3GRGA

Crystal structure of the f87m/l110m mutant of human transthyretin at ph 7.5
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
116
structure length
116
Chain Sequence
b'CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPMHEHAEVVFTANDSGPRRYTIAAMLSPYSYSTTAVVTNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transthyretin
molecule tags Transport protein
source organism Homo sapiens
publication title Novel Zn2+-binding sites in human transthyretin: implications for amyloidogenesis and retinol-binding protein recognition.
pubmed doi rcsb
total genus 25
structure length 116
sequence length 116
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 3grgA00
2ROXA 1KGIA 2IGLA 3A4EA 3CN0A 3IMTA 3IWUA 4TQIA 3U2JA 1SN2A 3ESOA 3ESNA 3GS0A 1GKEA 3M1OA 2TRYA 4I89A 3OZLA 4IK7A 4MASA 1TYRA 1BZDA 1ETA1 1Y1DA 4TM9A 5EZPA 1BZ8A 3TCTA 5A6IA 3KGSA 3IMSA 1IJNA 1F41A 3P3TA 4IIZA 1DVYA 5CM1A 3DK0A 4IK6A 3P3RA 3GRBA 3CFQA 3W3BA 1SOKA 4TKWA 2G2PA 4TLTA 4PVLA 3SSGA 4MRCA 1DVTA 2GPZA 2H0EA 3OZKA 2ROYA 4Y9BA 4IKJA 4TL5A 1DVUA 4Q14A 3IPEA 1IIKA 4FI8A 4ABWA 4I87A 1OO2A 1TTBA 1SOQA 4QXVA 5E23A 1QABA 4DEWA 2QGDA 4WNJA 5DWPA 2FBRA 4YDNA 4DEUA 1TZ8A 3DJTA 5FW8A 4DESA 5CN3A 3I9IA 3GLZA 4HJTA 4MRBA 4I85A 4QRFA 4TQ8A 4WNSA 5DEJA 3DGDA 4IKLA 3FCBA 4PWKA 2QPFA 2QGEA 4PWEA 5CR1A 5JIDA 4N85A 4TLSA 1SN0A 4HJSA 2PABA 1TTCA 2B77A 3IPBA 5HJGA 5JIQA 5FO2A 3IMVA 4ABVA 2F7IA 1F86A 4TQPA 5FW7A 2G4GA 2H1XA 3KGUA 1TSHA 3CXFA 5CNHA 1SN5A 2H0JA 3GS7A 3IMUA 2B14A 3I9PA 4D7BA 3IMWA 4ACTA 1BZEA 1DVZA 3B56A 3D7PA 1ICTA 4IKIA 1ZCRA 1KGJA 2WQAA 2GABA 1ETB1 3D2TA 3IWVA 3Q1EA 5IHHA 4KY2A 5L4FA 1DVSA 3NEEA 4HJUA 5AKSA 3DIDA 3NEXA 2G2NA 1TLMA 4PMFA 4TQHA 1THAA 4Y9GA 4DERA 3HJ0A 4PWJA 5JIMA 4PWIA 1U21A 4TNGA 4TNEA 3CFNA 2H6UA 2FLMA 1GKOA 1E4HA 4Y9FA 2H4EA 2G9KA 3DJRA 5TTRA 5E4AA 4ANKA 4AC4A 5FW6A 5AKVA 5CLXA 5EN3A 3DK2A 3CN1A 4PVMA 5L4IA 2G4EA 3NG5A 3U2IA 4DETA 4ABUA 1QWHA 4PMEA 1Z7JA 4PWFA 3CN2A 3P3UA 4HISA 2G5UA 2H0FA 2QGBA 2B15A 3BSZA 1IE4A 2TRHA 4TL4A 5CLZA 1FH2A 5AL8A 3GRGA 4L1SA 3KGTA 4QYAA 1X7SA 1ZD6A 3GS4A 4YDMA 3I9AA 5AKTA 4HIQA 4WO0A 5K1JA 5L4MA 2G3XA 3QVAA 4TLUA 4TLKA 2B9AA 4AC2A 5AYTA 2QGCA 1G1OA 3CFMA 3GPSA 4N86A 4L1TA 2B16A 5CLYA 1E5AA 1FHNA 3CN4A 3DO4A 3P3SA 1TFPA 2NOYA 3CFTA 4PM1A 5L4JA 3ESPA 1DVQA 1TT6A 1BM7A 5AL0A 2QELA 3BT0A 3IMRA 4ABQA 1TTAA 3NESA 3NEOA 3TFBA 1RLBA 4IKKA 4FI7A 4N87A 4Y9CA 1DVXA 3FC8A 3DJSA 5K1NA 5E4OA 1THCA 1X7TA 2G3ZA 4PWHA 4Y9EA 3A4DA 4PWGA 3DJZA 3A4FA 3CBRA 1E3FA 4TNFA 1IIIA 1BMZA 4PVNA 3CN3A 2F8IA 5BOJA 1TTRA 4FI6A
chains in the Genus database with same CATH superfamily
3MLSH 4A37A 2VZOA 1KPUB 3EUUA 4TNWF 2GJPA 1J9QA 2R69A 3ILDA 3FU8A 1XEUA 4K73A 4BV1A 5EZPA 2ICCA 3P0YH 4HHAB 4DGVL 3DUUB 1EEQA 3KWWA 5D7SH 4OLUL 4X6CB 2KS0A 4JFFA 2YRPA 1FZJB 2XACC 1H6UA 4HXAL 4UV4H 4YFDB 4P2CG 1JHLL 3E7JA 4DUXA 5IMMA 1U8CB 1PDKB 1OO2A 2HLEB 3BDBA 1OB0A 1WG3A 4PREB 4ODUA 4Z3GA 5F7BA 2BHFA 3O3DB 2ZG3A 1FGVL 5ANME 5I24A 1L9RA 3UEZA 2MTPA 5D7LE 1LE9B 2V3EA 3NIGF 2VAJA 4XPBH 3DXAB 1WA0X 2R27A 2HTLC 1DQDH 1E4XH 1RERA 2CA4A 3MJ9A 4N85A 2QVMA 4Q6IB 5GSVA 3V0AC 3OXRA 3NGBC 4JFDA 3LD8C 3LAFA 1QX1A 1LO5A 3ZKMC 2DMCA 1MI5E 4N2FA 4Y5VB 4NXSA 5DWUL 4F20A 4RWYL 1MQKL 4OZGA 4ODVH 4K5NA 3T2PA 2P45B 2WSDA 4DKAA 1NBQA 3OHMB 3EOAB 5D7JD 5C3LD 3PWNA 1BXUA 1U3JA 5CINL 5TGBB 3SE6A 4MCYB 3MLYL 4EN3D 1DN0B 1QG3A 5HHXL 3VWJB 1QI5A 2ENYA 2HT3C 2RBLA 5FO8B 1TNMA 1G0DA 2F1EA 3PJLA 4Y4KB 1X5GA 3LTVA 2Y7QA 1IEAB 3VFWA 1CFNB 2NY1D 3L5HA 3V55A 3RX5A 2DQHH 5L88L 3U2IA 5DUPL 3STLB 4OSUH 3ILEA 3LRKA 3QDGD 5DJCA 1C12A 1MEXL 1KNOB 2H26A 1MW0A 2XDHA 2QHRL 2ZYSA 2ZSVA 4NQVB 5JOFB 2IALA 5I17B 1YJDL 2FDBP 4XNZC 3ZE0E 3L9BA 2CO6A 2VMCA 3QFJB 1X9LA 2MQGA 3OG6B 5FDWB 5FFGA 1ZHLB 3V7MA 3CVIL 1LEIB 3IGUA 1P4LB 4MDIB 2NNFA 2QDWA 2I26N 5AVTB 3LB6D 1J0HA 3EFFA 1PJWA 5IR1A 3RGHA 5EULV 2MMXA 1EX0A 3RQ3A 4DSYA 5HGBB 4UF7C 1JZ2A 4ADIA 1CFNA 3ARUA 1CXIA 4UMSA 3BKMH 1DLFL 2OYMA 2WXFA 3KDPB 3EF4A 4PY7B 3GXFA 4D2NA 1K2DB 4X98B 1ERNA 4F58H 1S7QA 4X5RA 3DIVA 4RAUB 4OZFA 2E47A 2WXHA 1WP6A 3AQZA 3GXTA 2R4RH 3NZ8A 4WFFD 1P0SE 2VKXA 4Q52A 1AD9B 2AQQA 5F7DA 3THMH 3ZTEA 5CCKH 5KYXA 3I6GA 5EF2A 1ZHKB 5IHLB 3VXRA 4Z3HA 1VFUA 5IB4A 5J1SC 3SQOL 2VDMB 4S2SA 2XN1A 5KSUB 1NAKH 4PG2A 4I0PC 3DXAA 4U2ZA 4AGPA 1ZS2A 2R29L 5FEBA 5E9DD 2BCMA 3HLKA 2CG9X 1WS7A 2YBGA 3QDME 4FNUA 3TPKA 2P5WD 3REWB 2OMXB 5GRYA 1H5BC 5C0AB 3U0TA 5CZRA 1FFNB 2H3NA 2IBBA 1IMHC 3CZLA 3MOAL 3OKEB 5INDB 1K4DB 3EUDA 2FWSA 4QYOA 4LLQA 4BFGA 3J7HA 4LLDA 1HOCA 3ZIYA 4HK3J 5IP4A 1MCFA 1IM3D 2P24B 3RGBA 4JZNB 4X6CE 4JCLA 2HP4A 5GGSY 2EUZA 4PRID 4F9LC 2BSED 1TSHA 3FTVA 5C70A 2DWSA 3SDXA 3PP4H 2Z91B 3TT3L 2HLFD 3CDFA 3LV3B 4WTZG 1WFIA 3W0WB 4ZAKC 2VXSH 2BVOA 3SKNA 1Q72L 3QG6B 4TOYL 1UWEL 4KI5C 3U4EB 4Z8FL 2X12A 2GJ6D 3RVVD 4V1DE 2IDFA 3WLBA 1HHHB 2WQXA 5TPWL 3N1MC 1D6VH 4C4KT 3BKYH 2H2PC 3WSQL 4ODSH 4HUCA 2DQMA 3RWDB 1U3HA 4KROD 3PYCA 3PP3H 3WHXA 5TDOB 4L1DA 1IGYB 3JSSA 4UILL 1WZLA 5K93A 4L05A 4XXWC 3GSUA 1G1YA 1TZGH 3OHXA 3BQVA 3D07A 5KVEE 4JM4L 3ZE0F 1ZTXH 5DHXB 2OR9H 1KBGL 1ONQA 