3GR1A

Periplasmic domain of the t3ss inner membrane protein prgh from s.typhimurium (fragment 170-392)
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
195
structure length
195
Chain Sequence
HMAAELDSLLGQEKERFQVLPGRDKMLYVAAQNERDTLWARQVLARGDYDKNARVINENEENKRISIWLDTYYPQLAYYRIHFDEPRKPVFWLSRQRNTMSKKELEVLSQKLRALMPYADSVNITLMDDVTAAGQAEAGLKQQALPYSRRNHKGGVTFVIQGALDDVEILRARQFVDSYYRTWGGRYVQFAIELK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein prgH
publication title A conserved structural motif mediates formation of the periplasmic rings in the type III secretion system.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Membrane protein
total genus 71
structure length 195
sequence length 195
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1770 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3gr1A03
3.30.70.1780 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3gr1A01
3.30.300.170 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3gr1A02
3GR1A 4G1IA 3GR0A 4ALZA
chains in the Genus database with same CATH superfamily
3CQ2A 4DL3A 2FD2A 1FXLA 3HULA 1XHJA 4ZVGA 2CNOB 3FC9A 2KG0A 4E0DA 3KLGA 3WX4A 3RG2A 2E7GA 3JTPA 5E0OA 1ZA1B 4LF9J 3PTWA 3EZ5A 3MPWA 2ZNYA 2R3VA 2WONB 3RAQA 5ITHA 3IAM9 3NCQA 3PXGa 2ADCA 3DLKB 4WXOA 1MKYA 1UW9A 2Y4NA 3B6BA 2V8DA 3MMBB 2CNKB 5CABA 2QFIA 4CO1A 3KK2B 1D9AA 3CJKB 1WEYA 1TL3A 2LYVA 4LE5A 4ZKAA 3R9XA 1SJ1A 2ZH5A 2V0NA 3R2CJ 4ZPBA 2LXFA 1RTHA 4Z7CA 1N2FA 2ZNZA 1HNWF 3RW7A 3DLGB 2CQ4A 4P7VA 4MKAA 4E98A 4NZ7A 1S1TB 3QIPA 4OHYA 2FHKA 5K5MA 4AL5A 2GGPB 3LGMA 3QMQA 4NLQA 4OHWA 1ZH5A 3H20A 2KT3A 4PR6A 2DPLA 2AEMA 3IEVA 2XS5A 3BGFA 4WKRA 3CMAS 3S6EA 1E6VA 4C6AA 3N01A 3Q8UA 3VAFA 2WD9A 4L6V3 3G8QA 2HNDB 2DCUB 3BDPA 3HKWA 4Y2AA 2IYIA 2GMJA 4OI4A 3IG1A 1WHWA 2FVCA 4PXBA 2RILA 4CO5A 2DYJA 3A13A 2KFZA 3VZHA 1IJFB 1TK8A 3ET6B 1IN0A 3CT9A 4WFAQ 3BZQA 2F63A 2GQCA 4USHA 2DVIA 1SCJB 3PX4A 3JTNA 2HMIB 4LUBA 4C11B 1RAHB 1TL3B 4F4XA 3WIUA 2BH1X 3M8PA 1ZAWA 5CCLA 4MK9A 2VG7B 2ASJA 2ROEA 5LSLA 1ULTA 2DNKA 1WSVA 4F3MA 3K7RA 1XBWA 3J7A1 3KUEA 4RW9B 1RT4B 1LWCA 3QIDA 4I2PA 4IDKA 2LXUA 2KB2A 2V2ZA 4ES2A 3AOBA 3CD6S 3K8WA 3NGSA 2CPEA 3HF5A 3RTVA 3PHTA 1TUWA 2IDLA 3EGWB 2ZJQQ 1YRXA 4H4MA 4RNHA 2KZMA 2J9DA 3TR3A 1D09B 4HACA 2B6AB 2F7VA 2HQCA 1U49A 3W65A 3EDQB 1NYEA 2P9CA 1DQ9A 3OQ2A 4DV2J 2GO8A 5H1SV 1S77D 2M0GB 3EYZA 3D1OA 2VA2A 3DM2B 2MZRA 2J7KA 4DR7F 2A1BA 2DGVA 3FSXA 4IG3A 2LA4A 2XWXA 1J5OB 3AFGA 1Q0NA 1EETB 1WOSA 4ETZA 4OZ5A 3T1YJ 1J5EC 1YJUA 2CPHA 3MDFA 1IBMC 2VKRA 3A3PB 4DBQA 2YNFA 4OYMA 2XMTA 1FJGF 4AQYF 1R8PA 3TOQA 5F8HA 1LWCB 4FF1A 1P9YA 4IDKB 1K9MT 5FD1A 3M1VA 1J5EJ 4K4XA 4FNIA 4FYDA 3M32A 5T14A 2IRXA 1C4AA 4X62J 1RCXB 1HW9A 3THPA 1RHMB 4DCTA 4H4OB 1Q81T 5DETA 4H4MB 3VV2B 5GMKa 1BD6A 5B0GA 1Q79A 1UTAA 4B9LA 4JI1F 4LR8A 3R2DJ 3AB4B 2RD5C 2P2CB 4Y28C 4MKYA 3DHXA 1MD9A 4C3LA 1TK0A 4LFCF 2KYXA 3NWRA 3LPEA 1NJXA 2JZ5A 4GVLA 1ROFA 4PUOA 1GNKA 4NEYA 1WTBA 5E7OB 2DPJA 1MDBA 4JI8J 3VQSA 3KG0A 2OD4A 4K50A 2BE2A 3NGKA 3VGSA 4ATNA 1WF3A 2FJWA 3POTA 1YJRA 3L95X 1UW4A 2X1GA 3NAIA 4TY8A 2B4OA 4QWDA 4KR0B 1O8BA 4CM2A 1S9GA 2DGSA 1MROB 4YB1P 3M1VB 2CJQA 2Q1LA 1CJUB 4C9DA 3NGDA 1U8WA 2AYEA 2HS4A 1N5QA 2AJQA 3THVA 1JLEB 4NXMF 4UT4A 1SV5B 1HNZJ 1FKPA 3PEHA 4AT1B 5C2CA 2YWFA 3V6DA 2ZE2A 3JSMA 1H3DA 4LF5C 1HIYA 2H5JB 2F3JA 5HQ8A 4QOTA 1PYTA 2W24A 2OLWA 5GAEI 3SBMA 2YWHA 3ELHA 1JXEA 4Y34A 4JI3F 2GIRA 2NXCA 2YKNB 1YBTA 4RVOA 2LDIA 5SUHA 1YJ9S 1S6QB 4WFBQ 3ETMA 2Y1RI 4KO0B 4NYPA 5BUSA 3SQGB 3T9ZA 1J2VA 4DS5A 1I94J 1VIOA 3CSKA 2R7SA 3ZZ0A 4ZA1A 4F4WA 2RE1A 4K5RA 4N8NA 3IWNC 3LNVA 5E3RA 4OZLA 1VEHA 3QPIA 2MLZA 1IR0A 3QSIA 3K58A 2QJ3A 5IZHA 4XDCA 5HMXA 4TY8B 4OYIA 2K2PA 3OTBA 1NJYA 1TL4A 1JKHA 4EGLA 2CZ4A 2LEAA 3UEBA 3ZFVA 2DB1A 3J81j 1SKSA 1PAEX 1HLWA 3NBPB 5AJ3F 3OTDA 3TX8A 2FLNA 4M94A 3N5BA 1N4LA 4O3RA 2F9JA 1UKKA 1NSAA 1V3RA 3JSMB 1KTVA 4F4YA 4GMKA 3C16A 4DV3J 3FKBA 3H25A 5C24B 2D28C 4C98A 3MR5A 2QLBB 2AQ4A 1TK5A 5KFJA 3CDBA 2NLWA 1NKBA 3HHKA 1BQXA 2CQ1A 4M5LA 1X5OA 4EATA 1LKZA 2R8GA 4QR2A 2V67A 3B4MA 4X66F 5E3AA 4DSIA 2CJ9A 4X64C 3MUTP 1RT5A 2YX7A 2XI3A 2UUBF 3UNGC 3KNGA 4LRDA 2IAJB 5KYTA 2OAUA 1UA1A 2WHOA 2HQGA 1YQHA 2KL8A 5T7LA 3CULA 2B9WA 4WCEQ 3I5BA 2BR0A 4F02A 4X64J 2VG6A 2VF3A 4DL4A 2JRSA 1VI7A 3TZZA 2B3TB 1IBKF 2VV5A 1SI9A 3ISND 1F1BB 3SQOP 2JSXA 3HHLD 2FZKB 1USPB 3O1LA 5GADI 2W25A 3X1LB 4YB6A 2N7CA 1DURA 2KFYA 2R7OA 4FDFA 2HWHA 3C16B 3ICLA 1OQ3A 2XY5A 1N34C 2LU1A 3FQLA 5I42B 3GILA 3C14B 4ECZA 1HWIA 4QPXA 3BM7A 4WYWA 4M5GA 4GKKJ 1RU1A 1N34J 1RABB 2KM8B 5IM0B 3W2VB 4LFAF 4Q7AA 1CEZA 4KV8A 1YK9A 2C3UA 3TQEA 2MKCA 4QW8A 1VYAA 4ITSA 1WCJA 4Q2LA 3FCWA 2VB6A 3GJQB 2VG6B 2V4JB 2NUUG 4LF8C 4KGVB 1KBRA 2OHDA 4NZ0A 3RB0A 5L1IA 1LW2B 3D9BA 2GJIA 2VBWA 1WC1A 2W9BA 4DPYA 1WG5A 3MTKA 8ATCB 1C0TA 1I1GA 1K73T 4ED6A 2P2JA 4G65A 2GS8A 4RNOA 3FUYA 1Y5IB 2IVMA 3W64A 4B3OB 1BY9A 1KVIA 2GCFA 2X51A 2E9ZA 2LQJA 5KFBA 1NPPA 2FTRA 4LF6F 2Z2MA 1SPBP 2XSFA 3OHAA 1VCTA 1JNRB 2IDEA 3D28A 4RW4A 2ZM6F 1XEZA 3L9ZA 1GX5A 1Q86T 2CZ9A 1EJ7L 4Q43A 3RZAA 2V2VA 2MEWA 2CADA 1XQIA 4ZOSA 2Z56B 2ZH7A 2UV8A 2SXLA 2V6AA 