3GRGA

Crystal structure of the f87m/l110m mutant of human transthyretin at ph 7.5
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
116
structure length
116
Chain Sequence
CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPMHEHAEVVFTANDSGPRRYTIAAMLSPYSYSTTAVVTNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel Zn2+-binding sites in human transthyretin: implications for amyloidogenesis and retinol-binding protein recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Transthyretin
total genus 25
structure length 116
sequence length 116
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 3grgA00
1BM7A 4FI6A 3DGDA 2G4EA 5JIDA 1IIIA 1DVUA 1X7SA 1Y1DA 1KGIA 1ETB1 3ESNA 2ROYA 3IMTA 4L1SA 4TKWA 4DETA 5AKSA 3GS0A 4N87A 3FC8A 1BMZA 1TSHA 1DVQA 3IMSA 3IPBA 2TRYA 5HJGA 3CFQA 1ZCRA 3DK0A 4QXVA 5E4OA 2IGLA 1X7TA 1IE4A 4HJSA 2G2PA 1TTAA 4N86A 3I9IA 4PWKA 4WNJA 4MASA 3GRGA 5FW6A 3DK2A 5K1JA 5EZPA 4WNSA 4TL4A 4DESA 4IK6A 3FCBA 3CN2A 1GKOA 5L4FA 4QYAA 1OO2A 3NEEA 4IKIA 1TLMA 2B16A 4FI8A 3TCTA 4IKKA 3CFMA 2QELA 1DVSA 1KGJA 1TT6A 3CBRA 5CR1A 5DEJA 2H0EA 4TQPA 4ABUA 3CN4A 4DERA 3TFBA 5FW7A 4HIQA 3DJRA 3U2JA 5A6IA 4HJTA 4ABWA 4PMFA 1G1OA 5FO2A 4PMEA 1TFPA 4D7BA 2B14A 3W3BA 3P3TA 1SOQA 4ABQA 1IIKA 2GABA 1U21A 3DJTA 3DO4A 5CM1A 1ETA1 4DEUA 5CN3A 3KGTA 2H0FA 5JIMA 4ACTA 3IMVA 4TLKA 3DIDA 4MRBA 1E4HA 1SN2A 2GPZA 3GS7A 5CLYA 3A4FA 3NG5A 5AL8A 3A4EA 5L4IA 5K1NA 4PVLA 3NEXA 1QWHA 2H0JA 3NESA 4TQIA 1SN5A 4Y9EA 4Y9FA 5BOJA 3P3UA 3IPEA 3SSGA 2H1XA 4Y9GA 4PVNA 2G9KA 2NOYA 1TTBA 5IHHA 1IJNA 1BZEA 4PWEA 4TL5A 3HJ0A 1BZ8A 3GRBA 4TNGA 1FHNA 4PM1A 2F8IA 3Q1EA 4IIZA 4Q14A 5AL0A 1Z7JA 3I9PA 3IMUA 5DWPA 1DVTA 3BT0A 2QGDA 1THAA 4IKLA 1GKEA 4Y9CA 4DEWA 3DJZA 3OZLA 4MRCA 3U2IA 5E23A 1TTRA 2B15A 4TNFA 4PWIA 3KGSA 4HJUA 3ESOA 4PWHA 4TQ8A 1ICTA 5AKVA 1ZD6A 2ROXA 3IMRA 1TTCA 5E4AA 1DVXA 4AC2A 2WQAA 3I9AA 4TLTA 4I89A 4TLSA 5JIQA 4TQHA 5L4MA 4YDNA 4AC4A 3B56A 5CLXA 1E3FA 4PWGA 4N85A 3OZKA 3CN3A 5TTRA 2H4EA 1TZ8A 1RLBA 3M1OA 3D7PA 1SN0A 4FI7A 4L1TA 4Y9BA 1F41A 1SOKA 3A4DA 1F86A 3CFNA 4HISA 2QGBA 2G3ZA 1THCA 2G5UA 3ESPA 1FH2A 3QVAA 3DJSA 3GLZA 5L4JA 5AKTA 5FW8A 3KGUA 5EN3A 4WO0A 3BSZA 4TLUA 2B77A 3CFTA 4QRFA 5AYTA 1QABA 1TYRA 3D2TA 3GPSA 3IWUA 2TRHA 3CXFA 1BZDA 1DVYA 2F7IA 2G2NA 4I87A 4ANKA 4I85A 4YDMA 3GS4A 2H6UA 5CLZA 2B9AA 3NEOA 2FLMA 5CNHA 2FBRA 3IMWA 2QPFA 2PABA 2QGEA 3CN1A 1DVZA 4KY2A 4IKJA 4PWFA 4ABVA 2G3XA 3CN0A 3P3SA 3IWVA 3P3RA 2QGCA 4IK7A 2G4GA 4PWJA 4TM9A 4TNEA 4PVMA 1E5AA
chains in the Genus database with same CATH superfamily
2VDOB 4Z7NF 4UU9A 2WN3A 3APDA 5IHWA 3U7YL 2HJFA 2AQQA 1BG9A 3NJLA 4RBPH 1YVLA 3SZKC 1IBDA 1JG9A 3E6HA 2AJ3B 4KJYB 4PRHE 2WP3T 4O51B 3GBLA 3IETB 2ILLA 2X4TB 4OFDA 2W9DL 3OQ3B 4Z8FL 5FB8B 3UTOA 3N41B 1GAFH 2X10A 3HHSB 5DLLA 1QLEB 2V2XB 3IFPB 2EDYA 3JWNE 4PRIB 3FW6A 3HFFA 1KGUA 3FU8A 3QS3A 3TT3H 2IANA 1VRSA 2Z35B 4WLCA 3UZEA 4XMTA 5J8OA 4WHCA 3WFDH 3ZHDA 4RNRA 2V6HA 2R2EB 2OMXB 2CAKA 2EACA 4U6VH 3QG6B 2R8SL 4G8GE 3W9DB 3ZL4H 5TGBA 1NOAA 4DN3L 5KVEE 2BNQD 3WNLA 2AERT 1PLBA 5K33A 2XUWA 2NZIA 2AXFA 4Z7VA 3RZCD 1NCTA 1OAKL 4QHMA 1GYWA 4K94L 1QKZH 4OIBA 4F8PA 3N9GL 1SLVA 4UV4H 3MOAL 1AI1H 1AKJD 2R1XA 1UJ3A 5ES4B 5JPMC 1JN6B 4KTYA 3H7BA 3ZYZA 4L3EE 2DLHA 4NAMA 4XPAH 3I3BA 2XU9A 4CC1A 1A3QA 4PJEB 1DLFL 1U36A 3BPOB 3D05A 4JFYB 4ZOEA 3LHPH 1M7DA 4APQD 5JHBA 1T6VN 1LO2H 1YEEH 2VW4A 2WXGA 3IMUA 3OR7B 4UIMB 3ILDA 1BLNA 3P77B 4NKIL 3QYCA 3NIFE 2J88L 3MJGX 4XMUA 4PI2A 2RFXB 1A6VH 4P99A 1S8DB 1ZGLM 3T0EA 5F7BA 4U49A 1UA6H 4L48A 3BKMH 1NOFA 1TMQA 1USZA 3EF7A 4K94C 3D9AL 4J7RA 3G04B 2B39A 4ZK8A 3MDJA 1PX3A 1MHCB 1PZBA 3T3PE 3CVIL 2GIMA 3ZU8A 5FYLL 4F80A 3PAYA 1UWYA 3VD4A 1ZT1A 3BQUC 3HZVB 5EIVA 4EEEA 4S11A 3GJFK 4P2RA 1ITCA 1L5GA 1DUZB 1EAJA 2X42A 3N04A 4QHKI 2HYMA 5E95B 4CNIB 1TUPA 4U1MB 1JF1A 3SE4C 2W60A 4IEFA 5C6PB 1JWMA 5I1AA 4WI2A 4N0UA 3RUGB 1NBYA 2DYSB 2HJKA 5C9KA 1DVZA 4OZFG 4HOXA 1GVIA 1HQ4A 4TM9A 4UTAL 3QC5X 4C59B 3ETSA 1MAML 1TJHH 1GYUA 5I74B 3IXTB 4NKIH 1FC2D 3II2A 1ETB1 3ESNA 4WNQB 1BREA 5C0AD 4ZJ9A 2IANE 1TQSA 5B1JC 2W38A 3GTTA 1LHZA 5J3HC 4WFFD 3MBED 2X6VA 2P5WA 3PWJA 4E5XA 4JJ5B 2EDJA 3BWAB 2VUOA 5HHOE 5BV7L 1HQRA 3CLFL 1QBLL 1COBA 4JY4A 3CK0L 3TBVA 3INUL 1U4FA 3F04A 2O5YL 4IKKA 1K6QH 1NA8A 3IDGA 4K8RC 1OP5H 4D0CA 5BXFB 1KEML 2XBTA 3S36H 5TQ2L 2YLHA 4YDZA 4HUXA 3AS2A 2KLTA 4PRAA 2Z8VC 2QVMA 4ZTEA 5EBWB 2WKOA 5EF0A 3ZR6A 4ODHH 4QOKE 1YEIH 3EUDA 4UQCA 3QGVA 4ZX4A 4UQ2A 2IFFH 2HTKD 4P2RD 5DJYA 4HK3J 4Z6AT 5IQ9B 5L8KB 2GK2A 4N8VA 3H9SE 2OTWA 4PHXA 3L5IA 2YMXL 3WS6A 3OAWA 4P3CL 3MU3A 5E6IC 5HVHB 3TT3L 1KYFA 4OJYA 1NCGA 5TF1L 1KYOK 2WLLB 4UMSA 1N4XL 4QHNA 3QXDB 1Q1JL 2H1XA 4W93A 2PWFA 2YBRB 1AXSB 3GTVA 3RVXC 3US1A 1U8OB 4R8WL 3BQUD 4JPKH 5FR3A 1QRNE 3MNZB 5TF0A 3SPVB 5EU7E 1XHHA 5HDQH 1ACCA 3APMA 4PRIE 3MV9E 3U6XS 5T8IA 1TQCC 5LAXB 1EHKB 2XFXA 3FT0A 4U1HB 5E6RB 5FO8A 5B7FA 3SCMA 3ES6A 5C0AB 1WISA 8FABA 5F9JB 5JHLH 5AB1A 3G5VB 1EMTL 1FNFA 4BFNA 1EJ8A 1NGXA 1WE5A 3O0LA 4FFZH 4V2BA 3LKRB 1N5YL 5C7ZA 3B34A 3VFOB 2D9QB 3ESVF 2JI3A 3C6LA 4NUMA 4HALA 