3GR5A

Periplasmic domain of the outer membrane secretin escc from enteropathogenic e.coli (epec)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
153
structure length
153
Chain Sequence
MSSLEKRLGKNEYFIITKSSPVRAILNDFAANYSIPVFISSSVNDDFSGEIKNEKPVKVLEKLSKLYHLTWYYDENILYIYKTNEISRSIITPTYLDIDSLLKYLSDTISVNKNSCNVRKITTFNSIEVRGVPECIKYITSLSESLDKEAQSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EscC
publication title A conserved structural motif mediates formation of the periplasmic rings in the type III secretion system.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 39
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2009-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.120 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 3gr5A02
3.55.50.30 Alpha Beta 3-Layer(bab) Sandwich Phage tail protein beta-alpha-beta fold Phage tail protein beta-alpha-beta fold 3gr5A01
2M5JA 2Y3MA 2W77A 4JTMA 1ZZVA 2W76A 2W78A 2IAHA 2D1UA 3GR5A 2W6UA 4M0NA 2W16A 4E9JA 4G08A 3OSSD 2W6TA 2A02A 2O5PA 2W75A 4EC5A 3EZJA 4AR0A 4M0HA
chains in the Genus database with same CATH superfamily
2CWFA 4DR6H 3U1KA 4FJUA 4WANA 4AM3A 4JTMA 1N33H 1TUAA 4LF7H 1VBIA 2W77A 1IBLH 4JVYA 3D37A 2W76A 4NXNH 2D1UA 2IAHA 2O4CA 2FPHX 4YY3H 2W6UA 1FKAH 4JVHA 2ZQEA 4DV3H 4OO1G 4DV7H 4X62H 4OX9H 1WHRA 5IWAH 2LF0A 4LF8H 1ZTGA 3NCVA 4X65H 2A1SA 1HNWH 2JZXA 3L7ZC 2UXDH 4E9JA 4NZRM 1X0AA 1DTJA 1Z2IA 2VQFH 4DR2H 4DR4H 4JV5H 2AXYA 3KDGA 1X9ZA 2DGRA 2P2RA 2UXCH 2CTLA 2CTKA 4OCHA 2JEAI 2W75A 2UU9H 3GKUA 1IBMH 2JA9A 2WZPR 4M0HA 4LIJA 4JI5H 2LTLA 2FMRA 3V69A 5LL6b 2VKCA 4GKJH 3ADYA 1N34H 2W78A 4X64H 2ANNA 3I0PA 1J5KA 2K1HA 2ANRA 4JI7H 2M8WA 2CWHA 1HR0H 2YQRA 3J81W 2G8YA 4DV6H 4JYAH 4DV5H 4K0KH 1DT4A 2CPMA 4WALA 3VKEA 3OSSD 4LF4H 1AN7A 3OTOH 1N36H 1N32H 4MTKA 1XNQH 2P5ZX 1UG8A 1J5EH 2O5PA 4DV2H 5DT9A 3T1YH 4EC5A 4H8AA 1SEIA 2BA0A 4NZTM 4AR0A 1XMOH 4BA1I 3J7AK 5BR8H 4JI4H 3JAMW 4DR7H 4DV1H 2FFMA 3J80W 1ZZJA 2M5JA 2OPVA 3UOEA 5FLXW 1VIGA 2OPUA 2Y3MA 3T1HH 1XNRH 4DUYH 4JI0H 1V9NA 4JI2H 2VQEH 4B3MH 1ZZIA 1WVNA 1V8CA 1NXUA 1XMQH 4LFCH 2D9IA 3GABA 4DR3H 2W16A 2Z6BD 