3GR5A

Periplasmic domain of the outer membrane secretin escc from enteropathogenic e.coli (epec)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
153
structure length
153
Chain Sequence
MSSLEKRLGKNEYFIITKSSPVRAILNDFAANYSIPVFISSSVNDDFSGEIKNEKPVKVLEKLSKLYHLTWYYDENILYIYKTNEISRSIITPTYLDIDSLLKYLSDTISVNKNSCNVRKITTFNSIEVRGVPECIKYITSLSESLDKEAQSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A conserved structural motif mediates formation of the periplasmic rings in the type III secretion system.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords EscC
total genus 39
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2009-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.120 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 3gr5A02
3.55.50.30 Alpha Beta 3-Layer(bab) Sandwich Phage tail protein beta-alpha-beta fold Phage tail protein beta-alpha-beta fold 3gr5A01
2IAHA 2W76A 2A02A 2M5JA 3OSSD 4JTMA 3EZJA 2W78A 4E9JA 2D1UA 2O5PA 2W75A 4M0HA 2W6UA 3GR5A 4EC5A 4G08A 4M0NA 2W6TA 2W77A 2Y3MA 2W16A 4AR0A 1ZZVA
chains in the Genus database with same CATH superfamily
2BL5A 2IAHA 2AXYA 2JZXA 1IBKH 4LF8H 2ANNA 4DV7H 5LMUH 2W76A 1X4NA 1HNWH 4AIMA 1NXUA 1AN7A 3V69A 4B3RH 4X62H 4DR2H 2CTEA 3SB1A 1ZTGA 4YHHH 4AM3A 2Z6BD 4WANA 4JVYA 5BR8H 2P5ZX 4DV3H 4UHVA 5JEAG 4DUYH 2P2RA 1DT4A 4JI1H 4DV2H 4WALA 2LF0A 4GKJH 1N36H 2MJHA 4B8TA 1FJGH 1K28D 4EC5A 2LTLA 2UUBH 2VQEH 3I0PA 3OETA 1N33H 2QNDA 2ZQEA 4IFDG 2OPVA 2LTMA 2PT7G 2M8WA 2Y3MA 4X64H 1FKAH 1V9NA 1XNQH 2D9IA 2CWFA 2E3UA 4LIJA 5C0XG 1HNZH 1XRHA 2UXDH 4DV0H 3VKEA 2F4VH 1UG8A 5LMNH 1DTJA 4B3SH 3GABA 2JVZA 1J5EH 2M5JA 4K0KH 3OSSD 2VQFH 3KDGA 4AQYH 2PY9A 1Z2IA 1ODHA 1F0XA 4FJSA 2UXCH 4FJUA 2JA9A 1X4MA 4DR1H 2D1UA 2O5PA 3CDDA 4M0HA 2CTKA 2W16A 4JI4H 2ANRA 3T1HH 1J5KA 3J7AK 4PDBA 1IBLH 4JI5H 4LF7H 2WZPR 3L7ZC 1I6UA 2A1SA 1ZZIA 1VIHA 2W6UA 4BA2I 5DT9A 3FAUA 4NZTM 3ADYA 1X9ZA 4DR5H 2W6TA 2CPQA 2E5LH 4JI0H 4LF9H 2CTMA 2FMRA 1TUAA 1IBMH 1S03G 4JVHA 4OD6A 4OCHA 4LF4H 4JI6H 4B8CD 2A02A 4DV4H 2W78A 5LL6b 1WVNA 3UOEA 4LF5H 3OV5A 4JTMA 4NXMH 2NN6G 4X65H 2UU9H 4E9JA 3RF2A 2CTLA 