4PP2B 2EE3A 3SKJH 4NNXB 1RSYA 2G60L 3BT2H 3M1OA 3RZCA 3ZRCC 1NMCB 4DP5X 1YY8B 1JZ2A 2WLJA 1RMFL 1IVLA 1QBLH 4WV1C 2HJLB 5F1IB 1ONQA 4R7NA 1MNUL 3VU2A 4PJ9D 4F33B 1IUZA 1TLKA 4NRZB 1MXDA 4PRNB 4Z7WF 1W72H 2DTSA 3WELA 4K3DL 4XMPH 4F1ZA 2HKFH 3SPGA 2A77H 2MOGA 3BEWA 3LN4A 3PHQA 3TF4A 3O3EA 2CKBA 3SGKC 4ZMVA 3HJEA 1PZCA 4N8PA 4XNUH 4KKAD 1PZ5B 3PXHA 4Z78B 3QJRB 4O02A 3TT1H 1R46A 1NGWB 4H8VA 4JZNB 4Q4EA 3W57A 2FX8L 4L37B 4BUQA 3E2HC 2J1YA 2CO7B 4I4WA 2WYTA 3ARDD 5CWSA 2ITDA 4KMQA 1A7PH 3DV4B 2AXGA 5FGBC 2B5IC 3NFPA 3GDCA 3T0XA 1FYTA 3OKEA 3GSNA 2AJUL 4K9JA 4IK6A 4KJQD 1OPOA 5CN2A 4XNAA 1MCOH 5AOKA 4BINA 2K3TA 3QUMA 1GKOA 4LLYB 1X9QA 2GUOA 4FNQA 3LPFA 1WZKA 1ED3A 2DLFL 4WFHE 5AAWC 4KH9A 2VL5B 5MERB 3SDCD 2YRZA 4LIQL 4F2EA 1FNHA 3NABL 3JVFC 2VC2H 4FP8L 2BW5A 3IS0X 1MJ8H 4L29A 5DHYA 3RG1C 2ZD0A 2CCVA 3FQXA 4MAZA 2UVFA 2F54A 4LB8A 3QZOA 4WEBL 1ZIAA 3CX2A 5AW2B 1IGFL 1UA6L 4OKDA 2WXLA 3B2UC 5F89A 3ZKNC 5BS0E 2BVTA 3KEHA 3LHAA 4K15A 4J3TA 4XXDA 5IFJA 3IEAA 3BFQG 4FS0A 4K9EC 3I75B 3VXOA 6FABH 3BHBB 5I6OA 1XD0A 4PRIA 3NABH 5C09D 4PLOB 1GHFH 5AAWA 3D4CA 2Y6TE 3GSVB 1DQLH 4XPHL 1NGQH 3X3GH 4NRXB 4P8QA 5HXMA 3H56A 4ZAKB 4JM2A 5B38B 2APSA 4OFIA 4JN2A 4H4NA 1FNEA 4UM8A 1TZGH 5TDOA 3W0WE 4RMRA 1L7IL 3NRPA 3CLEH 4MNQB 4PLJD 3OPUA 4KUCD 4U0RB 1K9TA 1QKZL 4RDQF 1RUKH 3SKOB 3T0AA 5HY9B 5DEGB 3FRPB 1N67A 3B9KB 3TVMD 3B7UX 1WC7B 3FUNA 4WK2B 3SKUD 4C4UA 4MAYC 1Q94B 2XXMB 4M3KB 2Z8SA 1CFNB 3I02B 1D7DA 2B9BA 1BZ7A 4KWUA 4HEME 1EPFA 2AQRA 2ZKXA 4JFHD 2R1XB 2VISA 2BY2A 5HYJE 1VGKB 3QRFM 2CJSA 1TCRA 3VRLE 4LPUA 2X41A 3HZ3A 3P2TA 2HKFL 1YPZA 4BGDA 3P3YA 1HCZA 4A2HA 1OB1B 2YPVA 4JFPA 5T33L 4AV0A 1IBHA 3UTQA 4ODUB 1R3KA 1IFGA 3WSQH 1OE3A 4PJ7E 2NXYD 2CSPA 4PJFF 3WKNA 4ZX6A 4AEHL 4OUOA 4Y2NA 4Z8FH 4X8JB 3CE1A 1SMAA 4U4BA 1A21A 4PG9B 1N64L 3W9DA 1T0PB 1ZRUA 1X9RA 4TNEA 5DVNA 1N7MH 4GRWE 1NPJA 2DD8L 4QY8A 3UBXB 4JHWL 4OCXH 5KSVB 4MZ3A 3L3KB 3QNZA 4P9ML 5DRZA 2H2SC 3UBHA 4H2CA 3T6ZA 3KWVA 2QZQA 2PCPA 2APTA 4JKKA 4KRMB 4X83A 5CEZD 4B7LA 2ERJC 4XB3A 5BW7C 1DE4A 1CURA 4RIRB 2A4ZA 4LOFA 2X4QA 1SXBA 3I74A 4W9ZA 4HETA 2IF7A 3JWNC 3QDMD 3QQ3A 4YHOH 2KZWA 4JQIL 2DD8H 3UZVB 1XB8A 4LBAA 2Q8AH 2R4RL 2BVEA 4PGJA 2BVPB 2P24B 2VERA 3S8FB 2P44B 1RP8A 2DQHH 2P43B 2AQ2A 1JF1B 1OAQL 4K4KA 4G1EA 2A1WL 2JLPA 3L3JA 3DVNB 2H0EA 3LCYA 3LD8C 4RZCA 3GJFB 2Q20A 1JGUL 3ATAA 2TAAA 4NQXA 3UYPA 3ZE1F 5EBLA 4HOWA 4ABQA 2D7MA 1ETA1 1RIVH 4GSUA 1OK0A 5IQNA 3S48A 4ZD3L 4YH6A 4HUVB 4KNQA 4PG2C 5F3HB 3GS7A 4RGOH 2ARJA 3SJVB 4DVRH 2R0ZH 4IJ3B 4WJ5A 4JZJC 3Q01A 3EF4A 5D1XC 5C0IA 3PL6C 4R7VA 1PCSA 2PCYA 1IV8A 4Z5RA 4J8RA 1FN4B 4Z3HA 2YFNA 3X12A 4D9QD 3SBQA 4AQ1A 2JJTA 3CXDL 3PABA 1P7QA 1R24A 3N44F 2WVTA 4NPYA 3VWKD 4LNVA 3ZDXB 1H0DB 2F5AH 1DQJA 1QLRB 4OV5A 4Q58C 4EI5A 4NWUH 3UO8B 1FE8L 2DQGL 3FQTA 3HG1A 3LKNA 4WO4D 1MF2H 5SWQA 3O9WB 3T0EE 5DJYB 4ODXA 3QIWA 3RWGB 1X6LA 3GSRA 1KG0A 2VSDA 3QEQD 4ORGA 2FJGB 4JQXA 1SF5A 2E7MA 2GJ6E 1CXEA 1TJHL 3MRRB 2GIXA 4G1MA 4GSDL 5EPMB 1J05A 1IAIL 3FO9A 1G0YR 2NNXA 4X2UA 5T1LD 4PJDF 2UXTA 1F41A 1JVOA 3ESPA 3ZZ1A 2X70B 1OSYA 4APQA 5CZVH 4G6AC 4HPOL 2XX0A 4HOMA 4GFTB 4RX4A 1UVQA 1LEGA 3J7HA 5D2NA 4R97C 3QIUB 4JRXD 4FQJL 5I8KH 2H2SD 4ELKA 2VMFA 2WKGA 5CP3A 3GHBH 4CMMB 1JTOA 2VXVL 3E8UL 1CIUA 3Q2LA 3OKOB 3HBGA 3VM5A 5M7QA 2CO4A 3DUUB 3HMWH 4ILDA 3BZ5A 5I0DA 1LE9B 4YDLC 1AFVH 5HGAA 4RFEA 3MO1B 4BFIB 4AKPA 1QVOB 4F2MA 3V4VL 4WCYL 2BZDA 3T5WA 1MCEA 4X0KA 3HE7B 5EB9A 5KS9B 3DIFB 3VWKB 3CU1A 1I3UA 2FO1A 4OLUH 2LABA 5L88L 3HS0C 2NY2C 3MLUH 2Q7NA 1A8ZA 1UTDA 5TF1H 5JR1H 3BUPA 1J1OL 1I7TA 1N59B 3QXAA 5D5MB 1BFOA 3DBXA 4R96B 1DVFC 1AI1L 1NGPH 4U1NA 1PZDA 1BIIA 2DYPD 3BGAA 4KI5C 5CJBA 3ZT7A 4YHLH 2XNAA 5F7LB 4HV8A 4IOSA 5EU3A 5C0EB 3NSJA 4F58H 1YO4A 5LBVA 5L0QC 1DDHA 4AG4H 1YCSA 3EJZD 3L3IB 3EOTL 2WLIA 3FTGB 1Z3GH 3NFPB 4NI6A 2ORBH 4P59L 2PPFA 2QEJA 4K5LA 3AXIA 2B1OA 4U1SA 1GMIA 3GMMB 1FL5B 5BRQA 3OKNB 1CDCA 4MD4B 4L3CB 2O6CA 4L18A 2VN7A 3KYNA 3QJFA 1UZ8A 2FH8A 3TBTA 1SHMA 2GBTA 3B2UD 2BSSB 1G1KA 2EDKA 1EH9A 5B1KA 3TBCA 2YA2A 1V55B 2YD2A 4CJ0A 3PAVA 4DN4H 3UEZA 1I85A 2ZOUA 5IKCA 1BF2A 3DC0A 1BYPA 4HMEA 3FFDA 1XH2A 3RY5A 5J11B 4JDTL 2FNBA 3I9AA 1S7VB 1IARB 2F1AA 4FXGC 1I8KA 2JXMB 1C08B 3CPLA 4AENA 4JM0A 3S6CA 3BHBA 4YSCA 1FO0A 1WFJA 1BWMA 1L7TL 3BXNA 1L6XA 4LDCA 2X40A 5I6PA 2EYSB 3LQAH 5KSUB 1N8ZA 3KYMB 35C8L 4LRIA 4BQBA 3ARDC 5FYKD 5CU5A 2P48B 4P2QE 4B96A 1SLUA 4ANKA 1B4RA 1IGIL 4HHAB 3FRPA 1DN0A 2VDRH 4BIKA 4FDWA 3ZTJG 4GW5B 2ZUVA 1WPCA 4LRNL 1CDJA 4JR9H 1Z9LA 5FM4A 4JREC 3Q2CA 2BNRB 2V0AA 4OF3A 3RIFF 4OLWH 2H3NB 5ISZB 4RISH 1HX0A 5IMLB 2NNFA 4JFXA 2DLIA 5MEQA 1JV2B 2J88H 2YC1B 4BA8A 5AKSA 5K59F 3MYJB 4MTMA 5MENB 1C16B 4OGQC 3QSKB 4PJ9C 5E03A 2WZPA 3DK0A 3ARZA 3TM6A 5IROC 3VFWA 3DX6B 2R7EA 4H7VA 3OG6B 1U8IA 3FO1A 3K72B 3WHE1 4YSRA 5F9OL 5GGSY 1CK0L 1TEGA 2IC2A 5CGBA 2UY6A 4ZMAT 1IAOB 1OGAB 1CYGA 3SPIA 3WMPA 3GSOA 2A0LC 1ZGLB 1OLLA 2OTUB 1RJZA 4IOFD 2R0WL 3ARYA 1KLFA 3KCPA 5JW5A 5FF6B 1JGEA 3FT3B 5BOPA 3L48A 1A6UH 2GAZB 3GUFA 4ECNA 1A9VA 3P3TA 4LPVA 2GABA 4LF3A 3L08A 3QG7H 4JNXA 2C1PA 3VRJA 4UF7C 