4LF9F 2KXFA 3DKDA 4RNFA 1HYSB 3TJ9A 2N4DA 4DX6A 2R7VA 1WDTA 1VISA 1WTFA 4RNNA 2DD8S 3LGHA 2AYAA 2ZHBA 3CTRA 3TVYA 2CRLA 1ZYQA 1XRBA 3RAMA 2B4VA 1IKYA 1GXLA 2K1RB 3DOKB 2LQ8A 1M0SA 3P3DA 1TELA 4ZP9A 4PCQA 3U1MA 4GVBA 1K0RA 5THWA 2R7TA 4ELVA 4UW2A 4M5KA 2BOPA 3RU0A 2YXLA 5J2NA 1IXKA 4ZP6A 4CLPA 2MMYA 2ZH8A 1R0AA 3M8ZA 1ZTWA 4GXQA 1VQMS 3W8GA 1WNEA 5DS7A 1RT1A 3BPSP 3UOWA 2VONA 3EVWA 2HRYA 1RLCL 3M05A 2EW9A 3KHHA 3VZIA 1DFDA 4OZ3A 5KFSA 5IV4A 1QSLA 3VGVA 5KT7A 5LL6d 3H5YA 5HL7Q 5D3GB 2X7IA 2AMCB 4F26A 2D7VA 4ZS6A 2H51B 4WTYA 2YKPA 1RWWB 3TUIC 3NAHA 1CJTA 4J9UE 3CW8X 1SC1B 2X1FA 2J6TA 4RL1A 2APOA 3M2VB 4ICLB 2LEBA 2C2MB 4ZJQA 1JLQA 4ILRA 1PYSB 5EGYA 3FZBA 1PA4A 1LW0B 4KFBB 3DHVA 4MTNA 1HPZA 2OPLA 1PG4A 3TRGA 4UUWA 2ROGA 2XC9A 3BGOP 4OYZA 2DR9A 1B70B 4B9TA 1YZ6A 2Z2ZA 2W9AA 2D27A 1BE4A 1U0HA 1VLOA 5LXYA 3O2EA 1EQMA 2JNVA 4X84A 2HHHC 3DGPB 2QLFB 3TWZA 3OL6A 4KH1B 1JB0C 2DNQA 4NASA 1U2CA 2CPIA 5BR8C 3CCZA 3CEDA 1Q1KA 2WBRA 3GU0A 2YNIA 4KGKA 5EX0A 3NS7B 3H2UB 3J81U 5B08A 1OJ4A 2OPRA 4DV2F 1S1XA 4RBVA 2Y8WA 3WC0A 3R8YA 5BYSA 4IFYA 2UVUA 1NK8A 2Y8YA 2HGMA 4ANDA 4P2SA 3WX8A 2W2PP 3T1YF 1U48A 5ETOA 2VZ9A 4P74A 4YN3B 1JLQB 4ETXA 4OI1A 1RLDA 5KFIA 3H5XA 3UX2A 3PIPQ 2QA4S 2PIIA 3ILLA 2BJ7A 2R4FA 1HWKA 1AFJA 1RB0A 4DR1C 1J5EF 2EFNA 2F4FA 4JI6J 4O44A 4ED4A 1M6XC 4DR1J 3J7YI 3EPIA 1TMMA 1YJ7A 3AQPA 3DLLQ 2QIFA 2RHSB 1Y3KA 5LMUJ 4IRKA 1NM2A 3HD1A 1EKSA 5EUHA 1NJWA 2DNHA 4WV3A 2W2NP 1K1SA 3AOCA 4JB8B 5B09A 4R0EA 4TY9A 5HO4A 3CIMA 3UDCA 3M8YA 2CU6A 2UXBJ 2FZCB 4JI8F 2AKWB 4JV5J 3G2XA 4I6WA 5M2RA 1FK9A 5LMNJ 2MGZA 2RJZA 3NCRA 2PD1A 4U8VA 4ZJLA 2CQHA 4IQMA 1U2RA 1FKOB 5D6GA 4YUDA 1HBMA 5IOLA 1VQ9S 2YQ3A 4UOGA 2JNJA 2PGCA 5IWAJ 2DTJA 4WF9Q 3C15A 3V81B 3VGUA 4L72B 4USJC 1UJ4A 1GMUA 3GYGA 5C7PA 2IBOA 5A8RA 1O90A 5CD4H 3ZZRA 1HNIA 1HARA 1B0VA 5KG6A 3N4WA 1NAQA 2CDQA 4GKJJ 2H48B 1ML8A 4DPUA 2E29A 1HNZF 4P73A 4DCSA 4B17A 3D5MA 4FXVA 5HSPA 3LP2A 3PESA 4XTTA 4R1LA 3HM9A 3UR3C 1Q53A 4CTAB 5KFTA 2U1AA 2VQEJ 3TANA 1YKWA 2XZWA 2OD6A 3C19A 1U09A 4LIRA 4RLQA 4B02A 2ATWA 2C2EA 2HFNA 5HBMA 4DN9A 3O5TB 1FRXA 2DNMA 3VF0B 5IT9D 2EK1A 2LKZA 1I94F 1FRMA 2YX1A 1FVSA 2DGWA 1K1QA 5KTQA 1N0VC 1FK9B 1SJRA 1IUJA 1X4HA 5KG3A 1YWXA 3MCSA 2F8MA 1S59A 2BZ2A 5IQ6A 1VQ4S 5L9XA 1RBOB 1IQTA 1VRUA 3D3BJ 3L4BC 1LXNA 1FVQA 1Y3JA 2GAGC 3N9UC 1MNEA 1TKTA 4OJHA 4JI2J 2OTJS 2QW0X 3QZ7A 3QRQA 5FJ4A 2FC9A 4K2XA 2OIHA 7FDRA 1NK5A 3KMSA 3OR2B 1XR7A 1NSPA 3V2UC 1RSCA 4FF3A 1V5IB 5KOXA 1JLFA 2VPZB 2RF2A 3T19A 1RWPB 1IR2A 2JVRA 2DXEA 1GMWA 3H0PA 5F41A 2CG4A 4FPIA 4RZRA 3OJSA 5HVGA 4RWWA 3SV3A 1XR5A 3R44A 1WF0A 4P2FA 5HBMB 1KLMB 3I55S 5ETPA 2DGUA 5L1KA 1BUXA 2HIYA 2ZOFA 2MJNA 4AL6A 1XK8A 2B51A 4B08A 2MKSA 5JXSA 3HI9A 3FFIB 2BANA 3ENQA 1BC6A 4DFMA 1NY8A 1OMSA 2CWXA 3HXMA 5HN0A 4X64F 1NK9A 4C2MA 2O66A 3KLEA 2ZKUA 1T11A 1S6OA 1TKTB 4USKA 4DV7C 3J80D 4G1QB 3OLBA 3MGJA 2A2CA 3HHLB 4PPZA 4ZVOB 1WHVA 4R0JA 3UN3A 1UP1A 5L38A 4RW7B 1WHXA 2JLFA 1MXAA 5IFIA 3GTYX 4OZ2A 3NEKA 2V4QA 3A4IA 3FEZA 1HQ2A 3MAHA 2M9KA 2J5AA 1T02A 2EFPA 1EHWA 5EWFA 3EM1A 4DQIA 2XSJA 3CNQP 5KFRA 5KFAA 4XX2A 3TJ8A 1LWFA 2PDAA 4WE1B 4YR3A 1R8HA 4URSA 1DTTB 2FC8A 3U1LA 2UVVA 4PWDB 1FUGA 2XCPA 1GPMA 1N34F 3W1YC 4CLKA 4Y2KA 4USIA 5CZXA 5H9UA 3MZIA 4DX5A 3VWSA 3CJQA 1EB0A 1R8BA 3GYXB 1WOOA 3TEHB 3VALA 2NQPA 4DV5C 5DZ6A 2VPXB 2EFQA 3OSPA 3HVAA 3FMWA 1HD0A 2BW2A 1YTYA 2C28A 1MWYA 4ID5A 3W5YA 4J9OA 3RUBL 2VBXA 4A8MP 5C42A 1FX4A 2H54B 4FYVB 4K4SA 1U2FA 1GXUA 3LH2S 1T9UA 3JSRA 1DHMA 1XMOC 2CPDA 2N7YA 4EYHB 1KP6A 4L73A 4QR1A 3BJYA 5DG8A 3TZYA 4OYOA 1I51B 3AOAA 4NLPA 4WP9A 1IKVA 2DH9A 1UJ6A 1WELA 1CJKB 1F60B 1OWXA 3ILOA 3ZZZA 4OI2A 1P27B 1XC9A 4KHPJ 1VHIA 3H5UA 5BURA 5KFMA 3P5BP 1TL5A 4L3KA 4NXNJ 2VPYB 4C8KA 4NA2A 1HBNA 2WK4A 1O93A 3JB9k 5B0FA 1JLAA 2GVZB 2O67A 2LQ9A 4LF2A 2HS0A 1B4SA 1C1CB 4J5OA 1KTQA 1F5BA 2YKMA 4ID5B 1HWLA 2YWKA 1FD2A 1NK0A 2G9OA 3ZNJ1 1M5VC 1D1UA 3H2TA 1N8RT 3PYDA 2HWTA 8RUCA 4B3TC 1CULA 3VQTA 2L9NA 5IC4B 1WEXA 2JH3A 1XNQC 3C5EA 3AF5A 5DGAA 4UZCA 3ITHB 3I82A 4UOCA 4M63A 1DQAA 2HW3A 2XNRA 2BRLA 3C6TA 4WTOB 5LSRA 3MTJA 2E8FA 4DU7A 2DGOA 1XIQA 1GH8A 3EPGA 3HVTA 1QWIA 3UD4P 4I56A 3R9WA 2GW8A 1E6YA 1JJCB 4ZVSB 4X65C 2CQBA 2AYMA 4ED1A 2NREA 1JLAB 3PFOA 1Q8IA 2JFDA 5H9FK 2I0XA 4HT7A 1RAJA 1NBEB 3W9HA 3GV5B 2AHOB 2B9XA 3AXKA 1BQNA 1JX4A 3MMAB 2DNZA 3BGRA 1QTNB 3OL7A 2YQ0A 4DG1B 4EZ9A 2B7CB 1QSSA 1N56A 4KB7A 3CJ4A 3ILIA 3GFHA 3A12A 1Y00A 2V63A 3L09A 4FS1A 2DNLA 2BQUA 3I31A 3IO1A 5A0YB 2DCLA 4C8NA 2LQBA 1NJZA 1TL7B 1Y0HA 2PN6A 4OYBA 3CDEA 1S97A 1ICEB 1RTDA 5DDRC 4LF4C 5J1EA 3H59A 4WFXA 3OFEA 3R3TA 3GG1A 2Y1IA 1Z4UA 3H90A 1BQMA 4DL7A 1XR6A 1PC5A 3Q2SC 4RUHA 2G1DA 4JI4C 5B7WA 5KYVA 1RT6B 5E3PA 2PSZA 2WVCA 2DHXA 3BKUA 4QIEA 1RJJA 3OFGA 3RBEA 1NPKA 2HHHF 1URRA 3DMJA 3PVXA 5T8TA 1U26A 2DNNA 4ZVEA 1XMQC 1VQPS 4A8OA 1M5KC 3SFUA 2OMOA 2HNYB 3OXLA 2F8EX 2DHSA 5DRKA 1NO8A 2DK2A 2RQCA 4OLPA 2L08A 3ISZA 4PPDA 3BS9A 2XG8A 2BJ8A 3QO9A 3CMQA 2QL7B 2FGOA 1AB8A 1T8EA 1O5JA 1MWZA 1X4CA 4KPYA 3UW1A 3U02A 2IM0A 1TVRA 2IMWP 2X1BA 1N5TA 2AGPA 2HG4A 3FSIA 6FDRA 4X4SA 3IWLA 1VGYA 2C2ZB 3A9UA 4DPTA 3HFKA 3K57A 3CQ3A 3N6MA 