3GQOA

Crystal structure of macro domain of venezuelan equine encephalitis virus in complex with adp-ribose
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
161
structure length
161
Chain Sequence
KAPSYHVVRGDIATATEGVIINAANSKGQPGGGVCGALYKKFPESFDLQPIEVGKARLVKGAAKHIIHAVGPNFNKVSEVEGDKQLAEAYESIAKIVNDNNYKSVAIPLLSTGIFSGNKDRLTQSLNHLLTALDTTDADVAIYCRDKKWEMTLKEAVARRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structures of Chikungunya and Venezuelan equine encephalitis virus nsP3 macro domains define a conserved adenosine binding pocket
pubmed doi rcsb
source organism Venezuelan equine encephalitis virus
molecule tags Viral protein
molecule keywords Non-structural protein 3
total genus 51
structure length 161
sequence length 161
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2009-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3gqoA00
3Q71A 3EWRA 4X2TA 3KQZA 2DX6A 4IQYA 3VFQA 4R6TA 4K3NA 1BLLE 5D8NA 5AILA 4ZI6A 2L8RA 2BFRA 5CB5A 3SIGA 5FSZA 3KQXA 4J5SA 2BFQA 5DUSA 4JVVA 3EW5A 3GPGA 4R76A 4ABLA 4J5RA 4ZX9A 4ZY1A 4D86A 3PEIA 4ZX8A 4ETJA 4R7MA 2ACFA 5HIHA 4KYBA 1GYTA 3GQEA 3KZWA 4GVVA 3EWOA 5FSXA 2FG1A 1VHUA 1NJRA 1BPMA 4ZY2A 3EJGA 2EWBA 4J5QA 3KR4A 3H8EA 1ZR3A 2FXKA 4KSIA 3V2BA 4K0CA 1TY8A 4GUAA 4ETKA 5FSYA 4JCAA 3H8GA 3GQOA 1SPVA 3GPQA 5HOLA 4ZY0A 5E3BA 2VRIA 3SIHA 5FSVA 1LAPA 2X47A 3ETIA 3EJFA 2LGRA 3IIFA 4ABKA 5CB3A 1BPNA 3KR5A 5CMSA 3IIDA 3JRUA 2J9AA 3SIJA 3GPOA 1HJZA 3V45A 1LCPA 3EWQA 5FSUA 4JLLA 3SIIA 5CBMA 2XD7A 1LAMA 2AFCA 3EKEA 3Q6ZA 4JGKA 4UMLA 4ZYQA 3JZTA 3IJ3A 4TU0A 4ESSA 1YD9A 1ZR5A 3T8WA 1TXZA 2FAVA 4GVWA 1LANA 4J4ZA 2EEEA 3EWPA 3H8FA
chains in the Genus database with same CATH superfamily
3Q71A 3EWRA 4X2TA 3KQZA 2DX6A 4IQYA 3VFQA 4R6TA 4K3NA 2KQVA 2W2GA 1BLLE 5D8NA 5AILA 4ZI6A 2L8RA 2BFRA 5CB5A 3SIGA 5FSZA 3KQXA 4J5SA 2BFQA 5DUSA 4JVVA 3EW5A 3GPGA 4R76A 4ABLA 4J5RA 4ZX9A 4ZY1A 4D86A 3PEIA 4ZX8A 4ETJA 4R7MA 2ACFA 5HIHA 4KYBA 1GYTA 3GQEA 3KZWA 4GVVA 3EWOA 5FSXA 2FG1A 1VHUA 1NJRA 1BPMA 4ZY2A 3EJGA 2EWBA 4J5QA 3KR4A 3H8EA 1ZR3A 2FXKA 4KSIA 3V2BA 4K0CA 1TY8A 4GUAA 4ETKA 5FSYA 2JZDA 4JCAA 3H8GA 3GQOA 1SPVA 3GPQA 5HOLA 4ZY0A 5E3BA 2VRIA 3SIHA 5FSVA 1LAPA 2X47A 3ETIA 3EJFA 2LGRA 2WCTA 3IIFA 4ABKA 5CB3A 1BPNA 3KR5A 3IIDA 5CMSA 3JRUA 2JZFA 2J9AA 3SIJA 3GPOA 1HJZA 3V45A 1LCPA 3EWQA 5FSUA 4JLLA 3SIIA 5CBMA 2XD7A 1LAMA 2AFCA 3EKEA 3Q6ZA 4JGKA 4UMLA 4ZYQA 3JZTA 3IJ3A 4TU0A 4ESSA 1YD9A 1ZR5A 2RNKA 3T8WA 1TXZA 2FAVA 4GVWA 2JZEA 1LANA 4J4ZA 2EEEA 3EWPA 3H8FA
