3GR5A

Periplasmic domain of the outer membrane secretin escc from enteropathogenic e.coli (epec)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
153
structure length
153
Chain Sequence
MSSLEKRLGKNEYFIITKSSPVRAILNDFAANYSIPVFISSSVNDDFSGEIKNEKPVKVLEKLSKLYHLTWYYDENILYIYKTNEISRSIITPTYLDIDSLLKYLSDTISVNKNSCNVRKITTFNSIEVRGVPECIKYITSLSESLDKEAQSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A conserved structural motif mediates formation of the periplasmic rings in the type III secretion system.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords EscC
total genus 39
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2009-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.120 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 3gr5A02
3.55.50.30 Alpha Beta 3-Layer(bab) Sandwich Phage tail protein beta-alpha-beta fold Phage tail protein beta-alpha-beta fold 3gr5A01
2W75A 2Y3MA 4E9JA 2W78A 2W77A 1ZZVA 2W16A 4EC5A 2O5PA 2W6TA 3EZJA 4JTMA 2D1UA 2W6UA 2M5JA 2A02A 2IAHA 2W76A 3GR5A 4M0NA 4G08A 4AR0A 4M0HA 3OSSD
chains in the Genus database with same CATH superfamily
2JZXA 4X62H 1VBIA 1X9ZA 2LF0A 4JI8H 1HNWH 3RF2A 1HNXH 1Z2IA 3KDKA 4LFCH 4JV5H 1XNRH 1WE8A 2FFMA 3V69A 2VQEH 4DUZH 3T1YH 1S03G 1ZZJA 2WZPR 4NZTM 4EC5A 2AXYA 1ODHA 4DR4H 4DUYH 1NXUA 4DV3H 2CPMA 2UXDH 1N32H 1K28D 2UUAH 2HH3A 2W6UA 2G8YA 4DV1H 3L7ZC 3UOEA 4DV4H 1IBMH 4DV6H 4B3TH 2JVZA 5JEAG 2BA0A 2M5JA 4JYAH 1WRUA 2X531 5K36G 1IBKH 2IAHA 3GS9A 1V9NA 4GKJH 1VIHA 4LF4H 4IFDG 1FJGH 2HHHH 2OPUA 2UUBH 2E5LH 2CTEA 2LTLA 2D9IA 4JI7H 4UHVA 5LMNH 2P5ZX 1PQXA 2Y3MA 2ZQEA 2ANRA 2UXCH 1X0AA 5IWAH 1ZZVA 3OV5A 2W77A 2W16A 1XNQH 3VKEA 1WTJA 2CTKA 2VQFH 4OCHA 2W6TA 1VIGA 2FPHX 4JI4H 1ZZKA 4JTMA 2L4WA 2CTFA 4AM3A 1WVNA 1MSZA 2PY9A 4LF5H 3ADYA 2LRRA 4BA2I 1I6UA 4WANA 4LIJA 2O4CA 2X06A 3QD7X 4X66H 3J81W 2HH2A 5A2QW 1X4MA 4LFAH 4YY3H 5C0XG 2BL5A 4K0KH 1SEIA 1I94H 3D37A 2W76A 1WHRA 3J80W 2NN6G 1XRHA 2JEBI 3GKUA 3GABA 1XMQH 4JI6H 4OD6A 4NXMH 1UG8A 4M0HA 1N34H 4NXNH 4B8CD 4DV5H 2A1SA 4B3RH 5IT9W 1FKAH 1K1GA 1J4WA 3T1HH 2P2RA 2W75A 1XMOH 2K1HA 2QNDA 1J5KA 1ZTGA 4H8AA 