2CPMA 2G8YA 5IWAH 1HNXH 4LFBH 1ZZKA 4GKKH 2L4WA 2HH3A 3J80W 1XMQH 1HR0H 4YY3H 4DR3H 4JI8H 4OX9H 2DGRA 2CTFA 1SEIA 4NXNH 4DV1H 1WHRA 3GR5A 1WTHD 4H8AA 4DR4H 1XNRH 5K36G 1VBIA 1VIGA 3OTOH 4B3TH 4JI2H 3GKUA 2UXBH 2W77A 1KHMA 1K1GA 4AR0A 1PQXA 4JYAH 4LFCH 4DV5H 3QD7X 1MSZA 2YQRA 2CTJA 4BA1I 4QMFB 4JI3H 3AEVB 1EC6A 2LRRA 4JI7H 2Z0SA 2JE6I 3T1YH 2HHHH 3U1KA 4DR6H 3EZJA 4NBQA 4B3MH 2FFMA 2W75A 4MTKA 2CWHA 2M6QA 2BA0A 2O4CA 3JAMW 2UUCH 1WRUA 2X531 1V8CA 1N32H 4NZRM 2PQUA 4LFAH 2JEBI 1X0AA 5A2QW 1J4WA 4JV5H 1WE8A 2X06A 1S20A 2HH2A 2UUAH 2FPHX 2JEAI 4KHPH 5IT9W 3D37A 4G08A 2VKCA 1XMOH 2OPUA 4X66H 3NCVA 2K1HA 1ZZJA 1N34H 4DR7H 3GS9A 4M0NA 4LF6H 4DV6H 3KDKA 5FLXW 3J81W 1WTJA 2ZM6H 1I94H 4DUZH 1ZZVA 4OO1G
chains in the Genus database with same CATH topology
2IAHA 2W76A 1IBKH 4LF8H 4DV7H 5LMUH 1HNWH 1AN7A 4B3RH 4X62H 4DR2H 3SB1A 2Z6BD 4YHHH 5BR8H 4DV3H 4DUYH 4JI1H 4DV2H 2LF0A 4GKJH 1N36H 1FJGH 1K28D 4EC5A 2UUBH 2VQEH 3OETA 1N33H 2ZQEA 2PT7G 2Y3MA 4X64H 1FKAH 1XNQH 2W16A 2D9IA 1HNZH 2UXDH 4DV0H 2F4VH 5LMNH 4B3SH 3GABA 1J5EH 2M5JA 4K0KH 3OSSD 2VQFH 3KDGA 4AQYH 1ODHA 1F0XA 2UXCH 4DR1H 2D1UA 2O5PA 4M0HA 4JI4H 3T1HH 3J7AK 4PDBA 1IBLH 4JI5H 4LF7H 2WZPR 1I6UA 2W6UA 5DT9A 3FAUA 4NZTM 3ADYA 1X9ZA 4DR5H 2W6TA 2E5LH 4LF9H 4JI0H 1IBMH 1S03G 4OD6A 4OCHA 4LF4H 4JI6H 4B8CD 2A02A 4DV4H 5LL6b 4LF5H 3OV5A 4JTMA 4NXMH 4X65H 2UU9H 4E9JA 3RF2A 4LFBH 5IWAH 2L4WA 1HNXH 2W78A 4GKKH 3J80W 1XMQH 1HR0H 4YY3H 4DR3H 4JI8H 4OX9H 4NXNH 1SEIA 4DV1H 3GR5A 1WTHD 4DR4H 1XNRH 3OTOH 4B3TH 4JI2H 2UXBH 2W77A 4AR0A 4JYAH 4LFCH 4DV5H 3QD7X 4JI3H 4JI7H 3T1YH 2HHHH 4DR6H 3EZJA 4B3MH 2W75A 2O4CA 3JAMW 2UUCH 2X531 1N32H 4NZRM 4LFAH 5A2QW 4JV5H 2UUAH 5IT9W 2FPHX 4KHPH 4G08A 2VKCA 1XMOH 4X66H 3GS9A 3NCVA 1N34H 4DR7H 4M0NA 4LF6H 4DV6H 3KDKA 5FLXW 3J81W 2ZM6H 1I94H 4DUZH 1ZZVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IAH A;  2W76 A;  2A02 A;  2M5J A;  3OSS D;  4JTM A;  3EZJ A;  2W78 A;  4E9J A;  2D1U A;  2O5P A;  2W75 A;  4M0H A;  2W6U A;  3GR5 A;  4EC5 A;  4G08 A;  4M0N A;  2W6T A;  2W77 A;  2Y3M A;  2W16 A;  4AR0 A;  1ZZV A; 
#chains in the Genus database with same CATH topology
