3GRRA

Crystal structure of the complex between s-adenosyl homocysteine and methanocaldococcus jannaschi dim1.
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
263
structure length
263
Chain Sequence
QCFLIDKNFVNKAVESANLTKDDVVLEIGLGKGILTEELAKNAKKVYVIEIDKSLEPYANKLKELYNNIEIIWGDALKVDLNKLDFNKVVANLPYQISSPITFKLIKRGFDLAVLMYQYEFAKRMVAAAGTKDYGRLSVAVQSRADVEIVAKVPPSAFYPKPKVYSAIVKIKPNKGKYHIENENFFDDFLRAIFQHRNKSVRKALIDSSKELNYNKDEMKKILEDFLNTNSEIKNLINEKVFKLSVKDIVNLSNEFYRFLQNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding of adenosine-based ligands to the MjDim1 rRNA methyltransferase: implications for reaction mechanism and drug design.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
molecule keywords Dimethyladenosine transferase
total genus 93
structure length 263
sequence length 263
ec nomenclature ec 2.1.1.-:
pdb deposition date 2009-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3grrA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3grrA01
3ELWA 2C7RA 2ZWAA 1BKYA 3LBYA 3EVDA 3MB5A 5FUBA 2HV9A 3HVJA 5ICGA 3KQOA 1P39A 2JHPA 3E05A 4PYMA 1ZG3A 3T7SA 5GM1A 2Y1XA 5EG5A 4QVGA 3CKKA 5LQJA 3NVMB 3DMHA 4AZTA 2E5WA 2PX2A 3TFWA 4MQ4A 3G7UA 2NXCA 4RV9A 4CKCA 5D1HA 4CKEA 1I4WA 4DM3A 3LKDA 3FTCA 3P8ZA 4JXJA 4MTLA 3BWYA 3KQSA 3QV2A 4QPNA 1ZQ9A 2AVNA 4RYLA 5DXJA 1Q0SA 3MHTA 1WXWA 5LQCA 3G5TA 4PONA 3PS9A 5K03A 4O29A 3GRYA 5K01A 3EEYA 3DOUA 4M37A 2FK8A 2PX5A 4UOEA 4WXHA 5CUQA 3LECA 5JUWA 2UYHA 3B3FA 4RTOA 4PYQA 9MHTA 5K0BA 1N7JA 1DL5A 4C08A 4QTUB 2ZIGA 2P7IA 5E8RA 4MWZA 2VDWA 3I58A 5DRYA 4FS8A 1VE3A 4PWYA 3OPNA 3R3HA 4GBED 2IGTA 3E23A 4U7PB 4GC5A 2FRXA 2BM8A 3M6UA 4FGZA 2NXEA 4NECA 5BXYA 4CTJA 3HTXA 3BXOA 3KQYA 3NWBA 1WS6A 3A7EA 2P40A 3DH0A 4WVLA 4EKGA 4M7RA 5F2KA 5D1NA 2GAFA 3V97A 3P97A 2PSSA 3BWMA 1M6YA 3KPJA 4XUEA 2O05A 3LX6A 3IV6A 2Z6QA 3F4KA 3G2MA 5HIIA 1G8AA 2EJTA 3FPFA 3P2EA 3TKYA 4POOA 3KQWA 1RI3A 1RJEA 1SKMA 3UJ9A 2NP7A 1I1NA 3UZUA 4HGYA 4RTJA 