5A2QW 4AQYH 3QD7X 5K36G 4IFDG 4UHVA 1ODHA 2MJHA 4G08A 2JVZA 4LFBH 2W6TA 4X66H 5LMUH 4DR5H 1FJGH 2CTMA 2PT7G 4GKKH 1WTJA 4B8CD 4YHHH 2LRRA 1S03G 2A02A 2HH2A 1IBKH 2E5LH 4LF5H 2UUCH 4QMFB 2UUAH 4JI8H 2LTMA 3GS9A 4B8TA 1VIHA 2E3UA 4FJSA 1I94H 4JI3H 2UXBH 1K1GA 4B3SH 1WTHD 2PQUA 2PY9A 2UUBH 1ZZKA 2JE6I 3FAUA 2CPQA 5C0XG 4DV4H 1ZZVA 4LFAH 1KHMA 2Z0SA 4DR1H 4NXMH 3GR5A 2NN6G 4NBQA 1HNZH 3KDKA 2CTJA 2M6QA 4OD6A 4M0NA 4LF6H 5JEAG 4DUZH 2JEBI 3SB1A 4AIMA 4DV0H 2ZM6H 2CTFA 2X06A 1HNXH 1PQXA 5LMNH 3OV5A 1K28D 2QNDA 2HHHH 4B3TH 4JI6H 2BL5A 4B3RH 1XRHA 2HH3A 2F4VH 3OETA 1WE8A 3RF2A 4PDBA 4KHPH 1EC6A 1I6UA 4LF9H 5IT9W 1WRUA 3CDDA 2X531 3EZJA 4JI1H 1J4WA 4BA2I 2CTEA 1S20A 1X4MA 3AEVB 1F0XA 2L4WA 1X4NA 1MSZA
chains in the Genus database with same CATH topology
4DR6H 2W77A 4JTMA 1N33H 4LF7H 1IBLH 2W76A 4NXNH 2D1UA 2IAHA 2O4CA 2FPHX 4YY3H 2W6UA 1FKAH 2ZQEA 4DV3H 4DV7H 4X62H 4OX9H 5IWAH 2LF0A 4LF8H 3NCVA 4X65H 1HNWH 2UXDH 4E9JA 4NZRM 4DR2H 2VQFH 4JV5H 4DR4H 3KDGA 1X9ZA 2UXCH 4OCHA 2W75A 2UU9H 1IBMH 2WZPR 4M0HA 4JI5H 5LL6b 4GKJH 2VKCA 3ADYA 1N34H 2W78A 4X64H 4JI7H 1HR0H 3J81W 4DV6H 4JYAH 4DV5H 4K0KH 3OSSD 4LF4H 1AN7A 3OTOH 1N36H 1N32H 1XNQH 1J5EH 2O5PA 4DV2H 5DT9A 3T1YH 4EC5A 1SEIA 4NZTM 4AR0A 1XMOH 3J7AK 5BR8H 4JI4H 3JAMW 4DR7H 4DV1H 3J80W 2M5JA 5FLXW 2Y3MA 1XNRH 4DUYH 4JI0H 4JI2H 2VQEH 4B3MH 1XMQH 4LFCH 2D9IA 3GABA 4DR3H 2W16A 2Z6BD 5A2QW 4AQYH 3QD7X 1ODHA 4G08A 4LFBH 2W6TA 4X66H 5LMUH 4DR5H 1FJGH 4GKKH 2PT7G 4YHHH 4B8CD 1S03G 2A02A 2E5LH 1IBKH 4LF5H 2UUCH 2UUAH 4JI8H 3GS9A 1I94H 4JI3H 2UXBH 1WTHD 4B3SH 2UUBH 4DV4H 3FAUA 1ZZVA 4LFAH 4DR1H 4NXMH 3GR5A 1HNZH 3KDKA 4OD6A 4M0NA 4LF6H 4DV0H 4DUZH 3SB1A 2ZM6H 1HNXH 5LMNH 3OV5A 1K28D 2HHHH 4B3TH 4JI6H 4B3RH 2F4VH 3OETA 4PDBA 3RF2A 4KHPH 1I6UA 4LF9H 5IT9W 2X531 3EZJA 4JI1H 2L4WA 1F0XA 3T1HH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M5J A;  2Y3M A;  2W77 A;  4JTM A;  1ZZV A;  2W76 A;  2W78 A;  2IAH A;  2D1U A;  3GR5 A;  2W6U A;  4M0N A;  2W16 A;  4E9J A;  4G08 A;  3OSS D;  2W6T A;  2A02 A;  2O5P A;  2W75 A;  4EC5 A;  3EZJ A;  4AR0 A;  4M0H A; 
#chains in the Genus database with same CATH topology