 2BL5 A;  2IAH A;  2AXY A;  2JZX A;  1IBK H;  4LF8 H;  2ANN A;  4DV7 H;  5LMU H;  2W76 A;  1X4N A;  1HNW H;  4AIM A;  1NXU A;  1AN7 A;  3V69 A;  4B3R H;  4X62 H;  4DR2 H;  2CTE A;  3SB1 A;  1ZTG A;  4YHH H;  4AM3 A;  2Z6B D;  4WAN A;  4JVY A;  5BR8 H;  2P5Z X;  4DV3 H;  4UHV A;  5JEA G;  4DUY H;  2P2R A;  1DT4 A;  4JI1 H;  4DV2 H;  4WAL A;  2LF0 A;  4GKJ H;  1N36 H;  2MJH A;  4B8T A;  1FJG H;  1K28 D;  4EC5 A;  2LTL A;  2UUB H;  2VQE H;  3I0P A;  3OET A;  1N33 H;  2QND A;  2ZQE A;  4IFD G;  2OPV A;  2LTM A;  2PT7 G;  2M8W A;  2Y3M A;  4X64 H;  1FKA H;  1V9N A;  1XNQ H;  2D9I A;  2CWF A;  2E3U A;  4LIJ A;  5C0X G;  1HNZ H;  1XRH A;  2UXD H;  4DV0 H;  3VKE A;  2F4V H;  1UG8 A;  5LMN H;  1DTJ A;  4B3S H;  3GAB A;  2JVZ A;  1J5E H;  2M5J A;  4K0K H;  3OSS D;  2VQF H;  3KDG A;  4AQY H;  2PY9 A;  1Z2I A;  1ODH A;  1F0X A;  4FJS A;  2UXC H;  4FJU A;  2JA9 A;  1X4M A;  4DR1 H;  2D1U A;  2O5P A;  3CDD A;  4M0H A;  2CTK A;  2W16 A;  4JI4 H;  2ANR A;  3T1H H;  1J5K A;  3J7A K;  4PDB A;  1IBL H;  4JI5 H;  4LF7 H;  2WZP R;  3L7Z C;  1I6U A;  2A1S A;  1ZZI A;  1VIH A;  2W6U A;  4BA2 I;  5DT9 A;  3FAU A;  4NZT M;  3ADY A;  1X9Z A;  4DR5 H;  2W6T A;  2CPQ A;  2E5L H;  4JI0 H;  4LF9 H;  2CTM A;  2FMR A;  1TUA A;  1IBM H;  1S03 G;  4JVH A;  4OD6 A;  4OCH A;  4LF4 H;  4JI6 H;  4B8C D;  2A02 A;  4DV4 H;  2W78 A;  5LL6 b;  1WVN A;  3UOE A;  4LF5 H;  3OV5 A;  4JTM A;  4NXM H;  2NN6 G;  4X65 H;  2UU9 H;  4E9J A;  3RF2 A;  2CTL A;  2CPM A;  2G8Y A;  5IWA H;  1HNX H;  4LFB H;  1ZZK A;  4GKK H;  2L4W A;  2HH3 A;  3J80 W;  1XMQ H;  1HR0 H;  4YY3 H;  4DR3 H;  4JI8 H;  4OX9 H;  2DGR A;  2CTF A;  1SEI A;  4NXN H;  4DV1 H;  1WHR A;  3GR5 A;  1WTH D;  4H8A A;  4DR4 H;  1XNR H;  5K36 G;  1VBI A;  1VIG A;  3OTO H;  4B3T H;  4JI2 H;  3GKU A;  2UXB H;  2W77 A;  1KHM A;  1K1G A;  4AR0 A;  1PQX A;  4JYA H;  4LFC H;  4DV5 H;  3QD7 X;  1MSZ A;  2YQR A;  2CTJ A;  4BA1 I;  4QMF B;  4JI3 H;  3AEV B;  1EC6 A;  2LRR A;  4JI7 H;  2Z0S A;  2JE6 I;  3T1Y H;  2HHH H;  3U1K A;  4DR6 H;  3EZJ A;  4NBQ A;  4B3M H;  2FFM A;  2W75 A;  4MTK A;  2CWH