3GQKA

Crystal structure of the bacteriophage phi29 gene product 12 c-terminal fragment in complex with atp
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
163
structure length
163
Chain Sequence
DFAEYFESLGGQVIETGYLVTLEKGKIRKAEKGEKIIGVISETAGFVLGESSFEWQGAVLKNEFGGIIYEEVTTEDGVKFKRPLPNPDFDPNKNYIPRSQRREWHVVGLLGQIAVRIDETVKQGHSIDAVGGVATDGDNFIVQEITTPYTKEKGYGVAIVLVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Preneck appendage protein
publication title Crystallographic insights into the autocatalytic assembly mechanism of a bacteriophage tail spike.
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Viral protein
total genus 23
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2009-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.300.10 Mainly Beta Beta Barrel Virus Head Decoration Protein; Chain: A, Head decoration protein D 3gqkA01
4.10.80.40 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 succinate dehydrogenase protein domain 3gqkA02
4YTMA 3VR8A 4YTNA 2H89A 4KX6A 3VR9A 3AE5A 1NENA 1TCZA 2WP9A 3AE8A 3P4SA 1NEKA 4YSYA 3AE9A 2H88A 1C5EA 3AE2A 1KF6A 4YT0A 2WDVA 3P4PA 2FBWA 4YSZA 4YXDA 1KFYA 2WDRA 1VD0A 1ZOYA 1L0VA 3P4QA 3CIRA 3P4RA 2WU2A 2WQYA 3SUCA 3AEAA 5C3JA 3ABVA 3AEBA 3AEDA 3AE3A 3SFDA 1ZP0A 4YSXA 3AECA 3GQKA 2WU5A 3AEGA 3AE1A 5C2TA 3SFEA 3VRBA 2ACZA 1TD3A 3AE4A 1TD4A 2WDQA 1YQ3A 3AEEA 3GQHA 1YQ4A 2B76A 2WS3A 3AE7A 3AEFA 3AE6A 4YTPA 1TD0A 3VRAA
chains in the Genus database with same CATH superfamily
1VBD4 2PLV4 3VR9A 1Z7S4 1NENA 3AE8A 4YSYA 1NEKA 3AE9A 1RUD4 1AR74 2RS54 3P4QA 1OOPD 2HWB4 2WQYA 2X5ID 3JD74 5C3JA 3AEBA 4RHV4 3AECA 3GQKA 2WU5A 3AE1A 1COV4 1RUF4 3SFEA 2ACZA 1TD3A 1K5MD 1TD4A 2RM24 3GQHA 1AR94 3AEFA 1TD0A 2EX3A 1PO14 4YTNA 2R044 1R084 1VBA4 1PVC4 2H88A 1KF6A 2WDVA 3P4PA 1HXS4 4YSZA 1VD0A 1ZOYA 2RS34 1L0VA 2PYJA 4Q4V4 1XHXA 1XI1A 3AEGA 2RMU4 4PDWD 1XHZA 2HWC4 1RUJ4 1EV14 3AEEA 3J8F4 2RR14 2WS3A 1RUH4 3AE6A 4YTPA 3VR8A 1AR84 2H89A 4KX6A 2R064 1VBC4 1EAH4 1RMU4 1RUI4 3P4SA 1ASJ4 3AE2A 1H8TD 4YXDA 1RUC4 1D4M4 2WDRA 1RHI4 3CIRA 2WU2A 1NA1D 1RVF4 3AEDA 2R7FA 1ZP0A 4YSXA 2RS14 4Q4Y4 5C2TA 2PYLA 2R074 3AE4A 1YQ3A 1YQ4A 3AE7A 1HRI4 1NCQD 4YTMA 1AR64 1VBE4 3FI7A 1MQTD 1RUG4 2PW9A 3JBG4 3AE5A 4Q4W4 1TCZA 2WP9A 1HRV4 1PO24 1C5EA 4YT0A 1AL24 2FBWA 2PZSA 1KFYA 1R094 4GB34 1VRH4 3P4RA 3SUCA 3AEAA 3ABVA 3AE3A 3SFDA 4Q4X4 1VBB4 1BEV4 2PY5A 3VRBA 1RUE4 1PIV4 2WDQA 1POV0 2B76A 3VRAA
chains in the Genus database with same CATH topology
