3GQOA

Crystal structure of macro domain of venezuelan equine encephalitis virus in complex with adp-ribose
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
161
structure length
161
Chain Sequence
KAPSYHVVRGDIATATEGVIINAANSKGQPGGGVCGALYKKFPESFDLQPIEVGKARLVKGAAKHIIHAVGPNFNKVSEVEGDKQLAEAYESIAKIVNDNNYKSVAIPLLSTGIFSGNKDRLTQSLNHLLTALDTTDADVAIYCRDKKWEMTLKEAVARRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structures of Chikungunya and Venezuelan equine encephalitis virus nsP3 macro domains define a conserved adenosine binding pocket
pubmed doi rcsb
source organism Venezuelan equine encephalitis virus
molecule tags Viral protein
molecule keywords Non-structural protein 3
total genus 51
structure length 161
sequence length 161
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2009-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3gqoA00
1VHUA 1LCPA 5AILA 5DUSA 4UMLA 4K3NA 4KSIA 4D86A 3GQOA 3EWQA 3VFQA 1ZR3A 3EWPA 4ETJA 5HIHA 1GYTA 4ZY2A 4J5RA 4J5SA 2L8RA 2BFQA 2EEEA 2AFCA 1SPVA 3SIIA 2J9AA 4K0CA 3Q71A 4R7MA 3EJFA 3KQZA 3IIFA 1YD9A 5D8NA 3SIHA 1NJRA 1TY8A 3H8GA 3T8WA 3V45A 3GPOA 2FXKA 5CBMA 3H8EA 2BFRA 4TU0A 3H8FA 5FSVA 3IIDA 5FSXA 5E3BA 1BPMA 2EWBA 4ZI6A 4R6TA 2XD7A 4GUAA 2ACFA 5FSYA 4GVWA 4ZY1A 4ZX9A 3GPQA 5CMSA 2FAVA 3EWOA 3Q6ZA 4R76A 1ZR5A 3EKEA 3GQEA 1HJZA 3KR4A 4J5QA 2X47A 2FG1A 4ZX8A 4JGKA 3GPGA 5FSUA 4J4ZA 4X2TA 3KZWA 1LAPA 3EW5A 4GVVA 3JRUA 4ABKA 1BLLE 3SIGA 4ZY0A 5HOLA 3PEIA 3EWRA 3KQXA 5CB5A 4JLLA 3SIJA 5FSZA 3JZTA 2LGRA 1TXZA 3KR5A 2VRIA 4IQYA 4KYBA 4ESSA 4ETKA 3EJGA 1LAMA 4ABLA 4JCAA 3ETIA 3V2BA 1LANA 1BPNA 4ZYQA 3IJ3A 4JVVA 5CB3A 2DX6A
chains in the Genus database with same CATH superfamily
1VHUA 1LCPA 5AILA 5DUSA 4UMLA 4K3NA 4KSIA 4D86A 3GQOA 2WCTA 3EWQA 3VFQA 1ZR3A 3EWPA 4ETJA 5HIHA 1GYTA 4ZY2A 4J5RA 4J5SA 2L8RA 2BFQA 2JZDA 2RNKA 2EEEA 2AFCA 1SPVA 3SIIA 2J9AA 4K0CA 3Q71A 4R7MA 3EJFA 3KQZA 3IIFA 1YD9A 5D8NA 3SIHA 1NJRA 1TY8A 3H8GA 3T8WA 3V45A 3GPOA 2FXKA 5CBMA 3H8EA 2BFRA 4TU0A 3H8FA 5FSVA 3IIDA 5FSXA 5E3BA 1BPMA 2EWBA 4ZI6A 4R6TA 2XD7A 4GUAA 2ACFA 5FSYA 4GVWA 4ZY1A 4ZX9A 3GPQA 5CMSA 2FAVA 3EWOA 3Q6ZA 4R76A 1ZR5A 2KQVA 3EKEA 3GQEA 1HJZA 3KR4A 4J5QA 2X47A 2FG1A 4ZX8A 2JZFA 4JGKA 3GPGA 5FSUA 4J4ZA 4X2TA 3KZWA 1LAPA 3EW5A 4GVVA 2W2GA 3JRUA 4ABKA 1BLLE 3SIGA 4ZY0A 5HOLA 3PEIA 3EWRA 3KQXA 5CB5A 4JLLA 2JZEA 3SIJA 5FSZA 3JZTA 2LGRA 1TXZA 3KR5A 2VRIA 4IQYA 4KYBA 4ESSA 4ETKA 3EJGA 1LAMA 4ABLA 4JCAA 3ETIA 3V2BA 1LANA 1BPNA 4ZYQA 3IJ3A 4JVVA 5CB3A 2DX6A
