;  1PO1 4;  2WQY A;  1EV1 4;  1NCQ D;  1PO2 4;  2HWC 4;  4YSZ A;  1KFY A;  1TD0 A;  1OOP D;  2H88 A;  4PDW D;  4Q4X 4;  1AR7 4;  1POV 0;  1RUG 4;  1AR6 4;  1RVF 4;  1RMU 4; 
#chains in the Genus database with same CATH homology
 3ABV A;  3GQK A;  3VR9 A;  5C2T A;  1TD4 A;  3AE2 A;  3AE4 A;  2WDV A;  3AED A;  1YQ3 A;  3AE6 A;  3P4Q A;  3CIR A;  3P4S A;  4YSX A;  4YTN A;  3SUC A;  1NEN A;  3AEG A;  3P4P A;  2WU5 A;  2FBW A;  3AEE A;  3VRA A;  3AE5 A;  3AEA A;  4KX6 A;  3P4R A;  3AE1 A;  3AEF A;  2H89 A;  3AEC A;  3VR8 A;  1C5E A;  1TCZ A;  1TD3 A;  2ACZ A;  2WDQ A;  1L0V A;  2WDR A;  1ZP0 A;  2WU2 A;  3SFD A;  2WQY A;  4YTM A;  3AEB A;  3SFE A;  4YT0 A;  4YSZ A;  5C3J A;  1KFY A;  1TD0 A;  3AE3 A;  3GQH A;  4YSY A;  1YQ4 A;  2H88 A;  3AE7 A;  2WS3 A;  4YTP A;  1ZOY A;  3AE9 A;  2WP9 A;  3AE8 A;  1VD0 A;  4YXD A;  2B76 A;  1NEK A;  1KF6 A;  3VRB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...