3GR5A

Periplasmic domain of the outer membrane secretin escc from enteropathogenic e.coli (epec)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
153
structure length
153
Chain Sequence
b'MSSLEKRLGKNEYFIITKSSPVRAILNDFAANYSIPVFISSSVNDDFSGEIKNEKPVKVLEKLSKLYHLTWYYDENILYIYKTNEISRSIITPTYLDIDSLLKYLSDTISVNKNSCNVRKITTFNSIEVRGVPECIKYITSLSESLDKEAQSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EscC
publication title A conserved structural motif mediates formation of the periplasmic rings in the type III secretion system.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 39
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2009-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.120 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 3gr5A02
3.55.50.30 Alpha Beta 3-Layer(bab) Sandwich Phage tail protein beta-alpha-beta fold Phage tail protein beta-alpha-beta fold 3gr5A01
2O5PA 4EC5A 2W6UA 2W77A 4E9JA 2A02A 3EZJA 1ZZVA 2IAHA 3OSSD 2W16A 4M0HA 2D1UA 2M5JA 4AR0A 2W75A 2Y3MA 4M0NA 4JTMA 2W78A 3GR5A 2W76A 2W6TA 4G08A
chains in the Genus database with same CATH superfamily
3T1YH 4QMFB 1ODHA 1V8CA 1N36H 2FPHX 5FLXW 4JYAH 4NBQA 1IBKH 2W77A 4K0KH 2JE6I 4GKJH 2HHHH 2CTFA 4BA2I 2CTJA 4AM3A 4PDBA 1N33H 4DUYH 2PY9A 2A02A 4WANA 1N34H 1AN7A 2ZM6H 1VBIA 1DT4A 2CTMA 4DR7H 2E5LH 2D1UA 4OCHA 2HH2A 4JI4H 4LF7H 2QNDA 5A2QW 4DR2H 4OD6A 4DR4H 4LF9H 2ZQEA 2ANNA 4NZRM 1WVNA 2BA0A 1WHRA 4B3RH 2Z0SA 4JV5H 2M8WA 4OO1G 4DV0H 4AIMA 4JI7H 1WRUA 2W6TA 4JI1H 2FFMA 3J7AK 2LTLA 4LFBH 2VQFH 1I6UA 4G08A 4KHPH 2LTMA 2O5PA 4JI3H 4LF4H 3FAUA 4AQYH 1HNWH 3GKUA 3VKEA 4JI5H 1IBLH 4NXMH 4B3TH 2UXCH 2MJHA 1ZTGA 2ANRA 4MTKA 1XMOH 2Z6BD 2NN6G 1X0AA 1X9ZA 2JZXA 3V69A 3KDKA 4X62H 2D9IA 2CTKA 1VIHA 2A1SA 2CPMA 1J5KA 4B3MH 1J4WA 5K36G 4JVYA 1PQXA 4DR1H 4DV5H 1IBMH 2JEBI 1EC6A 2X06A 4GKKH 2DGRA 2HH3A 3J81W 1X4MA 4LF5H 1KHMA 2WZPR 4B3SH 4JI8H 4X64H 3I0PA 5BR8H 2UUCH 3OETA 1XNRH 4JVHA 1K1GA 1F0XA 5LL6b 1WTHD 3KDGA 3T1HH 3U1KA 2LF0A 3QD7X 4LF8H 1TUAA 1V9NA 2M6QA 2L4WA 5DT9A 1ZZIA 1WTJA 2W6UA 3UOEA 1NXUA 2W16A 2UUAH 1HNXH 4E9JA 1K28D 2OPUA 4BA1I 2K1HA 1ZZVA 