4NBQA 5BR8H 2LTMA 1X4NA 5LL6b 3KDGA 4DV0H 4B3MH 2OPVA 3JAMW 4DV7H 4QMFB 2UU9H 2CTLA 4BA1I 4JI5H 2JA9A 2MJHA 4NZRM 5DT9A 4OO1G 1WTHD 4AIMA 2E3UA 4DR6H 4X65H 2CWHA 2VKCA 4B3SH 2Z6BD 1KHMA 4X64H 3CDDA 1S20A 4DR5H 2F4VH 2DGRA 3I0PA 4LFBH 1DT4A 1N33H 4FJSA 2CPQA 4M0NA 2FMRA 4JVHA 4PDBA 3OTOH 2PQUA 4LF8H 4LF9H 4AR0A 1IBLH 4DR3H 2Z0SA 1F0XA 3OSSD 4DV2H 4DR7H 1N36H 5LMUH 2JEAI 4JI3H 4FJUA 2UUCH 4LF6H 4E9JA 2W78A 4LF7H 2CTMA 2O5PA 5FLXW 1HNZH 2JE6I 4JVYA 4JI0H 3EZJA 2M6QA 4WALA 3AEVB 4GKKH 3FAUA 4JI2H 4B8TA 1AN7A 4DR1H 1HR0H 4OX9H 1V8CA 1EC6A 2D1UA 2M8WA 2ZM6H 4AQYH 2CWFA 1TUAA 3J7AK 1ZZIA 3U1KA 1DTJA 3NCVA 2A02A 4KHPH 2CTJA 2YQRA 4YHHH 3SB1A 3GR5A 2ANNA 4G08A 1J5EH 4DR2H 4JI1H 4MTKA 3OETA 2UXBH 2PT7G
chains in the Genus database with same CATH topology
4X62H 1X9ZA 4JI8H 2LF0A 1HNWH 3RF2A 1HNXH 3KDKA 4LFCH 4JV5H 1XNRH 2VQEH 4DUZH 3T1YH 2WZPR 1S03G 4NZTM 4EC5A 4DR4H 1ODHA 4DUYH 4DV3H 2UXDH 1N32H 1K28D 2UUAH 2W6UA 4DV1H 4DV4H 2M5JA 1IBMH 4DV6H 4B3TH 4JYAH 2X531 1IBKH 2IAHA 3GS9A 4GKJH 4LF4H 1FJGH 2HHHH 2UUBH 2E5LH 2D9IA 4JI7H 5LMNH 2Y3MA 2ZQEA 3OV5A 2W77A 2UXCH 5IWAH 2W16A 1XNQH 2VQFH 4OCHA 2W6TA 2FPHX 4JI4H 4JTMA 2L4WA 4LF5H 3ADYA 1I6UA 4X66H 2O4CA 3QD7X 3J81W 5A2QW 4LFAH 4YY3H 4K0KH 2W76A 1SEIA 1I94H 4NXMH 1XMQH 3GABA 4JI6H 4OD6A 3OETA 4M0HA 1N34H 4NXNH 4B8CD 4DV5H 4B3RH 5IT9W 1FKAH 3T1HH 2W75A 1XMOH 1ZZVA 4LFBH 5BR8H 4DV0H 5LL6b 3KDGA 4B3MH 3JAMW 4DV7H 2UU9H 4JI5H 4NZRM 5DT9A 1WTHD 4DR6H 4X65H 2VKCA 4B3SH 2Z6BD 4X64H 4DR5H 2F4VH 1N33H 4M0NA 4PDBA 3OTOH 4AR0A 4LF8H 4LF9H 1IBLH 4DR3H 3OSSD 1F0XA 4DV2H 4DR7H 1N36H 5LMUH 4JI3H 2UUCH 4LF6H 4E9JA 2W78A 4LF7H 2O5PA 5FLXW 1HNZH 4JI0H 3EZJA 4GKKH 3FAUA 4JI2H 4DR1H 1AN7A 1HR0H 4OX9H 2D1UA 2ZM6H 4AQYH 3J7AK 3NCVA 2A02A 4KHPH 4YHHH 3SB1A 3GR5A 4G08A 1J5EH 4DR2H 4JI1H 3J80W 2UXBH 2PT7G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W75 A;  2Y3M A;  4E9J A;  2W78 A;  2W77 A;  1ZZV A;  2W16 A;  4EC5 A;  2O5P A;  2W6T A;  3EZJ A;  4JTM A;  2D1U A;  2W6U A;  2M5J A;  2A02 A;  2IAH A;  2W76 A;  3GR5 A;  4M0N A;  4G08 A;  4AR0 A;  4M0H A;  3OSS D; 
#chains in the Genus database with same CATH topology