chains in the Genus database with same CATH topology
3Q71A 3EWRA 4X2TA 3KQZA 2DX6A 4IQYA 3VFQA 4R6TA 4K3NA 1BLLE 5D8NA 5AILA 4ZI6A 2L8RA 2BFRA 5CB5A 3SIGA 5FSZA 3KQXA 4J5SA 2BFQA 5DUSA 4JVVA 3EW5A 3GPGA 4R76A 4ABLA 4J5RA 4ZX9A 4ZY1A 4D86A 3PEIA 4ZX8A 4ETJA 4R7MA 2ACFA 5HIHA 4KYBA 1GYTA 3GQEA 3KZWA 4GVVA 3EWOA 5FSXA 2FG1A 1VHUA 1NJRA 1BPMA 4ZY2A 3EJGA 2EWBA 4J5QA 3KR4A 3H8EA 1ZR3A 2FXKA 4KSIA 3V2BA 4K0CA 1TY8A 4GUAA 4ETKA 5FSYA 4JCAA 3H8GA 3GQOA 1SPVA 3GPQA 5HOLA 4ZY0A 5E3BA 2VRIA 3SIHA 5FSVA 1LAPA 2X47A 3ETIA 3EJFA 2LGRA 3IIFA 4ABKA 5CB3A 1BPNA 3KR5A 5CMSA 3IIDA 3JRUA 2J9AA 3SIJA 3GPOA 1HJZA 3V45A 1LCPA 3EWQA 5FSUA 4JLLA 3SIIA 5CBMA 2XD7A 1LAMA 2AFCA 3EKEA 3Q6ZA 4JGKA 4UMLA 4ZYQA 3JZTA 3IJ3A 4TU0A 4ESSA 1YD9A 1ZR5A 3T8WA 1TXZA 2FAVA 4GVWA 1LANA 4J4ZA 2EEEA 3EWPA 3H8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q71 A;  3EWR A;  4X2T A;  3KQZ A;  2DX6 A;  4IQY A;  3VFQ A;  4R6T A;  4K3N A;  1BLL E;  5D8N A;  5AIL A;  4ZI6 A;  2L8R A;  2BFR A;  5CB5 A;  3SIG A;  5FSZ A;  3KQX A;  4J5S A;  2BFQ A;  5DUS A;  4JVV A;  3EW5 A;  3GPG A;  4R76 A;  4ABL A;  4J5R A;  4ZX9 A;  4ZY1 A;  4D86 A;  3PEI A;  4ZX8 A;  4ETJ A;  4R7M A;  2ACF A;  5HIH A;  4KYB A;  1GYT A;  3GQE A;  3KZW A;  4GVV A;  3EWO A;  5FSX A;  2FG1 A;  1VHU A;  1NJR A;  1BPM A;  4ZY2 A;  3EJG A;  2EWB A;  4J5Q A;  3KR4 A;  3H8E A;  1ZR3 A;  2FXK A;  4KSI A;  3V2B A;  4K0C A;  1TY8 A;  4GUA A;  4ETK A;  5FSY A;  4JCA A;  3H8G A;  3GQO A;  1SPV A;  3GPQ A;  5HOL A;  4ZY0 A;  5E3B A;  2VRI A;  3SIH A;  5FSV A;  1LAP A;  2X47 A;  3ETI A;  3EJF A;  2LGR A;  3IIF A;  4ABK A;  5CB3 A;  1BPN A;  3KR5 A;  5CMS A;  3IID A;  3JRU A;  2J9A A;  3SIJ A;  3GPO A;  1HJZ A;  3V45 A;  1LCP A;  3EWQ A;  5FSU A;  4JLL A;  3SII A;  5CBM A;  2XD7 A;  1LAM A;  2AFC A;  3EKE A;  3Q6Z A;  4JGK A;  4UML A;  4ZYQ A;  3JZT A;  3IJ3 A;  4TU0 A;  4ESS A;  1YD9 A;  1ZR5 A;  3T8W A;  1TXZ A;  2FAV A;  4GVW A;  1LAN A;  4J4Z A;  2EEE A;  3EWP A;  3H8F A; 
#chains in the Genus database with same CATH topology