4DUZH 4YHHH 1FKAH 2IAHA 2BL5A 3OSSD 4DV4H 4DR6H 1FJGH 1N32H 4M0HA 2X531 2F4VH 4AR0A 2P2RA 3D37A 2W75A 3SB1A 2Y3MA 1ZZKA 4LF6H 2CPQA 1S20A 4JI6H 2VQEH 2JA9A 1WE8A 2CWFA 3GR5A 2AXYA 2E3UA 5JEAG 1HR0H 4UHVA 4NZTM 3GABA 2UXBH 2VKCA 1X4NA 4DV2H 1I94H 4DV6H 1S03G 4LFAH 2UXDH 3CDDA 4EC5A 3JAMW 4YY3H 1MSZA 4LIJA 1HNZH 2LRRA 5C0XG 2PQUA 5IWAH 2JEAI 1SEIA 4H8AA 4JI2H 2YQRA 4DV3H 1ZZJA 4NXNH 3AEVB 3ADYA 3OV5A 4LFCH 4DV7H 4FJUA 3EZJA 4X66H 4OX9H 4WALA 1Z2IA 1DTJA 1UG8A 1XRHA 4B8TA 3NCVA 2M5JA 4X65H 2FMRA 2G8YA 5LMUH 5LMNH 3J80W 3L7ZC 4DV1H 3GS9A 4M0NA 4JI0H 2P5ZX 4FJSA 2O4CA 1XMQH 4JTMA 2W78A 1VIGA 4IFDG 2W76A 2UU9H 2CTLA 2OPVA 3RF2A 2CWHA 4DR5H 2PT7G 4DR3H 1J5EH 5IT9W 4B8CD 2CTEA 3OTOH 2JVZA 1XNQH 2UUBH
chains in the Genus database with same CATH topology
3T1YH 1ODHA 1N36H 2FPHX 5FLXW 4JYAH 1IBKH 2W77A 4K0KH 4GKJH 2HHHH 4PDBA 1N33H 4DUYH 2A02A 1N34H 1AN7A 2ZM6H 4DR7H 2E5LH 2D1UA 4OCHA 4JI4H 4LF7H 5A2QW 4DR2H 4OD6A 4DR4H 4LF9H 2ZQEA 4JV5H 4NZRM 4B3RH 4DV0H 4JI7H 2W6TA 4JI1H 3J7AK 4LFBH 2VQFH 1I6UA 4G08A 4KHPH 2O5PA 4JI3H 4LF4H 3FAUA 4AQYH 1HNWH 4JI5H 4NXMH 1IBLH 2UXCH 4B3TH 1XMOH 2Z6BD 1X9ZA 4X62H 3KDKA 4B3MH 2D9IA 4LF8H 2W16A 4DR1H 4DV5H 1IBMH 4GKKH 3J81W 4LF5H 2WZPR 4B3SH 4JI8H 4X64H 5BR8H 2UUCH 3OETA 1XNRH 1F0XA 5LL6b 1WTHD 3KDGA 3T1HH 2LF0A 3QD7X 2L4WA 5DT9A 2W6UA 2UUAH 1HNXH 4E9JA 1K28D 1ZZVA 4DUZH 4YHHH 1FKAH 2IAHA 3OSSD 4DV4H 4DR6H 1FJGH 1N32H 4M0HA 2X531 2F4VH 4AR0A 2W75A 3SB1A 2Y3MA 4LF6H 4JI6H 2VQEH 3GR5A 1HR0H 4NZTM 3GABA 2UXBH 4DV2H 2VKCA 1I94H 4DV6H 1S03G 4LFAH 2UXDH 4EC5A 3JAMW 4YY3H 1HNZH 5IWAH 1SEIA 4DV3H 4JI2H 4NXNH 3OV5A 3ADYA 4LFCH 4DV7H 3EZJA 4X66H 4OX9H 3NCVA 2M5JA 4X65H 5LMUH 5LMNH 3J80W 4DV1H 3GS9A 4M0NA 4JI0H 4JTMA 1XMQH 2O4CA 2W78A 2W76A 2UU9H 3RF2A 4DR5H 2PT7G 4DR3H 1J5EH 5IT9W 4B8CD 3OTOH 1XNQH 2UUBH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O5P A;  4EC5 A;  2W6U A;  2W77 A;  4E9J A;  2A02 A;  3EZJ A;  1ZZV A;  2IAH A;  3OSS D;  2W16 A;  4M0H A;  2D1U A;  2M5J A;  4AR0 A;  2W75 A;  2Y3M A;  4M0N A;  4JTM A;  2W78 A;  3GR5 A;  2W76 A;  2W6T A;  4G08 A; 
#chains in the Genus database with same CATH topology