 2CWF A;  4DR6 H;  3U1K A;  4FJU A;  4WAN A;  4AM3 A;  4JTM A;  1N33 H;  1TUA A;  4LF7 H;  1VBI A;  2W77 A;  1IBL H;  4JVY A;  3D37 A;  2W76 A;  4NXN H;  2D1U A;  2IAH A;  2O4C A;  2FPH X;  4YY3 H;  2W6U A;  1FKA H;  4JVH A;  2ZQE A;  4DV3 H;  4OO1 G;  4DV7 H;  4X62 H;  4OX9 H;  1WHR A;  5IWA H;  2LF0 A;  4LF8 H;  1ZTG A;  3NCV A;  4X65 H;  2A1S A;  1HNW H;  2JZX A;  3L7Z C;  2UXD H;  4E9J A;  4NZR M;  1X0A A;  1DTJ A;  1Z2I A;  2VQF H;  4DR2 H;  4DR4 H;  4JV5 H;  2AXY A;  3KDG A;  1X9Z A;  2DGR A;  2P2R A;  2UXC H;  2CTL A;  2CTK A;  4OCH A;  2JEA I;  2W75 A;  2UU9 H;  3GKU A;  1IBM H;  2JA9 A;  2WZP R;  4M0H A;  4LIJ A;  4JI5 H;  2LTL A;  2FMR A;  3V69 A;  5LL6 b;  2VKC A;  4GKJ H;  3ADY A;  1N34 H;  2W78 A;  4X64 H;  2ANN A;  3I0P A;  1J5K A;  2K1H A;  2ANR A;  4JI7 H;  2M8W A;  2CWH A;  1HR0 H;  2YQR A;  3J81 W;  2G8Y A;  4DV6 H;  4JYA H;  4DV5 H;  4K0K H;  1DT4 A;  2CPM A;  4WAL A;  3VKE A;  3OSS D;  4LF4 H;  1AN7 A;  3OTO H;  1N36 H;  1N32 H;  4MTK A;  1XNQ H;  2P5Z X;  1UG8 A;  1J5E H;  2O5P A;  4DV2 H;  5DT9 A;  3T1Y H;  4EC5 A;  4H8A A;  1SEI A;  2BA0 A;  4NZT M;  4AR0 A;  1XMO H;  4BA1 I;  3J7A K;  5BR8 H;  4JI4 H;  3JAM W;  4DR7 H;  4DV1 H;  2FFM A;  3J80 W;  1ZZJ A;  2M5J A;  2OPV A;  3UOE A;  5FLX W;  1VIG A;  2OPU A;  2Y3M A;  3T1H H;  1XNR H;  4DUY H;  4JI0 H;  1V9N A;  4JI2 H;  2VQE H;  4B3M H;  1ZZI A;  1WVN A;  1V8C A;  1NXU A;  1XMQ H;  4LFC H;  2D9I A;  3GAB A;  4DR3 H;  2W16 A;  2Z6B D;  5A2Q W;  4AQY H;  3QD7 X;  5K36 G;  4IFD G;  4UHV A;  1ODH A;  2MJH A;  4G08 A;  2JVZ A;  4LFB H;  2W6T A;  4X66 H;  5LMU H;  4DR5 H;  1FJG H;  2CTM A;  2PT7 G;  4GKK H;  1WTJ A;  4B8C D;  4YHH H;  2LRR A;  1S03 G;  2A02 A;  2HH2 A;  1IBK H;  2E5L H;  4LF5 H;  2UUC H;  4QMF B;  2UUA H;  4JI8 H;  2LTM A;  3GS9 A;  4B8T A;  1VIH A;  2E3U A;  4FJS A;  1I94 H;  4JI3 H;  2UXB H;  1K1G A;  4B3S H;  1WTH D;  2PQU A;  2PY9 A;  2UUB H;  1ZZK A;  2JE6 I;  3FAU A;  2CPQ A;  5C0X G;  4DV4 H;  1ZZV A;  4LFA H;  1KHM A;  2Z0S A;  4DR1 H;  4NXM H;  3GR5 A;  2NN6 G;  4NBQ A;  1HNZ H;  3KDK A;  2CTJ A;  2M6Q