5GAHI 1HW8A 2D74B 5D0HA 1SUQB 2O01C 4JI6F 5A6PA 2DISA 5KFGA 3PR4A 4YHHC 4A8XA 4DR1F 3EZUA 2VDIA 2VG5B 1FA0A 2HIQA 2QMWA 3MM6B 3OPKA 2Y1JA 5LMUF 4P71A 3GCWP 3H2LA 1IKWB 4DFKA 1HNXC 2BJDA 1PBUA 1ZETA 2RT3A 2ZVIA 4X4RA 5KT3A 3JAMD 1NHVA 2MQQA 2NXEA 1KNZA 4A4JA 1KD1T 2J6SA 1RZMA 3AY0A 4DLGA 2A10A 3LW5C 1VLYA 1X9WA 2UXBF 4PXEA 2G0IA 2HVIA 5KFHA 2E9RX 1SQGA 1ZBTA 5LMNF 2YBVA 3T5HA 1JLCB 1PIEA 1O0PA 3QO9B 1RGVA 3OXFA 4NEZA 4D3GA 3K2YA 4V19J 4CIOA 5FDLA 4U96A 1WEZA 4CO3A 3NXZA 4ZPDA 3IR6B 4EWTA 2ABYA 2FJBB 2MLXA 2DHHA 4EZ6A 5IWAF 3PYGA 1TUVA 3NNAA 1KOOA 3MEKA 2MZTA 5HATA 3TAMA 1NH8A 4GXRA 5EDWA 1MN7A 4JYAC 4I7FB 2HRUA 2WP0C 3DOLB 3H98A 4ZVQB 2QZ8A 4FUTA 3R5CA 5F8GA 2QE5A 2H3EB 3DXSX 2W4CA 3FGVA 3H4BA 2CQ0A 1T94A 2HLTA 3CD5A 5LJ5Y 2VQEF 2MSSA 4JYAJ 1U1QA 2WRMA 3PW4A 2FVSA 4UUXA 3EGZA 4DHVA 1ZM9A 4HHUA 1NK4A 4D4IA 3GV8B 2D1TA 2IC3A 3CJEA 3A8IA 4DR4C 5F9LA 3KLVA 5F8NA 2HBYB 3PBKA 1HHSA 2FLPA 2C42A 3O2IA 4DI6A 4K4YA 2BEFA 2F1FA 3QFWA 3N0VA 9ATCB 3BR8A 4DSEA 1SKRA 4DR4J 2IM2A 2DGTA 4JI7J 2IMOA 4YY3C 4ZHRA 3AJ2A 4JI2F 1FTCA 2MKIA 2OP5A 3SCKE 1R0BG 3C6UA 2JDJA 1D3WA 1NPRA 1L3VA 2P8IA 1BWVA 3R1HA 3PNIA 2QLXA 3DI6B 2WVDA 3IMQJ 3M2UA 5CCMA 3M6VA 1RWMB 3S01A 4X4UA 5I3UA 2FJAB 2MKJA 2W2QP 4F7VA 4DDFA 3CIZA 4MIAA 3R27A 3IMLA 3QWUA 1HH2P 4ISBA 3ILJA 1OQ6A 1F3VA 2DIUA 3D7SB 3OT9A 4LSLA 3H8YA 3LAMA 1WJ9A 1HD1A 2WBMA 3H5SA 1RT3B 5HROA 2DH7A 4TNOA 4ILLA 3DDIA 4ED3A 3IEUA 2CUYA 5KT6A 2LA6A 3M8SA 3RBDA 4DUZJ 3A8KA 4HHJA 1TR0A 5AXMA 4Z2XA 2MJUA 2DNPA 2V68A 4OZ0A 3G82A 1EP4A 4PROC 1WKJA 3FBFA 3IRXA 1T3OA 3HLUA 3QT6A 4LVOP 1NEEA 2ASLA 3W62A 4B3SC 3KG4A 3CC4S 1UWAA 5K8OA 3C6UB 2GMLA 3CCLS 4EK2A 4DSKA 1HQUA 2R8KA 3HPOA 2ZKTA 1VBZA 4OJ1A 3A25A 5I3UB 4RW6A 3PV8A 4Y00A 4O4RA 4PXCA 2IM3A 3NY0A 4ANCA 4F0KA 2NPFA 1HBUB 3BO4A 3UDLA 4KPCA 4LSLB 3MFHA 4ECSA 2MMAB 3MM7A 4FXWA 4QCLA 3PYEA 1S7IA 2HWIA 5GMDA 1U1PA 5HROB 2J9DE 5E3CA 4J90A 2MCQA 1AZSB 2QA2A 4CT9A 4OIXA 3I56S 4DV4J 3P49B 1C0UA 4EBEA 4DF4A 4QU7A 5KG1A 5J2MA 1TKZB 1Z2ZA 3SDEB 2XS2A 4I2QB 1TKXB 2J76E 5L39A 4RJVA 4ECXA 3AODA 1VC0A 3NGUA 4Y2CA 2FZGB 2PMZD 3SSRA 4M5HA 2HAFA 2CVEA 2VSQA 3SYZA 1PSDA 3SEOA 3FBCA 1PCAA 5IT9U 4PG6A 1UVNA 3JTOA 1XNRJ 2VFUA 1W26A 3PRDA 4DR5C 3THTA 1RQ0A 2CQGA 3QGGA 1QE1A 3JS9A 3W2WA 4Q8FA 3D6TB 1HR0C 4DU8A 2DNRA 2R8JA 2W9CB 3K5PA 1KVKA 3LA0A 4MJKA 1RI7A 3FDSA 3J7AN 4KIAA 2KHCA 1RTJA 1KN6A 1P4EA 1U1NA 2CY1A 4KHPF 1CS4A 3MM7B 1HMVB 4NXNF 1T05B 3ZNUA 2FHJD 1OYEA 3M8QB 3ULHA 3TAPA 3B54A 3OHBA 2CZVC 2MSTA 1YSJA 3UDEA 2E1RA 5E41A 5A6WA 3CCJS 3CJ0A 3TEGA 5KFOA 3W3SA 3PRVA 2F65A 3QRPA 2HBRB 4MAKA 4CLFA 2B5JA 2OSQA 2DHMA 3T1HC 2M8HA 5F9NA 1DY3A 3PCOB 4OQJA 5J2PB 4PUHA 3NCPA 4EBDA 3JQJA 1KSPA 3NI2A 3H7HB 4ER8A 2A6MA 5K8NA 3T3FA 1U47A 5K8PA 4ZLLA 1NDPA 5KFYA 1VR6A 2JOQA 3W2WB 4MIBA 5DQIA 2N3LA 1ZAXA 1VQKS 2MQ8A 1AYEA 4QQBA 1VBXA 3KYLA 1UEUA 2XO6A 2JEIA 2C3PA 2HS3A 4AYBD 2RIJA 3VAJA 2HFZA 2Q6BA 2HNZA 3I5AA 3CF5Q 2BBEA 2QT7A 3H2VE 4DX8H 2G13A 2IRUA 4O0IA 1FO1A 4DR2J 3G6YA 3V5RA 3MMCB 1JJHA 4MIWA 4NX9A 3UI3A 2MTLA 5A8KA 3FCVA 4ZIWA 4UY8T 4ZVFA 4I6AA 2ZZTA 3GJSB 2VD3A 3SFGA 4DUYJ 1LK7A 4DV1C 5KG4A 2B5JB 2XY7A 2RH3A 1N6QA 3RBZA 1QDUB 1HWUA 5KG2A 5BSRA 2R2SA 1KQFB 3SXLA 3DRPB 2OJ3A 2HZVA 5A76A 2ONFA 2Z30B 2WVBA 2BKPA 4OI3A 2V8HA 4P72A 3QJPA 4LSZB 2MY7A 2MLYA 1VQ8S 4U8YA 3CGIA 4CH1A 1NHKL 1S9EB 4R8UA 3ZZPA 2XMUA 1TH5A 3PKMA 3ZZUA 4DPOA 2D3ZA 2OMLA 3CJ3A 2FVRA 2FJXA 4URGA 3V6HA 3R5DA 3UWTA 3I0RB 3L8CA 3TVKA 1UPPA 3R5GA 3W8PA 3O44A 4NMXA 3T5LA 3K5OA 2I5JB 2J8AA 5MLCV 4JI5J 1FE0A 2MZSA 3OFFA 2R2RA 4BC9A 3MD1A 6FD1A 2UUAJ 1P7LA 4C8LA 1S1UA 3PYFA 2PT7G 1YVFA 4LRBA 1WDDA 4TLRA 2DR5A 2V2KA 2HVHA 5HLFB 3V4IA 4OZ1A 2CQ3A 1G6BA 4NCGB 4DJBA 4IR9A 5CAAA 2OI2A 4IH5A 1I6JA 2MKYA 3E01A 4NL5A 1EGAA 1AT1B 3DLEA 4CO4A 2F40A 1UZDA 3HHDA 2ILZA 3PW7A 4JV1A 2OEKA 2UU9C 3G8SA 1TMJA 2GJFA 2Y0SD 2DYAA 1REVB 4PG4A 5F0UA 3PJWA 2HHUA 3KLIA 4LFBC 5KAKA 1NK6A 2FY8A 1ZM2A 4O3SA 3ZTQA 4DV0J 1JQGA 2CPZA 7FD1A 3GWCA 3GV7B 2QSWA 3ENAA 2R8HA 3RGIA 1WI8A 3K5NA 4WP8A 1UVIA 1S1UB 4CT8A 5BSTA 2YWEA 1RHRB 3DLBA 2ZH4A 1PJ6A 1REGX 2BQ3A 3SSQA 4LQ3A 2C2KB 3GIJA 1C1BA 3J7ZT 1S1WA 5IFMA 3KFWX 3DLHA 4MH4A 2R42A 1NB2A 2E1MC 4EFAC 3BGUA 4FYYB 1VQOS 1QSYA 2KDOA 2BE7D 2L3MA 3O3LA 1AW0A 4WPAA 2GAHC 1FERA 4OYXA 3DLEB 2JEJA 4OL8A 3DYAB 4ZK7M 1F2GA 4C8ZA 4DZ6A 1VOMA 1T3NA 2WONA 2E5LC 5E7QA 2J0WA 1M1KT 1RTIB 4D56A 4PWUA 3AB2B 1NKCA 2VFSA 3MMBA 3D54A 1CJVB 3BDEA 2D9PA 3CJKA 4KBIA 1ZM4A 4CH7A 3CDAA 1RT2B 1QUPA 5C5JA 4JYAF 1P4EC 3MM8A 3DXBA 1EZZB 2RAQA 2WSCC 4MKBA 3RG6A 5GAEU 2ALZA 4UTGA 4H4KA 3IC1A 2XMKA 3DLGA 5DDOC 4DX7A 1S1TA 4C4WA 3D2WA 3OW2R 4E2FB 2GGPA 3T6BA 2FIUA 4ZP7A 5KFDA 1VS3A 2NCLA 3M30B 3DHWC 5M2UA 3MPVA 4WXWA 4BWMA 1FDAA 1SC4B 2HBZB 4PRFA 4DR4F 4MMOA 4JI7F 3OTOC 4OX9C 2HNDA 3OUYB 4DR3C 1KS2A 2YWGA 1URNA 3D0GE 1N5YB 2OPQB 2Z58B 3H40A 1SC6A 4JBCA 5IV3A 3MUMP 2NS1B 3A26A 4A48A 4IR7A 2YNGA 4NLRA 2UV8G 1SH0A 1UZHA 3ET6A 4FZVA 3MOZA 5I4MA 3UVJA 2HMIA 4P2MA 2NYHA 3RBXA 4C11A 3W61A 5A2QY 4CLYA 4FKYA 1RHQB 3CD7A 3I0SA 1WC6A 3MM8B 3SSSA 3WHIA 5DM6Q 3CCMS 2VG7A 3TA1A 4IG0B 3T6JA 1KWMA 4B9NA 4RUBA 3KLHA 2D3OR 2F4VC 3R9LA 