 3T1Y H;  4QMF B;  1ODH A;  1V8C A;  1N36 H;  2FPH X;  5FLX W;  4JYA H;  4NBQ A;  1IBK H;  2W77 A;  4K0K H;  2JE6 I;  4GKJ H;  2HHH H;  2CTF A;  4BA2 I;  2CTJ A;  4AM3 A;  4PDB A;  1N33 H;  4DUY H;  2PY9 A;  2A02 A;  4WAN A;  1N34 H;  1AN7 A;  2ZM6 H;  1VBI A;  1DT4 A;  2CTM A;  4DR7 H;  2E5L H;  2D1U A;  4OCH A;  2HH2 A;  4JI4 H;  4LF7 H;  2QND A;  5A2Q W;  4DR2 H;  4OD6 A;  4DR4 H;  4LF9 H;  2ZQE A;  2ANN A;  4NZR M;  1WVN A;  2BA0 A;  1WHR A;  4B3R H;  2Z0S A;  4JV5 H;  2M8W A;  4OO1 G;  4DV0 H;  4AIM A;  4JI7 H;  1WRU A;  2W6T A;  4JI1 H;  2FFM A;  3J7A K;  2LTL A;  4LFB H;  2VQF H;  1I6U A;  4G08 A;  4KHP H;  2LTM A;  2O5P A;  4JI3 H;  4LF4 H;  3FAU A;  4AQY H;  1HNW H;  3GKU A;  3VKE A;  4JI5 H;  1IBL H;  4NXM H;  4B3T H;  2UXC H;  2MJH A;  1ZTG A;  2ANR A;  4MTK A;  1XMO H;  2Z6B D;  2NN6 G;  1X0A A;  1X9Z A;  2JZX A;  3V69 A;  3KDK A;  4X62 H;  2D9I A;  2CTK A;  1VIH A;  2A1S A;  2CPM A;  1J5K A;  4B3M H;  1J4W A;  5K36 G;  4JVY A;  1PQX A;  4DR1 H;  4DV5 H;  1IBM H;  2JEB I;  1EC6 A;  2X06 A;  4GKK H;  2DGR A;  2HH3 A;  3J81 W;  1X4M A;  4LF5 H;  1KHM A;  2WZP R;  4B3S H;  4JI8 H;  4X64 H;  3I0P A;  5BR8 H;  2UUC H;  3OET A;  1XNR H;  4JVH A;  1K1G A;  1F0X A;  5LL6 b;  1WTH D;  3KDG A;  3T1H H;  3U1K A;  2LF0 A;  3QD7 X;  4LF8 H;  1TUA A;  1V9N A;  2M6Q A;  2L4W A;  5DT9 A;  1ZZI A;  1WTJ A;  2W6U A;  3UOE A;  1NXU A;  2W16 A;  2UUA H;  1HNX H;  4E9J A;  1K28 D;  2OPU A;  4BA1 I;  2K1H A;  1ZZV A;  4DUZ H;  4YHH H;  1FKA H;  2IAH A;  2BL5 A;  3OSS D;  4DV4 H;  4DR6 H;  1FJG H;  1N32 H;  4M0H A;  2X53 1;  2F4V H;  4AR0 A;  2P2R A;  3D37 A;  2W75 A;  3SB1 A;  2Y3M A;  1ZZK A;  4LF6 H;  2CPQ A;  1S20 A;  4JI6 H;  2VQE H;  2JA9 A;  1WE8 A;  2CWF A;  3GR5 A;  2AXY A;  2E3U A;  5JEA G;  1HR0 H;  4UHV A;  4NZT M;  3GAB A;  2UXB H;  2VKC A;  1X4N A;  4DV2 H;  1I94 H;  4DV6 H;  1S03 G;  4LFA H;  2UXD H;  3CDD A;  4EC5 A;  3JAM W;  4YY3 H;  1MSZ A;  4LIJ A;  1HNZ H;  2LRR A;  5C0X G;  2PQU A;  5IWA H;  2JEA I;  1SEI A;  4H8A A;  4JI2 H;  2YQR A;  4DV3 H;  1ZZJ A;  4NXN H;  3AEV B;  3ADY A;  3OV5 