3MGGA 3FZGA 5K0LA 2ZIEA 3AY0A 1YZHA 4IV8A 2PX4A 3GU3A 4OBWA 3ELYA 3FUXA 2I6GA 3HCDA 4PIPA 1G60A 3REOA 3ERCA 3LCVB 5IKMA 5CVJA 3GO4A 4R6XA 4E2XA 1JTFA 4PYIA 2OXTA 4LG1A 5EKUA 1NW3A 3TMAA 3OFKA 1BC5A 4KIGA 3TKAA 2O57A 4K6MA 4PNEA 4KDRA 4YMHA 4FT4A 2OB2A 2QRVB 3EVBA 4PIMA 3C0KA 3GRRA 1YUBA 2CL5A 4BLVA 3I53A 3SR4A 3UJDA 4M38A 3GCZA 3TR6A 2GH1A 2C7PA 1XXLA 3QOWA 3TM5A 3HM2A 1XDZA 4HGZA 5DM4A 2PT9A 5BW5A 3HA5A 1D2GA 5EOVA 1QZZA 2OZVA 4F86A 3KPVA 4LECA 4DZRA 1VP3A 2AOUA 1VBFA 2R3SA 3DULA 2C7QA 3DTNA 3EMDA 4ATNA 1UFKA 3HVKA 4KDCA 3BGDA 4P7FA 5LQUA 1WG8A 2G71A 2GB4A 4AZWA 3R0QA 4GUAA 4YV0A 2QE6A 1QAOA 2G70A 2YXEA 3EMBA 5IH3A 3OE5A 4RTPA 4QPPA 2NXJA 2PLWA 3TLJA 3P9NA 1SUSA 5CVDA 2QM3A 1XDUA 5F2NA 3BKWA 3M6XA 3UJ7A 4FSXA 2PXAA 3M6WA 3WSTA 4RTLA 2EX4A 5T67A 5FQOA 2IPXA 2V7EA 2V74B 3FPJA 2G1PA 1KIAA 1NV9A 4C07A 2AOUB 4XUDA 3FRIA 3R6TA 4E32A 3RODA 2ZBRA 2OB1A 2PKWA 3ELDA 4DF3A 4BY9E 2GPYA 4KVZA 3TQSA 3MTEA 4RTRA 1SQFA 3C3PA 5CIYA 3TRKA 1P91A 1TPYA 2OO3A 5EC8A 1ZGJA 5E2BA 4C06A 3HA3A 3FYCA 2PGXA 3DXXA 5HILA 4KW7A 3OU2A 5GIPE 3EEOA 5BP7A 5DLYA 4HRAA 1R74A 1NBIA 3CJRA 1I9GA 3JWGA 3UJ6A 4EMSA 3DXYA 3EVFA 2P8JA 3NJRA 3OZTA 5K0NA 3SGLA 3DMGA 2YQZA 4GOLD 1R8XA 3KPWA 5FQNA 3RW9A 3HCFA 2O0LA 3UA4A 4PYJA 4E70A 5GP1A 3UJ8A 4YV1A 2NXNA 4HTFB 3CC8A 4E31A 5FCDA 1KR5A 5EGSA 5P8WA 2N47A 2JHAA 3NMUF 3NW9A 1U2ZA 1L3BA 3PX2A 2AOTA 5E1DA 3SVZA 4C05A 2FPOA 1PRYA 4R8RA 4BLWA 1RI4A 2XVMA 3B3JA 3K0BA 1WY7A 5DTMA 2EG5A 1YF3A 2CMGA 3U81A 3EGVA 3I9FA 3M6VA 3ID6C 3PLAE 3OCJA 2CWWA 2ONYA 3I64A 3TM4A 1NBHA 1JQDA 3KQVA 1G55A 3KR2A 2WA1A 2H1RA 5FHRA 4YV2A 1EIZA 2ZWVA 4HTFA 5E9WA 1N7IA 5DX0A 3G2QA 5G02A 3HCEA 3VC1A 3EVZA 1G6Q1 1KHHA 4G56A 1SVUA 2FK7A 3HVIA 3KQPA 5DM1A 1KPIA 3FYDA 2LD4A 2P41A 1ORIA 3KHKA 4LWPA 4PCLA 5F2OA 5LQRA 4KRGA 3A25A 5EZQA 1EJ0A 5HIKA 1O9GA 1X1BA 4XCXA 4X61A 2YR0A 3FUUA 1R6AA 1Z3CA 1TW2A 5LQNA 1HMYA 1WXXA 2HWKA 2ZBPA 4U7TB 5HFJA 3FTEA 1PJZA 1KXZA 1N2XA 2GLUA 1RI5A 4RVGA 