chains in the Genus database with same CATH topology
1VHUA 1LCPA 5AILA 5DUSA 4UMLA 4K3NA 4KSIA 4D86A 3GQOA 3EWQA 3VFQA 1ZR3A 3EWPA 4ETJA 5HIHA 1GYTA 4ZY2A 4J5RA 4J5SA 2L8RA 2BFQA 2EEEA 2AFCA 1SPVA 3SIIA 2J9AA 4K0CA 3Q71A 4R7MA 3EJFA 3KQZA 3IIFA 1YD9A 5D8NA 3SIHA 1NJRA 1TY8A 3H8GA 3T8WA 3V45A 3GPOA 2FXKA 5CBMA 3H8EA 2BFRA 4TU0A 3H8FA 5FSVA 3IIDA 5FSXA 5E3BA 1BPMA 2EWBA 4ZI6A 4R6TA 2XD7A 4GUAA 2ACFA 5FSYA 4GVWA 4ZY1A 4ZX9A 3GPQA 5CMSA 2FAVA 3EWOA 3Q6ZA 4R76A 1ZR5A 3EKEA 3GQEA 1HJZA 3KR4A 4J5QA 2X47A 2FG1A 4ZX8A 4JGKA 3GPGA 5FSUA 4J4ZA 4X2TA 3KZWA 1LAPA 3EW5A 4GVVA 3JRUA 4ABKA 1BLLE 3SIGA 4ZY0A 5HOLA 3PEIA 3EWRA 3KQXA 5CB5A 4JLLA 3SIJA 5FSZA 3JZTA 2LGRA 1TXZA 3KR5A 2VRIA 4IQYA 4KYBA 4ESSA 4ETKA 3EJGA 1LAMA 4ABLA 4JCAA 3ETIA 3V2BA 1LANA 1BPNA 4ZYQA 3IJ3A 4JVVA 5CB3A 2DX6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VHU A;  1LCP A;  5AIL A;  5DUS A;  4UML A;  4K3N A;  4KSI A;  4D86 A;  3GQO A;  3EWQ A;  3VFQ A;  1ZR3 A;  3EWP A;  4ETJ A;  5HIH A;  1GYT A;  4ZY2 A;  4J5R A;  4J5S A;  2L8R A;  2BFQ A;  2EEE A;  2AFC A;  1SPV A;  3SII A;  2J9A A;  4K0C A;  3Q71 A;  4R7M A;  3EJF A;  3KQZ A;  3IIF A;  1YD9 A;  5D8N A;  3SIH A;  1NJR A;  1TY8 A;  3H8G A;  3T8W A;  3V45 A;  3GPO A;  2FXK A;  5CBM A;  3H8E A;  2BFR A;  4TU0 A;  3H8F A;  5FSV A;  3IID A;  5FSX A;  5E3B A;  1BPM A;  2EWB A;  4ZI6 A;  4R6T A;  2XD7 A;  4GUA A;  2ACF A;  5FSY A;  4GVW A;  4ZY1 A;  4ZX9 A;  3GPQ A;  5CMS A;  2FAV A;  3EWO A;  3Q6Z A;  4R76 A;  1ZR5 A;  3EKE A;  3GQE A;  1HJZ A;  3KR4 A;  4J5Q A;  2X47 A;  2FG1 A;  4ZX8 A;  4JGK A;  3GPG A;  5FSU A;  4J4Z A;  4X2T A;  3KZW A;  1LAP A;  3EW5 A;  4GVV A;  3JRU A;  4ABK A;  1BLL E;  3SIG A;  4ZY0 A;  5HOL A;  3PEI A;  3EWR A;  3KQX A;  5CB5 A;  4JLL A;  3SIJ A;  5FSZ A;  3JZT A;  2LGR A;  1TXZ A;  3KR5 A;  2VRI A;  4IQY A;  4KYB A;  4ESS A;  4ETK A;  3EJG A;  1LAM A;  4ABL A;  4JCA A;  3ETI A;  3V2B A;  1LAN A;  1BPN A;  4ZYQ A;  3IJ3 A;  4JVV A;  5CB3 A;  2DX6 A; 
#chains in the Genus database with same CATH topology