3ZE2B 3HZYA 4GP5B 4TLKA 2IWGA 2YPKB 2DEXX 2PMZA 2Q3XA 4B9GA 1RHHB 1HHHB 4N28A 1OLZA 3V4PA 1A5FL 4X8XA 4MKMA 1WDAA 4PLKD 1LO2L 3D25B 1BZ8A 5KBNC 2UZYA 3VDBA 3SBPA 1VKXA 2RQEA 5CD5D 3FB8A 2F8IA 3H9ZA 4HS3B 2PWGA 3EHBD 3HCVA 4OGXH 4PGZA 4L9LA 1Z9PA 2Q6WA 3WFHB 4UT9A 4PP1D 5EEZA 3EO0B 3G5XB 4QTHA 4TQ8A 4GKNB 5IVZB 1LXMA 3G5YB 5T3XH 4F1SA 1J86A 4JREB 5DJDA 2V8LA 4BRJA 5AUMA 1BXVA 5DO8A 3QAZC 1CF8H 4NI3A 1Z9SB 3TA4D 4W68A 5IF0B 3FUMA 3B7SA 4HEMA 3HB3B 1TTUA 2DBLH 2K9FB 5LB1A 2NY4C 2Z93B 4DVBA 4F9PC 4DZ8A 5I1KL 4JFUA 4AJYV 4AM0B 1TQBC 5DJ6B 4TLUA 5GGQH 1E2ZA 1ECZA 4FQCH 3IWUA 2XN9D 3LKPB 4MQXC 1JPGA 3MRBA 4B5EA 3MLPA 1G7HB 4ZUSA 5JW4R 2RALA 4IJ3C 2X2HA 1F02I 2O6PA 3ESMA 3EFFB 4FQ1L 3VI3E 5JHDA 4NBYB 2X4SA 4A2FA 2DV6A 2HVKA 1XZ0A 3OZ9L 5IOPB 5C3IA 5DVMA 5DGRA 2NT0A 4KK5D 3LZPA 4HBCL 5FAAA 4LLDA 2JELL 5HDQL 2BHUA 3V6ZB 5DR5L 4ANUA 5EZJB 5C0BB 3EGXA 2DH3A 4QHMB 2M8XA 2GC7C 1YEFL 2EIJB 3SPJA 3NFNB 4C57C 2XIBA 2RHEA 3PJLA 1T5WA 4CVXB 1D5ZA 1WTLA 5HHOB 4YDJB 5BZXA 4HU2A 1RIHH 2DQ6A 5IB4A 4PJHB 4ONFH 4L1HA 1KJ2B 2YMXH 1IGTB 4YDIH 5GZND 3DROA 3DX3A 3QDGD 5DRWA 4UM9B 1HN1A 2W88A 5IBTL 4EKXA 4NQCA 2JJTC 1QNZL 3S4SA 4EDXA 3GHBL 4A63A 4W9LC 5H94B 5BQ7B 1I7RA 3DO4A 1CF1A 5A7EA 3FQUB 1FZJA 1ZHLB 2JB5H 1SJEB 1HXMA 4CU6A 3UZQB 3I6LE 1CFSA 4KITB 3RB5A 2WK2A 4KTEH 1VCBC 4PG2A 3KXFA 2X4NB 1LNUA 1MHCA 1CT8A 2ZAGA 5FHBH 5BV7H 1QWHA 1MFVA 2X9XA 1D9KD 3I2CL 1K5WA 2J8UE 4UT9H 3UTZA 4HCRH 1WBZA 2R0KL 4NIKB 1DEDA 4WKXA 5IK3A 3RZCC 2XN9E 3HA0A 1TSRA 1PKOA 3PHSA 4NO0A 1D7FA 2R59A 2Z9TA 2X88A 1CI3M 1BOGB 1NBZB 3SYPA 5DD3H 4EXPX 4GG6B 2Z0BA 2OSYA 4WSGA 1OCWL 2WNGA 3ZIYA 3EJYD 1B3JA 2ODHA 2DQUH 3EO1B 4DUWA 1AO7B 1KUMA 3QJSB 5JOFB 2F8XC 2WLIB 5E8DL 3EDDA 4JRXB 2QSTA 4TPRH 1Q0EA 4OI9A 1GOGA 2DQCL 2QPUA 1AYOA 4ZMZA 2ENPA 2OSXA 1AXTH 1QSFD 3KNBB 4PJIB 4Z7UB 5BW7A 2VDRL 1MCNA 4WY7H 2DQJL 4BSJA 1G9MC 2I27N 3QVAA 4TUKL 3QEUB 3SJVD 5IB2B 4DQOL 2UWEE 5HYQB 4OZFB 4NZJA 1T7XA 5D5MA 1D3CA 3VFUA 5CLZA 3AXHA 1R19A 1D6VL 1KELH 5JW4N 1YDPA 3HE7D 1ACYH 2KMWA 4NKOA 2ATKB 1R1CA 2QSCH 3RL1B 5BZDA 2OJEB 2FIKA 4LXFA 3O41A 2JNZA 2Z31B 1KPRA 1A6VL 1BJ1J 3FUIA 4DN4L 3R1GL 5FHAH 2CLRA 3NUKA 1BQRA 4NC2B 2AXWA 2X6BA 1JHTA 1OAQH 3IKCB 5I0YA 3EAKA 3IPBA 5DK0A 4NT6B 4AI7A 1AJ7L 2CJUL 2NSMA 4QJ4B 1MWAB 2D31A 4Y4FC 5D7SL 2LLGA 2ZSVA 4X6EA 2MTPA 5D96C 2CA4A 1TR7A 1EFQA 1H6TA 3KYNB 1J1PL 3LS5H 4HIPA 4FYQA 2LU4A 3FKUS 3H53A 4H40A 3CZJA 1X6NA 3QG6A 4NJAH 5FUOL 5C09A 3VCLB 3VGDA 4FQXC 4HLEA 2ZX7A 3CBRA 4XMLL 3WL9A 3LEYH 5HHPA 2Z31C 4S0SD 2A9NL 3EJPA 4QJ3B 4C8XA 2Q2EB 3KPOB 1MI5B 2CXKA 3F3HA 5LBSA 1SEQH 1LWJA 5LAXA 3BH8A 5EO0A 5JOPE 5DQ9B 5JXEA 5KZCB 4PCYA 1AHKA 4DEUA 2B2XL 4HPYH 1EGJL 1UA7A 5GS1A 1JCVA 1GS8A 2F8OA 3C60B 1G7PA 2PETA 3IFLH 2M83A 4JHAL 4MSWB 5E8EA 2X1PA 2QADC 2QDWA 4R84A 4HGWB 5F8RC 1NC2B 5EU6E 4QYOB 2R2EA 2VZUA 3IPEA 4EI6A 2W0FA 1H6FA 5L6YL 1UD8A 2DQEL 3EOAB 2HTLD 1P4LA 3F58H 2J4WH 1T21B 1EAQA 1NFDB 2P8MB 3KG5A 4UTBL 1G7LB 2BCKB 3OBAA 1JHKH 2ED7A 2X4PB 4H1LA 2N56A 4JO4L 1NGZB 3PWNA 2HWZL 2BNRA 3ZDXE 1WFIA 4Y2OA 2H3NA 2WWKO 2W0KA 4LMQE 4G5ZL 3EBHA 5D2NE 3LV3B 3U2IA 5K9OB 4P23B 4N20A 4K7PH 3SQBA 2OCJA 4TNFA 1YNTF 1XXFC 1ZD6A 3DSFL 2BS8A 2X2YA 1U3JA 2OR9L 3LZLA 3BZFA 3O3BA 2WQAA 1AC0A 3AQDA 4AUYA 4YO0A 3SY0B 5D1QD 3C5ZB 1A8JH 1Y6MR 5I8KL 2R69H 3SBWC 2XXGA 5I2IB 4Y2DA 1F8TL 3HNVH 5DS8A 5F6IB 4JM4L 2AEPL 5GJSL 2A7BA 4XPHH 5D55A 2NXZC 3X3GL 5L4JA 2L3BA 4BE6A 2FTAA 4J8QA 2ZUQC 4JVUA 2PXYC 1SQ2N 2PYFB 1S9WA 3GS4A 1PLAA 4JY6B 1AC6A 3BWUF 2J5WA 1XB3A 4OUUB 5CIPA 3UABA 2IDUA 1KJMB 1HDMA 2P45B 5ACMA 4ZTPL 1AQKL 2IVFC 1K4DA 2Y06H 2GSIB 3EJSA 1PDKB 2GTWB 2GT9B 2JB6A 4Y4FA 3NSYA 1ZHBB 3SEPA 4PJFE 5DJDB 3LH2L 4GKSA 4NAJA 5DRXA 3AC0A 3TH2T 1DJWA 4FYRA 5DFAA 3WD5L 4E5XB 1PSKH 1CG9A 1UOVA 4LHUA 2D7TH 3NIGE 4JE0A 5EZIL 3C60C 4HAKA 4I2XB 1OHZA 1RUML 1JYWA 2WBJC 4JUSA 2VLJE 1CD1A 5EWIL 4ZMLA 1HXKA 2WTRB 4DJMA 5CAYB 3AY2A 5E2VH 2R1WA 2MCMA 3KM1A 1KBPA 1PQZB 4OLZH 4TQPA 4H5SA 4NFCA 4QHLA 5TJWK 2QJDA 3U2JA 3JV4A 4QUOA 5MEOA 1G9NL 1XR9A 3KPRD 4OB5L 5LGJB 3OB0K 4U1IB 4NCDA 4U1GC 3CMGA 5FOBB 3V4VB 5K5YA 1TDQA 2EH8H 3ZDYE 5T3ZD 4HAFA 5CZKA 4GP8B 1BFTA 4M93B 4WUUB 3VGGA 2A6KB 4ZBJA 2CHWA 4NWTL 3ETTA 2OI9C 4K3EL 1E4JA 1SHSA 1QW8A 4APXB 5A1AA 3U0PA 3GB7A 1BXAA 1M05A 3F6LA 3SCMB 4GH7B 1B0GB 3OG4B 5C9JA 1XDTT 4PRHB 1NAMA 4RRPA 3D69B 2H6PA 3EDJA 4MZIA 5IQ7L 1LO4L 1KEGL 2I32A 4Z7QE 4PN6A 3E38A 2F68X 3BD5A 3RJQB 1IGML 3GHEH 3RAJL 1HCYA 1PAMA 4NPJA 3QPXL 4XNBA 1RK7A 1OTSD 1ZSHA 2DI7A 3E3QC 4GFXA 5B1JA 2ED6A 1T0MB 2DMKA 2A77L 1INEH 5DO2D 1UT2A 3WE1A 2G3ZA 4P5TA 1XGPB 4QXGH 2ENSA 1XX9C 4K5NA 3T08A 5I1EL 1RURH 4GW4A 1IM3A 1YYCA 3IRPX 4Q0XH 5LGHH 2WMPB 5D93C 4DO5A 3CWGA 3GXIA 4LNRA 3WTYA 3FQRB 5T3ZE 8FABB 2BNUB 3FUDA 1O5PA 2YOAA 1L3WA 3ARGA 3MRCA 3S4SB 3SE4A 4HFWB 3DARA 1KV7A 2P80A 2VXSH 1NFDE 4HIJB 3WFZA 1FLRL 2DOCA 1BFVH 2LGNA 3QO1B 1CN4A 3NCBB 5KSBE 3T0WA 1S2EA 3DETC 2VCOA 2B3IA 3DMMA 2AJYH 1WJ3A 4OCSH 3GS0A 4NJAL 4K5MA 5CJQL 4NBZB 5F3BA 5KSAC 4GG6F 1H19A 4FXLA 3T4AB 3CJJA 4I18B 4PJCB 1OCZB 2XZQH 1MRDH 5FYJL 1OWWA 4N6RA 2CO1A 4HLJA 2WZ0A 