3LKZA 1AF7A 1ORHA 4KIFA 3SX0A 4RTMA 1VL5A 5ICCA 2FCAA 2AOVA 5JR3A 3AXTA 4E2WA 4CKBA 2OY0A 3DLIA 3B3GA 2CKDA 4H0NA 3IHTA 2BZGA 3BZBA 3DLCA 1NW8A 3RIEA 2C7OA 3HNRA 3ORHA 2ADMA 5DT2A 2G72A 1KYZA 4Y30A 5DSTA 5K8VA 1MJFA 4P7GA 5EIWA 1SUIA 5C0OE 3GIWA 3A7DA 2HR1A 1NKVA 3FUWA 2UYQA 2Y1WA 4IWNA 5DXAA 2QY6A 3DUWA 3H2BA 4GOOD 4Z2YA 3TOSA 3V8VA 3KPUA 4YUWA 5K0GA 2YXLA 3HVHA 2AOXA 2IBSA 3GRVA 1O9HA 3EGIA 4CXMA 4OA8A 1IXKA 4MHTA 4HH4A 3BGIA 3LL7A 1IM8A 3MAGA 4RX1A 2PXCA 5E8JA 4LWOA 4AZSA 4BP1A 2QYOA 3ANXA 1M0EA 3P71T 3T7RA 3G5LA 4FZVA 3UBTA 1WZNA 1TW3A 5C1IA 1M6EX 4YUYA 5K0CA 10MHA 1JQEA 3CCFA 4R8SA 1FJXA 3PFGA 2IH5A 1QANA 5EVJA 1UIRA 1ZHFA 3CGGA 4EVIA 2WA2A 3G8BA 3NDJA 4BLUA 5K0EA 3EVGA 4RTKA 1L3CA 1FP1D 2UYOA 3HA7A 4PGHA 1XCLA 3VC2A 3EVCA 2XBMA 3THRA 2ESRA 4E33A 2F8LA 1ZKDA 2VDUE 4RTQA 1SQGA 2IDKA 2BR3A 3CVOA 5EZSA 1VLMA 1DCTA 5FULA 2XYVA 1EJ6A 4YMGA 4PYOA 4QQKA 2QRVA 1FPQA 1QAQA 1P1BA 3JWIA 2IP2A 5EEHA 2P3QA 3AXSA 5GIOE 2YTZA 3JWJA 5K0FA 2AN3A 3R24A 2VZ9A 4CWAA 4E2YA 5LSAA 3OZSA 5DWQA 3NVKI 1X1AA 5K0JA 2O07A 3BGVA 3ER8A 4E30A 2IH2A 1VPTA 2ZZKA 3LHDA 5LQAA 2I7CA 2KW5A 4DQ0A 2AS0A 3EVAA 4PYKA 3QOXA 1B42A 5ICFA 3OZRA 1D2HA 5EPEA 5E1OA 5T6BA 3FUTA 5KS2A 1HNNA 1JQ3A 2YXDA 2ZBQA 4F85A 1JR4A 4GOMD 5KQSA 3GNLA 3HP7A 2IFTA 2AOWA 3P2KA 4P7JA 4Y2HA 5FA5A 1YFJA 2ZULA 3BWBA 4OA5A 5CD1A 4RVHA 4GF5A 4ISCA 5LQKA 2CMHA 2IBTA 1NW6A 4PYLA 4R05A 3FUVA 5BW4A 3B89A 4PGGA 2FYTA 3C6KA 5B1SA 3Q87B 2Z6UA 2PXXA 2P3OA 3EVEA 3PX3A 3PVCA 3MTIA 4DKJA 5M5BA 3IEIA 4PYNA 3E7PA 5DX8A 5EIFA 3ELUA 3D2LA 3LDGA 3LGAA 3BUSA 4DCGA 3VYWA 2FHPA 3KPYA 5CVUA 5DX1A 2Q41A 4B17A 2YVLA 2JH9A 1JG3A 4KWCA 2ZZNA 5GOZA 3P9CA 3HEMA 3C3YA 5DRTA 4YUXA 5E9JA 5HIMA 1JSXA 5K09A 2I62A 3KR9A 2Z6AA 1X1CA 1XDSA 3GRZA 3KR1A 2PJDA 3ME5A 3MCZA 4ER6A 2BH2A 1RI1A 3LDUA 2ZCJA 4ER3A 3HCCA 2ZZMA 3KQTA 1JG1A 4ER5A 2YX1A 3NWEA 2UZ4A 4GQBA 1H1DA 4E2ZA 4EQZA 2ZLBA 4MIKA 3DMFA 3OE4A 1VQ1A 3O7WA 2UYCA 1T43A 2JH8A 1X1DA 4HC4A 1G8SA 4DA4A 