2V9KA 4KKOB 3RV2A 1YG0A 4RW9A 1T7PA 1RT4A 1S5ZA 4Q45A 3IXQA 1UCNA 3R97A 1GMVA 1W7WA 3QAEA 1X5SA 3UNYA 1GXTA 2WW8A 3KJNB 1YBUA 1G1XA 4KTVA 2E8CA 4DUZF 1EARA 1HI0P 1KQGB 5AXKA 2F4VJ 2R8IA 2XHCA 1F9HA 2BKNA 2I9SA 2RS8A 2YNHB 5EHHA 2GHVC 3ZTSA 2B6AA 2QVZX 4LBHA 2UXCC 2MQOA 5M2PA 3JAMU 3R7SB 1U1LA 4FTFA 1PJ5A 1PILA 1RDRA 1QM4A 3HSJA 5L46A 2QMXA 2L48A 2JFKA 1HWJA 2YNGB 3JYTB 3DM2A 4PQUB 3UVJB 1S10A 5GADU 3NGTA 4NRUA 3WDOA 1J5OA 3I0SB 4OZNA 4O4GB 1EETA 3Q8VA 2I6WA 3R5JB 3PR5B 4YR0A 1SKWA 3IBWA 1YJVA 4FNHA 3KLHB 3NGRA 2E7XA 4ZJZA 2FHJA 5CYMA 4B3MC 4ECRA 2BM1A 3CCQS 1FNMA 2OFGX 1FXDA 4RWXA 3TO8A 4DS4A 4DV4F 3W66A 3OR1B 2PN2A 4F3QA 3NNHA 4H4OA 4W98A 5K85A 3J81Y 3MAAB 2Y3YA 4QIWD 1JMTA 1U02A 4NE9C 4PUIA 2ZDOA 4TVAB 2GA7A 4J9QA 3F56A 2KI2A 3VAKA 5HI7A 1NZ8A 4ZMMA 4IOAQ 1KONA 2KTQA 5AE2A 1NXIA 1PKUA 2UUTA 3GLJA 3PO5A 2P9EA 1FRJA 1XNRF 2ZFHA 1R6YA 1X0FA 2RDJA 5KOWA 4YDXA 1LFWA 1LXJA 4A8FA 3BKTA 1TQLA 1WC5A 4OYAA 1S0OA 4N77A 3ETOA 1DTQB 2V94A 4CLUA 5J2QB 1U1KA 4DR5F 2AU0A 2GVDB 4JP8A 3C46A 5CYMB 1FWPA 4UY85 4J91A 3OLAA 2KXNB 1RBAA 1TUGB 1SVDA 2RVJA 1MROA 1TAQA 3JSYA 2OKQA 2OUGA 2AIRB 1CJUA 3QBCA 1IBMJ 4OFZA 3QSYB 2BJOA 3LP1B 3RRKA 4C7QA 4NOHA 2BMBA 5MAOA 1JLEA 3GPAA 3AD7C 1SV5A 2DO4A 4AFFA 1ZZNA 4FBUA 4K0KC 4L74A 4K4UA 1FWLA 2E1CA 3HO1A 2ZD1B 3HCXA 3UR0A 4IOCQ 4YQWA 1JXLA 4NMLA 3TUZC 2HGLA 2PEHA 1QUVA 2YKNA 2XWYA 2QEXS 2OH2A 1S6QA 4ZVPB 4MTPA 4KO0A 3L7PA 4DQRA 3KK3B 3PW2A 3SQGA 1NSKL 4QIVA 2QVXX 1H7XA 4M5DB 2BJ3A 4LF1A 3GIIA 2C22A 2Z57B 2ZZNA 4WWSA 2XYPB 5D78A 4MK7A 2YPYA 4MYUA 2ZBCA 4JM1A 5K8MA 4BS2A 4N47A 3PROC 5KFXA 2ZUGA 2KRRA 4DR2F 4WBFA 3NBPA 1S7HA 4TU7A 2HQIA 4HVZA 3W9IA 2ZZMA 4H4KC 1UA0A 2DXFA 4ZDNA 3P4UB 3BGLA 3N28A 4CLWA 4DUYF 3TUFA 2KKHA 1LQ9A 3SIPB 1JJ2R 2L41A 3PZPA 4HTIA 4I69A 4CLZA 5C24A 1RHUB 2OO4A 4C97A 1RKJA 2FLOA 2ZDPA 1RKIA 3HD2A 2CJKA 4RU9A 4DV1F 4LF5J 1H74A 4C48A 5KFCA 1QM9A 4LSNB 2IVYA 4XAKA 4IO1A 4QR0A 1SIWB 4DZDA 3ZZOA 3IWXA 1MLAA 2IAJA 1UVKA 2M88A 1RP5A 1VK8A 4CNYA 3TA2A 2HZAA 2GJ2A 2OEJA 3IGVA 5K9FA 1K44A 4USMA 1T9TA 5F8IA 4LREA 2OPSA 1O51A 2ALYB 3D6MB 3H4DA 4G36A 4KGZB 2C2DA 1V6HA 2DPIA 4JI5F 3CO0P 2XMMA 3J7Z5 1RAGB 1H7WA 2DHGA 4P75A 1OY9A 4F36A 2UUAF 2HQFA 1USPA 1SKUB 2UVWA 1S1VB 1L3KA 2LXIA 4RW8B 5KFQA 2MY8A 3GFZA 1ZM3A 2NPIA 2HBQB 1UPMB 2AX0A 3PW0A 4IKAA 2H5EA 5I42A 2XNQA 3C14A 1L3SA 3JXOA 5B0AA 4DR7C 3U27A 3OVAA 4NLXA 2ADBA 1QVGR 3E2EA 2OPPB 4ANEA 4K4WA 1TTHB 2RUSA 2HFVA 5IM0A 3SCIE 3W2VA 2NXNA 1ZB8A 4J9LA 1M90T 2ATLA 3PFEA 5BUQA 3RB6A 2IBKA 1AMUA 2FHOB 4CDIA 3KDOA 2YTCA 5DQHA 2OPSB 4J9MA 1FJGC 2V4JA 3I9V9 3WBZA 4OYPA 2EEYA 3VAGA 1WKLA 1L2FA 1FNOA 2YKQA 2V7BA 4PHTA 4DV0F 1CLFA 1LW2A 5D15A 1KHWA 2GIFA 1MU2A 5BSWA 1U0SA 3J7YU 4I1TA 5KG7A 2QSFA 1K0VA 2G2ZA 5FLXD 4M5MA 4B3OA 2UUWA 4O3PA 4JI1C 2XCAA 2AJ2A 2D1RA 4PZVA 3ZXWA 2XLIA 2J6UA 2AJFE 2ZH3A 3IM8A 4I68A 1PBAA 1WACA 1JWWA 4HH1A 5F3TA 3KK1B 5C25B 2HKEA 3LAXA 3IBFB 4XO0A 4HL9A 3R6GB 1UKUA 4KAIA 1HYSA 3GB0A 3DRRB 4K4VA 1VDHA 2RU3A 3KXWA 3E3XA 3I87A 2PT0A 2PA8D 3NYRA 2CVIA 4AL7A 1TFYA 3ZZTA 3NOCA 3U1NA 3IS9A 1NRKA 2DR7A 3KNAA 2AYBA 1RWVB 3AQOA 5E33A 4DQPA 4R0MA 2K1RA 1MU2B 3DOKA 1KKGA 5A8WB 4N76A 2DH8A 1FX2A 3LUSA 4NXMC 3R7NB 1OYDA 2EBEA 4A47A 4LF8J 2B43A 1FJ7A 3G6VA 4M5NA 3S82A 9RUBA 2DEIA 4Y65A 5HMWA 3TUPA 3N54B 5L8RC 3HSZA 3LWMA 4JI3C 4EO8A 1VQ7S 2CPFA 3MUVP 1BLUA 4NLTA 2HRTA 4NLYA 3OBIA 4QYZK 1SH2A 4RM2A 1RTZA 3G7SA 3W5ZA 2XM3A 3PRBA 2VZEA 3Q8QB 2EKYA 4DQQA 1G4CA 1GAOA 2VICA 1F9FA 1PO6A 1Y4ZB 1V5VA 3FNNA 2NZ4A 2RKIB 4W92B 2MZJA 4EYIB 5T8SA 1FDDA 1SL1A 2IA0A 1P8GA 1IBCB 5B0DA 4O23A 5D3GA 3IS9B 2WAQD 4DPWA 2HHPA 2KT2A 4WP3A 1T03B 2LDYA 4NI2B 2KG1A 3M6UA 3NPDA 4USTA 1HNVB 3MM5B 4GC7A 3M2VA 2R7XA 2C3OA 4ICLA 2VIHA 3FMBA 2X3DA 4OYWA 3BSNA 5D77A 2AJ0A 1V3ZA 1T9YA 3PW5A 1NCLA 1T0TV 1X7VA 5A2QU 1S72S 2C2RA 1LW0A 1IWGA 4KFBA 4H54A 5F8LA 2H65B 3GSDA 1YGYA 3KUGA 4CLLA 1MXBA 2DNYA 3QFHA 3OVBA 1LWEB 1NMEB 3KLFB 4ID8A 4X66C 2Z2YB 5FLXY 1H2UX 2AT1B 2F4VF 1U24A 1ZOTA 3UCUP 3DGPA 3B4DA 1U25A 4L75A 3AD9C 1UWBB 2EFGA 2UUBC 5F8MA 1X4GA 5K14A 1TV6B 2XMJA 3MEGB 3BB5A 1XRCA 3OV7A 2KDNA 1IKXB 3PX0A 3UE2A 2LLZA 3CCUS 2V8VA 1KKHA 3Q8SB 1CPZA 4XIUA 4Q8EA 3MEEA 3K5LA 3ENWA 5CYQB 1M5HA 4KHMA 1RAEB 2XHWA 4KJIA 1IBKC 3P5TL 2LU2A 1R43A 1H38A 4HEA9 4IFVB 2PROA 2DO0A 3MCMA 2RMLA 3CCSS 3G8TA 4BBYA 4YFUA 2QLJB 1YITS 3G6XA 4Y2IA 5SZTA 1WORA 1OPIA 1ZPVA 5IT4A 2ZWPA 1U45A 2EK6A 3SCLE 4DV6C 1S6UA 3I5CA 4G6VB 5DZ7A 5B0EA 2B4UA 4DSJA 3LO3A 4LFAC 2P2QA 3AHPA 4DV6J 2RQ4A 3WQPA 4B3RC 2K3KA 5K14B 3SCJE 3D1QA 2RRAA 1DARA 3CE8A 2L9WA 1D9DA 3Q8PB 5JRHA 2N82B 2JC1A 2QG9B 2QA4G 2HHHJ 3VNRA 3MEEB 3BF4A 5F3ZA 1VJWA 1W25A 5BR8J 3HSDA 4KE5A 4GRSA 1VRTB 2OBVA 1X8DA 5LOQA 2I38A 2QL9B 1W2IA 1XN9A 4LIWA 3MEDA 3EQ6A 3A8JA 1FKOA 1RWOB 2BDPA 2B56A 4LR7A 3NWGA 4LF6C 2VUGA 2BQRA 4LQ9A 1LOUA 4S0MA 4IOBA 4RBTA 3HJFA 3NG8A 4OXIA 3NLCA 3TVZA 2WB1D 3V81A 4N8OA 2E5IA 1FRKA 1IBMF 4JI0C 1CBKA 1NLKL 2UUCC 3E51A 1BMQB 2VFTA 4P7TA 2Q43A 2KU7A 5KT4A 3A3OB 4JI0J 2VFVA 4J9NA 3EVMA 4CTAA 2E7VA 2MQMA 4CYUB 2UUCJ 3FBEA 1R6VA 3RB3A 3W5XA 2KFNA 1Y10A 1FHTA 5ETTA 1FRLA 3OJUA 4K0KF 4OHXA 3HVRA 1FNXH 