1T89A 4PV9B 4YX2L 2F54E 2OMBA 1IC5L 1KTLA 3BE1H 3H2QA 4LDEB 5D6DA 3TEUA 1ZV9A 3WIHA 4PW9A 5JORB 1RI8A 2B16A 5I9QB 3NZHL 5EIQA 5DHVA 2CIKA 3S5LB 2R2BA 2P5EA 5J6GB 1CTMA 4KGJA 2FIKB 3FOLA 5IJDC 5JW3L 4ZMOA 2GSMB 4ZOBA 5GHWL 1F4WH 1AO7A 1WA2X 3QCVL 4P04A 4R83A 4ZRGA 2E7LA 4NHCH 1DN2A 1BQKA 4F91B 3NGBB 4JCLA 4NDMA 1KJ2L 2NLJB 3HZMA 1FIEA 1OV8A 1MWOA 3IMVA 3L4WA 4M7KH 2J71A 4YUEH 4R0LC 4MWFB 4LLAA 3KYOA 4C56A 3V79C 3MCG1 2C4XA 5DC0A 2BMKA 2QKSA 5IHUH 4UILH 4F7TB 5SWSD 3ILPB 3K5SA 1FORL 1IZKA 3TNMA 1HEZA 1E5BA 3BEWB 3PHQB 4LCCA 4L9LC 3TEZA 4WHTB 2QBWA 2JFCA 8PAZA 4OBRA 4MJ5B 4AQAA 1TJIH 4NKMA 4V1DE 3U4KA 5DUML 4PM1A 1C1EL 2RIKA 1TTGA 4Q14A 1KWKA 2HX8A 4OLXH 1DVTA 2V9RA 3KH3A 4OZHB 4Y4KB 3UACA 1FNSL 4GQZA 5F89B 2YAFA 1SY6L 4LGSB 4NUGL 3EGSB 1Q94A 2E3VA 5CWSB 2OMWB 1PNDA 3BN9D 2V7NB 4FXKA 5B22A 4I3SL 2B1HL 4ZQKB 4L8DA 4Y19D 5TPWL 2FK9A 2ALAA 3BGFC 3QISA 4X5XB 3SN6N 1RURL 1QEXA 3LPGA 5EIIG 4UANA 3MLTA 4W4NA 3UGUA 4JFPB 1ED3B 4MMXC 1ID2A 1FNEB 4UM8B 3NJHA 1A7BA 4XWGL 4UNVA 1S78C 1JMXA 3D30A 4HUUB 3C75A 4Z9KB 5FK9A 5FHBL 5I24A 2NZ9D 2WOBA 3ECQA 1D2OA 4LCUA 1YYLL 4FMVA 2NR6C 2EJ1A 4XO8A 5AZ2H 5KVMC 2NDFA 3T1FA 1OALA 3UG5A 4YNYB 4O5LL 2QPSA 4KO9A 1E5UI 3C6SB 4D3CL 5IQ7H 3BFOA 1UXWA 1ZS8B 2OMUB 1DHKA 5KUKA 3EJZC 3P3SA 1ZVNA 1DBBH 3BZFB 1BM7A 3BW9B 5I1JH 2G4EA 1EZVY 4YO0B 2WVSA 1ES0A 3SHSA 2OKMA 2DWDA 4HV8B 2XTJB 3DDFA 5E1HB 4DP9X 4X99A 3BKML 4HKJA 1GH7A 4Y16B 4RGNB 5DC9B 2BC4B 1QR1A 3BIKB 2FGWL 3SGJA 4UT7L 3VJ6A 5KYXB 4MA7L 5MENE 4N8CL 4XC1L 3OGCB 3WTWA 4XN4A 3CFEB 3EOBA 4GB9A 4LEXL 4AGQA 1DLFH 2IAND 1BVLB 3O4LE 1NOLA 4V1DD 4QY8B 4NGHL 3QT2A 2NY6D 2VAJA 3DSNA 2A6JA 4G9FD 3O6FB 1ADWA 1JJUA 4ADGA 2HT2D 2IFFL 4PJAA 2YSSB 2YAMA 3SIKA 1BP3B 2JB6B 1YEHH 3MGOA 2IH8A 4YSPA 1KN2L 1S3KL 5KVFH 1U58A 1U21A 2I9TB 2YUXA 3H9SB 1LP9E 4NQEE 4IU2B 1M71B 4Y5YC 5IT2H 1S7WB 5IKCB 2NMSA 2IQ9H 1WTGT 1KEMH 5EU6D 4DPBX 5IGXH 1I85C 4NOBA 3BGFB 3TNNA 4TULL 1JV5B 3F65A 3TJEL 3B1TA 2IDCA 4XN2A 2W80C 2VR5A 3RLSA 1RULL 1QNIA 2JCCA 2X3CA 3LEXB 3JWOL 2H26B 5IV2B 4JY6A 2VUYA 4XRCA 5B3JE 1CCZA 2BSDA 3STZA 3LIZH 3LTVA 2ZWKA 1Q4NX 1Z7JA 4IGBD 4PJAE 3FQNA 1GAFL 1BEYH 3CTTA 3N85L 1G43A 3MUZ1 2DEWX 4AEIL 4CDHA 4DQAA 4ICXA 5IW6B 3TIEB 2EXYD 1BOYA 4OFKA 1A14L 1WYJA 2AQPA 5AAMC 4GQ9H 5EA0H 2K3HA 3KGSA 4AIZA 3WY1A 3GSXB 1I9IL 1V7NH 2FL5A 3A21A 2VDMH 2Z0UA 2TSBA 3E7JA 4AKQA 1WD9A 1W80A 3P69A 5GJTH 2V7HB 1RZPA 4V1DA 4UINH 4FNPA 2G5RA 4CKQA 4QHUA 4ZODA 3WENA 1EIBA 3IDIA 4JKWA 5K9KB 5ECGA 2AITA 3KLAB 4HOZA 4BXVA 3DX6A 1DVFA 1U93A 3FUJA 2VUKA 4PHZA 1QABA 3LS4L 4M8VA 3DO7A 3OKDA 4BDVA 1GMEA 4DGVH 3DSFH 3GMPB 4XVTH 1QASA 1JPTH 3IJHB 1A9BA 4ABVA 2XVKA 1XB6A 4JW3A 2J5LB 3T2OA 3VI3F 1XBRA 1MCPH 32C2B 3IWVA 3S8GB 4HIXL 3BKJL 3T2QA 1QBMH 1HZLA 2R69A 4JE4B 2WNWA 2ZIDA 2EE2A 4KH2A 1JHKL 4LOVA 5B4MC 3WDHA 1ZLVK 3TFKC 1V54B 1IX2A 2PW2B 3L3GB 5EMYA 2VO5A 2ENYA 4BM7A 1H9VA 3X2QB 2AEQH 3VXTB 4BFGA 4EZMA 4ZFOA 1QWUA 1KXQA 3O0RH 1ZTXH 1N0XL 2DLTA 4X4MA 5D71L 2WVUA 3RFZC 1D7CA 2ARJQ 5J1SC 2EH7L 1TJGH 5DJ8B 1K8IB 4PLNC 2SEBB 3ECVA 1QFOA 2B2XH 2IOOA 4X6DB 1NCCL 4JG0H 4JS7A 3VD0A 1KIUA 3ARGB 4NO5A 2UZYB 3IB4A 4ONGH 4JLRA 3VXUB 1FSKC 4O2CB 2D7PA 2I07B 1DDHB 4OZIA 3WHE0 3VYPA 4MDIB 3BVDB 2F7RA 4ENED 1Y18B 2CLZA 3GT6A 3LZQA 1A1NB 2H3XC 3RWFB 3QYMA 5CINL 4JQXC 2BZCA 4YHYC 2I60H 1DCLA 4YOKA 5E2UH 5FDWA 2RD0A 3LQAL 2HG5B 5HSFA 2AKRB 2YJLA 3KPRE 2OJZH 5MP6H 1SN5A 4GRWH 5GRJH 5KTEH 4X6CE 1JNHB 2OBGA 3L1GA 4DKEL 1J8HA 1TVHB 5IQMA 2VJ0A 3MLRL 4PY8J 2NSXA 2XY1A 3CH8A 3MRCB 5AL0A 2R2BB 5IFHH 3PCYA 1SPDA 2QDVA 4JFQB 3L17A 4PJGA 4WK0B 3GTNA 3OKYA 2FJSA 4E9VA 3H9HB 1TO5A 1LEIB 4PJIF 1DJGA 5E1AB 5BVPL 3HC3L 1TTCA 1AP2B 2CG9X 3ET9F 3V7AE 4PB9L 3P30H 3GMMA 4R90H 2GG1A 4Z7UE 3GKZA 1OCCB 1BZOA 5HDBF 5C2BL 1PL3A 2NUTB 1TZIA 2XTLA 2VRKA 5D7LD 4LCWB 3BEVB 2ADFL 1O9ZA 5JZ7D 1NBVL 1ZV5A 5I17B 3VFRB 3ARFC 4S1SH 2P4AB 3S5LG 1GPOL 3V5DB 4LEBA 1OCWH 1CDBA 3SE8H 2RR3A 2ZICA 1JGVL 3K2MC 1JGDB 4TUOA 4MS8D 4XNYH 3DV6B 4JHBA 4ELME 3ECWA 3KBFA 4LAQH 1UZ6E 2QQNH 3IAPA 4MA3B 3RPBA 2VZ1A 2YFOA 1FPTL 3TF7C 3H42H 3C87A 1EHAA 3GNML 3G6JA 2I85A 1HL8A 4IBVA 3CQQA 3IE9A 4ZUWA 2DJMA 3MJ8B 5A2JH 2AGJL 4LCUB 5DJCA 5IUCA 5FW6A 4A7TA 1B2WL 3KPSD 4FL4B 4HC1A 1JGVH 2C26A 1UD5A 4AJWA 2VZVA 3NJVA 3KCPB 4L2LA 4XCCH 2Y07L 1JHLH 2K7QA 5G5DA 4Q56A 4MJIB 3SOBL 4X4YA 3CVHL 2G2RA 4OSUL 4W4OC 1E5YA 1O7DE 1UGNA 2OMWA 3PREA 5IBTH 3A6CH 1PG7H 1F3JA 2F54D 3HE6B 4F8LA 5DJ0B 3RIAK 3F84A 1CUOA 2L7JA 1I9RH 5I1HH 1Z6JT 4YR6B 4LVHC 2E5EA 2YQBA 1WBXB 4LSSH 4RGMB 4X7TB 1YAZA 1CGVA 4YZFE 5A7BA 1B2WH 3GZKA 4HUUA 4KKBC 2AJZA 2VZTA 5SWZA 4PJ8C 1NSNH 3U30C 2ZQKA 3NESA 4Y9EA 4WEUD 1WHPA 1KLFB 4OQTL 4H13C 1P4IH 4C4BA 3IJEA 4KVNL 3SDDA 1T20A 4J1UA 3D85A 1Z5YD 5LXGL 3PP3H 4NP9A 3I85A 5KVEH 3CCHA 5DHXB 3B9EA 2A73A 4LBEB 4DEWA 2XQYG 1UENA 2QKIB 2C9VA 5IVZA 4QXTB 3DXAE 1NPNA 4MDJA 4TSBH 3PGFL 5LCVH 3K6SB 1XCQA 3IMRA 1Z9SA 4FKEA 1DVXA 5HBBA 2UYLA 2I60L 2BPBA 1MCSA 3RIAF 3TYGH 1S7WA 4HIHA 4X4ME 1WD8A 4AYFA 4FEMA 3KLSA 2JQMA 2OTUA 5GSRB 1TZ8A 3D7PA 1VACA 3E8VA 3FT4A 3FCSB 1ZGLP 3ARBB 2KL6A 1FZOA 4XCYB 