1P1CA 1F38A 3FPGA 1ZGAA 3SMQA 1VP9A 4X41A 3FPHA 1V39A 4GOND 2OYRA 5HZMA 1UWVA 1INLA 2NP6A 1RJDA 2I9KA 3GGDA 1BHJA 2ZW9A 3CJTA 1DUSA 5EKXA 5GINE 4C4AA 4OX9Y 1KP9A 3B7PA 3THSA 4GC9A 1Y8CA 1AQIA 3MQ2A 4RTNA 1BOOA 1L1EA 2ZFUA 3EGEA 2EFJA 4C03A 2PVCA 4V0RA 3LCCA 3PT9A 2IIPA 2B3TA 4QVKA 4FR0A 2VDVE 3DXZA 3OU7A 1JG4A 4EK9A 4QDKA 5HOQA 3G89A 5C9ZA 2BR4A 3KQMA 4A6DA 4HSGA 5E1MA 2PT6A 4F84A 3KR0A 4QDJA 3X0DA 4AX8A 3GJYA 1AV6A 2P35A 3B5IA 3G2PA 3P9IA 4RVDA 3SSNA 1QAMA 1IY9A 5KYGA 4ZTBA 3CJQA 3BKXA 3LPMA 2PWYA 3NDIA 4M36A 3ER9A 4R6WA 3SSOA 4X63A 5FWAA 1XJ5A 5EMKA 5FTWA 1NT2A 3G88A 4DCMA 2NYUA 3JWHA 5MHTA 1JTEA 3LDFA 5CM2Z 1FBNA 3UJAA 1XTPA 4IV0A 2EJUA 2H00A 1KPGA 2WK1A 1EAMA 3P9KA 1D2CA 4FSDA 5EMJA 1YB2A 2VP3A 3FRHA 4OBXA 3M33A 2B25A 3G2OA 4ER7A 2OPBA 2PWPA 5EHGA 4RWZA 1Q0TA 2NNWB 2PY6A 5EQJB 3PFHA 2IH4A 2AR0A 2B9EA 5CVEA 4ER0A 3AJDA 4P58A 2AZTA 4RVFA 3TPZA 5EEGA 2PBFA 3IYLW 2GS9A 4RSRA 2YUIA 5T64A 3M4XA 2GA9A 1JG2A 5DM0A 1O54A 1YFLA 4C04A 3S68A 2OKCA 3NTVA 4OQDA 1L9KA 3GXOA 5H02A 7MHTA 2ORED 5DTRA 2G8NA 3R9XB 1SG9A 4XUCA 5CCBA 3OU6A 4X1OA 3HCBA 1R00A 2BM9A 3BT7A 3UWPA 5E1BA 1MHTA 3LCUA 5CVVA 8MHTA 2AVDA 1FP2A 2ZVJA 5HIJA 5EHIA 4YUVA 3HCAA 1RJGA 3KKZA 1JSZA 3LSTA 4PINA 3A27A 4QQNA 1EG2A 3A26A 4BP3A 1RJFA 3SXJA 2DULA 2IDJA 4IKPA 2A14A 2XVAA 5GWXA 1OR8A 5CCXA 2O06A 1EQAA 3M70A 1R8YA 1YZ3A 2P3LA 4FP9A 2ZIFA 2JG3A 1G38A 3SSMA 1F3LA 3G8AA 2JHCA 4DMGA 2OBFA 3SM3A 2B78A 2XYQA 4RTSA 3FTDA 3FTFA 1NW5A 2JJQA 2R6ZA 2PV0A 3DR5A 5U4XA 5KQRA 3VSEA 4X60A 1X19A 3FPEA 3L8DA 1NE2A 4EKIA 3CBGA 5GM2A 5KVAA 2B2CA 2DPMA 3EPPA 2P1DA 2P7HA 2VS1A 4PCAA 1KPHA 3K6RA 5ICEA 2HTEA 3UJBA 4CTKA 4OQEA 3C6MA 3GDHA 5HEKA 1NV8A 5DTQA 4AZVA 4HG2A 3O4FA 2ONZA 3PB3A 1VIDA 4L7VA 3GRUA 5FADA 3MERA 2BR5A 2HNKA 5EMMA 5FWDA 1XVAA 4A6EA 3UFBA 5E2AA 3Q7EA 5EMLA 3UJCA 3I5UA 2AN4A 3BWCA 4P7KA 4QTTB 2K4MA 5E9QA 3PTAA 3A4TA 1NW7A 2HMYB 3E8SA 5FA8A 3AWIA 3DP7A 5LR6A 1KYWA 4FT2A 2ZTHA 3MCTA 3GWZA 3T7TA 3OFJA 1R18A 2AN5A 1QYRA 2PX8A 3KU1A 4GEKA 1XCJA 2H11A 5DPMA 2ZSUA 5K05A 4YUZA 5DSXA 2AOTB 4V0QA 3UA3A 3T0IA 2ERCA 1L3IA 3O31A 4AUKA 5ERGB 2XYRA 3KQQA 5FHQA 1AQJA 3P2IA 3LBFA 5DM2A 1RI2A