4HT1L 4Z7QF 1F8TH 1QLRB 3R19A 1SJHB 3TBWB 4GKNB 3QCTL 1GRWA 4XO3A 3PP3K 2YA1A 1CLYH 1F97A 3REVA 1AO7B 3FQRB 1B4LA 4LFHD 5DZLA 5DZPA 4NB7A 3HCVB 2ZUVA 4K3HA 1I7RA 3FCTA 4PJBA 2F5BL 5CU5A 3FXIC 4GSQA 3QQ4B 5F7EH 4Z7VA 3NK3A 4JLRB 5GS2H 3CZUB 5C07B 2W92A 4KRLB 3MJWA 2P43B 4XI5D 1HK6A 3OZ9L 1OZTG 5CJQL 3OMIB 1GY1A 3H6AA 2ITDB 2CMRH 4N4YB 4FFVC 4KKLC 1NQBA 4GUQA 4M56A 2BNQB 3UBHA 1OGAA 5D93C 2ZD0A 3KNBA 3VXNB 1USZA 3N06B 5E2UH 3MUJA 4GB9A 1HN1A 4KAQH 1MFBL 4OIIL 5ADOH 5IV2B 4Y9BA 4YEFA 2Y72A 2DF3A 3ZL4L 4FXLA 5DO2D 3SBQA 3CXHK 2NQDA 1RZKH 2VDNH 1PYWA 3C09B 4IBZA 4IU3A 5I76B 5IKCB 4P2QD 2X70B 3HBZA 4W70A 4PD4K 3K2KA 5JPMB 1P5UB 15C8L 2ATKB 3PJNA 5KS9B 1A0QL 4G7YL 4GKOA 4PPTA 2BCKB 2LU3A 2EDEA 3NABL 4HW6A 1P4BL 3VD4A 1IGMH 2ITFA 2BHYA 1HKFA 3SGEH 2K6YA 3LEXB 1ZY9A 2AXGB 2J21A 3BKCH 4FNTA 1A4KA 1ET5A 2GABA 3OKDB 3GIZL 1NCCL 5IVXB 3RDTD 5I8EA 2ATPB 3B37A 3MRNB 8PAZA 3BEWA 4AJ0A 1YNKH 1JNNH 3G6JA 2ZAGA 3ARFB 5D1XA 4BK5A 4OUUB 3FPYA 2OSXA 3K72B 3JWNH 2YEZB 1WZ1L 3TYGL 1E4HA 4ZZFA 1S7RA 4FCHA 2VN7A 3FH5A 1TVHA 5DZJA 3OB0K 1ZLSH 1G84A 1SNRA 4MMYA 4PJFA 5EN3A 5MEQA 4V33A 4UTCA 1R34A 2DQJH 3MCLL 4HAKA 4EI5B 5DK0A 2I69A 3VFTB 4YGVA 2AJ3A 2WJ5A 3NACL 3HLAB 2YKLH 2APBA 3DIFB 5E0FA 3ZTJH 1YMME 2DBLH 5IQLA 4PS3A 1I1FB 2GTZB 2VR5A 5JW3L 2IANE 1ZJAA 3SJVE 3PAYA 5CKAA 1BIIB 2Z92B 3DHJA 5JNYA 3BGMA 2OL3A 2CR6A 1UB5B 5D72H 2AQ1A 2VTFA 1PKQB 3QFDA 2XY2A 3GO1H 3MRGA 1Q0XH 3OD3A 4GXUM 1U58B 2EINB 1WC7B 5EUOB 4KHXH 4Q74A 4OD1H 1AKJA 4HUXB 3ARFD 3FC8A 1R46A 4G8AC 3ZHFA 1FL3B 1WS8A 5E4EC 3S35X 3H7BB 3ZYJA 1EXUB 2WN2A 4XWOC 4ZFQA 4CW1B 1P7QD 5JPNB 1J10A 3FQUA 4LPUA 4OJAA 2HKFH 3AUWB 3HG4A 4JN2B 5FC9A 2BIQA 2L8AA 3MSPA 4E41E 5A6IA 1NGPL 3GZOA 4F7CA 1A7BA 2ERJB 3WXWL 1E28A 3QXTA 1OF2A 4IK6A 4PJGA 1JYVA 1MNUL 3T3ME 2P46B 2N7AA 1U8KA 3LEYL 4Z7WB 1ZV2A 1GYUA 2ZXCA 1ASOA 1L6ZA 2XI9A 1WQVT 3MCKB 4TL5A 2PWHA 2W8CA 4M6MH 4C54A 4XNMB 4DGWC 2WBJB 3QIBB 2Y5EA 4P46B 5I5IA 1AIFB 3EO0B 1T80A 3G9AB 5AOKA 4G6FB 4HCGA 1RULL 2VJXA 3F7RA 2XICA 4I85A 3VI3F 4AGNA 3ZTCC 2ZWNA 4W4NA 4YLCA 5FUOH 4BZ2A 2AJZB 3UBXA 1Z6JT 2X05A 4LCUA 3SE8L 2DKSA 5KJRL 5ACZB 3KGUA 4ZXBC 1E8YA 2HPOA 3TZVD 3VSUA 1QQDB 3FAXA 2VLKB 1ZCRA 2ZONA 5KYYB 2WQAA 2V5TA 1F4YH 4XVOA 4YHKH 3ZDZE 4KQ3L 5C0GB 5DS1A 1DSFL 4RDQG 1ZLWK 1QA9A 1SJEB 2CUIA 3KPRE 4NENB 2G2NA 2R1WB 4F2MB 4KXDA 3MRBB 3QZWA 2B1AH 1DP0A 1K5NA 3KLHC 1YJDC 1RUKL 4OZIF 3BQUA 4PP2A 1MAMH 3HE7B 4GRMA 4R26L 5E4AA 1EO8L 25C8H 5DO8A 4AM0B 4LEEA 3EGDA 4H2CA 4GH7B 2H9GA 5J6HB 1QR4A 3D9AH 1INDL 1MZYA 4PJIE 2LW3A 1CK0L 1ID2A 2KQNA 4HG4K 4NZRL 2ZZUT 4XI5C 1MCLA 2XPYA 2F53E 3P9MB 1MFUA 1BFSA 5F3BA 1NGYB 5EEUA 1NCGA 4WCYL 3SCMA 4HOWA 5IJDC 5HDOA 3OJ2C 5DD1L 1BQLL 5BO0D 4K9EC 1M7IA 3QDAA 4FJ6A 4LGSB 1AQDA 5EO1A 2HJFB 5A1AA 2NY0C 3UAJA 3BGAA 4DUWA 3BLBA 4WKXA 4F37F 2LE9A 4PBXA 3IAQA 1R5WB 2VN5A 4L0PB 5E1QA 1MN4A 4S0HA 3SD5A 5I5RA 1T0MA 4NC2B 2N1TE 4AM0A 4ES8A 5GGRA 1EVTC 4Z77A 1VEMA 4WSJA 4H1LH 4GMSL 1FV1B 4ZUUA 1QP1A 2NY6D 1IIIA 1W0WB 4NQUA 1ZMYA 4Y1AA 3UEQA 4P5KA 4QHNB 1XVSA 4MMXC 1ECZA 3CFDA 1GC1H 3RGVD 4KVNH 5BZDB 5C09E 3QQ9C 2XYCA 4NNXA 4OCSL 3IMSA 4X7SL 1VEOA 5FIEA 4A67A 5ECJE 1NC2D 3AZUA 4FNSA 1S7UA 2VLMD 3V52H 3QIWA 2ZKHH 2EXYD 4R96A 1L5GB 5DJAB 3H56A 1IKFL 4FYQA 3NJIA 2IOMA 3CAFA 3T0EC 1Q9OA 2YD0A 4Y4HD 4DK6A 5ICYB 1XSOA 4ZS7L 1XCWA 4K9EH 4JQIH 1SJVA 1V7NH 4PSRA 5E2VL 5EOCH 2CHXA 1M57B 4EJ1C 5FW8A 1JZEA 4HUWB 1XGRB 4FE9A 1FNFA 1K5NB 4ZAKB 5FYKE 2F8XC 2VAAB 5DZVA 5C8JB 2X3AA 3EZ8A 4U4BA 3CHOA 3FPXA 4FFYH 1VADA 2BOCA 4F1ZA 1U8KB 3CNKA 3RKDD 1JSYA 2K7PA 1J8HE 2FZ3B 4Z7QB 3IGLA 1FLRL 1YUKB 5JXEA 3C5ZB 3ALWA 2O6FA 3FDWA 4PV9A 2OQJA 2OMVA 2XN2A 4MCZA 4XAKE 3HIZA 3T0VA 5FYLD 2CLRB 3ULVE 1FF5A 2ITCB 2GK2A 2ZCKH 2X3CA 3C6LC 4X4ME 1OM3L 1RU9H 1D5ZB 5GGSB 4NKIH 3GHBH 2BERA 4GKSB 4U1LA 2I9LB 3DMMA 4TVPD 4R4FH 3QWOA 3PJSB 4ACPA 2NY0D 4ZO9A 3KLSA 2OK0H 1LO0L 3DX6A 4PVMA 2J88L 3U9UA 4R4ND 2RA1A 3MJ8A 2V0AA 3ZL2A 3PHOA 3IGAB 2ZUTA 4ZX4A 1MELA 4DP7X 4JB9H 3LKNB 3WU1A 4EI6B 2DQIH 5C09A 3DXAD 2Z35A 3EO1B 3C12A 1HHKB 3L3OB 2AK4D 1KN2L 2VN6A 4BQ6A 2X4PA 5AW0B 5B39B 2PW1B 3L3IA 1CYXA 2J1KA 5IVNA 4N5UA 4EUPH 2NY2B 1LK3H 1MXGA 2W5PA 1F6FB 3F84A 3RL2A 1UHVA 5ILTL 4BFJA 4D8PA 4HIPA 5K69A 4A6YB 4X5WA 2BOBB 4PJIB 3DBXB 3WYRA 1I9JL 4X7CC 4RAUA 2R0WH 3HS8A 4WWKC 4U7SA 5I75C 4ZD3L 5FHAH 2MTAA 4D0BA 4N2LA 1F58H 4NYLB 5C0BA 1SPDA 4JKMA 1SZNA 1CN4A 5B3JF 1KXVA 4FA6A 4JREB 4P5TB 4WTZA 1JYWA 5CCJA 3QB7C 3QUYA 5DJZA 1UG9A 2UVEA 4JHVA 1YYLH 3ARFC 3HFFA 3KXFB 4YZWA 4C56B 2F53A 2X2UA 4DVBA 4PJHE 2D0HA 4P3WA 4RSYA 4JKWA 2JJTA 4IM8A 3UX9B 1JDCA 5F7WC 4WI4A 2XVGA 3VGFA 3D85D 4H1LB 2ZX5A 1VADB 4MNHB 5B7MA 2ZJSH 4KK8C 4QTIH 4MX7A 4XCFL 3OR7B 3WMQA 3FOMB 5A7EA 3GSVB 3JV4A 1R33A 3V2AR 4PJ5D 4LF3B 5IHBA 3MUY1 4WNJA 4L3CB 1I3GH 3KCWA 1MFCH 1ZHBB 3EIFA 2DOCA 3HZ3A 3O2VH 1BG9A 5LQBH 3TESA 4PW4A 4DZ8B 4MJ5A 2EIJB 3NIGB 1VKXB 1KJ2H 3EJQA 4OZFB 4N3UA 2YRBA 1BZ7B 4IRJC 4MQXD 4NQDE 5DHDA 1YDPA 4OD3L 2G3NA 5IQNA 4A7SA 3EOAA 1HXMB 4ZFOA 4U33A 3NFPA 2R2BB 1LJMA 5GS0C 4U6HB 1RCYA 1BZOA 5I23A 1YEHL 1QYGH 1XGQB 3VFNB 1F11A 1CI5A 1CD9B 