2EVHA 2AVFA 3ERXA 3FCGA 3CDGB 4N2BA 3P0VL 3NA4A 3ZDZB 4D0DA 4J3OC 4UCFA 2XG5A 4BEIA 1B4TA 4Y5YB 5CUSL 5AEAA 1E6OH 2E8ZA 3STZB 3O3AB 4H25B 3G6DH 1RIVL 4XBPA 5EF2A 1EZVX 3HZYB 1JDAA 4RMUA 3KYAA 2AI0L 5I19H 1ZT1B 2EH7H 4IKJA 2IH1A 3ULUD 4XB8A 1AHWB 3H3KA 2DLEA 2E86A 4V1DB 5CSBA 1KTBA 2X0UA 3ABLB 2FE0A 3HE6C 5CJOH 2H8PB 1QLEL 2FO4A 1OGSA 4MQXD 4MA7H 3T0EB 4UDUA 5IB5B 4KQ4L 2PYEB 3MJ9A 1U8MB 4JBSA 4FHKA 1PU0A 3LSOB 2I69A 3BKJH 3KR3H 4CVXA 1F6LL 5MEND 4I2XE 5IMKA 1MH5A 5KJRL 2DB8A 4Q2ZB 3VXMB 1J5OH 3ATFA 4UM9A 4KKCD 1H3VA 3OAZK 3OXRB 3LS4H 3BRDA 1OARH 1BBJB 4MS6A 2BIQA 1G7LA 2BCKA 3GXMA 4L1LA 4MMXB 4R26H 4U6YB 2CBMA 2VDPL 4AV4A 3GRWA 5EOQL 5E2JA 5C0GA 3K4DA 4IRSA 5GSVA 1MQKH 2VQ1B 3E9TA 3BVNB 2M2DA 5BCAA 5KANI 2VRQA 3KM2A 2E6QA 2HJLA 1DJZA 4ZI8A 5FKAA 2P3YA 1CGXA 4NM8L 4PRNA 2E27H 4JZOB 1BD2D 4JHVA 5BZWB 3MFFB 4FLHA 3U1QA 1X9UA 4QT5A 3TBSA 1GZHC 4I5BB 5EF1A 2Z92A 3Q8EA 4Z0XA 4KKZA 5CJXA 4PRBA 4H0HB 3FT2A 1C1EH 3BH4A 3KDPB 2NY6B 3PPEA 1PG7W 1YN6B 2XIIA 4JFFE 1S7UA 2NY1D 3HUJE 4ACPA 5E4EB 1MSPA 4XVTL 5AKVA 5JA9A 5J6HA 4JPIA 5J13C 2FWLB 2C4FT 2DQIL 4HBQA 3W9EA 4ODSL 3G6JE 3BKCL 3WJJC 1KGCE 4FOMA 3QUMB 1JVKA 5EBWA 3RGVC 1XSOA 3FRUA 3FUFA 5E8NA 1YEHL 3FB5A 1WFUA 1SMOA 4G8FA 5D7IA 3MRDB 5KVFL 5LQBH 1MCLA 2H45A 4QRUA 4M43H 4AK1A 5I76B 1JYXA 4EUPA 4FZEH 3O2WL 4PCTA 2EIEA 3HB3D 4HK0A 3MRQA 4MXQD 5DD6B 1SYSB 4MX7A 4G1EB 4R6UA 3EJCA 3KHQA 5BQ7A 2IPKB 2D0HA 1KFAH 4FQ2H 3VYOA 1I9IH 4O02B 2BM3A 2WIMA 5BRZE 3FN0L 1F3DH 4BGLA 1F13A 4KQ0A 5D4HA 1FG9C 43CAA 1ZVSA 2FT7A 4XMVA 3MRMA 3BUYB 4BFRA 5I1LA 3TEYA 4AKOA 1FJ1A 1KF9B 4HUCA 2BP0B 4XP1L 1IEHA 3K46A 1KCRH 3KPPA 3ULUC 3IKCA 2OL3L 3C8KB 3QDJA 2DYPA 3GYRA 2VITA 1WWBX 3CSYB 4OD2A 1QYGH 1WK0A 3I3EA 1JCKA 2NX5B 3CZLA 1C12A 1G7QB 3GZOA 5J7CC 3NRQA 4JFZH 2YD0A 4JMNA 1ZLVH 4IM8A 5DUJA 1XXDC 1HKLH 4YHML 3C08H 5C09B 4RGND 1S9VB 3TA3D 1DQJB 3ULUL 2WBJD 3NPSB 1HHGB 5MEPA 1UGKA 2PWEA 3WTUA 1OE1A 1D7BA 1KN2H 1UACH 4X7EC 3S35H 3NJFA 4A7GA 1MFEH 1U95B 1WUNT 2LU5A 2X87A 4KHXH 1QO3B 3ZDZE 3U0PB 5G2NA 3FH7A 4XHJD 1JNNL 4KMLB 5DI8A 1ITBB 4G9FB 1QSVA 4UNUA 4ZAKA 4TRPL 1A6AA 4QXGL 3L6FA 4XP9H 5E2TH 2ZG2A 2YEQA 4HKBB 1BF5A 1FZMA 1RK0A 2EIZB 1NCUA 2WNXA 1T1XA 4OFYA 5D1QE 3OMZA 4AQEB 1Q8MA 5DQJA 4AYDC 1AHMA 5EEVA 4EI6B 1MW0A 1QW9A 1ZANL 1JXDA 4V11A 3VCLA 4FJ6A 5KS9A 2Z3FA 5HYJA 1UACL 1A22B 3A4AA 4UWQB 1ZWIB 4Z1PA 2NXZD 4TL5A 3N42B 4HUKB 1H6UA 2PP8A 2ZCKH 3F7VB 2OXHA 1MVUB 1IQWL 3FCTA 2R9HC 2FH6A 1T7YA 3JWOC 3LV3A 3VFGL 1HHKA 3U79A 1E9QA 1EJ6A 5IWLC 1YC7A 1UJ3C 1I75A 5C0BE 4DUXA 3DX0A 4PREA 1KXQE 4NUQA 1URIA 4I9WE 2RQ8A 5B8CA 4L5FH 1TFHA 4JO8A 1P6FA 1INDL 2A83B 4PJ5B 1KIRA 4P4KA 1M6UA 1XIWC 2IMNA 5ID1A 2W0FB 1OAUL 2F53E 5F88A 1KJ2H 3LRHA 4Q6IC 4PG9A 1WC7A 3FJTA 4MZ2A 1KB5L 2CBTA 4YDKH 3LN9A 5FCSH 3MA9L 4JKPH 3BSZA 5G5DB 5I71B 4ZFZB 1QRNA 3QQ9D 4U1JA 1F4YH 4KRPC 2FJHA 3UBXG 3SQBB 3OAZH 3QPQC 3V55A 3DLQR 2WHVA 4O9HH 5CGYC 1UM6H 3AAZA 1MDTA 1QFWM 1YPZB 2K7PA 3LXBA 3C5JB 1SY6H 1TTFA 3VGAC 5CFAA 3DIVA 1JZ3A 2VABB 4MJ2A 5EN2B 3KWWB 4OLXL 1FNLA 5CZXD 3OKMB 4TVPD 4ODSH 2XYCA 4L8SB 3T8XA 4YBQC 3EW3B 4AMKL 4QO1B 2VLJD 3AROA 1X5IA 4NDMB 1PSKL 3ISWA 1OSPH 2WUBL 5JZ7C 2QHRL 4AMXA 3BC9A 5I6NA 5KVDL 2YGQA 4DAGL 3GUTA 4U6HA 5I71C 5BUAA 1KBBA 4D0DB 3HNSH 4DESA 3R06B 2WIIB 1A64A 2VE6A 3N43B 3K1DA 3L3HA 4NQQA 1U2YA 1TCRB 3DWTA 2EUWA 2YD3A 3TBYB 1EAOA 4X6BA 3R4RA 3JV4B 4Q0XL 5LGHL 5KZCD 2QLYA 1QRKA 4OAWB 4K7FB 3TFKD 3NA9L 4NENB 1XF5A 3N0PB 3P4OB 3UPRA 3ZRSA 2UWEB 3BP5A 1X7QB 2NY0D 3U6RA 4X5WA 1DUYA 3LNGA 3BKYH 3K2UH 2NQ3A 1FZOB 3MBEA 3QUYA 1YQVL 3ULSB 3ZUCA 1HH6B 2J73A 4B9JA 4WGVB 1E67A 2ZCLH 3QUHA 1MH5B 2MKWA 2XACC 1DE4B 4CMMA 4EOWL 4LCIL 2H5UA 3UL4A 2OSLB 3QWOA 5GGUB 3ULVH 3PRZA 4E0RA 3FZUD 4G1MB 4WFGE 1S8DA 1AHWA 4UQIM 2CKNA 2YUWA 3ZTCC 2AJ3A 1X5JA 1D9KA 4JO1L 2Z8WC 4HIEA 4YHPB 1FVEA 1VFUA 3MLXH 5F7NC 3OKLA 3QNYA 4PWIA 1DFBH 4PIRF 1XR8B 2NY5L 2JK5B 4XMKL 1ZLSL 4TUUA 2AV1B 3IU3A 4GO8A 4GQQA 1Z5LA 3LHPL 4HJJH 4QR7A 2EXYC 1BPLB 4FULA 4MKTA 3UTPD 3ARRA 2YRPA 4N85A 2WBKA 3S88H 2VRAA 1U8KB 2YKLH 1G9NH 2AEWA 3QC6X 1B3IA 3I6GB 4MBOA 1WZAA 3ULVE 1KG0B 4UV4L 4HMDA 2YN3A 3ZHFA 5IP4A 2C8NA 5B1BB 4HVBA 3T6WA 4I87A 3MRRA 2HJKB 3ZT5A 3CFDA 4IHOB 1Q72L 4CSTA 4BWTA 5F0MB 2ZUWA 1HSBA 3EHBB 4HC1L 2Y1ZA 4P2QA 5GGTL 2HT2C 5EC2B 2R51A 4GOSA 5D8JH 1AGFB 2VDKL 3WEXB 4AVKA 4TSBL 4JFSA 3LH2H 3UYOD 1IEAB 1NGQL 2BSRA 4F5CA 1AJ7H 4WWKB 1GHFL 4X7DC 2NY6C 2WKLA 4WU5A 2VM9A 4ZOCA 3AY4A 3L7EA 3NH7H 1TCMA 1A7OL 3B9AA 4ZXBC 3I3DA 1LK2A 3C2AH 4UMGA 3Q43A 4Z3FA 3FN0H 4AGLA 2Y36L 3IGLA 2F5BL 3FAWA 4OB5H 4TVPL 5DEZA 43CAB 3U7YH 4EN3C 3MOBL 3H3BC 1I1AA 5ESAA 1EANA 2H1PH 1MDAA 1FH5L 1XF4B 2AK4B 2WCSA 2LAAA 4JDEB 5DXWA 4GKNA 1YMMD 4RFOH 1KOAA 3WEOA 4OVUA 2AEPH 1EDHA 2HG0A 1VDGA 5ESQA 1E9PA 2ZXBA 5B1CA 3VFSA 4CUCA 4LCYB 5BJTA 2HRPH 4AIZB 2AJUH 4UNTA 4PS3A 4WY7L 1DSYA 5EO9B 3SDDC 4DZ8B 3FU7B 1D6EA 4JANB 3UYRL 5L2KD 2LVEA 1KLUB 1DN0B 2KDGA 3NEXA 1J9TA 2P8PB 4MCNA 4NC1C 5DZVA 2GITA 4DP4X 3QQDA 1HQ4B 5D7EA 3UPAA 4H8WC 4W9DC 2EO9A 1PMYA 2IALA 3VSQA 4PJXB 3VTMA 2XOTA 1IJNA 4K2UH 4BELD 3FOMB 1OGTA 1T7ZA 