 2JZX A;  4X62 H;  1VBI A;  1X9Z A;  2LF0 A;  4JI8 H;  1HNW H;  3RF2 A;  1HNX H;  1Z2I A;  3KDK A;  4LFC H;  4JV5 H;  1XNR H;  1WE8 A;  2FFM A;  3V69 A;  2VQE H;  4DUZ H;  3T1Y H;  1S03 G;  1ZZJ A;  2WZP R;  4NZT M;  4EC5 A;  2AXY A;  1ODH A;  4DR4 H;  4DUY H;  1NXU A;  4DV3 H;  2CPM A;  2UXD H;  1N32 H;  1K28 D;  2UUA H;  2HH3 A;  2W6U A;  2G8Y A;  4DV1 H;  3L7Z C;  3UOE A;  4DV4 H;  1IBM H;  4DV6 H;  4B3T H;  2JVZ A;  5JEA G;  2BA0 A;  2M5J A;  4JYA H;  1WRU A;  2X53 1;  5K36 G;  1IBK H;  2IAH A;  3GS9 A;  1V9N A;  4GKJ H;  1VIH A;  4LF4 H;  4IFD G;  1FJG H;  2HHH H;  2OPU A;  2UUB H;  2E5L H;  2CTE A;  2LTL A;  2D9I A;  4JI7 H;  4UHV A;  5LMN H;  2P5Z X;  1PQX A;  2Y3M A;  2ZQE A;  2ANR A;  2UXC H;  1X0A A;  5IWA H;  1ZZV A;  3OV5 A;  2W77 A;  2W16 A;  1XNQ H;  3VKE A;  1WTJ A;  2CTK A;  2VQF H;  4OCH A;  2W6T A;  1VIG A;  2FPH X;  4JI4 H;  1ZZK A;  4JTM A;  2L4W A;  2CTF A;  4AM3 A;  1WVN A;  1MSZ A;  2PY9 A;  4LF5 H;  3ADY A;  2LRR A;  4BA2 I;  1I6U A;  4WAN A;  4LIJ A;  2O4C A;  2X06 A;  3QD7 X;  4X66 H;  3J81 W;  2HH2 A;  5A2Q W;  1X4M A;  4LFA H;  4YY3 H;  5C0X G;  2BL5 A;  4K0K H;  1SEI A;  1I94 H;  3D37 A;  2W76 A;  1WHR A;  3J80 W;  2NN6 G;  1XRH A;  2JEB I;  3GKU A;  3GAB A;  1XMQ H;  4JI6 H;  4OD6 A;  4NXM H;  1UG8 A;  4M0H A;  1N34 H;  4NXN H;  4B8C D;  4DV5 H;  2A1S A;  4B3R H;  5IT9 W;  1FKA H;  1K1G A;  1J4W A;  3T1H H;  2P2R A;  2W75 A;  1XMO H;  2K1H A;  2QND A;  1J5K A;  1ZTG A;  4H8A A;  4NBQ A;  5BR8 H;  2LTM A;  1X4N A;  5LL6 b;  3KDG A;  4DV0 H;  4B3M H;  2OPV A;  3JAM W;  4DV7 H;  4QMF B;  2UU9 H;  2CTL A;  4BA1 I;  4JI5 H;  2JA9 A;  2MJH A;  4NZR M;  5DT9 A;  4OO1 G;  1WTH D;  4AIM A;  2E3U A;  4DR6 H;  4X65 H;  2CWH A;  2VKC A;  4B3S H;  2Z6B D;  1KHM A;  4X64 H;  3CDD A;  1S20 A;  4DR5 H;  2F4V H;  2DGR A;  3I0P A;  4LFB H;  1DT4 A;  1N33 H;  4FJS A;  2CPQ A;  4M0N A;  2FMR A;  4JVH A;  4PDB A;  3OTO H;  2PQU A;  4LF8 H;  4LF9 H;  4AR0 A;  1IBL H;  4DR3 H;  2Z0S A;  1F0X A;  3OSS D;  4DV2 H;  4DR7 H;  1N36 H;  5LMU H;  2JEA I;  4JI3 H;  4FJU A;  2UUC H;  4LF6 H;  4E9J