 1VHU A;  1LCP A;  5AIL A;  5DUS A;  4UML A;  4K3N A;  4KSI A;  4D86 A;  3GQO A;  2WCT A;  3EWQ A;  3VFQ A;  1ZR3 A;  3EWP A;  4ETJ A;  5HIH A;  1GYT A;  4ZY2 A;  4J5R A;  4J5S A;  2L8R A;  2BFQ A;  2JZD A;  2RNK A;  2EEE A;  2AFC A;  1SPV A;  3SII A;  2J9A A;  4K0C A;  3Q71 A;  4R7M A;  3EJF A;  3KQZ A;  3IIF A;  1YD9 A;  5D8N A;  3SIH A;  1NJR A;  1TY8 A;  3H8G A;  3T8W A;  3V45 A;  3GPO A;  2FXK A;  5CBM A;  3H8E A;  2BFR A;  4TU0 A;  3H8F A;  5FSV A;  3IID A;  5FSX A;  5E3B A;  1BPM A;  2EWB A;  4ZI6 A;  4R6T A;  2XD7 A;  4GUA A;  2ACF A;  5FSY A;  4GVW A;  4ZY1 A;  4ZX9 A;  3GPQ A;  5CMS A;  2FAV A;  3EWO A;  3Q6Z A;  4R76 A;  1ZR5 A;  2KQV A;  3EKE A;  3GQE A;  1HJZ A;  3KR4 A;  4J5Q A;  2X47 A;  2FG1 A;  4ZX8 A;  2JZF A;  4JGK A;  3GPG A;  5FSU A;  4J4Z A;  4X2T A;  3KZW A;  1LAP A;  3EW5 A;  4GVV A;  2W2G A;  3JRU A;  4ABK A;  1BLL E;  3SIG A;  4ZY0 A;  5HOL A;  3PEI A;  3EWR A;  3KQX A;  5CB5 A;  4JLL A;  2JZE A;  3SIJ A;  5FSZ A;  3JZT A;  2LGR A;  1TXZ A;  3KR5 A;  2VRI A;  4IQY A;  4KYB A;  4ESS A;  4ETK A;  3EJG A;  1LAM A;  4ABL A;  4JCA A;  3ETI A;  3V2B A;  1LAN A;  1BPN A;  4ZYQ A;  3IJ3 A;  4JVV A;  5CB3 A;  2DX6 A; 
#chains in the Genus database with same CATH homology
 1VHU A;  1LCP A;  5AIL A;  5DUS A;  4UML A;  4K3N A;  4KSI A;  4D86 A;  3GQO A;  3EWQ A;  3VFQ A;  1ZR3 A;  3EWP A;  4ETJ A;  5HIH A;  1GYT A;  4ZY2 A;  4J5R A;  4J5S A;  2L8R A;  2BFQ A;  2EEE A;  2AFC A;  1SPV A;  3SII A;  2J9A A;  4K0C A;  3Q71 A;  4R7M A;  3EJF A;  3KQZ A;  3IIF A;  1YD9 A;  5D8N A;  3SIH A;  1NJR A;  1TY8 A;  3H8G A;  3T8W A;  3V45 A;  3GPO A;  2FXK A;  5CBM A;  3H8E A;  2BFR A;  4TU0 A;  3H8F A;  5FSV A;  3IID A;  5FSX A;  5E3B A;  1BPM A;  2EWB A;  4ZI6 A;  4R6T A;  2XD7 A;  4GUA A;  2ACF A;  5FSY A;  4GVW A;  4ZY1 A;  4ZX9 A;  3GPQ A;  5CMS A;  2FAV A;  3EWO A;  3Q6Z A;  4R76 A;  1ZR5 A;  3EKE A;  3GQE A;  1HJZ A;  3KR4 A;  4J5Q A;  2X47 A;  2FG1 A;  4ZX8 A;  4JGK A;  3GPG A;  5FSU A;  4J4Z A;  4X2T A;  3KZW A;  1LAP A;  3EW5 A;  4GVV A;  3JRU A;  4ABK A;  1BLL E;  3SIG A;  4ZY0 A;  5HOL A;  3PEI A;  3EWR A;  3KQX A;  5CB5 A;  4JLL A;  3SIJ A;  5FSZ A;  3JZT A;  2LGR A;  1TXZ A;  3KR5 A;  2VRI A;  4IQY A;  4KYB A;  4ESS A;  4ETK A;  3EJG A;  1LAM A;  4ABL A;  4JCA A;  3ETI A;  3V2B A;  1LAN A;  1BPN A;  4ZYQ A;  3IJ3 A;  4JVV A;  5CB3 A;  2DX6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...