4PJDB 2YIHA 4NQCD 1CDGA 5DHVH 5AYUH 5J12B 2CCLA 1BGXH 2Z4TA 1BWWA 5DWPA 4XODA 5JHDD 2X4SB 2R1YB 1AS8A 2IG2L 4EDWL 4N8VB 1U41A 3ATBA 3OJVC 3R7RA 3ZL2A 1OVZA 1XSIA 5LNEA 1BQUA 3BN9C 1HJCA 1ZA6A 4GKZA 5DD0L 4YSSA 1O7VA 1VESA 4IHBA 2WKOF 3ILPA 2CU9A 1NSNL 4WHTA 5TH2A 2WLNA 1FRGL 5EORH 1P84K 2I9LB 2Y1VA 4ZO6A 2WJ5A 3ISYA 3WKYA 4LLVB 4X80L 4JPVH 1RZGB 2FX7H 2NNAA 3DJSA 3QCUH 3T3PB 1RJLA 3GIZH 2LR4A 5IHLB 1MQ8A 4N4YB 5IVXE 2WLKA 3JV5A 2OR9H 2TRHA 4MD5B 1GGBH 5DRNB 5KUMA 3G9AB 4XH2A 4AQ8C 2YC1A 2WXIA 1DLHA 3ML8A 5DSCA 2YD6A 5B3JF 4XTRD 1NGXB 3UGXA 3TO4A 1EWHA 4GQPH 1NBZA 2OK0L 4M61B 1PKQE 3RI5K 3DRTB 4OTXH 3L6FB 3V52L 1U3ZA 5IJKC 1CE6A 2HKAA 4MB4A 1OP3K 3L3DB 4WHYH 4N2NA 3RYMA 3QDAA 4JRXA 3AJ7A 1L6PA 3QUZB 3P77A 4LE8A 3CFQA 3V0HA 3KL3A 4XHQA 3VXRE 4BZYA 5FOJA 2N3JA 3ZDZF 2JELH 1S7RA 2WGNB 3GMOA 4HBCH 4XE0A 1IEBA 3C6SA 3GGWA 3PV7A 1I1FB 2QR0B 3KWTA 5INDA 2NYYC 4WK4B 1NMBL 1R3JA 2ATPB 5C92A 1XGQB 4BQCA 1E7VA 3VE0A 4BZ2L 4PJ5E 1AIFA 2YPVH 1RPUA 3KWWA 1OAZH 3APCA 2BVOA 4FTVE 3KLKA 4DERA 3CZFA 4X99B 1QI5A 5FO2A 1ZA3A 4ZX3A 2DMHA 4KV5E 2GSGA 3HG1D 1YC8A 1LYQA 1P6AB 4D9RE 3M7OA 2GCYA 1JHTB 2X1OA 5T1KD 4YMPA 1CBVH 1JZGA 3ARSA 4HWZA 5AW1B 4HG4K 4ANWA 1ZHNB 5F96L 3KLQA 5CHNB 3TH3T 3R8QA 2PUQT 2VH5H 3NACH 3F7RA 1H3PH 1PD6A 1PLCA 2EC8A 3LEXA 2XV6B 4I77L 1K4CA 2NZ1A 4M4RA 3RWEB 2Q76B 4BZ2H 3MYJA 3F6JA 3PGCA 2WOYA 1UXLA 5IMOA 1KCSH 3QEQB 3B9KA 4X6BB 1SDDA 2R4SH 4FGMA 1AANA 4BFOA 5I73B 1SOSA 2VDLL 4Y16A 4YSUA 1KPRB 1ORSB 2WBWB 4F7CB 1ACYL 2H9GB 4YSTA 5FM5M 3SZ6A 3PXJA 4G7QB 3AG3B 2IBGA 2R23A 5ACZA 3K6OA 3Q6FB 3GSVA 3U25A 3Q5YA 2CBOA 2WNKA 2E9IA 3VXSD 2NTFB 2VQ4A 3ESUF 3DRQB 2ZXDA 2Y7OA 2DMCA 2F19H 2Q1EA 3G6JB 3UAJD 3IDYB 1R0AL 1ZLUH 3GXPA 3RFZA 4WFED 3IU4L 3LXCA 4X4ZA 2VDOL 3H9YA 2IV9A 4RDBA 4FRWA 1JE6A 1I1YA 2MCAA 2I9TA 2P7TB 4OM0L 5D7KD 4N8VG 4ZPVA 5I8OL 4CN4A 4JQVC 1OB0A 3FN9A 1LQSR 2FBRA 3SDDD 4NQDE 5I66A 1R5VB 4OFVA 3WFBL 3DETD 5FUZL 2Z93A 2C9UA 2OCFD 2WXKA 4DVBB 1Y07A 4GMSL 4MJIA 4HT1L 4X4YB 4M93C 1A6ZB 5EO0B 4UM9D 1OPGL 5DVKA 1FRGH 3FB8B 4UTAA 1NL0H 1TJGL 2HH0H 4M29A 1CXLA 4KDTA 3B2XA 3NCJH 4UB0L 2FR4B 5DR5H 4HXAH 1YEGH 3GNMH 3KLAA 4IRJC 2NY5C 2ZWNA 2ZTBA 4KI5D 3FDWA 1DQQA 1Q0YL 3UTZB 4WV1B 1ZCRA 1KSRA 2W65B 2WQSA 4GAYA 12E8H 2NYKA 1O6SB 3BOVA 4GW1A 5CSGA 3T0DA 1FFRA 4K94H 1UKSA 4I9XA 1CWVA 4KPHH 5EZPA 4KTEL 3LZRA 2IFGA 4CC4A 3KGRA 1MFAH 1QPKA 4CVZB 2XTSA 2VQTA 2CBPA 1LE5B 3VXSE 2JJSA 2I07A 2EDXA 1SFHA 4P2OD 2WQWA 1HDMB 2A6IB 3LQAC 4R5VA 4UUJA 1VGKA 1WGOA 4WZ9A 5E24E 4OLYL 3ZDYF 2AJXL 1FC1A 4R7NB 3NPZB 1SOQA 3E9UA 5AAMA 4BH8B 3WJLA 4B0MB 2X5PA 3QXVA 2N4IA 3IXAB 3NCMA 3MNMA 2WQ8A 3L4ZA 2BP8A 2CDFA 1SN2A 1NCDH 2FIRT 5GGRA 2GHWB 1NCHA 3FQ2A 2OXGB 2A9BA 2CCWA 1T83C 1AGBA 4CBZA 4LCVA 4NQCB 2CWRA 1DANT 4X98A 4AQ1B 4F7PA 4L4TB 1UT9A 2YARA 4JJHA 1JPST 3NCYS 2BOCB 4FC3E 3U9PH 3NN8B 1D5XA 4OJAA 3ARBA 4ELMF 1O6VA 4GQ9L 3DHMA 3QUXD 4E2OA 1QA9A 5HYSB 3D06A 3BYYA 5HP5A 3QIWB 1FWXA 3QRGL 2EADA 1NCBL 1HNGA 3QHFL 4P5MB 1B90A 2X28A 1UQSA 4PGEA 2ZXCA 4B5ZA 4QRRD 2IQAB 2ISDA 3WIIL 2A6DA 5F7MC 1EEYA 5F44A 2D3LA 1NCWL 3FCUB 3FTZA 5J57B 3L3OB 2VDMB 3VFUB 3J2PA 3EBIA 4PR5A 2BY3A 3JT2A 5IGXL 2MWCA 4Z7UF 1SN0A 1PZ5A 3S36X 2L4OA 4PJXA 3GLZA 3DO7B 4N2CA 1DJXA 3SGJC 3DHUA 2QADD 4GRLC 3MC0A 3MLVL 3ARXA 1X5HA 3MUJA 3SE3C 2BLFA 2XQBH 3ALXA 5IW1B 4BH7A 4GBXC 4EZJA 2BJMH 3QDMA 3QEQE 2KHAA 3ZSTA 5F2FA 5GZOA 3V0FA 1KN4H 1YJDH 4HGWA 1MCKA 3Q6GH 3KE0A 5LO7A 4KROD 1LP9A 4IRSD 4L29B 1FGVH 4WI0A 1NUNB 1C7TA 4R4BB 2WWMD 1R75A 2P8PA 1KTDB 1X7TA 5HHNA 4ELMA 1VEMA 1GY1A 1WIOA 1ZT4A 3QHZH 4FHBD 3C8DA 4BCXA 3JYBA 5D4QA 5C0RH 3LMJH 3KWUA 1X5FA 1WCBA 3TN0D 1YLBB 2XDHA 3ARGD 4N1CA 4X8GA 5DUMH 2VXVH 3D07A 3GSRB 3M1BB 2GI7A 2FZ3B 3VI4F 2VISB 2IBBA 1KTKE 2A9DA 3HMXL 1C5DB 5D7IE 4N2FA 5FKPB 4MA8H 4I5BA 4FQJH 3MROA 1KBGH 2WAQA 1UT1A 4QXUL 2ZOWA 1GSKA 1LD9A 3FU6A 4YBQD 3Q8CA 4DEPB 2XWBB 2R0WH 4LGRB 4M8UA 5DZJA 4N2EA 2XA8H 3IJ8A 5DMYA 5CN3A 1EEZA 2MHAA 5C08A 1ZVHA 5T3ZH 1REIA 3JV6A 1BVZA 3QUZA 2GPZA 2DDQH 3E6FB 5EOCH 3VFRA 1A7RH 5F9OH 2R4SL 4ODTH 4DO6A 4G9DB 4KZCA 2IDSA 1S7SB 2JV6A 3BH8B 4O02H 2B8OT 1BFOB 3DBXB 4ALAL 2RGSA 4YAQA 3VE0B 4CL7A 3N85H 5I16A 1BF8A 3PP4L 4M6NH 1KTCA 3WNKA 1TO4A 3MUY1 2QKIA 3BO8A 3HNSL 3VXQA 4AL8L 1MCJA 1FNSH 2C9RA 2WXFA 1I4FB 2XCMC 3DHPA 4KKLD 5A2IH 4FQPA 1GS6X 4UTCA 3UTTD 4TNWK 2ZSWB 1BQ5A 3B8SA 3RNQA 3CLWA 4PRPB 3IBEA 3L5WB 2WD0A 1ADQH 3L9EA 4X8JA 4M7LT 4Z7QB 2ZYSA 1T6BX 1Z0NA 3T6XA 1MG3C 1Q9LB 5DJ2B 5BZZA 2VMCA 2K45A 1IC1A 3JZ7A 5D6CB 4I18A 2DEYX 2YQ2A 5I74C 3VXPB 4P4RA 4ODVH 4YK4C 1IGJA 2IWFA 1QSFE 3PGCB 1E8YA 4NLHA 1TZOA 4O9HL 1UM4L 4TSCH 1DL7L 3MRLA 2BSSA 1JWUA 5HYSG 4BCYA 3WN5C 4PUBH 5DURB 3Q9PA 2XN1A 2DIAA 4S2SB 4PJ7B 3S5YA 2O61A 3NP4A 3UMTA 4Z7OF 2G5BB 2UXFA 4KZEL 1QACA 3WY3A 3VNYA 2MJWA 4M56A 2C34A 2FYYA 4Y89A 4YXLL 5BVJB 2AV7B 2DWYA 5ALCL 1J9QA 1DVUA 4X6CB 3LZFL 3CFKA 3D2UD 1E4KC 1CD1B 1JVLA 4U05A 1QR4A 2XIDA 4AXWA 4DKDC 5F7WC 3IMSA 4Z7AA 2CJTA 4OVVA 3TX4A 4BRVA 3W11C 4PAZA 2GHZA 1AO7E 1KBWA 2Q76A 4XVSL 1IAOA 4Z7WE 3VFGH 4YDVA 1CQYA 1DBJH 1Z3GL 3ZBMA 3IGUA 2HCZX 4GAGL 5DLML 