2DQDL 4LCYB 4D0DA 3UO8B 4OLZH 2E6QA 1FORL 2HJLB 4EF3A 4U05A 3TIEB 4MNGE 3WXVH 4P4KB 2JSFA 3V0VA 2FQDA 5IFHL 1H3GA 1W6WA 3D39E 1XF3B 2CUHA 4L3CA 3N41B 4Q6KA 4HFWA 5BOZG 3MX0A 3FOMA 4JFTA 5SWQA 1W8OA 5GZOA 2CO6B 4Z7OE 3QUKB 4YHZH 1G7HA 4G2AA 4J3TA 2CLZA 1XBRA 2NNXA 3FTXA 3SDDC 3VB9A 3BLKA 1C12B 3C2AH 4R7DB 3GJFA 2DWYA 2IJ0C 4PP1C 5H37A 5L6YL 1U8CA 3MTXA 5T1LD 3DX0A 1FG2A 3CN2A 3V6OC 4JJOA 2HZHA 2P7TB 5F6HI 2A6KA 4G5AA 4I0CC 1XEDA 1BBDL 4M6OH 4WWPA 3VW3H 5CGYC 1O6SB 3TBWA 4DVRL 3B2UC 2WXKA 2K8MA 3FT3B 5MI0B 2F1BA 4M7LL 2GK0B 1MFEL 4WHYG 3B9VA 4BUQA 1WIUA 2XVLA 5ENWB 2MRYA 1MIMH 4OLWH 4M8QA 1UYWL 2LVCA 2BOLA 4N86A 1PZSA 1RUQH 1OT2A 5L4JA 1KGYE 4YPGA 1FL5A 4Z7VB 2AI0L 2DQUH 4X80H 2EDRA 1DHKA 2XVBA 3MRJB 3FK3A 1OAQL 4XRCB 5C08D 4KNSA 1RLBA 4NQCB 4M3JA 2LU5A 4K71C 3WDJA 5JHDB 1U42A 1QI3A 1KJ3H 2OAAA 2DQCL 2G3ZA 3AXHA 3DV4B 4KO5A 2CKBB 2JKIS 5GIRB 4CDHA 3MV7A 1QW9A 5C6TL 4BZ1H 5MHSD 4U1SA 1EEUA 4G9FA 4FN0A 1NINA 1R3LA 2IBZX 5TE4H 4ZW8A 3T0EE 2R1XA 2IAMC 4Q9BA 2EC9U 4NQXA 1AIZA 1YPZE 3D0LB 4B5EA 1PDKA 2ARJQ 2DIEA 1TYJA 1UTDA 4UM8B 3UTPD 3DTXA 3ULSB 3G5YA 4JS7A 4WSGA 4K3JL 5CBEA 3TBSB 4BFIA 3WIIL 4JL2A 3UAJC 4G42A 4LSUL 4WEEA 5EZLA 5CFHA 1IAKB 4Y5YB 3O2DH 3JTSB 3H3PH 1PZ5A 2UYLA 1K6QL 4MHHG 5GJSL 3BD3A 4KROC 1S5HA 5CUSL 4APQA 4M93B 4Z78A 3IJ7A 1UEYA 4JGMA 3TO4B 3ETBJ 4NERA 3ECVA 1UD2A 3CSGA 4MQTB 2WXJA 3R7RA 4NAJA 5A7BA 1KC5L 4MMXA 2CCVA 3QJHA 5K9QI 5LN8A 3MRHA 2YS4A 4M4RA 1VFOA 2DB8A 2FGWL 4JHWL 3L1OL 1ROWA 2WSPA 3SPIA 4WWID 2X4QB 4FTVE 4XPAL 3VFSB 3QNFA 3VFRB 1FVEB 2QVIA 2NXYC 1JE6A 2ADIB 3GMQB 3QQNA 3AU0A 4QRUA 5EU6D 3B9KB 3KR3H 4M1DL 3CCHB 3UAEA 2BNQA 3ARDA 3N1GC 2XTJD 1UWXH 2VRAA 2M2DA 2Y07L 3MRFA 2IIJA 4K94H 3JYCA 4KQ4H 1IX2A 2FQFA 3N40F 3NOIA 4RMWA 1RHFA 4ISVA 4WW1B 4A38A 3OB0H 3L08A 5A40E 4XNUH 9PCYA 4CDGC 1PBYA 3LNFA 1NBZB 1OARH 2EH7H 2AJYH 3GFUA 3WDHA 5CO1A 2FJFA 3QDGB 2RD0A 4ATWA 3B2VL 2YD3A 4XBGB 4UOZA 4X4YA 5AKTA 1B6UA 1RUAH 2R4SL 2WQSA 1NJ9B 1Z3RA 4U0QB 1GTNA 1R24A 1RMFL 3D08A 4RZCA 4EN3B 5TQ0H 1A9BB 5JW5A 5FLVA 2VABB 5CEZE 2WTRA 2CR3A 5AZ2H 3NZ8B 5EU7C 3SZ6A 2JE8A 5MENA 2DTML 2XWTB 1JGDA 3NUKA 5AVSB 4AKPA 4H20L 4ONFH 1AACA 3AROA 4GSXA 5HHQA 1CFTA 2P5WA 4FI7A 2EYTA 4G6AD 4MCMA 1F90L 3K71A 5C0JA 2YEZA 3V8OA 3OXSA 3LQAL 3FH7A 4JDVA 43C9A 4TSBL 4Z0XA 5E6IC 1MCOH 3T2OA 5J11C 1Z2KA 3S48A 4QXGL 4XMLL 3ARSA 4XN5A 2QKIA 4NCDA 1NFDE 2EJ1A 2YEQA 4TKWA 1JD7A 3ZR5A 5BNXD 4JJ5A 3LB6C 4Y5VC 2WTOA 1CFQB 2WUCL 3IDUA 4B0MB 5LG6A 2ZOKB 3IJEA 2JH2A 5JMOC 4LLVB 4LASH 1OAUH 4XOEA 2BY3A 3JWNE 4MZRA 3MNDA 2MCPL 1T7ZA 4HQQL 4NCC2 4PJ9A 1AXIB 4NO5B 4FZEL 2CHWA 1AGBA 1HHIB 5KYYA 4JY4A 4NX0A 5KJ4A 2BVPB 2EDTA 3QUXC 2NW3A 1ZSDB 1KJMA 4TQPA 4OJYA 4JFQB 2ADYA 4NUGH 3FT2B 3TBSA 3US9A 4ZPVA 1S9XB 2ZKXA 3B2XA 2DW5A 3CQPA 4XP9H 1M3JA 5DJYB 4P4KD 1Z5LB 1DL7L 3DSFL 4LL4A 7FABL 3MOBL 5F7HA 4HK0B 2JJTC 4OLXH 3KJ6H 2CM5A 4YN3A 5I6NA 3EO9H 4X9HA 5JYLA 2DWTA 1NLDL 4DZBB 3MA7A 1NPUA 2LR4A 2FLMA 1NGWA 1JF1A 3CFIC 1LEKB 2VSDA 3NQIA 1ZLUK 3H0TB 1OQXA 5DVOA 1Q0YH 2AQPA 3AW5A 2D7TL 3O6LH 1G9NC 1EDHA 4FFZL 1C8PA 1WZMA 2MFNA 4PJAE 5IJCC 1JNHA 3VXUE 3T6ZA 2J56A 4JCMA 4ZOEA 3AQYA 3HPLB 5HVFB 1DUYB 3BZ4A 3MBEB 2ARJB 4WWKD 4I77L 4GFTB 4GQZA 1M71B 4M9PA 4JFQA 2I60L 3GSNA 4ZTPH 1EZVY 4HOMA 3X3GL 3FB7A 3UTSA 5EFIB 2JWYA 2BINA 2OFQA 2Y06L 5J3HD 1MRFL 2Q86A 5DGRA 4ZNEE 5DMIL 3BRFA 3BISA 4KTEL 2QADC 3FMGH 5CEYB 5FHBL 5DVKA 1IBGL 2DN7A 1KGXA 2BVQA 4GLRI 2D03L 5CZVH 4U3HA 1CGYA 1RJLB 4E9LA 2EEDA 1WGVA 4UQIM 5CSGA 2X6CA 4PJ8A 4NBZB 1NBCA 3FO1B 1ORQA 2F2HA 1PG7L 1KB9K 4JG1L 2R23A 5JOPD 2XJKA 3RURA 4AUYA 3HMWL 1QNZL 3AREC 3OKNA 1MXDA 3CH1B 1YNLL 4WFED 4I7ZC 1IM9B 5HY9B 1CE1L 3NPSB 3TN0A 4PGJA 4M8UA 1TTRA 2APSA 4P2YA 4PJEA 1Q9LA 1P7QB 3MV9B 5F6HJ 4ELME 1L9TA 2PCYA 3ZO0A 3MREB 2YXFA 1S7RB 3ZU8A 3QYCA 4FQ1L 4KFZC 4IK7A 1JFQH 3TO4C 4OFKA 3S8WA 2GUYA 3DRTB 4XNZB 2YC1A 2NUPA 1ND0B 3PABA 3HTLX 3VI4F 4FQHA 1G7LB 3V95A 1H3PL 4YHNB 2EYTB 4OR1A 3FT2A 5ALCL 1G7PB 3VFMA 5BS0E 2NXZC 2A83B 3MROA 4ZTOH 1JWMA 3F83A 3P77B 5T3ZE 3PUUA 4QPEA 5ITBL 4FQ2L 4BFNA 4XO5A 5DWPA 1BVNP 3RFRA 5MEOA 1RK7A 3MJ9L 4NO3A 5HHME 4LARH 1RVFH 5CWSA 1E4WH 4MZIA 4PWEA 4NT6A 2XQYA 5HJGA 4P9HH 2B3RA 4BFBD 4BKLB 2CPUA 1YQ2A 3QPKA 2BIHA 5GGRB 4K7PY 4PJCB 2KYIA 5HJ3B 2APWA 4ZI8A 3IMUA 1KCVL 1FJ1B 2Y6TE 4AQ1B 2QADB 2A6JA 2VDRB 5FYJE 4KJWC 2IGFH 5I1IL 3RIFK 2Z9TA 1J1OL 4HKXA 3GXIA 3VG0H 1URIA 2BJMH 4EZKA 1I9IL 2DJSA 1MLBB 2CWRA 4JK0D 3AT0A 4PLJC 1L0QA 1C16B 2ZUQB 3P77A 1AXTL 1T1XA 2IADA 5I66A 2F19H 4NC1E 4OF0A 1SVBA 3HC3H 5CJ5A 1U4EA 5FS5A 2V3FA 2BSSA 2LT9A 4GRWE 3AU1A 1UCBH 3FS9A 4KUCF 4EDXA 5KVDH 3VI4B 2W1NA 4PWFA 2ALWA 3VFOB 3D4CA 1S7WB 1L7IH 3IYLW 4I2XE 2F8VA 1OV8A 3KGTA 5KSAB 3RY6A 3MV9A 1YLBB 4U6TA 1A14H 2N01B 3LZFL 1N6VA 4PV1C 2HFTA 4HUUB 2R1YA 1IM9A 4RFNB 4RGOL 3PWJB 5HY9A 4YR6A 4A7UA 3FULA 4DCQA 1PGRB 4BKSC 4P2QB 4E42B 4LCCA 3LIZL 4AV0A 4AW4A 2BX5A 3FUFA 4FFZA 4G8IA 4NQQA 2PWEA 4LGRB 4WJG3 4HZAA 3EH1A 1SF3A 1EFXA 3O2WL 4G72B 2E9WA 1GOHA 2BRRH 4ZODA 5DJ0B 4O4YH 4PV9B 5JHDD 1NCTA 3PQYB 2C34A 3GMRA 4PJ8D 2CDGA 3ZDXF 2AGJH 2QEJA 4NUPA 4U1HB 