chains in the Genus database with same CATH superfamily
3ZHQA 3R4CA 1C7QA 3WWCA 4HL4A 1BKYA 2QD2A 2PZEA 3FY4A 3SHTA 4MKZA 3O8NA 3MB5A 4Z4FA 1HNXM 3A4LA 4FFMA 1ZONA 5L7YA 2JATA 3QBJA 4K26A 4UHFA 5REQB 3OOHA 2W7TA 1CEXA 1ZITA 4H7HA 5TMBA 4YASA 5B55A 3JZMA 5AVQA 1QKKA 1WUYA 4X7PA 3FETA 3JASB 1L5VA 4RC9A 1FFGA 2ODAA 1NQVA 3P5SA 4DM3A 4R2IA 1DC4A 2NYRA 4NAVA 1SMKA 3VPCA 3QWLA 3KSDO 3DFUA 1UT6A 2JAHA 4WFJA 5T3UA 2I4OA 2JDIA 3RROA 4DMHA 5A2QA 5HHTA 2Q5EA 4IIBA 5IXJA 4HAOA 4PONA 1DKMA 2G88A 1OAOA 2A67A 4PU0A 4YCSA 5E4YA 4UC0A 1N1DA 2QBYB 1LDYA 1FTWA 2BFMA 4MUHA 3DHVA 3ICQB 2HXGA 3O8QB 1QRTA 1JA1A 4BLCA 1WCXA 2CCGA 4QQFA 1JFVA 1D2AA 5HF9A 4II7A 3SF8A 2O3SA 2VNKA 1LW6E 3H5OA 3MGBA 1UXHA 2F90A 4MUGA 3X1YA 5JMOA 1L4GA 5JEEA 2JI4A 4GR9A 4QBIA 2O5EA 4YA6A 4NONA 2JJ8A 4JNKA 2QNRA 2VA8A 2NIPA 3V4LA 2V03A 3VXKA 3ILVA 4BFVA 4D8WA 3A1FA 1NNUA 1XD8A 5DSZA 1Z4LA 2M6SA 3B53X 4QLOA 3TD9A 3OESA 3Q1LA 2XVXA 3I9OA 1JYSA 2YFHA 3G59A 3GQ4A 3GDOA 5DW0A 3L6UA 3PR3A 3I0NA 3SJAA 4ZYUA 1WS6A 1GZHB 2GBGA 2ODBA 3DH0A 5HS6A 3U1VA 1RBZA 2EFCB 4Q4AB 4R2HA 3DMRA 3O91A 4OGLA 3KYCA 5K0SA 2CVOA 2Z2KA 3G5MA 3T35A 1WETA 1HXHA 3A1NA 2XCUA 4GDFA 3IPCA 2DAIA 3DL2A 1PS0A 3F9RA 1OLXA 4JJKA 1NF8A 2P9EA 3TZHA 3VVLA 5LMUM 3AV3A 4D26A 1I36A 2E4XA 4RHEA 2I7PA 4JI3M 4EZEA 3H9QA 3IQHX 3BJEA 5EJ2A 3O84A 4OBWA 5AKIA 1P77A 2I6GA 4MJLA 5CT5A 1UJ2A 2FWIA 4DCOA 4DV2M 4Z7OB 1NIPA 1LZKA 3U37A 1BX0A 1TR8A 2NMVA 4PZDA 2WOJA 3LY7A 4BMYA 1EVZA 3HE3A 1BC5A 4N7RA 3HU2A 4K9SA 3RJ5A 5A9SA 3T7EA 4MYTA 4E51A 2Y0QA 1PR5A 1S02A 3MGCA 3NZEA 2HA6A 1OU4A 3I53A 1ADBA 1ESDA 1OI3A 4FFRA 2A84A 4ZCIA 1QVRA 4KB5A 2FWPA 1YHZA 4IPTA 4FFWA 1NF2A 3QEMB 3IUJA 5EJMA 1ZNYA 3L0SA 1FMCA 2JZ1A 2BMAA 2NAFA 3ST7A 4GH9A 4TVKA 3VBEA 1G5FA 1WIVA 3BD6A 1QG0A 4DLRA 2OZVA 4RGBA 