A;  4LFC H;  4DV7 H;  4FJU A;  3EZJ A;  4X66 H;  4OX9 H;  4WAL A;  1Z2I A;  1DTJ A;  1UG8 A;  1XRH A;  4B8T A;  3NCV A;  2M5J A;  4X65 H;  2FMR A;  2G8Y A;  5LMU H;  5LMN H;  3J80 W;  3L7Z C;  4DV1 H;  3GS9 A;  4M0N A;  4JI0 H;  2P5Z X;  4FJS A;  2O4C A;  1XMQ H;  4JTM A;  2W78 A;  1VIG A;  4IFD G;  2W76 A;  2UU9 H;  2CTL A;  2OPV A;  3RF2 A;  2CWH A;  4DR5 H;  2PT7 G;  4DR3 H;  1J5E H;  5IT9 W;  4B8C D;  2CTE A;  3OTO H;  2JVZ A;  1XNQ H;  2UUB H; 
#chains in the Genus database with same CATH homology
 3T1Y H;  1ODH A;  1N36 H;  2FPH X;  5FLX W;  4JYA H;  1IBK H;  2W77 A;  4K0K H;  4GKJ H;  2HHH H;  4PDB A;  1N33 H;  4DUY H;  2A02 A;  1N34 H;  1AN7 A;  2ZM6 H;  4DR7 H;  2E5L H;  2D1U A;  4OCH A;  4JI4 H;  4LF7 H;  5A2Q W;  4DR2 H;  4OD6 A;  4DR4 H;  4LF9 H;  2ZQE A;  4JV5 H;  4NZR M;  4B3R H;  4DV0 H;  4JI7 H;  2W6T A;  4JI1 H;  3J7A K;  4LFB H;  2VQF H;  1I6U A;  4G08 A;  4KHP H;  2O5P A;  4JI3 H;  4LF4 H;  3FAU A;  4AQY H;  1HNW H;  4JI5 H;  4NXM H;  1IBL H;  2UXC H;  4B3T H;  1XMO H;  2Z6B D;  1X9Z A;  4X62 H;  3KDK A;  4B3M H;  2D9I A;  4LF8 H;  2W16 A;  4DR1 H;  4DV5 H;  1IBM H;  4GKK H;  3J81 W;  4LF5 H;  2WZP R;  4B3S H;  4JI8 H;  4X64 H;  5BR8 H;  2UUC H;  3OET A;  1XNR H;  1F0X A;  5LL6 b;  1WTH D;  3KDG A;  3T1H H;  2LF0 A;  3QD7 X;  2L4W A;  5DT9 A;  2W6U A;  2UUA H;  1HNX H;  4E9J A;  1K28 D;  1ZZV A;  4DUZ H;  4YHH H;  1FKA H;  2IAH A;  3OSS D;  4DV4 H;  4DR6 H;  1FJG H;  1N32 H;  4M0H A;  2X53 1;  2F4V H;  4AR0 A;  2W75 A;  3SB1 A;  2Y3M A;  4LF6 H;  4JI6 H;  2VQE H;  3GR5 A;  1HR0 H;  4NZT M;  3GAB A;  2UXB H;  4DV2 H;  2VKC A;  1I94 H;  4DV6 H;  1S03 G;  4LFA H;  2UXD H;  4EC5 A;  3JAM W;  4YY3 H;  1HNZ H;  5IWA H;  1SEI A;  4DV3 H;  4JI2 H;  4NXN H;  3OV5 A;  3ADY A;  4LFC H;  4DV7 H;  3EZJ A;  4X66 H;  4OX9 H;  3NCV A;  2M5J A;  4X65 H;  5LMU H;  5LMN H;  3J80 W;  4DV1 H;  3GS9 A;  4M0N A;  4JI0 H;  4JTM A;  1XMQ H;  2O4C A;  2W78 A;  2W76 A;  2UU9 H;  3RF2 A;  4DR5 H;  2PT7 G;  4DR3 H;  1J5E H;  5IT9 W;  4B8C D;  3OTO H;  1XNQ H;  2UUB H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...