3S37X 5I0YA 3NH7L 4UT6L 4HD9A 3QH3A 1UWFA 4W1TA 4W9FC 4FI6A 4YO0B 4GOSA 4AQ1C 1OW0A 4MA1C 2YK1H 3D48R 5AW1B 4AWJC 2XZZA 4AYEC 1Y18A 3NSCA 4YH6A 3CUPA 3PLYA 3UO1L 4ONHA 4XNQA 5HP5A 4XVSH 4XPHH 4E9XA 3FUDA 1H0DB 2Z35B 3PHAA 4O51B 4Y1TA 5HGAB 3I02A 3VI4E 1JZ3A 4IKNA 1GYWA 1H3WM 1KLUA 4M7ZC 3QRFM 12E8H 3G04B 3RNQA 4EVNB 3AAZA 5C8JA 4BFEA 5AVZB 3BEVA 2CIKA 2WMPA 1BYPA 1OAZL 5BRZD 3IDIB 3SE9H 3FFCE 1V3KA 1AGFB 2GTWB 3MRMA 1YZZA 4U4IA 1KG0B 5D93B 4A1RA 5JQHC 1GA2A 4HJGA 4DESA 1RY7B 2X9YA 3H2QA 3RUGF 4JW3A 5F70A 3V0HA 4BWUA 5BW7C 4DFHA 1IRAY 1C1EH 3TEXA 5BVPL 2BNRD 5D1QD 1ZANL 2XOTA 3RTQB 4AV5A 5H4ZA 5BS0A 1HQ4B 4B5ZA 3OJVC 4D7PA 1DBBH 4XNAA 2I07A 4QRPD 4G6KL 4P5KB 1QSFB 2MIZA 3W2DL 3N1PC 1KWGA 3ESVF 3Q6GH 4R3SB 3LS5L 1IQDB 2F74B 4G6ML 3IBOA 2D8KA 3BT2H 5F1KC 3VWKA 1N64L 2CBOA 3MLXH 1DQLH 2VLKD 1KG0A 1UXWB 3FSVA 1BBJA 5ICZA 4MAYB 1RL1A 5IFJB 5GGTL 2CIKB 2WMPB 1H8OA 4Z3TA 4EPSA 1YEGH 1CXFA 2PO6B 1UT9A 1QFUL 3HE6B 3RX9A 4IOFD 2A1WH 1QFPA 5IHZA 4D3CH 4MB1A 1HYSC 3C08H 1EZUA 2XBDA 5HVGB 4G1EB 1YQVL 4NQEA 5GGVY 4PJ9C 1AR1C 5TFSH 1I7ZA 4U6YB 3W38A 1P5VA 4X9YA 2IO5A 4FC3E 1BQHG 4O00A 3FSOA 2Z93B 2X89D 4G1MA 4KO7A 1UM6H 2GK0A 4Y2NA 5B7EA 3QH3B 5K1JA 3KPMB 3KXFD 4ENED 1UUSA 2HUHA 4QRQB 3K2MC 2WVSA 4HIIA 2OSLA 2VC2L 2MNJB 4P5TD 2IH3B 1CBVH 1DFBL 2Z64C 2OSYA 1F45A 3W11C 4LSQH 1ADQA 4DOHB 1R3HA 4PRAA 5D1ZC 1SBBA 1UXWA 3Q8CA 3L5XH 2Q7AA 3N41F 3S88H 4P2OC 1A7RL 5DD6B 1GVIA 2X7LA 2ZWYA 4GP8B 1K72A 4YSOA 2CLZB 3TH4T 3QO1B 2BWQA 4TSAH 1TZIB 5E1IA 4ZK8A 3EH2A 5C0RH 4TTGA 2IPTL 4F1SA 3HA0A 3O11B 5FOJA 2ADGB 4XMXA 3C5JB 3VWJA 3QC5X 5HHOE 1ETZA 2QDVA 4PUBH 4Y19E 1DQJA 2FK9A 4WJ5B 1FA4A 2GEQA 3WUZA 4PR5A 1PIFA 3NCYS 4KH9A 3FTSA 1CO1A 5I0VA 1M1XA 1NMBH 4K23L 1YMHB 2A9BA 4LBEB 4Y1SA 5KTEL 2B20A 3RY6C 1YDPB 1BPVA 4PBVC 3QJUB 1RURH 3GSXB 3LN5B 3VDCA 3GGWA 1SQ2N 3A6BL 2WOBA 4S0TD 3F58H 5INCB 2DD8L 4AEHH 4D8PB 1N5AA 1WFJA 2W91A 3P69A 5ESVB 1XMEB 1QUNB 1XX9C 4ZRGA 2PW1A 3L3IB 4ANUA 5JA8B 2WZ6A 3HG2A 1XHHA 1AP2B 2NDFA 4TN9A 3BI9X 4S1QH 4MAYA 3VQLA 1EZSA 5EU5A 1RZIA 4PJXA 1KJVB 1S3RA 4LHUG 1NFDA 4L5FH 1M05A 3MZTA 4OJFL 2QZQA 3MN8A 2IXQB 3EJYC 4Q6IA 4S10A 4XT1C 3F7YB 2BSEA 2NZ9C 2VGLM 2FSEB 3DX6B 4C56A 3MLZL 4HDIA 3DTXB 3ULSA 4BFIB 1AD0A 4BH8B 4OAWA 2DI9A 3PGFL 1CGXA 4ZUVB 1VJSA 3MHZA 2MPAL 5GS0H 2IH1B 4LLYB 5CZXC 2WBJC 4YHIB 5KSBA 4BSVB 4PJCF 2UY7A 1OB1B 4HX1A 4YDLC 2P5EA 1FSKB 3FRPA 3FUEA 3EOYG 3G5XB 4NPYB 2ZAHA 4UINH 3NJJA 3VMPA 1FRGL 3EKCA 1U8NA 4AMKL 4YE4L 3B1TA 1O5PA 1UATA 3QJHB 1Z9LA 4LAQH 1FYTA 1HXYA 4Q9CA 3WN5C 4LSDA 3OLIA 3O0RL 4ZZKA 3WE6A 3EYUL 3PUCA 3S34H 4ZUTA 5JQ6L 2D0FA 4RMQA 3T2NL 3K6FA 1IE5A 5EN2A 1JXGA 4G9FD 3OAUL 5GS1C 3GB7A 3MRJA 2VQ1B 2NRDA 5DUBB 3BP7A 1A6AA 4BFFA 3S35H 2XZQH 3SO3C 5I18L 2YD9A 1U8JA 4OCNC 4KMTH 4HK3N 3DX9B 3HC0B 3OJMB 2DQTL 1IT9H 5ADPH 1JERA 3BO8A 3K1DA 2PTUA 4UT9L 2BDNH 4HV8A 4HVBA 5CF3A 3NIDF 1LQBC 5CLTA 4ANVA 3FTGA 4FQPA 4FF9A 2NXZB 2X6UA 4NWUH 3HNSL 3SDAB 1PS3A 2OMYB 3O4LA 5D2LE 2XFXA 1NBYA 2JMRA 5EZIL 1TKWA 2WXPA 4R7DA 4F8OA 2I32A 3VACA 3TT1H 4XCCL 1SOKA 3ZN6A 2G2PA 1JZFA 1KLFB 4PVLA 3V0EA 1D7FA 2H0EA 3WFBL 4HC1L 1PZCA 3VU2A 4KJYB 4CKQA 3QUYC 4X6EB 3FFDB 4ZMQA 5C6WH 1R3IH 1KIRB 3VFWB 4YFEA 4U6HA 4S2SB 5E70A 1P6WA 2VW7A 4G71B 1RJZB 4XN7A 4OM0L 3VJ6B 2P4AB 3ZSSA 5CN3A 5ENWA 1BFVH 3DIFA 4X6DA 2JQAA 4M43H 4U1GB 4CUCA 4UQEA 1H9DA 5J9PB 2O93L 3T77B 4HPOL 5AALA 5D1QA 1S3KH 4G5ZL 3B9KA 3H9SB 1LGVA 3D12B 4P04A 2DPKA 4MA8H 4B41A 4DN3L 2VDRH 5F9DC 3HUJF 3H54A 3ZKSD 4J5VA 2AXHA 2V7HB 2YAHA 3KLAB 4Q9RL 3N44F 3B7TA 1YPZA 4KNTA 3C6SA 3LPPA 5C0CD 1LDPH 1H8NA 2CJSA 1G5AA 4ZJ9A 4DGYL 3OKYA 1FFOB 3OC8A 4KK6C 4NNPH 3B9KC 5I1CL 2JLPA 4FULA 5LN4A 2YN5A 3OKDA 2NY6C 1XXDC 3OAYH 3EYSL 4OCLC 4L37A 3T2QA 5F7AA 4NN7C 4HJEA 5I1JL 4XBMA 1GCYA 1DEEA 1PF3A 4YVUA 3OM3B 4LIQL 4ZX5A 2XTJC 5ERWB 2XWEA 3ARDD 5HI4C 4F33A 4L1SA 4MD5B 4MJID 5TH2A 6PCYA 1FAIL 3BW9B 1CU4L 4S1SH 4X7EC 3HPJB 5C0AD 1EUTA 2ED7A 3EDJA 1Q0EA 4NRYB 3QARA 2JCCF 1KCWA 4TXVB 5C9JB 4DP2X 2QPSA 5AZEL 4KDWA 1EO5A 1T1YA 3VXOA 4UTBA 1KEMH 4ELMA 3RTQC 3DVGA 4XCYA 3WFCH 1G7MB 2NY5C 5SX4H 1G94A 5JIKA 1DVQA 2L7UA 3HNTL 4Y4FC 1E5YA 3CIAA 1PD0A 2KDGA 2W0FA 9CGTA 2EO7A 4XMWA 3DJSA 3BJ91 4OFQA 4UNUA 5FV2A 1H8LA 2FO8A 5B8CA 5LBGA 4N8VB 5AOJA 5JDSA 3VNZA 2VM4A 2IDTA 1E3FA 2BPBA 1SDYA 4KUCD 2EDBA 3SDXB 1NMAL 3V0GA 1G7JB 2EVFA 4XN8A 2VR8A 2ZUQC 4L9LA 1H6FA 2YKKA 1M2OA 1PZ5B 1TQTA 2FX9L 1IVTA 1PSKH 2J5LC 3UTSE 5HD8C 1R6VA 2F58L 1REIA 3F64A 4LPVA 4MA1B 5DLLA 1DVTA 3CFCH 4K5LA 3VFUA 1IGYA 1TVDA 3MPCA 4MBOA 3AG1B 2AEPH 5EO9B 2DLFH 4PY8J 3CPLB 4EOWH 5J8OA 1TF4A 4X50A 2VDQH 3U9WA 2EABA 5F96H 4P4RA 4H25B 1QOKA 4UB0H 1KY7A 1NEZG 1T66C 5C08A 5D2NB 2Z92A 2G3MA 3SE4A 4XNMA 1XD0A 4MGXA 3VSTA 2WLNA 3DI2B 3HC4H 3LZRA 3O8XC 4TUUA 2DQEL 2ODIA 3LHPL 4OFPA 2H0JA 1UD3A 3NCJH 4PTTA 4X6BA 5I1AA 2YAFA 1NGWB 4DGVH 1HSAB 5GGVL 1XSJA 5DJ2B 2LLGA 3HS0B 4NO0A 1IB5A 3K8MA 4CW1A 1MJ7L 3MRPB 4D9RE 4UV4L 4XWOD 2X40A 3BZFB 3TBCA 2G9KA 4CKVX 1PZAA 2B59A 4ZUSA 3OVUB 4NWTH 5CLXA 4Y8DC 2ATPA 4JHAL 3TEZA 2VWEE 2YSTA 2G4EA 1C9SA 2VB5A 4XBGA 2XRAH 1JZ8A 2FEDC 3F01A 