2Y5EA 5J56B 4LLQA 4HDIB 4JPVL 2FECI 3TOPA 5ETUB 2BFVL 3QP3A 5CEXA 1P7KB 3GBNH 4J8RB 3U7WL 2XKUA 1OW0C 5KAQG 1AGEB 3FO2B 5CEZL 3LB6D 1MVUA 1FO0B 4TSAL 3CU7A 2XA3A 3SQOH 4AV5A 5CBEA 3FT4B 3RL2A 2VR6A 2W9EH 4PQXA 1UJ3B 3WOVA 3GMNA 3ZE2E 2B20A 5I1EH 1W0WA 2H7WA 4DZBA 1A3RL 2EC9U 3NFSL 4GSDH 3PE9A 1F4AA 4PBXA 4XCFL 5F0LB 3V6OC 3TPUA 2V2TA 4H5SB 4OLUL 1IC7H 5KBKA 4UQDA 1QUPA 5CSZB 2AF2A 1PW3A 1BGXL 2P28B 1SUHA 1VPOH 5IEKB 5EC1A 2UZXA 4RFNC 3REWB 2PW1B 2N7SA 4XVUD 1UKQA 5I9QC 4HJGA 2MCPH 5DT1H 4FQHB 2FEDD 1FL6A 3GJEB 1BZ9B 2RCSH 5CJ8A 5FLUA 3QO0A 3OHXC 3ZRFC 4AYID 4DP7X 1KB3A 3WLWD 1UB6B 4RX4D 4BXSV 2ITCB 2I5YL 3B5GA 5ALBH 5IBLC 5F3BB 3KPNB 2RB8A 4ZQTA 4OF0A 2WY3B 4FG2A 1NJ9B 3QI9D 4XE5B 2W94A 1N6QH 3F5WB 5J13B 4HPOH 3QJHB 5CR8A 3B56A 2Y7LA 1FH5H 3U1SL 2CUMA 4N0UB 1XL4A 5DDHA 1NM9A 2ERJB 3NJNA 4RMQA 2YAHA 2CGZA 2Z4QA 2RJMA 2WBJA 3N1GC 1DBAH 3MRJB 4TTDD 7FABL 2Q9OA 4WO0A 5EUOA 3RVWC 3WE6B 4BKSC 1CGTA 5E9AA 3ARBD 4WWOA 1MJUL 4KX9A 5G55A 5JTWA 1ZVSB 3PHAA 4M43L 2DQHL 3J27A 1N6QL 1JUFA 5TDPB 1TQUA 3EKCA 3TIDB 2WAHA 4EXKA 3MRNA 1QFUL 5D8JL 3FH5A 1LM8V 3H3PH 1T22A 4JFDA 2R69L 4A6YA 2EECA 4QCIA 4YSEA 2XETA 1FO0H 1RLWA 1SXNA 4U0QB 1WH0A 1BIIB 2CM5A 3TBTB 2W60B 4IEFB 3K0YA 2BIHA 3RUGA 3DOHA 4ES9A 2XTJE 4PR5B 5MI0B 3BP5B 1OL0A 4F7PB 3D39A 5F8QC 1RH8A 1JRHL 4KKCC 2LU3A 5E6ZA 4DCQB 2ICCA 1JYVA 2WXPA 1GW0A 2BFGA 5HJ3B 4OLEA 4UZSA 1NUFA 2CHDA 2VXSL 4DGIH 5D1ZB 3HE7A 4UTBH 3IBOA 2I7OA 4J2QA 1IC7L 2DQEH 2HFGL 2X4UB 4ZTPH 5JO5A 4AEHH 1R4XA 2UY7A 1ZLWK 2J56A 1A3RH 2IOIA 3SDYH 3CN4A 3CSYA 4NPKA 4OD2B 4YHIB 1OTTC 4X6DE 5GIRA 4FLOA 1CO1A 2V3FA 3BSGA 3V6ZA 2EP6A 4A67A 2WMPA 1MNUH 2J3SA 3MR9A 5KBMA 2IGFH 3FO0L 3TBVB 4R4BA 3LKOB 1QSFA 2CR6A 3L1OL 4ZT1A 2DQMA 4HULB 1LP9B 1OAXL 4BSWA 1KJVB 1XGRA 3BX7C 2JI1A 3M88A 4JQIH 4MJID 1OQXA 1XV8A 3KYKH 4OLVL 5D1ZC 4Y1AE 3F7PC 2V8MA 1DBJL 1F00I 3I84A 3P3UA 4XMLH 1N5YH 4L0YA 5IQ9A 1EMTH 3L9BA 2ZUXA 1F6AB 5IHHA 3B2PA 2ZX8A 2R83A 5JDSA 3VQ2C 3VXNB 3C8KA 3CLEL 1EZUA 4MXVE 1YNKL 2EE9A 1T04A 3CBJB 5C09E 2BHFA 3BAEL 2WBXA 4WI4A 1X4YA 1XCXA 1I8MA 3IDMB 3AREB 3O3DB 3NDZE 1RCYA 1X5AA 2CO7A 4GJTB 1QLEH 5AW4B 3CFDB 5T3XE 1VIWA 3KXFD 1E3XA 1P69B 1YY9D 4PU2A 5CILL 4ZW7A 1U3NA 5ERWA 3WNIA 3R1GH 4F9LA 2LTQC 3MI6A 2QTVA 3ML9A 5I6KA 3B2MA 3HI6L 5IB4B 2F08A 3CMOH 1MKFA 1S7VA 4Y9BA 3QWRD 1MFNA 1A9EA 5MEQB 1AG6A 1MCIA 4GIPD 5I16B 4KBPA 5E5MA 3HHSA 1WCBB 3WUWB 4GINA 4JM2C 3IF1A 3G6DL 4M1GH 3RZWA 5IFAL 4B7IA 1HHKB 2WTPA 1E6OL 3OF6D 2WZPD 4JPWH 2IWKA 4EBQL 2VQUA 2YSSA 2YAOA 3P73B 1RQ5A 2H6UA 2BMKB 1JRHH 2OZ4L 5T1DH 3QA3B 2XHNA 3RX7A 3IFOA 1AZNA 3HPJA 4N9OB 3JTSA 3KPQA 4AH2A 5F9WB 1KTRL 1XGTB 1FYHB 4LVEA 4Z7OE 3FHQA 4HCRA 1XH1A 4ZXBA 4YNYA 1DSFL 1E90A 1UD3A 3JQOB 4AT6A 3T65B 5L8LB 4PGCB 2ZCHL 2WWNA 5GS2H 2TRYA 1JV2A 1D5BA 3ES6B 2CNYA 2DPKA 2FWOA 1MRCL 4LEOA 3HAEG 2VJXA 4R0LB 4YBLB 1M57B 1SDYA 2HP4A 3CXHJ 1WSST 3QFJA 5ICYB 3V7AG 1TU2B 1EBPA 4KVNH 4MB5A 2KLSA 2F7PA 5FGBA 3RPKA 4N2MA 1JPSH 3UG3A 1KB5H 3K80A 1RHHA 4PJGB 5F72S 1NFIB 2B4CC 4MLSA 4CW1B 2AMGA 1EZSA 5IF0A 3RWHB 4FG6D 3ARTA 15C8L 4UIMA 3DGCR 1C5BH 2L8AA 5HYIA 4KZ0A 2RA1A 2IH3A 1KENL 3CSBA 1UWGH 4NHUA 4Y5VA 4NZUL 5SWSE 4L5FL 1JPGB 4ZUVB 1ADQA 1YPZE 4FLQA 5JIMA 3RDTA 2DM4A 2X0VA 3BIBX 4ZUTA 3DIDA 5JQHC 1IGJB 4KKQA 5C08E 3QH3B 1YAIA 4KNTA 1NFDF 4KMTL 3ARFD 3T1WA 1PVHA 3GBDA 1KY6A 2A2QT 3CVHH 3QNXA 5GGUA 4UZGA 4K07A 1PGRB 2XSKA 4U1MA 4O4YL 1HNFA 3HG5A 5E0FA 2DWEB 3VFNB 1BZ7B 1PCXA 3QNZB 2AQSA 2UWEA 4YHPA 5DRZB 2BSTB 5L6YH 3K71A 2YMOA 4JKLA 5F71A 3HCVB 2B59A 3A23A 4MA3A 4YDJA 3UJJL 4YC2B 3F64A 1W0WB 4WNQA 3NZ8B 4XI5D 5EEXA 1NC2A 1MPAL 2E9JA 4I89A 3DXAB 1QTPA 4K9EL 3GRWH 4NXSA 1OOWA 3MLVH 3L3HB 1QD0A 1LDPH 1N5AB 3CPUA 4JX0A 3PU7A 4MXWH 4KHXL 1G84A 4E42B 1G9EA 2NY2D 3IJHA 5C7XL 3JUZA 4LVOB 1ZAGA 5JPNA 2OMYB 3WGUB 4HDIA 1OANA 3ZKMD 3ZMRA 4M6ML 1NCIA 3QQNA 5HI5C 2DL9A 3EDKA 1ASQA 1BECA 3GRWL 3ECUA 3B37A 4FMFA 3BZEB 4QRTA 4ZYKA 2BK8A 5JHMA 1DANU 4PJBB 2BOBA 2D4FA 4HWUA 4AK2A 4AL8H 2BH0A 4DZBB 1CF8L 3FRPG 5ADPH 1SF3A 5DRXB 4CADB 4ZFOL 1BVNT 3ULVC 4P2OA 4FZ8H 3H6AA 4M1CC 5GGRY 3BQUB 3D34A 1SUJA 5AZUA 3PHOB 4X9GA 3NCEB 3TASA 5ITBH 2PXYD 3V10A 3GDBA 3VTAA 2ESVA 1H9DA 1DJIA 4OF5A 4XPBH 2GBAA 5T3ZL 5B39A 5T5FL 1IO4C 4LQ1A 1U8OA 5AVYB 1OO2A 3CX5J 1G0DA 1T0OA 3TCTA 3IU3B 3W0WA 4GXVL 2BIMA 4DOHB 3Q5OA 4JFDB 3X11A 5DMJB 4PJGF 3JBG7 3BGMB 4KFMA 1V05A 5EPMA 3JZYA 3IKKA 3AT8A 4Y1SA 1ODAA 1ZXKA 5BS0B 1KPVA 4PS7A 3ZT6A 1UFGA 1MWAL 1A3ZA 1I7RB 5HVHC 1S9XB 4S10A 4XWOD 2Y5QA 1E4HA 2FO4B 1V5JA 3SD2A 3MODL 1F42A 3ZTEA 2OSWA 4N0FA 2K6YA 3QIUA 3L3KA 2HFFB 4L0PB 1IRAY 1IILE 1JTTA 1MJJB 1FA4A 3PL6D 2CLZB 3MRFB 5D1ZA 1E43A 1YYML 3BSZH 4A68A 2GC4C 5HDOA 4BV1A 4ODWA 3D69A 3KWXA 4GKSB 3I9GH 4PJCF 1TITA 3M1CA 3QWQB 2EIMB 5A6MA 4PH8A 1J05B 4X5LA 3WN5A 3RA7L 3N50A 2K9UA 3L1EA 4MHHG 3OZLA 3RKPA 3ZZSA 3QEHB 4LP5A 2FEEI 4YL9A 3BPNC 3PIQA 4YPJA 1AZZC 3ZO9A 2J5LC 1P2CA 2CO3A 2XBZA 4KVCH 3Q7JA 3WFBH 5EV7A 5HHQA 3T77B 4JFQA 1WWWX 4RISL 4YDNA 4XP5L 5CGTA 3CN3A 3KPOA 3LRLA 4LMQI 2FEEL 4A7GF 7CGTA 1QSEB 3IU4H 4HH8A 2IPUG 4MD5A 3S2CA 5EN3A 4MZRA 