A;  2W78 A;  4LF7 H;  2CTM A;  2O5P A;  5FLX W;  1HNZ H;  2JE6 I;  4JVY A;  4JI0 H;  3EZJ A;  2M6Q A;  4WAL A;  3AEV B;  4GKK H;  3FAU A;  4JI2 H;  4B8T A;  1AN7 A;  4DR1 H;  1HR0 H;  4OX9 H;  1V8C A;  1EC6 A;  2D1U A;  2M8W A;  2ZM6 H;  4AQY H;  2CWF A;  1TUA A;  3J7A K;  1ZZI A;  3U1K A;  1DTJ A;  3NCV A;  2A02 A;  4KHP H;  2CTJ A;  2YQR A;  4YHH H;  3SB1 A;  3GR5 A;  2ANN A;  4G08 A;  1J5E H;  4DR2 H;  4JI1 H;  4MTK A;  3OET A;  2UXB H;  2PT7 G; 
#chains in the Genus database with same CATH homology
 4X62 H;  1X9Z A;  4JI8 H;  2LF0 A;  1HNW H;  3RF2 A;  1HNX H;  3KDK A;  4LFC H;  4JV5 H;  1XNR H;  2VQE H;  4DUZ H;  3T1Y H;  2WZP R;  1S03 G;  4NZT M;  4EC5 A;  4DR4 H;  1ODH A;  4DUY H;  4DV3 H;  2UXD H;  1N32 H;  1K28 D;  2UUA H;  2W6U A;  4DV1 H;  4DV4 H;  2M5J A;  1IBM H;  4DV6 H;  4B3T H;  4JYA H;  2X53 1;  1IBK H;  2IAH A;  3GS9 A;  4GKJ H;  4LF4 H;  1FJG H;  2HHH H;  2UUB H;  2E5L H;  2D9I A;  4JI7 H;  5LMN H;  2Y3M A;  2ZQE A;  3OV5 A;  2W77 A;  2UXC H;  5IWA H;  2W16 A;  1XNQ H;  2VQF H;  4OCH A;  2W6T A;  2FPH X;  4JI4 H;  4JTM A;  2L4W A;  4LF5 H;  3ADY A;  1I6U A;  4X66 H;  2O4C A;  3QD7 X;  3J81 W;  5A2Q W;  4LFA H;  4YY3 H;  4K0K H;  2W76 A;  1SEI A;  1I94 H;  4NXM H;  1XMQ H;  3GAB A;  4JI6 H;  4OD6 A;  3OET A;  4M0H A;  1N34 H;  4NXN H;  4B8C D;  4DV5 H;  4B3R H;  5IT9 W;  1FKA H;  3T1H H;  2W75 A;  1XMO H;  1ZZV A;  4LFB H;  5BR8 H;  4DV0 H;  5LL6 b;  3KDG A;  4B3M H;  3JAM W;  4DV7 H;  2UU9 H;  4JI5 H;  4NZR M;  5DT9 A;  1WTH D;  4DR6 H;  4X65 H;  2VKC A;  4B3S H;  2Z6B D;  4X64 H;  4DR5 H;  2F4V H;  1N33 H;  4M0N A;  4PDB A;  3OTO H;  4AR0 A;  4LF8 H;  4LF9 H;  1IBL H;  4DR3 H;  3OSS D;  1F0X A;  4DV2 H;  4DR7 H;  1N36 H;  5LMU H;  4JI3 H;  2UUC H;  4LF6 H;  4E9J A;  2W78 A;  4LF7 H;  2O5P A;  5FLX W;  1HNZ H;  4JI0 H;  3EZJ A;  4GKK H;  3FAU A;  4JI2 H;  4DR1 H;  1AN7 A;  1HR0 H;  4OX9 H;  2D1U A;  2ZM6 H;  4AQY H;  3J7A K;  3NCV A;  2A02 A;  4KHP H;  4YHH H;  3SB1 A;  3GR5 A;  4G08 A;  1J5E H;  4DR2 H;  4JI1 H;  3J80 W;  2UXB H;  2PT7 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...