A;  4OD6 A;  4M0N A;  4LF6 H;  5JEA G;  4DUZ H;  2JEB I;  3SB1 A;  4AIM A;  4DV0 H;  2ZM6 H;  2CTF A;  2X06 A;  1HNX H;  1PQX A;  5LMN H;  3OV5 A;  1K28 D;  2QND A;  2HHH H;  4B3T H;  4JI6 H;  2BL5 A;  4B3R H;  1XRH A;  2HH3 A;  2F4V H;  3OET A;  1WE8 A;  3RF2 A;  4PDB A;  4KHP H;  1EC6 A;  1I6U A;  4LF9 H;  5IT9 W;  1WRU A;  3CDD A;  2X53 1;  3EZJ A;  4JI1 H;  1J4W A;  4BA2 I;  2CTE A;  1S20 A;  1X4M A;  3AEV B;  1F0X A;  2L4W A;  1X4N A;  1MSZ A; 
#chains in the Genus database with same CATH homology
 4DR6 H;  2W77 A;  4JTM A;  1N33 H;  4LF7 H;  1IBL H;  2W76 A;  4NXN H;  2D1U A;  2IAH A;  2O4C A;  2FPH X;  4YY3 H;  2W6U A;  1FKA H;  2ZQE A;  4DV3 H;  4DV7 H;  4X62 H;  4OX9 H;  5IWA H;  2LF0 A;  4LF8 H;  3NCV A;  4X65 H;  1HNW H;  2UXD H;  4E9J A;  4NZR M;  4DR2 H;  2VQF H;  4JV5 H;  4DR4 H;  3KDG A;  1X9Z A;  2UXC H;  4OCH A;  2W75 A;  2UU9 H;  1IBM H;  2WZP R;  4M0H A;  4JI5 H;  5LL6 b;  4GKJ H;  2VKC A;  3ADY A;  1N34 H;  2W78 A;  4X64 H;  4JI7 H;  1HR0 H;  3J81 W;  4DV6 H;  4JYA H;  4DV5 H;  4K0K H;  3OSS D;  4LF4 H;  1AN7 A;  3OTO H;  1N36 H;  1N32 H;  1XNQ H;  1J5E H;  2O5P A;  4DV2 H;  5DT9 A;  3T1Y H;  4EC5 A;  1SEI A;  4NZT M;  4AR0 A;  1XMO H;  3J7A K;  5BR8 H;  4JI4 H;  3JAM W;  4DR7 H;  4DV1 H;  3J80 W;  2M5J A;  5FLX W;  2Y3M A;  1XNR H;  4DUY H;  4JI0 H;  4JI2 H;  2VQE H;  4B3M H;  1XMQ H;  4LFC H;  2D9I A;  3GAB A;  4DR3 H;  2W16 A;  2Z6B D;  5A2Q W;  4AQY H;  3QD7 X;  1ODH A;  4G08 A;  4LFB H;  2W6T A;  4X66 H;  5LMU H;  4DR5 H;  1FJG H;  4GKK H;  2PT7 G;  4YHH H;  4B8C D;  1S03 G;  2A02 A;  2E5L H;  1IBK H;  4LF5 H;  2UUC H;  2UUA H;  4JI8 H;  3GS9 A;  1I94 H;  4JI3 H;  2UXB H;  1WTH D;  4B3S H;  2UUB H;  4DV4 H;  3FAU A;  1ZZV A;  4LFA H;  4DR1 H;  4NXM H;  3GR5 A;  1HNZ H;  3KDK A;  4OD6 A;  4M0N A;  4LF6 H;  4DV0 H;  4DUZ H;  3SB1 A;  2ZM6 H;  1HNX H;  5LMN H;  3OV5 A;  1K28 D;  2HHH H;  4B3T H;  4JI6 H;  4B3R H;  2F4V H;  3OET A;  4PDB A;  3RF2 A;  4KHP H;  1I6U A;  4LF9 H;  5IT9 W;  2X53 1;  3EZJ A;  4JI1 H;  2L4W A;  1F0X A;  3T1H H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...