4NNXB 5DA0B 3FU5A 2VKWA 4GYBA 4IRJB 1DQDL 1E4XL 1TJHL 4ES9A 1LL1A 3K1KC 1X5LA 4DK5A 1Z9SB 4GAAA 3Q5TA 2H47C 3PWJA 1U3YA 4ZT1A 4EBQL 1ZIBA 1UASA 5DWUH 1CGTA 1U2HA 4RWYH 4MNQB 3CSTA 3OWEA 1OTSD 5KVGE 5SWZA 3RGVA 4ZFFA 4NUMA 3WIHA 2GKIA 5K39A 3GBML 3ZTJG 5KG9A 1MFDH 4V11A 4F92B 5I2IA 4HZLB 4EAEA 5C0JB 3CSPA 5G4OA 1EK3A 4RNRB 4L3EA 4Y9CA 2WP3T 3I9GH 3OSKA 1NGXB 4OFYA 1BD2D 1P1ZA 2WYHA 3U1QA 4P3CL 5HHXH 2Y24A 4CADB 4LK4A 3ZZLA 3G08B 4YO0A 3FQWA 2X6MA 3TNNA 4OD2A 5MENE 2DQHL 3BE1L 2D7MA 4ELDA 5L88H 2Z4TA 1WFMA 3L13A 1CFBA 5DYFA 3BP6B 4JPVH 3TVMB 3HE7A 1JHKH 2IQAB 3LEVH 4FNRA 4PIBA 1AS6A 5ETUB 4KX8A 5IEKA 1TYRA 2QHRH 3Q13A 4JFHE 4ODWB 4QNPE 2IDSA 1YJDH 5D2NA 4MCNA 4NIYE 4PTUB 1B2WL 1I8UA 1OP9A 4FQJH 3NSYA 5J13B 1HTYA 2Y1YA 4UAOC 1A7QH 1MW3A 2YPVA 3TGXA 4E5XG 1T0PB 4F7EB 2Q76B 3MV7D 4BKLA 4FQQB 3HE7C 4X0KA 2PXYC 5JIPA 4GRLA 4JN1H 2I9TA 4FXGA 4LCVA 1MDAA 5D7IA 1IBBA 3WDIA 1U33A 3G5ZA 5T1LB 5ID0A 2OMNA 4UZGA 4POZD 5AOZA 2XN9B 1P5UC 3RTQA 1DLFH 3F12B 3QXWA 4L4VE 4FGMA 1QSFD 4WNQB 2XPGA 3UAFA 2XTSA 5ISZA 1QEWA 2PW2B 4R7NB 2I07B 3HI5L 1UACL 1IEBA 2B14A 2BS8A 2NW2A 2VDKB 4KXCA 4OCXH 4ZOBA 5G5DB 2KHAA 4UZSA 3CK0H 5I1HH 3HHRB 5DVPA 2WB7A 3SQOH 3DBXA 4CVZB 1OAYL 5L4FA 3O6KH 4OVVA 2R29H 4HA1A 1AKJD 4CU6A 4PRPA 1T5WB 1N3NA 3GXDA 3LY6A 4MNQA 4DW2H 4ZFFB 3DNKA 5EIQA 3VXTA 1U95A 2P9RA 2V8MA 2Y2TA 3D06A 3SPCA 2XV6B 1UFUA 1P1VA 2EO9A 3OB8A 3MO1B 4E36A 3UG4A 4JN2A 1QMUA 3NSXA 4KVCL 3KMDA 3N55A 4IOIA 5BVJB 5AKVA 2E8ZA 2VLLA 2ZUUA 3EYVB 3HS0C 3GMPB 5ICYA 5J5EA 1G9MH 3FT1A 3Q8BA 4OW6A 4P57A 5ANHA 1VESA 1DLHA 2HVBA 5CWSB 4PLOB 3QXUA 1DUZB 3KPLA 3RA7L 5C0FA 4X4XA 2YPLE 2Q6WB 4HS3B 5DSCB 3QIWC 4F3FB 3NAAL 4FG0A 3TT3H 3MLUL 2AXWA 4FNQA 3T0EA 4H2AA 5AYTA 4X5PA 3MO1A 3MFGB 5CU9A 4A63A 4F15C 3FHEA 1NA8A 3OLDA 3BT0A 1P7HL 4TUJB 2BW5A 4GKLA 4JZOA 4RFEB 4XVUC 4KDTA 1RI8A 5BV7B 1AR2A 1D6VL 1D2PA 4APQC 1OGAD 1D5IL 3BKYL 1TMCB 1XH3A 4KTGA 3MV8D 5EOCJ 1ZLVK 1YEJL 4QTHB 4JRFA 5MEPB 4L0YA 1HIML 3LN4A 4UIMA 1SN2A 4HLJA 4YSDA 5FCUL 5CCHE 2VITB 2XPGB 3FQUB 2EH8H 3UC2A 4Q6IC 1TZGL 2WIIB 2NX5B 3VFOA 3MLVL 3F12A 3S3BB 1O75A 1J5OH 1KDIA 1YC8A 2C9UA 2OR9L 3VX1A 4HT1H 4WUUB 1A1NB 1F8TL 2XXGA 2CBPA 2UV3A 3UADA 3QCTH 3L1GA 4LDLB 3TBYA 2HXAA 3L5WB 2VXTH 4L9LC 3LNHA 3LPFA 4IHOA 4J4PD 4YWGH 4D9QE 2FBRA 2NXYD 3PDOB 2HN7A 4WW2C 4YDNA 2JNZA 4PLKD 4F8TA 4KPHH 3WNLA 2F5BH 4QRRD 5DF0A 5GRJH 1YECH 1O0VA 4IIQC 5F7EL 2VLLB 1E9QA 3EYVA 3NJKA 4Y88A 5E5LA 1JTPA 3WD5L 4AQZA 2AFNA 4IOIB 1UWXK 2XHNA 2ZWKA 2OTUB 1P7BA 4IRZA 5BVJA 5BRPA 1JN6A 5CJQH 2VAAA 5JW4Q 2CMRL 4Y8AA 5F7FA 1FCGA 2B2XL 4KK5C 3BH8A 4ORGA 4WUUA 4K4KA 1OY3B 5E2UL 4AVKA 3TIEA 1PQZB 2GIXA 1WWCA 5F3HA 1OGPA 1SMOA 4KAQL 3ENEA 4OIIH 4D0DB 3FUNA 5ADOL 5CD3A 3HZYB 3WEOA 5J4MA 2XA8H 3H9YA 3L4YA 4LPYA 4UI2A 3ZL4H 4U31A 4B97A 2FUTA 3VXMD 2XIBA 1RZKL 3QEGL 4LBEA 1U91B 3UZEA 3ZE2F 3IRCA 3H8NA 3NSDA 4E9TA 1BLNA 3WELA 2HLFC 1G43A 3MRRB 1MCSA 1S7UB 2VZ3A 3FRUB 3Q7JA 5EBGA 2ZX9A 4G7YH 3WIFA 5F0MB 2ZNXA 1MQ8A 1V3LA 1SJMA 2C7UA 3NABH 2IFFL 3ZY7A 5F0LB 5GS2D 1L9SA 3TA4D 4Y4HB 5D6CB 3GSVA 2VDOH 3JV4B 4PJHA 3S2CA 5FUCC 1C5BL 3Q8FA 2F54D 1NCWH 5F88A 2YJLA 1NC2B 2DYRB 3GIZH 2XETA 4NQVA 3BP5A 3KL0A 2VDOB 4FQXB 1CI3M 2B5IC 3FTYA 3RIFF 1FZJA 3TYGH 3TF7C 2WP3O 1A1NA 2N7BA 3FTGB 2NNCA 4AZ8A 2JK5B 4HIXH 2WSKA 4HALA 3K6DA 1RZFH 4NIKB 2BFVL 3TM6A 1EVUA 1A1MB 5JYMA 3KWVA 3SBRA 3ORJA 1FO0A 6PAZA 3P73A 1S7VB 1LXMA 1PU0A 2DBLL 1TQBC 1FLTX 4HKJA 2R7EB 3P9LB 3KPSE 4G1EA 4YNYA 3ET9F 4QWWC 1QUPA 1VLXA 5FGCB 2BP8A 3LVEA 2E7BA 4Z7WE 3T3MB 3G5WA 2BVOB 3SKNB 4H8QA 1MCJA 3MU3A 4HHWA 3RU8L 1J5HA 3OL2A 2VW6A 2DEYX 2EDQA 5D72L 4JM2C 3GO1L 3KJ4B 1Q0XL 2WXMA 3QORA 1L9OA 2WC7A 2EEBA 3LPWA 4CSSA 3AJ7A 3S8FB 4O58L 4XBEH 4OD1L 1XGTA 1NCAL 3FT3A 1E6OL 3BO8B 1WT5A 1ZSHA 3LXCA 4HIHB 2I7SA 1VZIA 4PRNA 3OKEA 1I7TA 2O1AA 4GXUN 2HKFL 3VYNA 5F1NB 3FZUD 1JF6A 1T1WA 2J8UB 2Z4QA 3WXWH 1XSKA 5E56A 2L7JA 5KSAC 3QPXH 1OALA 2ADIA 3A0OA 4TRPL 1VEPA 4WU5A 3LEYH 1T20A 3T6WA 5D6CA 1EJFA 2AKRA 1E40A 4M6ML 1YY9D 4NSKB 4I48A 2RAMA 3AG3B 4HPYH 5I9QC 4Y5XB 1R17A 3QG6A 2VR7A 3KPMA 5DMJB 3ATDA 1LO2H 3H4HA 5A2JH 1QRND 3LV3A 3W0WA 1RULH 4QDGA 1CC3A 3CSYA 2FIRT 1A8JH 2IAMB 3QJTB 1QW8A 3SE8H 2LAGB 5D71L 3T6VA 2WWMC 4JFED 1UURA 2WLIB 4IIQA 1EAQA 5KBKA 4JFYB 3J8F7 3L9RB 2V7NA 4IRSC 1F4YL 1IAMA 4YHKL 2WLMA 4JFSA 4KQ3H 1BZQK 3CZFA 3K91A 3BUPA 1DSFH 3P4LA 2FSEA 3GWJA 2FJUB 1XAKA 1I7UA 2CRIA 2QPUA 3BXNA 3P3SA 2G5RA 4Y1AE 3ESPA 2Q8BL 4MS6A 5JTWA 4ZMYA 1TYEB 4ODXA 5K33A 1U8QB 1FFOA 1RUKH 4B95C 1AZRA 2NY4C 2YO3A 3GZQA 2WTRB 1FO0L 4MWFB 5G2NA 3NFSL 1MAML 4R26H 5JW4M 2WGXA 3WUWA 4LEXH 1U9KA 1HH9A 4OTXL 4J12A 4XCNB 4GAYA 5B3JE 1WAEA 2E7DA 3D9AL 1INDH 1X3DA 1PY9A 4GPVA 4I18A 3MNZA 3VRLF 3GS0A 1CDJA 3QUYB 2WLIA 4IIQB 1NAMB 3QUZD 4OCWL 4MS8C 2FYYB 4H5SB 3AT9A 4WCYH 5M95B 2P49B 1KB5A 4AOFA 4ICXA 4GIPD 5DD1H 2H2PD 1YEIL 4P2RA 4L4JA 4WJKB 1FVCB 1IC1A 4QXUH 4UT7H 1FH5L 3TA3C 3ZX1A 2CKNA 5IROD 4QXVA 3VWJC 5IIEB 1JMZA 2C4FT 3NVQA 2MKWA 1A9BA 2A4EA 2PWFA 3I85A 4L1LA 4LLWB 1HH9B 1IGTA 5KW9H 5DS8B 5JQIB 3ARDC 2X4TB 3CMGA 3ZGHA 3DO7B 3KPRA 3ULUF 4NP4L 4DP9X 