 3Q71 A;  3EWR A;  4X2T A;  3KQZ A;  2DX6 A;  4IQY A;  3VFQ A;  4R6T A;  4K3N A;  2KQV A;  2W2G A;  1BLL E;  5D8N A;  5AIL A;  4ZI6 A;  2L8R A;  2BFR A;  5CB5 A;  3SIG A;  5FSZ A;  3KQX A;  4J5S A;  2BFQ A;  5DUS A;  4JVV A;  3EW5 A;  3GPG A;  4R76 A;  4ABL A;  4J5R A;  4ZX9 A;  4ZY1 A;  4D86 A;  3PEI A;  4ZX8 A;  4ETJ A;  4R7M A;  2ACF A;  5HIH A;  4KYB A;  1GYT A;  3GQE A;  3KZW A;  4GVV A;  3EWO A;  5FSX A;  2FG1 A;  1VHU A;  1NJR A;  1BPM A;  4ZY2 A;  3EJG A;  2EWB A;  4J5Q A;  3KR4 A;  3H8E A;  1ZR3 A;  2FXK A;  4KSI A;  3V2B A;  4K0C A;  1TY8 A;  4GUA A;  4ETK A;  5FSY A;  2JZD A;  4JCA A;  3H8G A;  3GQO A;  1SPV A;  3GPQ A;  5HOL A;  4ZY0 A;  5E3B A;  2VRI A;  3SIH A;  5FSV A;  1LAP A;  2X47 A;  3ETI A;  3EJF A;  2LGR A;  2WCT A;  3IIF A;  4ABK A;  5CB3 A;  1BPN A;  3KR5 A;  3IID A;  5CMS A;  3JRU A;  2JZF A;  2J9A A;  3SIJ A;  3GPO A;  1HJZ A;  3V45 A;  1LCP A;  3EWQ A;  5FSU A;  4JLL A;  3SII A;  5CBM A;  2XD7 A;  1LAM A;  2AFC A;  3EKE A;  3Q6Z A;  4JGK A;  4UML A;  4ZYQ A;  3JZT A;  3IJ3 A;  4TU0 A;  4ESS A;  1YD9 A;  1ZR5 A;  2RNK A;  3T8W A;  1TXZ A;  2FAV A;  4GVW A;  2JZE A;  1LAN A;  4J4Z A;  2EEE A;  3EWP A;  3H8F A; 
#chains in the Genus database with same CATH homology
 3Q71 A;  3EWR A;  4X2T A;  3KQZ A;  2DX6 A;  4IQY A;  3VFQ A;  4R6T A;  4K3N A;  1BLL E;  5D8N A;  5AIL A;  4ZI6 A;  2L8R A;  2BFR A;  5CB5 A;  3SIG A;  5FSZ A;  3KQX A;  4J5S A;  2BFQ A;  5DUS A;  4JVV A;  3EW5 A;  3GPG A;  4R76 A;  4ABL A;  4J5R A;  4ZX9 A;  4ZY1 A;  4D86 A;  3PEI A;  4ZX8 A;  4ETJ A;  4R7M A;  2ACF A;  5HIH A;  4KYB A;  1GYT A;  3GQE A;  3KZW A;  4GVV A;  3EWO A;  5FSX A;  2FG1 A;  1VHU A;  1NJR A;  1BPM A;  4ZY2 A;  3EJG A;  2EWB A;  4J5Q A;  3KR4 A;  3H8E A;  1ZR3 A;  2FXK A;  4KSI A;  3V2B A;  4K0C A;  1TY8 A;  4GUA A;  4ETK A;  5FSY A;  4JCA A;  3H8G A;  3GQO A;  1SPV A;  3GPQ A;  5HOL A;  4ZY0 A;  5E3B A;  2VRI A;  3SIH A;  5FSV A;  1LAP A;  2X47 A;  3ETI A;  3EJF A;  2LGR A;  3IIF A;  4ABK A;  5CB3 A;  1BPN A;  3KR5 A;  5CMS A;  3IID A;  3JRU A;  2J9A A;  3SIJ A;  3GPO A;  1HJZ A;  3V45 A;  1LCP A;  3EWQ A;  5FSU A;  4JLL A;  3SII A;  5CBM A;  2XD7 A;  1LAM A;  2AFC A;  3EKE A;  3Q6Z A;  4JGK A;  4UML A;  4ZYQ A;  3JZT A;  3IJ3 A;  4TU0 A;  4ESS A;  1YD9 A;  1ZR5 A;  3T8W A;  1TXZ A;  2FAV A;  4GVW A;  1LAN A;  4J4Z A;  2EEE A;  3EWP A;  3H8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...