3MR6A 4ZIVA 1X4EA 2FB0A 1S76D 2GZOA 4HI1A 4ZN3A 3Q8YA 3RAXA 3MPYA 2D1QA 4F0MA 4KHRA 4DLEA 1D8YA 1KRPA 3MEDB 2CAJA 1X4DA 1UVLA 1VLAA 3KHGA 2M7SA 5JMNA 5DO2A 4HT5A 4ECQA 1SJQA 3CVKA 4DUTA 1S9FA 5LJ3Y 3D0HE 2NCKL 1VHFA 2DNGA 2UVRA 3P45B 4MFBB 1HBOB 3OR2A 4XDDA 2B8PA 1ULRA 3QYYA 4WZMA 1YJWS 5CXTA 4NLGA 2C3YA 4IRCA 1FTRA 1WSRA 4YDDB 2WVFA 3KLGB 1L3UA 1LQLA 3GMGA 1MG7A 2EI5A 2NUHA 4U7UD 2R7QA 1QTMA 2POKA 2IJFA 4HDHA 5HJXA 2MHEA 4LF5F 3PKYA 1OY6A 4D57A 1KLMA 1YRTA 4RKUC 2HHWA 3TP2A 4OX7A 2OEMA 3LALA 5K8FA 2CPXA 2VJVA 4RMNA 1AUDA 2R2UA 4KGMA 4NLOA 2XULA 3FFIA 3JQMA 5LCIA 3K59A 3LANA 4DCOB 2DEJA 2MKKA 1FEHA 4K4ZA 5U47A 2LECA 1ZPWX 1RTHB 3GPCA 2QMUB 1UFLA 2BYCA 4OLOA 4QYRA 4PWWA 4G1QA 2ZBPA 1RXOB 4DFPA 3HHLA 3IN5A 3OXGA 3QIPB 4PABA 2G2OA 2ZH9A 4RW7A 1L5UA 5D0GA 2JX2A 3OSNA 1FRHA 4UOFA 2FYXA 4N7TA 4DV2C 4TN2A 2YCBA 5F8JA 1LK5A 1E6VB 2CWKA 4WE1A 2UP1A 3GFXA 4NYOA 2ASDA 6AT1B 4Y3CA 5CD4A 1AROP 1DTTA 2XB2D 4PWDA 3VTIA 3ZTRA 1M1GA 3IG1B 3HFVA 2HHVA 1B64A 5BSVA 3T1YC 2DY1A 4DL0C 2CPYA 4EEYA 2PMWA 4FVCA 1XERA 1N5SA 2QLWA 2DR6A 3M8PB 4A8YA 5GAHU 1IJEB 1A6LA 4DL6A 3TZWA 2HVEA 3GJRB 2RB7A 3MF5A 5IXUA 1X60A 4X62C 4CWBA 2YWBA 2ACMA 1S79A 2MXYA 4DCVA 1S12A 4I2PB 1X5TA 4CO0A 3HZGA 4DV7J 3EUNA 5DM7Q 3RB4A 2DJWA 5DG9A 4MH8A 3Q86A 4ECVA 4C0OC 4KTTA 4ODJA 3KXDA 2DT9A 1CJKA 3QZ8A 3AA8A 2W4DA 4HACB 5KFVA 4AE5A 3N2QA 1IR1A 2W4PA 4F3OA 3F73A 5GAGI 3W60A 1EQ0A 2ZJRQ 2AF6A 2EFOA 1MDFA 3AA9A 4JI8C 3JSBA 3M8WA 4G3IA 5G4DA 4C3MA 2I1RA 3A9VA 3SV4A 2W8KA 3KMQA 5AXNA 2CA9A 2GVZA 2R9LA 2VL1A 3VR1A 4JUZA 1JIHA 1UJ5A 4IG3B 5BXIA 2COLA 2CIMA 1KVJA 1WD6A 3PO4A 3FVYA 3O6QA 4CI0B 1C1CA 5H9EJ 5IT9Y 3SO4A 2KVIA 2CJAA 2P6SA 2YNFB 3EXCX 1T9VA 2M52A 4DV5J 2BV3A 1HNZC 1RACB 1VMBA 4LF8F 3EX7B 1Q5YA 1FFWB 3BV8A 2JWNA 1R8CA 4F4ZA 4B9SA 5CA5A 3SI8A 4FVMA 3M4XA 3M32B 3KJQB 2DHAA 3ITHA 5ETMA 1O92A 1APSA 4DSLA 3NMRA 2FLLA 4U5YD 4RBUA 2FY1A 1H0HB 3OTEA 2YPZA 1XMOJ 4ZPVR 3HFZB 1NDKA 3EE3A 1RAIB 1V26A 5CYJA 1U6ZA 2Y9HA 1ZB9A 3DFEA 1RWXB 4QWBA 2E5HA 1IM4A 3OL9A 1OIAA 3KTQA 4NLUA 4I9GA 1I94C 2G0JA 2ZHAA 1UVJA 5DLFA 1D8ZA 4HH0A 1G2EA 2R7WA 1N32C 2VC1A 1VBKA 2C2NA 4LRCA 4PUOB 1DZ5A 2Z2LA 4BC7A 4Y0FA 2JC0A 3I96A 5HJYA 3MMAA 2GHWA 4UQTA 2BE2B 4RLEA 3VGTA 1U1MA 3POTB 4KC5A 4DG1A 1N32J 1YLXA 2VPWB 4WFNQ 4KRWA 5KT2A 2ASYA 3Q89A 4LBIA 1RWKB 4N56A 1LV5A 1UL3A 1S9GB 3TR5A 1QJHA 2BKOA 1QD1A 2MM9A 4G37A 2R7UA 1KFDA 2K8GA 3S7RA 1R31A 4DV3C 4FXDA 5A0YA 3GJTB 2IY5B 2HFOA 3J80Y 1TL7A 4B3TJ 2ZJPQ 4XPCA 3SMZA 1FKPB 1KQKA 5H9FJ 3ZC4A 3V6DB 2ZE2B 4DEZA 2EG2A 2I8EA 1XWLA 5L9NA 1XNQJ 1Q7YT 1T5HX 5L1JA 2YH0A 3GIMA 1VC5A 2OTLS 2MKHA 3CB4A 1N36C 2XYHB 5JVHQ 5FLXU 1JJ4A 5D4NA 1RT6A 1F9EB 2E5JA 1JXVA 2ZH2A 2CXCA 3AT1B 1SIZA 2QYGA 2RDIA 2KXHA 1MXCA 3P6YC 3CCWA 2W7PA 2BVZA 5JUMA 1P6TA 4RNMA 4MK8A 2BXJA 1N36J 4X65J 3IR7B 4ZVTB 2MYFA 2F5GA 1S6PA 2HNYA 1CQMA 1SXLA 3NOGA 2LCWA 1C4CA 4RLFA 1S48A 1Y9OA 3FRYA 3LWLA 2DBBA 2GC8A 2RRNA 4PG7A 1JKHB 1KEKA 2E5GA 2V8PA 5EX3A 2ILYA 2MZ1A 2ZUAA 1M5PC 2P2BA 5DDPC 2NYIA 5DLGA 2NR0A 4O3NA 2A0FB 3ISNC 4OJGA 3X3UA 4C3KA 3HHLC 4WIQA 1WF2A 1CQNA 4ED0A 4A8SA 1UMJA 3R5BA 4ELTA 2HHXA 1O9TA 4GKKC 4ERDA 1RAAB 1M6XA 1SUQA 1GMWD 1HI1A 1W2BR 2J7WA 4FYXB 2CJXB 4DV6F 4PG8A 1DBDA 1DRZA 2H9ZA 2PI4A 2VDHA 2VG5A 1HKAA 2VODA 2CJBA 4LF4J 3MM6A 1PG5B 3D66A 4ALZA 2YH1A 5J1NA 3BEGB 1RT5B 1IKWA 1M5SA 3GONA 5DJBA 4B3RF 1H6KX 4N41A 4JI4J 5BR8F 1WC0A 2W7AA 2CFXA 3CJ5A 5HVHA 1NDLA 1S6PB 4WK1A 4A8QA 5T7LB 2XMAA 3I08A 4EI2A 2LVWA 1G7CB 4EMDA 3LGXA 2ZHOA 1SJFA 1PGZA 1JLCA 1XMQJ 4IH7A 2KZZA 3CJTA 3CJ8A 3I9ZA 4OHVA 3UQSA 1QY7A 1S99A 1D9FA 3RR7A 5AT1B 1BHNA 1FF2A 2EFVA 1WI6A 3TNVA 4ZVHA 1ACMB 2P20A 4F4KA 4HPVA 3MR3A 2IRYA 4U6PA 4PZPA 2E7WA 3FCHA 2RSQA 3TDEA 4P6QA 4J9RA 1CC8A 2D7SA 5HANA 1HHTP 4I7FA 1S49A 3IR5B 2VC0A 3DOLA 2E0GA 2P9GA 4M1KA 1LWXA 4L2ZA 3Q8RB 4ELUA 4JI0F 4X4NA 2ZH1A 1SL2A 2HLUA 2UUCF 1T5DX 5LXRA 3KWMA 2ZOGA 4KV8B 4YHHJ 1JLBA 4K7QA 5HMZA 1R0CB 2KJVA 4A8WA 1V9OA 3G86A 3TYTA 3GSIA 3MI7X 2JVOA 2G2YA 3D0IE 1B7YB 3QGPA 1JOSA 1P9QC 3I4PA 2H4WB 1PU1A 3A1YG 3Q0AA 3C2PA 4FF2A 1HNXJ 4L76A 2V50A 3EICA 1KFSA 4ED5A 4G1PA 3C8YA 1Q78A 1SJ3P 2PC6A 2W9BB 1SQFA 3B7WA 5KFKA 4DOZA 5A1GA 4BWJA 1KLNA 1C0TB 2CXEA 3M9NB 2MQPA 5IS2A 3RJMB 4WIIA 4NLWA 3RR8A 5KG0A 4CLSA 3B82A 5KEIA 1B0PA 3OTCA 3UD5A 1KOHA 4FBTA 2Z8QA 3BKFA 4J37A 1IBLC 3QLHA 4IUFA 2DGXA 1T9WA 3U7JA 4RW4B 2VBYA 3GCXP 3RRGA 3DI6A 1X0PA 3T5JA 1NZAA 2BRKA 5HQMA 4F2SA 2AV5A 4JV2A 4LVNP 1IBLJ 1N48A 4RR5A 4YB5A 4ZPCA 1JLBB 3P8BB 2VFRA 3GFYA 2QFJA 4M5JA 1RT3A 2XEXA 3TUJC 2EBGA 2K7KA 1BGXT 1MMDA 4CP5A 5LT5A 4NA3A 5ADZA 2VKZG 3UD3P 2PI5A 5KT5A 1LCIA 3BSAA 2CQPA 4NRTA 3B8HA 2DIVA 1EIYB 4YEAA 2K3IA 2XMWA 1IKYB 1GFWB 1HI8A 3LAKA 1X31C 3LGNA 3UPFA 4UF4A 2P5VA 2RQKA 3FEYB 2GFFA 2HVDA 2OELA 1TZ0A 4GVBB 2Q66A 3M2RA 5CHCB 4LJMA 2EWHA 4AUKA 4CQ1A 2Y4OA 4DMZA 5J2NB 3QLHB 3TX0A 3QRRA 2G4BA 4I4BA 2VJUA 1R0AB 1RISA 4YY3J 2N3OA 4U67Q 3GIKA 4PQAA 1RT1B 2QN6B 4LF7C 2ZC3A 2GX8A 5EWEA 2BJ1A 2ASBA 3KG1A 2JLEA 4Y2MA 4DL5A 3M9OB 2JEGA 3QGHA 4K59A 3PX6A 1IB8A 4L4QA 2NXUA 2QL8A 3FSYA 1HBUA 2JMPA 3D1HA 2V4RA 4LF7J 2F9DA 3EXYA 1CC7A 1L3TA 5E5NA 1EKRA 4DCPB 1B3TA 