4QLWA 2WUBL 1GC1L 1ZGLA 3TO4A 3V0WL 3BVXA 4WV1B 4APQB 4X7SH 1PTZA 1OW0C 1JJUA 2W59A 4JG0L 4JFYA 4R90H 1PG7W 5E6IB 1IKFH 3KM1A 5E9NA 3SGEI 1QO3A 4ZS6D 4QRUB 2Z7UA 3BAKA 4JQIL 1TQSA 5E2VH 1V7ML 2GUOB 2V3DA 4JHUA 4QOKE 3EJZD 1FVEA 1LQSR 1EMTH 2MKLC 3KYMB 1A7PL 2HFGL 2Y1AA 2J44A 3QQ3B 4ZMXA 1JTOA 3BWUC 3ATBA 3QA3A 4A2FA 2Y7MA 3LQZA 3ZZSA 4GQQA 3PV6B 4QYAA 3RZCB 3KM2A 5AWNH 5FKPB 3I3BA 3UJIL 2HB0A 3QVAA 3VXOB 3ARWA 2NY4D 2MOVA 1FLRH 1YUHB 3W9EA 2NT0A 4EIZC 2YLKA 5C7XL 1ZT4A 4G9DA 4YBLB 2IAMD 2ESVB 1NUDA 5E6IA 4PRBB 1J1XL 4F7CB 1SM3L 2DLEA 4AQOA 2ZCKL 3S37H 1OM3H 3SDAA 1U3NA 3LNGA 1X5FA 3GHBL 2OK0L 4NOBA 1FP5A 4R4FL 3SQBA 1EBPA 2V2TA 3ATAA 3A23A 1KTBA 4ZOCA 2CM6A 1N2RB 1EEYB 2EADA 3V0JA 1UZ6F 5DS8A 2F7QA 1MWAB 2DQIL 4LLAA 5JZ7C 3WTWA 4XODA 2A73B 3L3KA 4DP1X 5EIIA 1KBVA 3SKMA 2E59A 1UC6A 1UOLA 4QD2E 2O5NA 5ILTH 3Q2NA 1P6FA 5FOBA 1B0GB 3GSWB 1O6TA 4YHNA 1VENA 5ANMA 2R0WL 2PW2A 4R7NA 3T1WA 5C9JA 4TVUA 4ZD3H 1JAEA 4HETA 5I6XB 2HFEA 2NNAB 3X13B 4ONOA 1CR9L 1J0JA 1RIVH 5D1XB 3FQWB 2RACA 2GVYA 1F58L 4W9KC 4CNIA 1M7XA 3BAJA 3QUMB 4YIQA 1PFCA 3O3AA 5CP7A 5ACMA 1IEBB 2NW2B 1I1YB 4DP4X 4P2RB 5JDJA 2C3VB 4JFFE 4LDCA 2GJRA 4FS0A 1I8KA 3IMWA 3E2HB 1YYLL 2H41A 1O9WA 5DD5L 1C7SA 4RBPK 2E6PA 4LSTL 2ICES 1V8HA 3CZKA 1KYOK 1II4E 3LPOA 3G6AA 1TPXC 2DAVA 3R18A 2X4NB 4HXBL 4JRXA 4HU8A 2UZIL 3HAEG 2ZJSL 2Y23A 2XQYK 4W9IC 4XCFH 5KS9A 4WV1C 1Y0LA 4F7EA 3LEXA 5AVYB 4FNLH 1XH1A 1VHPA 3EXLA 1I3GL 1KUMA 5LQBL 4DETA 2HTKC 1AS8A 1QWHA 5D1ZD 5EUOE 4MXQC 3FT9A 3EYQC 2B08A 4WTQA 3AY4A 2VJ0A 4JCWA 4OD3H 1CGVA 2ZUWA 5HDRA 3FCUB 3TX4A 2R56L 4HEPA 3RWJA 2WLYA 1BQKA 4E5XA 4IBQA 1QYGL 4Q4IA 4TLUA 3HMXA 3H55A 3UTTE 4AIEA 3L1EA 4OLZL 3H42H 1FORH 1BQHA 1TQUA 2DMBA 2X44D 5GGQH 3V6OA 2JI3A 1NCBH 4YDVB 5DGQA 3WXVL 4PJ9D 4B9CA 3ZO9A 4JRYE 1RAMA 3D33A 5IREA 4ILDA 3F65A 1NFAA 2Z7YA 3HKZA 3VCLA 5FUZH 5DJYA 5BV7L 4UM9A 1SOSA 1R1CA 4XX1E 1AZNA 2BLFA 4IRSA 4YL9A 2J12B 3QUXD 2N59A 4RMSA 2AQTA 3C2AL 4Z5RA 1SDDA 1M53A 3MUGB 4LHUD 2GB2A 2H6PA 1JZ7A 5L6YH 4N2GA 1GKEA 5GRUH 3LKQA 1E8XA 3SGJA 2WBKA 4AKQA 3T1FA 4EIUA 1RHHA 1CURA 1BBDH 2X4OA 3IDJA 3V6ZA 4DVRH 3HZMA 4XBPA 4MMZA 2HX9A 4ZW7A 2F8OA 2HLAA 4AT6B 5FF6B 5F3FA 1A22B 2E9GA 1LO3L 4H8VA 4EVNA 1L9QA 2DKMA 2E5EA 1RUQL 5KSVB 4P2OA 2AI0H 4X80L 1E50A 1RZGB 2RQEA 4HJTA 4U6YA 1SDDB 5KS9E 2UXGA 3AXIA 2R1YB 3B3BA 1KJ3L 1SHWA 4YR6B 1MJJA 2DQCH 3O6ML 4IRSB 1RZJC 4JRXE 4B53A 4Y2DC 4OZFG 2AEWA 3BIKB 1N3NB 5C6TH 4AZUA 2X1PA 5FB8B 2YD2A 1WCQA 3QIUB 2JJUA 2XV2A 1OSEA 1BMGA 2GBUA 4NM4H 3RI5K 4FLSA 4B9IA 4X0NA 3LKOA 5TE4L 3MJ8B 4U1GC 1CYGA 1ACYH 2O5XL 3P4MB 4HMCA 3SDXE 3G3LA 3GMRB 1GJIA 3RWFA 5E7FA 1R3KB 1RZQA 1MHEB 2RCSH 1GAFH 4ETYA 3JWDC 3K4ZA 4F2FA 2K9FB 4P46C 2EEFA 4P3DB 4K3JH 5FGRA 3VE0B 2R69H 2Y3NA 4XO4A 2VDLH 4LSUH 1ULVA 2CU9A 5E1GA 2LABA 3ZRSA 1B9KA 3O2DL 4AIZB 5EOQH 3MQIA 3K74B 3H3PL 3DECA 4AQEA 3QULA 3AT8A 3QPQD 4GRLB 5D6DA 2WWKT 1QBAA 3U7WL 4YK4B 2ZOOA 1RKRA 2VNCA 2DQFB 4PSPA 3JV5A 2XLLA 3U0WL 1NC2A 1BX2A 3PWUA 3SIKA 3EAKA 5IFAL 5DHVH 3UCRA 1KC5H 4JPKH 2Y0SA 3KD4A 4I9XA 1NDMB 4LMQI 4JHWH 5AAPA 2FGWH 3FKUS 1M42A 3MUZ1 4FG6D 3CHPA 3DTUB 4MDJB 3NN8A 1XCXA 1JDAA 4H44C 2HRGA 4XPAH 2B8OT 3STZA 4QRQA 3QXAA 2FT8A 2OR8A 1VA9A 2EXWC 1T21A 3KPOB 3V79C 1FC2D 3GHEH 2J5LB 1EGJH 3KR3L 4M1DH 1HNYA 3C60C 1N6UA 2MCAA 2IDCA 1KIUB 2J2ZA 4A6YH 2GI0A 5F3BB 4XXDB 5H37H 4WFGD 4WKZA 4XXWA 1NSNL 3N42B 1U8PA 4YXHH 1KXQA 1MWOA 3F7VB 4NNYB 3GD1C 4WQOA 4K3EL 3IEAA 1U8OA 1OARL 2EH7L 2PO6A 3A67L 3HE6A 3LRGA 5EU3A 1ITBB 1P7QA 5HDLA 3ZTDC 4HKXB 3LQAC 4I5BB 3QEQD 3D69A 4HUVA 2WKLA 2XXCB 1U8HB 1V27A 4A2DA 2OCCB 3EGXA 3TCLA 1FFQA 3LNEA 5FV1L 1RMFH 3LXAA 4M6NH 4MKTA 3IPEA 4FI8A 3LX9A 5LGJB 3BQUB 4PQXA 4LKCA 5AZ2L 4YHYC 3G7TA 1GYCA 1NGZA 4R84A 3QJFA 5C0EB 1GGIH 1KENL 1NC4B 3OX8A 3QEUA 2WKGA 4H20H 3APFA 2OCJA 5KANI 4P4KA 1A8ZA 5BOJA 1FFPA 1S7WA 2XWBA 5CR1A 5F7KC 1D5MB 4AGQA 1OT4A 3EJSA 4JMNA 2PPCA 4LU5H 2ADJA 4QRPB 1U8IB 5A3ID 1FVDA 4PB0H 3ABKB 2E86A 1PZ2A 2K3HA 5DD3L 3ALXA 2E46A 4HUMB 2BNRB 1X5IA 4EZJA 2C3XA 1MCOL 1XH3B 1OGSA 2X1WL 3D2TA 3F7QA 4CMMA 4QXGH 1XF4A 4PRIB 3O4LD 2D31A 5HYIA 2BSDA 5EU4A 4EIGB 2R59A 3P9LA 2X3BA 3GQFA 4KRNA 1RQ5A 5I5JA 3T0BA 1UB6A 4BQ8A 2CHNA 4K9JA 3TYFB 4FQXD 2WUCH 5K59E 3RL1A 1TITA 1J12A 4TNVK 3WIHH 1BD2B 3QWNA 2OP4L 1QLEL 2FYVA 4CN4A 4IBTA 5D96C 2W07A 1Z7JA 3MBEC 4RWHA 4U1NA 2QJDA 3F5WA 4FZEH 2FE0A 4NQTA 5D5MA 4CA4A 5C1MB 1SYSA 4FQXA 3C5ZC 1OP3K 3VVWA 4JGNA 1FSKC 2GC7C 2UWEF 2YPLA 3FTUA 4JKPL 4Z7UB 1N0LB 3SE3A 3R8BB 5L4MA 1QSED 2JIXB 2IPKA 4PG2C 2Z3FA 2ENJA 4P2QA 2Z31A 4A68A 1NFIB 1KPRB 4UM8A 3NBNA 3WV0A 3B7UX 1T4KB 3MOBH 5F7LB 5GS3A 3SKUD 4M61B 2CJTA 3VXMB 2OJEA 4KHTL 1VB9A 3EO9L 5J6GA 2J6EA 3QZPA 2WIIA 4C57C 2UZYA 1NLDH 3QHTC 3RB7A 2XVKA 2CJ3A 4Y5YC 3NZUA 4R6UA 1ZOXA 4UIMB 5HVHC 43CAB 1L7TH 5C3IA 4WU7A 4UT9A 4O2FA 1Q0YL 3O6LL 2V7HA 3KLAA 2HUEA 5ICXA 1O7DE 4MNQE 5J0BA 3RHWF 1S7VA 1NPNA 4LVOC 1T22A 4C4BA 4M8QB 2BM3A 5KVEH 2FJSA 2CBMA 3ARED 4ZUVA 3TCTA 1T4WA 4YDJA 2I60H 5HGHB 4ZTPL 2XWJA 5DFAA 3X3GH 5JW4R 4YSCA 2QSTA 4FEIA 1UXSB 2NR6C 5DMIH 2ZXAA 4XOCA 2E27H 3ZSTA 5FK9A 