A;  2M6Q A;  2BA0 A;  2O4C A;  3JAM W;  2UUC H;  1WRU A;  2X53 1;  1V8C A;  1N32 H;  4NZR M;  2PQU A;  4LFA H;  2JEB I;  1X0A A;  5A2Q W;  1J4W A;  4JV5 H;  1WE8 A;  2X06 A;  1S20 A;  2HH2 A;  2UUA H;  2FPH X;  2JEA I;  4KHP H;  5IT9 W;  3D37 A;  4G08 A;  2VKC A;  1XMO H;  2OPU A;  4X66 H;  3NCV A;  2K1H A;  1ZZJ A;  1N34 H;  4DR7 H;  3GS9 A;  4M0N A;  4LF6 H;  4DV6 H;  3KDK A;  5FLX W;  3J81 W;  1WTJ A;  2ZM6 H;  1I94 H;  4DUZ H;  1ZZV A;  4OO1 G; 
#chains in the Genus database with same CATH homology
 2IAH A;  2W76 A;  1IBK H;  4LF8 H;  4DV7 H;  5LMU H;  1HNW H;  1AN7 A;  4B3R H;  4X62 H;  4DR2 H;  3SB1 A;  2Z6B D;  4YHH H;  5BR8 H;  4DV3 H;  4DUY H;  4JI1 H;  4DV2 H;  2LF0 A;  4GKJ H;  1N36 H;  1FJG H;  1K28 D;  4EC5 A;  2UUB H;  2VQE H;  3OET A;  1N33 H;  2ZQE A;  2PT7 G;  2Y3M A;  4X64 H;  1FKA H;  1XNQ H;  2W16 A;  2D9I A;  1HNZ H;  2UXD H;  4DV0 H;  2F4V H;  5LMN H;  4B3S H;  3GAB A;  1J5E H;  2M5J A;  4K0K H;  3OSS D;  2VQF H;  3KDG A;  4AQY H;  1ODH A;  1F0X A;  2UXC H;  4DR1 H;  2D1U A;  2O5P A;  4M0H A;  4JI4 H;  3T1H H;  3J7A K;  4PDB A;  1IBL H;  4JI5 H;  4LF7 H;  2WZP R;  1I6U A;  2W6U A;  5DT9 A;  3FAU A;  4NZT M;  3ADY A;  1X9Z A;  4DR5 H;  2W6T A;  2E5L H;  4LF9 H;  4JI0 H;  1IBM H;  1S03 G;  4OD6 A;  4OCH A;  4LF4 H;  4JI6 H;  4B8C D;  2A02 A;  4DV4 H;  5LL6 b;  4LF5 H;  3OV5 A;  4JTM A;  4NXM H;  4X65 H;  2UU9 H;  4E9J A;  3RF2 A;  4LFB H;  5IWA H;  2L4W A;  1HNX H;  2W78 A;  4GKK H;  3J80 W;  1XMQ H;  1HR0 H;  4YY3 H;  4DR3 H;  4JI8 H;  4OX9 H;  4NXN H;  1SEI A;  4DV1 H;  3GR5 A;  1WTH D;  4DR4 H;  1XNR H;  3OTO H;  4B3T H;  4JI2 H;  2UXB H;  2W77 A;  4AR0 A;  4JYA H;  4LFC H;  4DV5 H;  3QD7 X;  4JI3 H;  4JI7 H;  3T1Y H;  2HHH H;  4DR6 H;  3EZJ A;  4B3M H;  2W75 A;  2O4C A;  3JAM W;  2UUC H;  2X53 1;  1N32 H;  4NZR M;  4LFA H;  5A2Q W;  4JV5 H;  2UUA H;  5IT9 W;  2FPH X;  4KHP H;  4G08 A;  2VKC A;  1XMO H;  4X66 H;  3GS9 A;  3NCV A;  1N34 H;  4DR7 H;  4M0N A;  4LF6 H;  4DV6 H;  3KDK A;  5FLX W;  3J81 W;  2ZM6 H;  1I94 H;  4DUZ H;  1ZZV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...