1AZSA 2IA6A 1NHUA 1MW7A 4BLGA 3IBCB 4KQZA 2XYGB 3CDUA 4F4AA 3KUHA 1CJTB 1OSCA 2C3MA 4V19X 2QRRA 5F0WA 5BSMA 3JAMY 2GO9A 2V5HG 4QU6A 4NCAA 4HHHA 1TKZA 3SDEA 1KC8T 2HAIA 3A3NB 3NKYA 3WIVA 4I2QA 1TKXA 2FJEB 2IVFB 4USUA 3M2RB 4XK8C 4A46A 5GVQA 1WH9A 4JI6C 2MQNA 2X1AA 2CNNB 1HPZB 2OPLB 4NLDA 1YZ7A 2C2OB 2BOAA 2B7BB 3KKFA 4DV7F 2BA9A 1VQLS 1U0HB 1R3NA 4X62F 1NKEA 3DGVA 4B3SJ 1Q8BA 5LMUC 3MMJA 2W9CA 2XY6A 2DGQA 2IHR1 3FK4A 4ZP8A 1FFGB 3FCCA 2DXDA 2AZ3A 3QJLA 2EG1A 2CYYA 4Q5VA 1FESA 4PYDA 1WF1A 3UZ0A 2VBZA 3L7UA 2YNIB 5JJBA 2O3DA 3VAHA 3F44A 2I2YA 2OPRB 1HMVA 1S1XB 4C8OA 2UXBC 1IM6A 4M5IA 1T05A 4JV5C 3M8QA 2XGPA 5LMNC 3K5MA 3BH6B 4IFYB 1N52B 1ZS6A 4HDGA 1MMLA 3V6JA 2AGQA 4F50A 1YX2A 1Q7LB 3MHYA 3BYPA 4OV1A 2VASA 4GO7X 4NDNA 1ELOA 5IWAC 2IJRA 2AEFA 2BUNA 4ZCIA 2ERRA 4AXIA 2DRAA 3PJ9A 3G87A 4DV5F 3L3CA 2R7RA 4GKJC 2Q79A 3HKZD 5J2PA 3MR7A 2H1YA 3QAUA 3D4JA 1G3OA 2V8GA 2K06A 4PUGA 3NS6A 3D6HB 4D3HA 5DDQC 2WW4A 4DF8A 2D9OA 1QAXA 1ZAVA 2MHNA 4HTJA 3UDVA 2VQEC 2KN4A 4O44B 4CLTA 1YRUA 1XMOF 2QGFB 2XLKA 4DR5J 4OX6A 1UEVA 4DL2A 3QATA 1HR0J 2CG8A 2EGTA 4TXSA 4UQGA 3LTOA 2Y1LB 2XZDB 3M9MB 1TKDA 4LMZA 4PKDB 1OO0B 5DQGA 1SH3A 3MMCA 1H72C 4YOEA 5ETKA 3W7BA 2DRDA 1P1TA 3FBBA 2MGZB 1PG3A 4JI2C 4IH6A 5D8HB 3H42A 4ECYA 3EGNA 5KG5A 1N32F 2BABA 1HBMB 4QPTA 3VHQA 3AD8C 2EC2A 3AF6A 2PO4A 2HGNA 3DRPA 2XGQA 1FRIA 2AP6A 3TQIA 3CW2C 3C15B 5KFNA 1VRQC 5A8RB 3T1HJ 2LP4A 3UCZP 1HNIB 2W1BA 1S9EA 1FFSB 4B3TF 3IP0A 2NSCA 3QWPA 4BDPA 3LPYA 4U7UK 3CPWR 2FUG9 3AJDA 2E9TA 2AJ1A 3LF0A 3HX9A 1RU2A 1XNQF 3LP2B 4DV3F 4X2BA 1UETA 3I0RA 3J80U 2IJNA 3NYQA 1H98A 4K2JA 2QX0A 4ECUA 3CCRS 3MOJB 3DLJA 2I5JA 3HDSA 4X4PA 1F5CA 1Q5VA 1PC4A 1K47A 3N79A 2HSEB 2QVYX 2D3UA 2D1CA 1RE1B 2IM1A 4ZVRB 1N36F 4X65F 4OV6A 4C0HA 3LNOA 4DFJA 2D69A 1F5AA 3UN2A 1JK9B 1S4FA 4QJVA 2VQFC 4TU9A 3DDKA 2KT5A 5HLFA 1VRUB 1FT8A 1NH7A 3UCGA 4OJ3A 2P02A 3MWBA 4NCGA 3BO2A 2J7UA 1Y5LB 4DV1J 5ETRA 3VNSA 3BBFA 1RA6A 2VQFJ 3I4HX 1RWNB 1LFPA 4NPOA 2M5HA 2J0XA 2HHTA 1JLFB 1RA7A 3A8EA 1GT8A 2RF2B 1REVA 5HK4A 1RADB 2AJ4A 2B4PA 3PACA 2A6OA 1A7GE 1R8AA 3DDNA 2E8EA 1U1OA 1WG4A 2YWWA 4Q44A 1V60A 4K5SA 2ZWOA 4ZN1A 2HZCA 2VU5A 3T1AA 3ZTPA 2YVSA 4LF4F 2HPUA 4GKKF 3G4SS 2QL5B 2LQ5A 1P1LA 4CZCA 4NYZA 2MPUA 4IRDA 3HVWA 4JI4F 4RM3A 3DN9A 1VQ5S 2IPOB 2ZH6A 3EGVA 4MKVA 4I6YA 2BANB 4J9SA 5CZVA 5L1LA 4HKQA 3VNQA 4Q0BA 1FXRA 4BHQA 4XPEA 4KY3A 1IWAA 2Y0BB 4FF4A 3KLEB 2ZVSA 3MPDA 1HFEL 1ZZFA 1XMQF 3DC2A 1UFWA 4QW9A 2WB4A 3SZ2A 1RG9A 2DITA 5D4OA 3HSGA 4KSEB 3C3LA 3RYLA 1RUSA 3DYAA 2VA3A 4EO6A 1TFWA 1PJ7A 2CQ2A 3G96A 4KHPC 5H9EK 3UN5A 1GTEA 1WHYA 4KH0B 1F2HA 2HK2A 2XSJB 1RTIA 3QT8A 4NXNC 2ZEJA 4ZCLA 2H4YB 8AT1B 2RHQB 1T9XA 3CJ2A 1LWFB 1ITPA 1UWDA 4KT0C 3C66A 2LEPA 2UU9J 1CJVA 4GS5A 1I3OB 5E3QA 3CMES 1YHQS 1RT2A 4RPFA 5ETSA 3QT5A 5ETLA 3M8RA 3E8OA 3HT0A 2AGOA 4URQU 1CSJA 4LFBJ 4YHHF 5EWGA 4ZCMA 3ZTOA 2O5DA 2YWCA 1M5OC 4X4VA 4QZVB 3GZ7A 1SQEA 2E66A 3CD0A 3MR2A 2B9EA 1RAOA 4P9SA 4O3QA 1U7LA 1Q82T 5IC6B 4EU0A 3IGNA 4Q0BB 2PE8A 3D67A 1UFKA 2BE9B 1HNXF 3CCVS 3QGIA 4U9RA 5EN1A 4D4GA 3MURP 3M30A 1H2TZ 5C42B 2KJWA 2JHEA 4KTQA 2VHGA 2HK3A 2IIHA 4M95A 3T9NA 2A2DA 3PM9A 3EVOA 3OUYA 3DNCA 4ZPWR 3FEXB 1N5YA 2OPQA 3BR9A 3K0JA 3LOUA 2E44A 4HYKA 4WU3A 2RU9A 3TARA 1IKVB 3V4MA 5KFEA 3CJSA 4ES1A 3US5A 1BXNA 4CM0A 4RVNA 2QYCA 4ZJOA 1RYRA 2E5LJ 2M5OA 1RYSA 4B9UA 1IBLF 2CDRB 1A9NB 1BWEA 1WOPA 1WC4A 5AE3A 1IVZA 1SC3B 2GNKA 1HBNB 4UZBA 2Z4PA 3N6LA 4IG0A 2E1PA 4ES3A 3HP6A 1KQSR 1K8AT 2MDAA 4KKOA 1X5PA 4OX8A 3LUYA 1FDNA 2FQQB 5KFUA 2D1SA 3MFIA 2DRBA 2ROPA 2YKMB 1U6FA 2FGCA 2MB0B 5ETQA 2PFFB 2UXDC 4DCUA 4AXJA 4DG8A 1X9SA 1GTHA 5ETNA 5I3PA 4L7IA 1CULB 3Q23A 3ZZYA 4F67A 4ILMA 3DCAA 2YNHA 2Y27A 3LQVA 2J9CA 2EXUA 2UXDJ 1GX6A 4TQSA 1NJIT 1B99A 3C6TB 3G9CA 2OSRA 3EMTA 1T95A 5GTDA 1HHQA 1QAYA 3D6FB 4V1Ak 3OTOJ 1VQ6S 3JYTA 4YY3F 2D3O1 2K7JA 4OX9J 4BSZA 3P96A 4PQUA 3HVTB 4DR3J 1ZA2B 1E6YB 2ZOMA 2FHMA 2FVQA 1YJTA 4O4GA 1FEEA 2HVZA 2M4MA 1R27B 2WOMA 2EPIA 4WS9A 4LF7F 4WK3A 1N33C 5A1IA 4MYTA 3TJAA 2PA3A 1V3SA 3PJXA 1BQNB 5IQQA 5BYQA 3BGRB 3OR1A 2M8DB 3CW9A 2HYIB 4ZCKA 5HMYA 1FCAA 4F0HA 3MAQA 1GEHA 3BREA 4PAAA 1N33J 1RHJB 3VCDA 3MAAA 1Y5NB 4TYAA 3GE9A 1YIJS 3IAS9 2XZTB 4ZPAA 4WKYA 2ZITA 3PDNA 4TYBA 1VJQA 3BBBA 4TLQA 2V2QA 1OPZA 3MD3A 1B0TA 4ECWA 2W01A 2OFHX 4DQSA 2BJEA 2GV1A 3K89A 3IPLA 4QWEA 4PG5A 1RTDB 5J1EB 4OYCA 2UXCJ 4DWIA 2IYGA 4Z37A 4A8KA 3BPDA 4B3SF 4IO9Q 2PFDA 1U1RA 1BQMB 1MSWD 3CO9A 1DTQA 5J2QA 1X9MA 2M2BA 2XMVA 4WFYA 4O0NA 2GVDA 5DGBA 2PMHA 2WOMB 1U4BA 3BQ0A 1UAWA 3QQCD 2AD9A 2NSBA 3UFCX 3NNCA 3BQ1A 2GIQA 1D0EA 1CVJA 3K6RA 3GP9A 3DMJB 1NK7A 4ZVUB 2WVEA 3HMJG 3HJVA 2V69A 4I9FA 4NLVA 4LBPA 4DR6C 4YP3A 3BN4A 1DJ0A 3MCNA 4F25A 3LP1A 4B3MJ 4JV5F 4USVA 1FJCA 3AAWB 4J9KA 3KJVA 4KYZA 2ZC4A 2WSFC 4C8MA 5G0RA 1YI2S 3PHEA 2DR8A 4DR6J 3TI0A 2ZD1A 2KZFA 1NSQA 1LNQA 2WCXA 4DCJB 1HL6A 1TVRB 2XI2A 3T5KA 2WTFA 3JQKA 5J1PA 1Q8KA 4PYAA 1RWUA 3ENVA 2ACYA 3DU6A 1NUEA 3Q24A 1RK8A 4LRAA 4R5PA 3DRXA 3KK3A 4C8YA 2QC3A 4DPXA 4GKJF 1VFJA 4M5DA 3RRHA 3T41A 3N6NA 1HR0F 3W9JA 3KOAA 2CQDA 5IT0A 1S0MA 4YMEA 1Q4RA 5LM7E 2Z0GA 4UOHA 1Q8LA 2ZBRA 1XTZA 1R89A 1Y11A 