1WPCA 5ABZA 5ISZE 4E9QA 4KTEH 1T03H 5FHBH 1DVUA 4JZNA 4I3RH 3C09C 4HIHA 1JGUH 3VQ2C 1T83A 4IRZH 2PNDA 4L4VA 2C1OA 5DJXB 3VH8A 1PX3A 3ZPDA 3L4VA 3MV8A 2OTUA 4NQXB 4LAJH 1KLFA 2QPDB 2Y5TB 2JKJA 3OSVA 5KSBF 1PG7H 1QATA 2QMJA 3MLRL 3L7EA 4JG1H 3TWYA 4DVBB 3W39A 3D69B 4N90E 3HMWH 3PL6D 4TLSA 2GHZA 5IB4B 3Q48A 5E99H 1YNLH 1QUNA 5EB9A 3NQKA 1CE1H 1AD9A 3KL5A 5KYXB 2F54A 2C9AA 3QUML 1M3IA 3GMLA 5D70L 4BXVA 1RZIB 2Z6FA 1XV8A 1HHHA 2XBTA 5TK2A 2K9UA 5C07E 2WYZA 8FABA 3RFZC 1D7BA 2DDQH 5SX4I 4Z3IA 5FO8A 1FO0B 1OGAB 1UXLA 1H3PH 4HWNA 4LHUB 5ALCH 5I75B 1GYVA 4JL1A 3SDAC 1T04B 2EUWA 5E9DE 3UPCA 2B4CH 1HNGA 4H8WC 1FVCA 3MDJA 4HAGA 5ITBH 4FQ2H 3Q2CA 4L3EE 1PW3A 5C0IA 1CXKA 5TF0A 3CJJA 5DC9B 1R3JB 3HMXH 5EBWA 5JPNC 3U82B 1YEKH 3MJ9H 1N18A 1OZUA 1JGDB 2NY6B 1RVFL 4XXCC 3ULAB 1E4WL 3DX8B 2WD0A 4FOMA 4P9HL 3QJOA 3TV3L 1LO5B 5B1CA 2R0LH 4BK5C 5SWZE 4R2GB 3KWUA 3BVDB 1W0VB 5FA4A 3HHSA 4KKLD 2CDEB 1AO7A 1KCVH 4RA3A 2ZX6A 1FDLL 3ZW3A 3DX2A 2IGFL 2VISB 4LSVH 1J1OH 3MGAA 5H8DA 4ODXB 3WEXA 5J13C 1L4IA 2CXGA 1PLAA 3KH3A 3T09A 4ZSOE 1NKGA 3X12B 1PEWA 5T33L 5HDBE 5CBEB 5DURD 1D6EB 3D2UB 2ITEA 4RETB 5GISL 1I1AB 5IB1B 3RVWC 1BQRA 5IW6B 1EAPA 3U1PA 3T71A 4XTRD 5DURB 3VXRD 1LWRA 4C55A 3PNWB 2KZ1B 3WJLA 3QI9B 3GTVA 3OHXB 5BQ7B 3PU7A 5E6UB 2A38A 5LBSA 4OY9A 1HCVA 2X4QA 1MCQA 5A16A 3HG3A 4BGDA 3WKQA 1A14L 3GMLB 1LE9A 1BP3B 2XQYG 2CAKA 4GFXA 4BSWA 5IB2B 4HBCL 4RGOH 4MRCA 1PLBA 4X5LA 3GJEA 5AW3B 3VGBA 4P2RD 3LIZH 4QRBA 3V10A 2OA9A 1UUNA 5KBPA 1G1CA 2OMTB 4HX1B 1N6QH 4DPRA 3FFCB 2H8PB 3CU7A 3O2WH 2CO1A 1ZVHA 3Q1SL 4P5MB 2CSPA 3CPLA 4O4YL 1ZGLP 5F1OB 4X4KA 5DU7A 5EIIG 7CGTA 3D1MC 2QGEA 5IB3B 5KVFH 4AK2A 1J1PH 1NBZA 3IFOA 1QFOA 1W91A 3CDZA 3D3VB 3IDXL 3K4DA 3NH7H 4OGZA 2CGRH 2NZIA 2A6KB 3K7UA 4G6FD 4WUUE 4WV1A 5GGUB 5DUBA 3GSRA 2I25N 4X9BA 5JDSB 1HDMB 5JUEL 1HCZA 4PJ5A 3DYOA 2WNWA 3UO1H 2P8PA 3Q1EA 3CZNA 5BW7A 5IB2A 1DO6A 3BUDA 3TJHD 4G8GA 1ZXKA 3Q2VA 3CZJA 2YQ2A 5HDBF 3GI8H 1FL5B 5TD4A 4TNGA 1UENA 3AS0A 4OLVH 2Z7WA 2X38A 2YHGA 4FG6C 4LXFA 1JXJA 4KZEL 5L8KB 5CXPA 1OAZH 3SE9L 1IBHA 4NHUA 3TNMB 5HYJA 5CZKA 1M2VA 2H6OA 2WXOA 3MGTA 3RWHB 3UMTA 5IIEA 2YUXA 2XPZA 4PMEA 4YSEA 2M8XA 2P5EB 4QRSA 2OTWA 3J27A 3VRIA 1ZANH 3UL4A 5HHVL 3NSJA 1S7XB 1QTYT 3VD1A 1CXEA 2I24N 4YZFF 4I0PD 4LCWB 3KYKH 4F27A 3ARBB 3PCYA 1FCCA 3Q6GL 4ZQKA 3LS5H 4G6MH 3CFMA 4BXSV 1MY7A 3U25A 3AREB 1FYHB 1N64H 2ZOKA 3IJEB 3MLXL 4JRXB 4M5ZL 2GAZA 2JI2A 4RAVB 3BUYA 3BVVA 4AYMC 2BP0A 4YOKA 4NI3A 5ITFB 1KPVA 5I1EH 2QV4A 2CHDA 1YEGL 2A6IB 5EUKB 3ZXAC 2A1WL 4XVJL 4PH8A 4D3CL 5J57B 1X5ZA 1B9ZA 3TBBA 3IFNH 4GBXA 1YQVH 2DEXX 3JV6A 3BVNB 3ESOA 3K6OA 5IESH 4Z6AT 5TFSL 2DI8A 2IPUG 2DZEA 1VSCA 3F05A 1BJ1J 3SPHA 1DDHB 2NY1B 5E1HB 4FG4A 5DJDA 1UM6L 3JXAA 5JA9A 5G4MA 4O2EB 1P2CB 4YK4C 2D7NA 1ZPUA 4Y0GA 3OGOE 4P46A 1YN6B 1IZJA 3VFRA 3UGXA 2VUYA 3QAZB 4CNIB 2VC2H 4DNLA 1CBVL 3HG0A 4LNRA 1YCSA 1LHZA 4KJYA 1X5YA 5LXGH 4M5YL 4LSQL 4RA0C 3N0PB 3FH8A 1J0ZA 3S88L 5IJKC 4F2ME 4Z3EA 2DYPA 4QXTA 3EJYD 1EHXA 3MV11 4WFHE 4X0KB 4YBHA 3NRQA 3FFOA 2Y6SC 4TSAL 2Q2EB 4F2MA 2FEEI 1KGCD 2ZX7A 3F3HA 3GMOB 3P4OB 5FGCE 5BCAA 5IMLA 1K8IB 1G0XA 3ROOB 4ZW5A 1F42A 2FECL 1E0OB 1XGZA 3TO4D 1SXNA 5T1KD 4N9GB 1JWMB 5D2LA 3SDYH 1BVKA 1GIGL 1MAKA 1J8RA 2BVQB 4NO3B 1PAZA 1N2RA 4TS6A 1I82A 2VZ1A 3VRJA 3WTVA 2AQNA 1T7VA 4IU3B 4KO9A 4LCWA 4Z0BL 5I76A 1Z9NA 5IKCA 1WEJH 5IJVA 3AS3A 5KTEH 2V9TA 4X7TA 2FBOJ 1D5BA 3A6BH 2EIBA 1G7JA 1WIOA 1PY4A 3ZL1A 1CGSH 3SEPA 1RLWA 2NYYC 4U3SA 3ZZ1A 5FGBC 2BZDA 5CHNB 4OF7A 1NEUA 4JPWL 2JKLA 2AJVH 1W8EA 3NT0A 1ZLWH 2C4FU 2FVNA 2FR4B 4MDJA 1RK0B 4EUPB 5D2NE 4K55A 3EOBB 4GI9A 4BWTA 1AHWB 4H25A 3RIKA 1SXBA 2DMGA 1QHQA 4N1HB 2XX1A 3S5LA 4C47A 4O51A 4HS3A 3A5VA 1S5IL 1P84K 1HC1A 4HIJA 2OMVB 4MCZB 4U0RB 1F4XL 4IKKA 2E6JA 1M71A 2EDJA 5K1NA 4OI7A 4G3YL 2GBAA 5T8IA 2XG4A 4HJ0C 3CXHJ 5JPNA 2CLVB 7PCYA 1R5VB 3LNDA 1H3UA 1GOGA 3ZGIA 2H32H 3TEUA 2GBTA 4PJCA 2EECA 3VSQA 2ATAA 5GHWH 1DJHA 2Q20A 4IMLA 4K5OA 4AMKH 5EUOF 2DJMA 5I0ZA 5AW6B 2GSMB 4LAQL 1UVQA 4P4KC 3QAQA 4WI6A 3NCFB 1UOKA 4G8GE 4J4PC 1P5UA 4G7VL 3O0RH 2V9RA 5DZ9A 4HK0A 3S34L 3W3BA 5JQ6H 3V4VL 1K8IA 3O6FC 3QUXA 4LDEB 4PTUA 3NCWA 1X5XA 3OAUH 1FBIL 4DEWA 1OKEA 2WO3B 4JY6B 3PV7A 5A2CA 2X6BA 3U6RA 4QRFA 3S35L 5BMFH 2XZQL 5I18H 3ILQD 3FCBA 1ZVSA 2NUPB 4KMTL 5E51A 4DGIH 5BJTB 3GMNA 3VRJB 3J2PA 5IVZA 1TZOA 2DQTH 1A1OB 2HFFA 4AH2B 4LLUA 4UT9H 4UT6A 2PCXA 3VNYA 1ZTMA 3QIWB 4TNVF 4U1LB 4ELMF 3EFDH 4YSPA 5ESQA 4ZUWA 5BZXA 2VL5B 3C5SA 3HNSH 3K46A 4NWUL 4W9LC 3PFUA 4Y19A 5PCYA 3ZZQA 3LKQB 1QVOA 2QFPA 1X5KA 4G8IB 3SOBH 4DTGL 5KYWB 2XIIA 4KJQD 1EEZB 1WWBX 3K5RA 3TT1L 2BNUA 1INEL 4OF6A 4HUUA 2FLBT 2JCWA 2Y4SA 3HG1A 1PMYA 4LKCB 2FNWA 3H4FA 3FAWA 5B22A 4D0CA 6FABH 5AD0B 5IEKB 5KYUB 4R7VA 1R3IL 2CCWA 2E7LC 5IW1A 3ROOA 5BRZA 2YWYA 5B1JA 4GQPH 4WWKA 3CU1A 1PVHA 2NY4B 2Y7OA 4LQ1A 3MVSA 4J28A 4M43L 1A6VH 4LVEA 2H0FA 1MNNA 1KCRL 1UM4L 1I1RA 1L0PA 2RH0A 1S3KL 4G5ZH 2DWEB 3RZCD 4PJDB 3KL3A 4M5SA 4WO4B 4ZFZB 4MA8L 1G4RA 1C16A 4DN3H 2VDRL 5FYKD 3OMZA 3WNPA 3DVNB 4YJZL 1G7PA 3VFMB 5LWYH 1MOEA 3BZEA 1LDPL 2YWZA 5DYOA 1I7ZB 5AVRB 1AO7E 