4YTMA 3VR8A 4YTNA 2H89A 4KX6A 3VR9A 3AE5A 1NENA 1TCZA 2WP9A 3AE8A 3P4SA 1NEKA 4YSYA 3AE9A 2H88A 1C5EA 3AE2A 1KF6A 4YT0A 2WDVA 3P4PA 2FBWA 4YSZA 4YXDA 1KFYA 2WDRA 1VD0A 1ZOYA 1L0VA 3P4QA 3CIRA 3P4RA 2WU2A 2WQYA 3SUCA 3AEAA 5C3JA 3ABVA 3AEBA 3AEDA 3AE3A 3SFDA 1ZP0A 4YSXA 3AECA 3GQKA 2WU5A 3AEGA 3AE1A 5C2TA 3SFEA 3VRBA 2ACZA 1TD3A 3AE4A 1TD4A 2WDQA 1YQ3A 3AEEA 3GQHA 1YQ4A 2B76A 2WS3A 3AE7A 3AEFA 3AE6A 4YTPA 1TD0A 3VRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YTM A;  3VR8 A;  4YTN A;  2H89 A;  4KX6 A;  3VR9 A;  3AE5 A;  1NEN A;  1TCZ A;  2WP9 A;  3AE8 A;  3P4S A;  1NEK A;  4YSY A;  3AE9 A;  2H88 A;  1C5E A;  3AE2 A;  1KF6 A;  4YT0 A;  2WDV A;  3P4P A;  2FBW A;  4YSZ A;  4YXD A;  1KFY A;  2WDR A;  1VD0 A;  1ZOY A;  1L0V A;  3P4Q A;  3CIR A;  3P4R A;  2WU2 A;  2WQY A;  3SUC A;  3AEA A;  5C3J A;  3ABV A;  3AEB A;  3AED A;  3AE3 A;  3SFD A;  1ZP0 A;  4YSX A;  3AEC A;  3GQK A;  2WU5 A;  3AEG A;  3AE1 A;  5C2T A;  3SFE A;  3VRB A;  2ACZ A;  1TD3 A;  3AE4 A;  1TD4 A;  2WDQ A;  1YQ3 A;  3AEE A;  3GQH A;  1YQ4 A;  2B76 A;  2WS3 A;  3AE7 A;  3AEF A;  3AE6 A;  4YTP A;  1TD0 A;  3VRA A; 
#chains in the Genus database with same CATH topology
 1VBD 4;  2PLV 4;  3VR9 A;  1Z7S 4;  1NEN A;  3AE8 A;  4YSY A;  1NEK A;  3AE9 A;  1RUD 4;  1AR7 4;  2RS5 4;  3P4Q A;  1OOP D;  2HWB 4;  2WQY A;  2X5I D;  3JD7 4;  5C3J A;  3AEB A;  4RHV 4;  3AEC A;  3GQK A;  2WU5 A;  3AE1 A;  1COV 4;  1RUF 4;  3SFE A;  2ACZ A;  1TD3 A;  1K5M D;  1TD4 A;  2RM2 4;  3GQH A;  1AR9 4;  3AEF A;  1TD0 A;  2EX3 A;  1PO1 4;  4YTN A;  2R04 4;  1R08 4;  1VBA 4;  1PVC 4;  2H88 A;  1KF6 A;  2WDV A;  3P4P A;  1HXS 4;  4YSZ A;  1VD0 A;  1ZOY A;  2RS3 4;  1L0V A;  2PYJ A;  4Q4V 4;  1XHX A;  1XI1 A;  3AEG A;  2RMU 4;  4PDW D;  1XHZ A;  2HWC 4;  1RUJ 4;  1EV1 4;  3AEE A;  3J8F 4;  2RR1 4;  2WS3 A;  1RUH 4;  3AE6 A;  4YTP A;  3VR8 A;  1AR8 4;  2H89 A;  4KX6 A;  2R06 4;  1VBC 4;  1EAH 4;  1RMU 4;  1RUI 4;  3P4S A;  1ASJ 4;  3AE2 A;  1H8T D;  4YXD A;  1RUC 4;  1D4M 4;  2WDR A;  1RHI 4;  3CIR A;  2WU2 A;  1NA1 D;  1RVF 4;  3AED A;  2R7F A;  1ZP0 A;  4YSX A;  2RS1 4;  4Q4Y 4;  5C2T A;  2PYL A;  2R07 4;  3AE4 A;  1YQ3 A;  1YQ4 A;  3AE7 A;  1HRI 4;  1NCQ D;  4YTM A;  1AR6 4;  1VBE 4;  3FI7 A;  1MQT D;  1RUG 4;  2PW9 A;  3JBG 4;  3AE5 A;  4Q4W 4;  1TCZ A;  2WP9 A;  1HRV 4;  1PO2 4;  1C5E A;  4YT0 A;  1AL2 4;  2FBW A;  2PZS A;  1KFY A;  1R09 4;  4GB3 4;  1VRH 4;  3P4R A;  3SUC A;  3AEA A;  3ABV A;  3AE3 A;  3SFD A;  4Q4X 4;  1VBB 4;  1BEV 4;  2PY5 A;  3VRB A;  1RUE 4;  1PIV 4;  2WDQ A;  1POV 0;  2B76 A;  3VRA A; 
#chains in the Genus database with same CATH homology
 4YTM A;  3VR8 A;  4YTN A;  2H89 A;  4KX6 A;  3VR9 A;  3AE5 A;  1NEN A;  1TCZ A;  2WP9 A;  3AE8 A;  3P4S A;  1NEK A;  4YSY A;  3AE9 A;  2H88 A;  1C5E A;  3AE2 A;  1KF6 A;  4YT0 A;  2WDV A;  3P4P A;  2FBW A;  4YSZ A;  4YXD A;  1KFY A;  2WDR A;  1VD0 A;  1ZOY A;  1L0V A;  3P4Q A;  3CIR A;  3P4R A;  2WU2 A;  2WQY A;  3SUC A;  3AEA A;  5C3J A;  3ABV A;  3AEB A;  3AED A;  3AE3 A;  3SFD A;  1ZP0 A;  4YSX A;  3AEC A;  3GQK A;  2WU5 A;  3AEG A;  3AE1 A;  5C2T A;  3SFE A;  3VRB A;  2ACZ A;  1TD3 A;  3AE4 A;  1TD4 A;  2WDQ A;  1YQ3 A;  3AEE A;  3GQH A;  1YQ4 A;  2B76 A;  2WS3 A;  3AE7 A;  3AEF A;  3AE6 A;  4YTP A;  1TD0 A;  3VRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...