1S4EA 2P2FA 4PEOA 3I32A 4NCBA 2M70A 2CNLB 4RX6A 3HT3A 3G6ES 3EWGA 2ATCB 3ONQA 2CQIA 1VQSA 2KYZA 4JI7C 2LMIA 2NZCA 4HI2A 1WG1A 2QA1A 5ETVA 3KJVB 1DQ8A 3AXMA 1SBRA 3BH7B 5G0RB 3R6LB 3WC2A 3HHEA 2J0QD 5DG7A 1YBAA 5GMEA 1VIXA 4IYQA 5FDLB 2DY9A 4OI6A 2EKNA 4C0BA 2KHDA 3I6PA 2W8LA 5D4PA 2V9WA 2KO1A 4B9VA 4K0KJ 3TAMB 1VK3A 3T1HF 1TU0B 5T41A 4R5PB 3I07A 4LSNA 3GR1A 5KFZA 2WZ1A 2Q6CA 4JOUA 3KDNA 2D41A 5BYRA 4WZQA 5E2QA 1QVFR 3HHNB 4ED2A 1HNWC 2QO3A 2G0CA 2KH9A 2QTWA 2A3JA 3CC2S 4QIFA 1CG2A 4OI0A 1GK8A 4RO0A 3HZEA 4DSFA 2EVZA 4YB7A 3CDWA 4IQXA 3F0NA 1HNWJ 5B0BA 4FUQA 4DUZC 2Z51A 2B9YA 1HQEA 4USWA 2AW0A 2XQCA 2IC3B 3QJJA 2VOPA 4ECTA 4W4MA 1FLOA 1S1VA 4FN5A 3S1TA 1VQNS 2JEFA 1DAXA 4P2XA 3TQ1A 3NMAA 2RQMA 1AXQA 4RW8A 1IQZA 2YX4A 2HFSA 3PEJA 2UZAA 2MQLA 7AT1B 4NWBA 3ZO7A 4ZHRB 4F8RA 4R1MA 1RBLA 2BX6A 1N5VA 3OD2A 4DXLA 3BYRA 5A19A 2VQFF 2OPPA 2OGUA 3DLPX 2LFVA 4OMFG 3CCES 3M2UB 4YS2A 1Z2LA 2FJDB 2FJVA 5FIIA 3MM9A 5AXLA 5K20B 3ETCA 2W2OP 3NS5A 3TAQA 1JLGA 4DV4C 3CXCR 3R7BB 1X4BA 4TQRA 4U7CA 3E7WA 2M3DA 2FVPA 1HQEB 4WJBA 3MPUB 1TP7A 4LR9A 1V25A 3GIRA 1EAYC 1WUUA 3D68A 1AUSL 2CPJA 2XTJP 2DKOB 4WU2A 1XJWB 3EZOA 2HFUA 4NA1A 3LP0A 3RW6A 2YKOA 1XNRC 1NU4A 2RDDA 2GHPA 1MN9A 3G82B 1EP4B 4CCHA 3KK1A 3IRXB 5C25A 3E7XA 1QLNA 4RUAA 4RU2A 1XMBA 2YKAA 4PXDA 4NOZA 1C2PA 4HLBA 4X4TA 1HQUB 1H2VZ 1H73A 2GMHA 4B9MA 1RY2A 3DRRA 3M6XA 3DU5A 3A4TA 5BJRA 5D0RA 4DR7J 2V34A 1VC6A 3EDRB 3MM9B 1JNZB 4RW6B 1SL0A 3VVUA 3WZ0A 3GKUA 1FD8A 3VAMA 4AQYC 3R5AA 4QWAA 1JLGB 3FRZA 2H5IB 1PYOB 2ZBQA 3VVTA 1TAUA 2UU9F 4ZITA 3TW0A 3QNWB 1NDCA 2HQDA 1RCOB 2A18A 4AD6A 1U8SA 3PIOQ 1GQEA 5A8WA 3W63A 3DRYA 2HJGA 4LFBF 1FJGJ 2HHQA 4AQYJ 4YR2A 1N0UA 1Q95G 2X3GA 2J0SD 2W7OA 1C0UB 4U95A 3BSCA 4MT1A 2F8HA 1KDNA 4X4QA 3LP0B 2CQCA 5J2MB 4QBUA 5D0EA 4O3OA 1WWHA 5HP1A 3DOMA 4Z7YA 4LFCC 1O6XA 3TZXA 4JI1J 2JLGA 4J9VA 1B7FA 3GQCA 5KFWA 3AJ1A 3BN7A 5BSUA 4NZ6A 1X4FA 2XBPA 1FKAF 2C1EB 2AYGA 2RKIA 1QE1B 3GG0A 5HQLA 4LFCJ 3BSOA 1FI4A 2U2FA 3Q83A 2KRBA 2M5YA 5B0CA 2N4CA 3DRSA 1NB7A 1RTJB 3K8VA 5DV9A 1HA1A 1TL1A 4DR2C 3FQKA 2NXJA 3KJFB 1T03A 4DN0A 4NI2A 1SJ4P 2E5LF 1CS4B 1OS5A 2EC0A 3D3CJ 1HNVA 3MM5A 4QYZJ 4M8LA 1S0VA 1S0NA 4FPRA 2RS2A 4DUYC 4RUCA 4EBCA 4TKTA 3QT7A 2BW7A 2WSEC 1AA1B 3F41A 1U6BA 3B78A 1F3FA 1NNDA 2AWZA 4J7CA 4F2RA 4NXMJ 5HP1B 3DOMB 2HHSA 1BA3A 1LWEA 2R2TA 5HAOA 2HQ3A 3KLFA 3CWJA 4K8RA 1F6TA 3O8WA 1KHVA 1UWBA 4JI3J 2AEJA 3UX3A 2GQQA 4JV0A 2FDNA 1TV6A 1Y7PA 3MEGA 2UXDF 4N5SA 1IKXA 1M1HA 4P52A 3BO3A 5C2GA 5KFPA 4CNZA 3DRSB 2W2MP 1X4AA 2KVQE 1I5OB 2RNEA 5CYQA 3OTOF 4OX9F 4K0BA 1TL1B 4CRJA 4JI5C 5KFFA 4DR3F 2AX1A 5CQGA 5AE1A 4ED7A 4GO5X 4NLSA 3IM9A 2HNZB 2HURA 3PG9A 3FCEA 2UUAC 4OZJA 4LT6A 4IFVA 4WFZA 1Q16B 4TPSB 3MXHP 4ZLNA 2KZ0A 3NRBA 2GQ2A 3IA0A 5I3QA 5AJ3J 1A0OB 4IR1A 4G1IA 5A8KB 1DLOA 3HK2A 4FS2A 4FKXA 4W90B 1J27A 2P6TA 5LSOA 1FDBA 3NP5A 3S8SA 2VOOA 3BBCA 1FWKA 4CO2A 4DG9A 1N6QB 2B8QA 1AFIA 2ZBIA 4WYLA 3CUNA 1EX8A 2L9DA 4ENOA 2CJYB 1N33F 3VAIA 4LRFA 2JL9A 1RAFB 2J9EA 2XS7A 3FJ2A 4FYWB 1QAJA 1R7IA 4J9PA 5RUBA 1S57A 4IZ6A 3OFHA 2JJ4D 3GR0A 4X66J 3IFEA 2P2MA 3Q2TC 1YDLA 4R8UB 3KHLA 2XO7A 4ZLJA 2UUBJ 1OSDA 2YQ1A 3M7VA 3R1LA 3OVSA 4DV0C 5A2QD 3MECA 3OL8A 2UXCF 3EERA 1VRTA 3NL0A 1F0XA 2RUGA 1LEOA 4E8UA 1WKKA 3FZ2A 1RT7A 4EUVA 1FJEB 4Y6IA 2B0GA 4BCAA 2CKWA 3CJRA 1IBKJ 3PY8A 2IFXA 2VH7A 4FP9A 1DLOB 5GAGU 1MMNA 3KHRA 4QWCA 1RHKB 3CCTA 1YJNS 2BACA 4X4OA 2AZ1A 4I64A 1XS3A 2O1PA 5HVFA 3Q22A 4B3MF 4HR2A 1K0TA 5D4LA 3V4IB 1KR4A 2Q3PA 4Q2MA 2MZQA 4ZPTR 1N88A 4P10A 1ZTTA 4ED8A 4DR6F 3ADAC 3E01B 4OHZA 4CYUA 3K17A 4F04B 1PAUB 4LFAJ 1FE4A 2E1AA 3UO0A 4B3RJ 3V6KA 4CH0S 2KM8C 4L3NA 3GYNA 5KFLA 3MECB 2J8SA 2XLJA 1WC3A 2YY3A 2PEBA 3TA0A 2G1HA 2HEKA 3AH6A 3DLKA 1Z1ZA 3KLIB 3MCOA 1XRAA 2QV6A 3CQ1A 1N54B 1RT7B 4K4TA 2BM0A 3M6WA 3KK2A 5JVGQ 4I0WA 3CC7S 3N5FA 1VBYA 3G71S 4QIGA 2BJ9A 4TU8A 1QAIA 2ZM6C 3L7OA 2RRBA 1UVMA 4KGXB 3EJMA 1VQYA 3IRWP 3J81D 1C1BB 3BQ2A 2DNOA 2XR1A 1S1WB 1SB6A 4LF6J 4MFBA 1HBOA 4I67A 4GC6A 4ZLPA 2FPHX 2ZM6J 1OY8A 4LF9C 3DAYA 4R25A 1MWQA 1UEKA 5CH7B
chains in the Genus database with same CATH topology
1JLAB 3PFOA 4DL3A 2XGPA 5LMNC 2AX0A 3PW0A 1Q8IA 3K5MA 2FD2A 2JFDA 4IKAA 4IFYB 1FXLA 2H5EA 1N52B 5I42A 4HDGA 4ZVGA 2I0XA 4HT7A 1MMLA 1RAJA 2XNQA 2KG0A 3KLGA 4E0DA 3GV5B 3V6JA 1L3SA 2AGQA 3WX4A 3RG2A 4F50A 2E7GA 2B9XA 5B0AA 4DR7C 1BQNA 3U27A 3OVAA 3JTPA 3MMAB 1JX4A 4NLXA 2ADBA 5E0OA 2DNZA 3BGRA 1Q7LB 3MHYA 1QVGR 4OV1A 3E2EA 3OL7A 2OPPB 2VASA 4GO7X 4K4WA 3EZ5A 4NDNA 1ELOA 4DG1B 3SCIE 3W2VA 5IM0A 2B7CB 4EZ9A 1ZB8A 5IWAC 3MPWA 1QSSA 2ZNYA 1N56A 2WONB 4KB7A 3RAQA 3CJ4A 5ITHA 2BUNA 3GFHA 4ZCIA 4J9LA 2ERRA 1M90T 4AXIA 1Y00A 3IAM9 3NCQA 2DRAA 2ATLA 3PXGa 3PFEA 2ADCA 3DLKB 4WXOA 5BUQA 4DV5F 3RB6A 3L3CA 2IBKA 1MKYA 1AMUA 2FHOB 2R7RA 3L09A 4FS1A 2Y4NA 4GKJC 2DNLA 2Q79A 3HKZD 2YTCA 5J2PA 5DQHA 2BQUA 3I31A 2V8DA 3MMBB 3IO1A 5A0YB 4CO1A 3QAUA 2DCLA 2OPSB 3KK2B 4J9MA 1FJGC 1D9AA 2V4JA 4C8NA 3I9V9 3WBZA 1G3OA 2V8GA 3CJKB 2LQBA 1NJZA 1WEYA 3VAGA 1TL3A 2LYVA 4LE5A 1L2FA 1FNOA 2YKQA 2V7BA 3NS6A 4D3HA 4ZKAA 4PHTA 1Y0HA 4DV0F 2PN6A 1CLFA 5DDQC 1LW2A 3CDEA 1KHWA 1SJ1A 3R9XA 4DF8A 