1OP5H 3WY2A 1COBA 3QNXB 2NOYA 1J8HD 1TDQA 3MNVB 1OPOA 2ZCHL 4NPKA 5CP3A 5IQ7H 4URTB 5I1CH 3UBXI 4PRHD 2E75C 5EDSA 3W5MA 4C4KO 2YD1A 5T5NG 4TNFA 1XZ0A 2X4UB 5D1ZI 3H9HB 1NKRA 3KW8A 3E6FA 3MXWH 4K15A 4PGCA 4CJ0A 4ADGA 2D7QA 4O02A 1JL8A 1VFBA 3H2WA 5IQMA 3C6LB 5E9DA 1B4RA 2J8UA 3IDGA 1J05A 3D18A 4GI6A 5A2LH 4PGBA 4HPHA 4FD0A 1UADC 1CU4H 1CJYA 4S1SL 2XU9A 1F4WH 3JVGC 4Y2DD 3EBAA 3BPNC 4PS4H 4IKJA 3A47A 5AZEH 3UBXB 4PLJD 1KSRA 2F9BT 2IXQA 1MCIA 1KEML 3HN5A 3NPSC 2J72A 2H2SC 2FT6A 2IH8A 2OZ4A 2VLRE 1JUFA 4GKZB 3HNTH 3IDNA 4AMWA 3QUZC 3VD7A 2MNUA 3P4MA 3NJNA 4A7QA 3LH8A 1ZDQA 5D7LD 4WI5A 3V4PH 5FO2A 3ASWA 1MFNA 3ARQA 1BFOB 5LCVH 1QRNB 1NMAH 3LDBC 2K4AA 1FNLA 1U8NB 3QDHA 3ME0B 2OJZH 1MI5D 2OCFD 3BCDA 2FX9H 5ECGA 2EEXA 1UA7A 3WO3B 3EG9B 2YOCA 4LESA 3SY0A 1PSKL 2WO4A 5DJAA 1CIUA 4M8RA 5I6MA 1IO4C 4RZKA 2Z4QB 2F58H 3CIQA 4LEOB 3LRLA 3N40P 1D5ZA 5DZNA 3CFCL 2JJWA 3FOLA 1ZA6A 3L3GB 5I6PA 4JO3L 1DCLA 2WXLA 4H1LG 3FQXA 4AQAB 5D4HA 1YA5A 4YSQA 1FN4A 4H8HA 2OXHA 2W9EH 32C2B 2AEPL 3G5VB 1NGZB 4EOWL 5D4JA 2CRYA 3LKRA 5BS0B 3L3HA 5F96L 3N50A 3O9WC 4UB0L 2V17H 4L8BB 1E8WA 3P3UA 3REWA 1QFWH 4OCRH 4DQAA 5HGDA 2Y2WA 3AUVA 3KWXA 1BFOA 3QHZL 2IWGA 4I9WE 2J4WL 3HC4L 2VDMH 2DQEH 3FRUA 3I9AA 2R2EA 1JF5A 3LHPH 3M45A 3NCJL 3T4YA 5HXMA 4EN3C 1TETL 1BLNB 3MV9E 3QISA 4J3UA 43CAA 2DH2A 4I2XA 3L9RA 5GGVH 4ESKA 2E9IA 4ANXA 1H0DA 3ZE2E 3GSXA 3NJHA 5KUKA 2DIJA 3BAIA 3F7VA 1ZWIB 2BNRA 3CG8A 5T5FA 2DM7A 5D5ME 4PY7A 1MJ7H 2WWOA 1KT2B 1MF2H 1M1XB 4HUKB 4NUQA 1THCA 5E08L 5C0DA 4DKEH 1QPPA 4PWGA 2VW4A 5FFLA 4NWTL 3QI9D 2J8HA 1KN4L 1XWVA 2WCGA 2RGSA 4JHAH 4X6DB 2XRAL 3MRDB 2APVA 4JPQA 1E5BA 3CQFA 2ZUYA 4I18B 1TJHH 1O9ZA 2CDEA 2R2EB 3F7LA 4EBQH 1B3JA 1NFDB 3QS3A 1DE4B 4QT5B 3V6FB 4AYFB 5IMMB 3GBMH 2BK8A 4I13B 4CGUB 3CX5K 4G80A 1MFDL 3LXUX 4AKOA 2NR6D 4B3VA 1KTCA 4Y4FB 4YL4A 2BVUA 1XF4B 5E8OB 3I9GL 2PUQT 2ZG1A 2KL6A 4G11A 3S4SG 3N04A 1QKZH 4LRNH 4P3CH 4PRPD 3RFZB 5F93C 2BP3A 3TZVB 3AB0B 1M1SA 2YFNA 1L9MA 4APXA 3GSOA 4OQTA 3H3KA 2Z8RA 3BE1H 3LNIA 5EEXA 5B8CC 4JPVL 1JHKL 2E0PA 2MQ3A 3LEVL 3CV5A 3CX5J 4B6ZA 1R47A 2K45A 3U0PA 3FCTB 4PJBB 3E3QE 1J8KA 3BKJL 4BH7B 1B2WH 3MNZB 4FQJL 4PJEE 4R8WL 2J55A 4GG8A 2OLDA 3QR1A 4GAYB 3RPKA 1A7QL 1ECYA 1F6AB 2G5BB 1IC0A 1S5HB 4GBXD 3P73B 1D2OA 2YEVB 3EHBC 4V1DD 3TOPA 3QO1A 4JQXA 3HJEA 3FTWA 4JN1L 1I9RL 2UZPA 4Y89A 4FABL 3CPUA 4AE1A 4GAJL 1PZUB 4N2KA 1XT5A 4GT7A 3L7EB 2EDWA 3U9PL 3WHE1 3GRGA 3GSUB 3RWIA 2FIKB 4PIRF 2K7QA 2J71A 3HI5H 1UACH 4PREA 4OCXL 1VPOL 4LLDB 2BFGA 4HC1A 3FQNA 4GXFA 5DC2A 3CK0L 5I1HL 1EDQA 1GXEA 2AK4A 3SYQA 1H19A 3LRMA 5DRXB 1ZJBA 2WZPD 1OAYH 5ICXB 3V8CA 2A9ML 3WN5B 3O6KL 1G7QA 3CVHB 5EIVA 1ACZA 3DSNA 4GG8B 1H15A 3O45B 1WE5A 5LBSL 3QW9A 4DW2L 3IMRA 4NQSA 4FQXC 5DRZA 1I8IA 1DVXA 2WNXA 1TOXA 4KVCH 1J8HB 1NL0L 1WAAF 4KJPD 4NAQA 3IFPB 4PVNA 3EDDA 3TFKC 5MERA 1KGIA 2IF7A 2ZTBA 4NLHA 2A9CA 2HWZH 2F08A 3V0FA 2OULB 1G9ML 5ABDE 5F7DB 4MASA 4TF4A 1F1DA 3CFEA 3VQMA 3VMOA 3VQ1C 1D9KD 2P48B 1E7VA 2EE6A 4Y5YA 3RA7H 4MZ3A 4A55A 3IJHB 4DP6X 4K7PH 3H9SE 1NEZA 3NAAH 3PQYE 5ES4B 1F4AA 2NUTB 3MLUH 4LCWD 3JT2A 3M1CA 4M9OA 3GI9H 3CDZB 3D3VA 4JY5H 3RWEA 4NQEE 4J6IA 3V4VA 2NMSA 5CEZD 4EEEA 1KXTB 1HEJC 4QYOB 3L3JA 1LYQA 2JLLA 2J1XA 3DI3B 2AXJA 1YPZF 1D5IH 1IAOB 2H32A 5IB5B 3X11B 1LD9A 2YBRB 1YEJH 4JFDD 3HG1D 4ELKA 4NQCE 2YMXL 5DHYB 1HIMH 3QQ9D 1E9OA 4F9PA 1LEKA 3II3A 2XNAB 3TU6A 5FCUH 3RJOA 1BHGA 2EH8L 4JM0A 4YDVA 1JGEB 4B9KC 3MLVH 2DQGL 3DVFA 1AQMA 5EBWB 1J5OL 5FYKU 4PJ6A 3Q06A 4J39A 4KV5E 2X4SA 1D5BB 4LIQE 4OCYH 2MQCA 4UQ9A 1A47A 1ND0A 3PABB 3SD2A 1DDHA 3WKPA 4DK3A 3QORC 5GXBB 1SQMA 3ZKQD 2ITDA 1EO7A 2PPEA 3T4AC 3G6JB 2GSIB 4OIFA 5TDNB 2GC4C 1EAOA 3KVQA 2VXTL 1OTUC 2Z1KA 3ZYOA 3QDMD 1AZCA 2P5WE 2LAAA 4H4NA 4YWGL 4RNRA 4ZTEA 2YGPA 1KJMB 3QUZA 2Q3AA 3OKLB 4EZMA 4RMTA 4YQXH 4KPHL 5D5MF 2BXYA 2GJ6A 2P5ED 4KRPC 5GRJL 1YECL 5IMLB 5FO7A 4K3DH 4G8EB 2ICEB 2GIMA 1VACA 2QR0A 4DKTA 3WD5H 1RJLA 1DVFA 4EXPX 1OSPL 2WQUA 1KIPB 2FL5B 4ODHL 1BWWA 1MCDA 3ABMB 5EUKA 3UTTA 2B59B 2PKDA 4HSQA 2B2XH 4MD4A 3QDJD 3UPAA 5I74C 5E6RB 1I7UB 3BXNB 4GLRH 4U1IB 4RIRA 1XIWC 4Z7IA 5I30H 2XA8L 2WQVA 2AEOA 3HPLA 5ESAB 5TK4A 3QEGH 1T1XB 4GRWH 1OLZA 3SYPA 5L2KB 2EZ0D 3U79A 2E7MA 4O5LL 1ASPA 4NEHB 5B4MD 2D2CC 5JHMA 3R06B 2IOOA 1BMWA 3ARGA 4UAOB 3LZPA 2BW4A 2EIDA 4JLRA 3P02A 4EKJA 2IFFH 3KYNB 4HZLA 1JFHA 3L81A 4RGMB 1JD9A 1BV8A 2RALA 1HEHC 2VDOL 2EDOA 2H9GB 1JG9A 2K8QA 3S98A 3HNVL 1C5BH 1RP8A 2R0ZH 3HW7A 3MODL 5E6SB 3DO3A 1NCWL 1ORQB 1IIKA 2GY5A 2ZPKH 2C4XA 2HTLD 3HEIB 4ONGL 2KPWA 4NT6B 2GJZB 3T8XA 4N0CD 3VFGH 5AVXB 4OZ4A 4P2OB 2XSKA 2YMTA 4RFOH 3ZDYF 4K5MA 3MRPA 4OV6F 1R75A 2FEJA 5EC1B 1MPAH 3WAJA 4HIXL 5KOMC 3UXFA 1JGIA 1RZFL 2BFVH 1WBYB 2WINB 1JPTL 1PFOA 3LRSA 2ZXGA 4ACTA 4YXLL 3MRFB 2LU7A 3HZVA 3GMPA 3R4RA 4DKFL 3ZDZB 3VCLB 2WPGA 1X9QA 4LGPB 1MCBA 4EN2A 2ZXBA 3GTTA 3IN0A 1CT8A 1P7KA 3BUTA 1GS8A 2EDDA 2PYEE 4PJAF 1ZTXE 3H53A 4MJ4A 3RU8H 1A6WL 4JZJA 1KLUB 5I1AB 4CVZA 1DBJH 1ZPLA 4RFEA 3Q8AA 5CHNA 4J1UB 3L3KB 4UTAH 1ZAGA 2AERT 2XX0A 2A74C 1PX8A 3QXDA 5E8NA 4O58H 4XBEL 1NCAH 1DCEA 3PWPE 5LCVA 1E6OH 4OKVB