5C1MB 3MV11 2ZXQA 2R1YA 1VAHA 2FBOJ 1LWHA 2B77A 2LLNA 2O5XH 3CNKA 5KJRH 1MIEL 3D0LB 3O6KH 3D48R 1BA9A 5K69A 2YO3A 1ZDQA 5GS0D 3MO1A 4BFIA 4JL2A 4ISVA 3PDOA 3VRLF 5C8JA 3C9NB 3QHFH 1FGVL 3MX0A 4KOCA 3P3RA 2HPOA 1NPUA 3Q6GL 4GIOA 2OAAA 1FG2A 1U91A 1CS6A 3NIDF 3NIGB 1FL5A 4N87A 4UBDD 4Y4KD 3VXRA 2VN4A 2NXYC 5I19L 1QG3A 4LVHB 5DA0B 1O7SA 3W1ZA 1CI5A 3FN3A 5DRNA 3N9GH 3OLDA 1UZ8B 4KZDH 1FZKB 1FIGH 1P84J 1Z9OA 2X53A 4XNMB 3LIZL 3FSOA 1JDCA 4QRPE 3UGEA 2IPUK 1SYSA 3RWIA 4QAWA 1H8SA 4CVWA 2ZP0T 5AG8A 4MNQA 3SKOA 2AJXH 3AREA 3OJDA 5EDXA 2QLVB 1TPXB 2W0PA 3FTGA 4Q6IB 5HDLA 2AJZB 3TYGL 5SWZD 5FUCE 1JFQL 1MG2C 4I13B 1B2YA 3FQWB 3E2HB 3ZZQA 3QJXA 1S9WB 2AK4D 3I6KB 1CFNA 1XEDA 3UBXA 1UADC 2WUCH 4PJFA 2MQGA 4HQQH 2XRAL 3CFUA 4OQTA 5G4NA 2X1XR 2GJ6A 4XH2B 5D96B 1NANH 3D52A 2UWEF 3RGVA 4LBEA 2OW6A 3COOA 3T3MB 2OYPA 2DTMH 1GGIL 5GS0H 1NIDA 1J1OH 1I7ZB 4RFEB 4Y9GA 4CW1A 5ICYA 1R3KB 5C0NC 1PJWA 3HC0A 2NNCA 3V4PH 4L8SC 4FYTA 4EUPH 1DCEA 4NNYA 4X6FB 3C09C 2L7UA 4G6KH 4K71B 3V5HB 3ZXAC 1KXTB 4HIHB 4OZFH 5LBGA 4OD3L 5GSRA 3MNWA 3IDNB 4N8CH 2PTVA 4OTXL 4ZXBB 2YQGA 4Y5VB 4HYTB 1GZHA 3RIFK 1MRFH 1ERNA 2ZX5A 2B1AH 4YVUA 3MLTB 1I1FA 4ZFFA 4OLYH 1IC4L 3DRQA 4HKBA 5T3XD 5C2UB 4KMTH 4KI5E 4ZPTA 2D03H 2DLGA 4GSQA 3RGHA 1G9ML 1R0AH 3AWEA 3QQ4A 5KYYA 3OXRA 4EMZA 5IREA 3QNXB 2IXQA 1KPUA 1G5AA 5FYLE 1ORSA 1QHPA 5TD4A 4PVBA 3OAUH 4JRYB 4WFHD 3VRIA 3N1QC 1W15A 3V9FA 3DOSB 1MLCA 2C1OB 5JQ6H 3PAZA 4PTTB 3BXNB 1E9OB 1JGLH 2JIXD 4XNDA 2G3XA 1U8MA 3ORJA 2Y3AA 4WENB 2VAAA 5HDWA 3QJFB 2CO6A 3OXSA 3S96B 1H15A 4L8CB 5ANME 1JERA 2CDEA 1M7DB 2I5YH 1HZHL 4P57B 1MCDA 3THMH 1QZ1A 1O6SA 4PRHA 1ZHBA 3A67H 3QQXA 4RBPK 1OP9A 4G7VL 4E42A 5IVXF 2KQNA 4S0TD 2WN2A 2VH5L 3ABMB 3OX8A 4S1SL 1LWRA 2DQGH 5JMOC 4BK5C 3WAKA 1IKNC 1QLFB 3MV7A 2JE8A 3O4LB 3Q5TA 1BYNA 2BRQA 5TE6L 4JPIB 3HEIB 4YHKL 4E5XG 1W16A 3HG1B 3LKNB 4WTZG 3B43A 1ET7A 2ENQA 1RZKC 1R3IL 2EYTA 2XPGB 1NAKH 2JKWA 1D5MB 3CVCA 2EDNA 1BMGA 1KYDA 3QIWC 3V8CA 4POZC 2IWEA 3NP3A 5CZVL 1JZ4A 5E4EC 2GTQA 4A38A 2YOCA 5DD5L 3VMNA 3NJXA 3CFEA 3EOBB 2JWYA 4TVPH 2FB4L 3T1FB 1NLDL 3RVXD 4BFEA 1UEMA 5IMLA 3WJMB 2R2HB 4YWGH 4L9LB 5AOLA 3G04A 5DLMH 3VXPA 1ZJBA 3TVMA 2KLRA 3O8XA 3RVWD 2WIIA 1RZ8A 2AZAA 2YLKA 2A6KA 3DXAD 4XGZA 4LKCB 5EIIB 3RVVD 5BV7B 4M6OL 4PJAB 2HAZA 4HF5L 3QUZC 2DWDB 4C56D 4NKDA 4N0RA 5FX3A 3V52H 4L4VE 1X4ZA 3ZJAA 1OTSC 5I6XB 1AQDA 4GS7B 1DUZA 5GGTH 2EQDA 3GSUB 4HZ1A 3OR7A 2UXGA 2PN5A 3QI9C 1KJ3L 3P4OA 2EC9T 2OMVB 4G3YL 5GGVL 3UPRB 2ZXAA 5C6WH 4A1RA 4HK0B 5DD6A 4K8RD 4H26B 4LO9A 4TQHA 3PJSB 2FHBA 4PWGA 2AQ3A 4EIGB 4RGOL 1S9KC 3BVNA 1WAAA 1GGIH 3IXTA 2E7DA 2Y4SA 3WUZA 4FFZA 2NRDA 1UM4H 4TSCL 3BFWA 2YKLL 5TE7H 2EDHA 4YXHL 4EDXB 1JGIA 4I85A 3KYOB 3UJJH 3VXSA 3BISA 4G6ML 5T33H 4J3OF 4LFHD 4UYQA 1VFAA 1HQRB 2OMZA 4DTGH 2CR0A 5CILH 2BNUA 1F3RB 1U8PA 2FBJL 3AS3A 2XZZA 4NP4H 3CQFA 4PVMA 3L7FA 2BIIA 4KO7A 3DO3A 1CFQB 1KDIA 1A2YB 2JQZA 4PJXE 4LP4A 3U0WH 2PW2A 4O4YH 3V9EA 5H37H 4A66A 5I1CH 3MRBB 1D5ZB 2J12B 2OYMA 4IBQA 5HJDA 1PZUB 1GRWA 1MCPL 2A4CA 4EVNB 1A7QL 2IDTA 1Y1UA 2Q7AA 2GEQA 3NIFF 2HA1A 2IGLA 2OQJA 5GZNA 4N86A 1A6PA 3X1GA 1FJ1B 4M6NL 1OAYH 4HGKC 2PR9A 5D5ME 2VDNH 4QOKA 5FGCE 3D0LA 3FH8A 1OOAA 3FFCE 3DPBA 3KYMA 5FLVA 3WIHL 2WLLA 5E56A 2F6AA 4LPCA 3OAYK 1EEYB 3GSQB 4UIKH 1OAXH 2DDQL 3WEBA 3UC2A 3DX7A 3ECBA 3FQYA 1LO0H 3Q8AA 4PJ5A 4EUPB 2XQYA 3RX5A 4OZIB 4LVOC 1G7JB 3T0ED 3TESA 4IOIB 4MJHA 4QDGA 15C8H 1UHVA 2CUIA 4OGYL 1T5WB 4PBDA 1I8UA 4F24A 5HHQB 5C70A 3QZMA 4F33A 1U8HB 4W6XB 3FFDB 3UDWC 4FJYA 5JA8B 1CICA 1EFXB 4HS8L 4XOCA 1BEYL 4AEIH 3JUYA 1X5MA 1JK8B 1LDSA 4H44C 1J48A 2HX7A 4DGIL 3VSUA 4JFTA 4POYA 3KPSA 1LLAA 2AP2A 1SZNA 3D85D 2XC8A 2DJ4A 2EVFA 5ALBL 1RPKA 2J7LA 3AACA 1T1XB 4DW2H 1BVKA 2NXYB 1RUAL 3BT0A 2HFTA 5D1QC 4PS4L 3UAFA 2IQ9L 1CPUA 4GAFB 4Y9CA 3DJZA 3PQYA 3I6KA 5FDYA 1JBJA 2VLKB 3IDXL 2N7AA 4ERSL 1NIBA 4GSRA 4PWHA 1RZIA 1H5BC 2JKXA 4MA1B 1MOEA 1JGLL 4Q97A 1ZE3C 3S3CB 1NEZG 4L8DB 3BW9A 3BDYH 1NMAH 1YMHA 1KULA 4LU5H 1S7TB 3CFNA 4NZFA 3RGVB 3H7LA 3RQ3A 1F56A 5AKTA 1W72L 3SGDI 3B9DA 2IALB 4GAAA 5ICXA 6CGTA 3VQ1C 3GMLB 4MNQD 3HR6A 3STLA 2F7IA 4Y4KC 5ID1B 1AGDA 1MJ8L 4GT7A 1GIGL 1NKRA 5E5RB 4A37A 4PRDB 4OKVB 3SYAA 3AGVA 3GPEA 4XC1H 1LO0L 1VKXB 1TZHB 2PABA 4I48A 3DX4A 1YG9A 2YMTA 4RH4A 1YEDA 1FAIH 5HYQA 1PFOA 3UBXI 3QPKA 1AACA 3BP7B 3VFSB 3E1F1 5JIDA 3FU0A 1DQTA 4RCAA 1DBKH 1HH6A 4AZUA 3KPLB 4GXVH 1KXVA 4PEEA 1WS8A 2W59A 3VA2C 1OP4A 2Z31D 4XXWC 5CS7A 4K7PL 4NC0B 5KYYB 2X7LB 4FNSA 3HUJB 2F61A 1FFPA 4RA0C 5A6LA 4Z7VE 1T1ZB 1UG9A 4RGNE 1W6LA 4PY8I 4PWKA 4N25A 3RX8A 1FL3B 1PG7X 2YA1A 3DK2A 5AZ2L 3K2UL 1XGYL 3TL5A 2EIBA 3I02A 4GT0A 1C8QA 4FJZA 4F15C 3VW3L 1RZJH 3BCFA 3O8XC 3IFNH 2RACA 4P23A 4IKIA 4WI3A 1ZXQA 5F7DA 5KYWB 4B60A 1DSWA 3KLHD 4PGBA 3MACL 2O6EA 4I0PC 3CHSA 4M9OA 5D7JA 1AOZA 4PUBL 3AQYA 4MJ4A 3SCMC 1AVAA 1U30A 3FF8A 3FTWA 2IBZY 1DL7H 2JKSA 3ZLQC 2X9WA 4LFHG 1NM4A 4Y16C 3HS8A 4XPTH 2H0FA 3AG1B 5D9SA 4D8PA 1JZ8A 3D3VB 4GBXD 3BT2L 3HE7C 3QWRA 3HUJF 3QEGL 4S2SA 3VWKC 5D2LF 2PYFA 3B7RL 3DUSA 4MCMA 3ULUH 2NDGA 2PR4H 3I75A 1LO5B 4OJFL 3TJHC 2ZUSA<