2D9OA 2ZH5A 1QAXA 1ZAVA 2V0NA 1S97A 2MHNA 4HTJA 4ZPBA 1RTDA 5DDRC 2VQEC 2KN4A 2LXFA 1RTHA 4LF4C 1MU2A 5J1EA 3H59A 4O44B 1N2FA 4WFXA 5BSWA 3OFEA 3J7YU 1YRUA 3R3TA 3GG1A 1XMOF 2ZNZA 1HNWF 4I1TA 2Y1IA 5KG7A 2QSFA 3RW7A 3DLGB 2CQ4A 4P7VA 4MKAA 2XLKA 1Z4UA 4E98A 1BQMA 4OX6A 4NZ7A 1K0VA 1S1TB 4DL7A 5FLXD 3QIPA 1XR6A 4OHYA 2FHKA 1UEVA 1PC5A 4B3OA 2UUWA 3Q2SC 4O3PA 5K5MA 4RUHA 4DL2A 4JI1C 4AL5A 2G1DA 2EGTA 2GGPB 4TXSA 4JI4C 5B7WA 2XCAA 2D1RA 3LGMA 4UQGA 2XLIA 3QMQA 5KYVA 1RT6B 2J6UA 2AJFE 4NLQA 5E3PA 4I68A 2ZH3A 4OHWA 2PSZA 1ZH5A 2DHXA 3M9MB 3H20A 4QIEA 1TKDA 1RJJA 3OFGA 4LMZA 2KT3A 4PR6A 4PKDB 2DPLA 3A9UA 1WACA 3RBEA 1OO0B 1JWWA 2HHHF 4HH1A 5F3TA 5DQGA 3IEVA 1URRA 2XS5A 3KK1B 3BGFA 3DMJA 5C25B 3PVXA 4WKRA 1SH3A 3MMCA 1U26A 3CMAS 5T8TA 2DNNA 3S6EA 4ZVEA 1XMQC 1VQPS 1E6VA 4YOEA 3LAXA 3N01A 4XO0A 3W7BA 3VAFA 2WD9A 4L6V3 4A8OA 1M5KC 3G8QA 3SFUA 2OMOA 4HL9A 2HNDB 2DCUB 1P1TA 2MGZB 1UKUA 1PG3A 2HNYB 3OXLA 2F8EX 2DHSA 5DRKA 3BDPA 3HKWA 4JI2C 1NO8A 4Y2AA 2DK2A 2IYIA 4KAIA 2RQCA 4OLPA 2GMJA 4OI4A 1HYSA 3GB0A 4IH6A 3IG1A 1WHWA 2FVCA 4PXBA 4ECYA 5D8HB 2L08A 3DRRB 3EGNA 3ISZA 4PPDA 2RILA 5KG5A 4K4VA 1N32F 3BS9A 2BABA 1HBMB 4QPTA 4CO5A 2RU3A 2XG8A 2DYJA 3KXWA 3QO9A 3AF6A 2PO4A 3E3XA 3I87A 2KFZA 2HGNA 3DRPA 2PT0A 1IJFB 2PA8D 3VZHA 2XGQA 2FGOA 1TK8A 1FRIA 2CVIA 3NYRA 1IN0A 3CT9A 4AL7A 1TFYA 2AP6A 4WFAQ 3TQIA 3BZQA 1T8EA 3ZZTA 1O5JA 1MWZA 1X4CA 2GQCA 4USHA 3U1NA 2DVIA 4KPYA 3UW1A 3IS9A 3U02A 3JTNA 3PX4A 2HMIB 4LUBA 2IM0A 1TVRA 4C11B 5KFNA 2IMWP 1NRKA 1TL3B 2X1BA 1N5TA 2DR7A 5A8RB 2AGPA 2HG4A 3KNAA 2AYBA 4F4XA 3UCZP 2BH1X 3M8PA 1ZAWA 3FSIA 6FDRA 4X4SA 1HNIB 3IWLA 1VGYA 3AQOA 5E33A 1S9EA 4DQPA 4B3TF 5CCLA 4R0MA 2K1RA 1MU2B 3DOKA 4MK9A 2VG7B 3HFKA 2ROEA 3K57A 2NSCA 5A8WB 2ASJA 4N76A 3N6MA 3QWPA 4BDPA 3LPYA 2DH8A 5GAHI 4U7UK 5LSLA 3CPWR 1ULTA 1HW8A 2D74B 3LUSA 2FUG9 5A6PA 1SUQB 2DNKA 2O01C 4JI6F 4A47A 4NXMC 2EBEA 4F3MA 2E9TA 2DISA 5KFGA 2AJ1A 3K7RA 3LF0A 3HX9A 3PR4A 2B43A 1XBWA 3LP2B 1XNQF 4DV3F 3J7A1 4X2BA 1FJ7A 1UETA 3I0RA 4YHHC 3G6VA 4RW9B 2IJNA 1RT4B 4A8XA 3NYQA 1LWCA 4DR1F 3S82A 3EZUA 3QIDA 4I2PA 4IDKA 1H98A 2LXUA 2KB2A 2VG5B 1FA0A 4ES2A 3CD6S 3K8WA 2HIQA 2QMWA 4Y65A 3MM6B 2CPEA 5HMWA 3HF5A 3RTVA 3OPKA 3N54B 5L8RC 4ECUA 3LWMA 4JI3C 4EO8A 2Y1JA 5LMUF 1VQ7S 3CCRS 2CPFA 3MUVP 1BLUA 3DLJA 3H2LA 2I5JA 3HDSA 3EGWB 4NLTA 4X4PA 3MOJB 1IKWB 1F5CA 4NLYA 3OBIA 2ZJQQ 1PC4A 1YRXA 4DFKA 1HNXC 4H4MA 1SH2A 4RNHA 4RM2A 3N79A 2BJDA 2KZMA 2J9DA 3G7SA 1ZETA 2QVYX 2RT3A 2D3UA 3PRBA 4X4RA 2D1CA 5KT3A 3JAMD 2VZEA 3Q8QB 1NHVA 2EKYA 2B6AB 2MQQA 2F7VA 2IM1A 1KNZA 4A4JA 4DQQA 1U49A 1GAOA 1KD1T 2J6SA 3AY0A 4DLGA 1F9FA 2A10A 1N36F 3LW5C 1NYEA 2P9CA 4X65F 1PO6A 1DQ9A 1VLYA 1X9WA 2UXBF 1Y4ZB 4PXEA 3FNNA 3OQ2A 2NZ4A 5KFHA 2E9RX 2RKIB 2HVIA 4C0HA 4W92B 4DFJA 1ZBTA 2MZJA 5LMNF 1F5AA 2GO8A 1JK9B 4EYIB 1S4FA 5H1SV 4QJVA 1S77D 2VQFC 3T5HA 2M0GB 5T8SA 1JLCB 1FDDA 4TU9A 1SL1A 1O0PA 2IA0A 3QO9B 1RGVA 1P8GA 3OXFA 3DDKA 2KT5A 5HLFA 3EYZA 1VRUB 1FT8A 4D3GA 3K2YA 3D1OA 1NH7A 3UCGA 2VA2A 3DM2B 4OJ3A 5B0DA 4O23A 2MZRA 2P02A 2J7KA 3MWBA 4DR7F 4V19J 2A1BA 2DGVA 4NCGA 4CIOA 3FSXA 5D3GA 5FDLA 3BO2A 3IS9B 1WEZA 4CO3A 2WAQD 2J7UA 4IG3A 4ZPDA 2LA4A 1Y5LB 3IR6B 4EWTA 2ABYA 2HHPA 2FJBB 2KT2A 2XWXA 3VNSA 1J5OB 4EZ6A 1T03B 5IWAF 2LDYA 1RA6A 2KG1A 1EETB 3I4HX 1LFPA 1TUVA 3NNAA 1KOOA 3MEKA 3M6UA 3NPDA 2MZTA 4NPOA 1HNVB 2J0XA 3M2VA 3MM5B 1NH8A 4OZ5A 2C3OA 3TAMA 4ICLA 4ETZA 4GC7A 2R7XA 4GXRA 1J5EC 1YJUA 5EDWA 2CPHA 3FMBA 3MDFA 2HHTA 1IBMC 2VKRA 1JLFB 1RA7A 3BSNA 5D77A 3A8EA 2AJ0A 4DBQA 1GT8A 2RF2B 2YNFA 1REVA 1V3ZA 3PW5A 2AJ4A 2B4PA 3PACA 2XMTA 4JYAC 4I7FB 2HRUA 2WP0C 1A7GE 1X7VA 1R8AA 3DOLB 1FJGF 3H98A 4AQYF 1R8PA 3DDNA 3TOQA 5F8HA 1LWCB 1U1OA 4FF1A 2E8EA 1WG4A 1S72S 2QZ8A 4IDKB 1K9MT 2C2RA 1LW0A 5FD1A 4Q44A 4KFBA 4K5SA 4FUTA 3R5CA 3M1VA 5F8GA 2QE5A 4H54A 4K4XA 4FNIA 3DXSX 2HZCA 5F8LA 2W4CA 3FGVA 3T1AA 3GSDA 2CQ0A 3H4BA 4FYDA 3M32A 5T14A 2IRXA 1YGYA 1T94A 2HLTA 3CD5A 1C4AA 5LJ5Y 2VQEF 1MXBA 2MSSA 1HW9A 2YVSA 3THPA 4LF4F 2DNYA 3OVBA 4DCTA 4H4OB 1LWEB 2HPUA 1U1QA 2WRMA 1Q81T 3PW4A 4GKKF 2FVSA 5DETA 3G4SS 3KLFB 4UUXA 4ID8A 4H4MB 4X66C 2LQ5A 3EGZA 5FLXY 5GMKa 1P1LA 4DHVA 4CZCA 1BD6A 1H2UX 1ZM9A 2F4VF 5B0GA 1NK4A 4D4IA 3GV8B 4NYZA 2D1TA 1U24A 1Q79A 2MPUA 1ZOTA 4B9LA 4JI1F 3UCUP 4IRDA 3DGPA 3B4DA 1U25A 3HVWA 4JI4F 4RM3A 2IC3A 3CJEA 1UWBB 2EFGA 3DN9A 1VQ5S 2UUBC 5F8MA 4DR4C 5F9LA 1X4GA 5K14A 3KLVA 2ZH6A 5F8NA 3AB4B 2RD5C 4I6YA 2BANB 1TV6B 2XMJA 4J9SA 3MEGB 3PBKA 3BB5A 5CZVA 1HHSA 4Y28C 5L1LA 4HKQA 1XRCA 4MKYA 3DHXA 3OV7A 3VNQA 1IKXB 4Q0BA 1MD9A 2FLPA 4C3LA 3PX0A 3UE2A 1FXRA 2LLZA 3CCUS 2C42A 4BHQA 4XPEA 2V8VA 3O2IA 1TK0A 4LFCF 2KYXA 3Q8SB 4K4YA 4FF4A 3KLEB 2ZVSA 1CPZA 2F1FA 1HFEL 1ZZFA 4XIUA 1XMQF 3MEEA 4Q8EA 3K5LA 3DC2A 3ENWA 3N0VA 1UFWA 1NJXA 5CYQB 1M5HA 3BR8A 4DSEA 4QW9A 1SKRA 2IM2A 2WB4A 2JZ5A 3SZ2A 4KHMA 1RG9A 1ROFA 2DGTA 4PUOA 1GNKA 2XHWA 1WTBA 2IMOA 5E7OB 2DPJA 1MDBA 4YY3C 2DITA 5D4OA 4ZHRA 4KJIA 1IBKC 3AJ2A 3P5TL 3VQSA 4JI2F 4KSEB 3KG0A 1FTCA 2OD4A 3C3LA 2LU2A 4K50A 3RYLA 3DYAA 2BE2A 2VA3A 3NGKA 4ATNA 1R43A 2MKIA 2OP5A 1H38A 3SCKE 2FJWA 1WF3A 3POTA 4EO6A 1TFWA </