4B6SA 3IHPA 3CEAA 2AOUA 5T4BA 2RK6A 3DTNA 3M9LA 2G9UA 3MG9A 2GBLC 2YWXA 2X7JA 4ALMA 2ALJA 5IANA 3TD6A 4WIAA 1XQYA 1HT3A 5IDQA 2G1JA 2PLWA 3SHOA 3E2PA 4DT1B 4N12A 1T8YA 3D31A 5LQMA 4OQFA 2Y1DA 2FV8A 4KH1A 1QDEA 2O6LA 5KYTA 4RACA 3ZDBA 3M34A 4F3TA 1F51E 3BXGA 2WFMA 1Z2PX 2JBAA 5DYGA 4EARA 1I5RA 4DJJA 3R6TA 2PZ8A 4MI6A 2V7BA 1U94A 1DJOA 4CIYA 4AWXA 1BDHA 1FW6A 1E2NA 1AIPC 1SQFA 2F43A 3AVUA 2Z8YM 3WLIA 4NY1A 3AETA 1VG5A 2BNKA 1DIHA 1UPUA 4K9MA 3O38A 4QELA 3SIXA 3A4YA 4E15A 2BDTA 5MFZA 1Q74A 3RUDA 1XCPA 2DT5A 4KQIA 5HTOA 2UXBB 3CCCA 1CW2B 2OCDA 3GLUA 3N2ZB 4RCYA 1V4BA 4EL0A 3PNMA 5ALMA 3P0HA 2YQZA 3IOMA 5LMNM 2C3PA 2OVFA 4I6GA 5B1HA 3HCFA 3BGWA 2HX1A 1OAIA 3CIFA 3I23A 3RW9A 3TQTA 3OTOM 1IPHA 2J7PA 3UJ3X 3VVCA 5K3BA 4P34A 1CLEA 2PTHA 2P9FA 4IXMA 3CU5A 3OD5A 4RZ3A 1VYHA 3PNPA 4EJ0A 3OKAA 1IB6A 4B73A 5LIRA 4L95C 2IW1A 1QYVA 3F8TA 2C2BA 3PNOA 4KJZA 2R1TA 2R6R1 3B3JA 1M67A 5E7JA 3QVWA 3OJLA 3QW2A 1S1MA 3AF4A 2ZVPX 3EFOA 4MH0E 2WTBA 4F6RB 1IDN1 4YLEA 4DARA 2JS7A 1FTYA 1WCIB 3STUA 4OF4A 2G7MC 5I7SA 4ACBA 3KR2A 3B9PA 1RW4A 3KOZA 1CUCA 3LUCA 1MO5A 4ECEA 2F5QA 5F64A 3FNGA 2QMUA 1X92A 2Y99A 4MYHA 1X7GA 4RE6A 3VKFA 4EY7A 3QU7A 1GRRA 1XR3A 4REQB 1WHSB 4RKEA 3V34A 4KMMA 5EZQA 4D0SA 2JLYA 2DHQA 4CV0A 3HJTA 5CITA 2QUZA 2ZBVA 2HWKA 5BSUA 4FU0A 1LWNA 3RU9A 4YQFA 1GJRA 1FFHA 1PJZA 2VF4X 3CEMA 2FPSA 3EUFA 4KIFA 3V80A 5BV1A 5J4HA 1VCHA 1VL5A 2A9RA 4RTMA 2QPOA 1HNZB 2J6HA 4CKBA 4B5LA 4DGSA 2C5HA 2C59A 3IHTA 2HRDA 1YZNA 1GUZA 1S3IA 3HNRA 5DFLA 1GKUB 5DT2A 1AA9A 1GU1A 1RQLA 1UUFA 2WYOA 3GGCA 4IJKA 3WRWA 2A5GA 1YC2A 3MWFA 3PFCA 1ORDA 3LA8A 4YCDA 4ZVUA 4II2A 4JBGA 2Z1MA 1HZJA 3A7DA 3G2NA 4OK3A 3DTVA 5IU6A 1C3VA 2OFWA 1AH2A 1KOJA 4U0KA 1GIAA 1O6ZA 4HGQA 5K0GA 3PTLA 1XTSA 2XNCA 1ESCA 5SYNA 1DWQA 3L0DA 1WXEA 5D87A 5EWLA 4QKQA 2XZUA 3LT1A 4UJ5A 2V9PA 4DYHA 3ZLJA 3BTSA 2I3BA 3ZHUA 4L15A 1G16A 2NG1A 3L0IB 3U7QA 1NQUA 4EVSA 3AVOA 3LC7O 3ASVA 5I8WA 2X9NA 2QYOA 2WU3A 2DZNB 4L9SA 4LY3A 3HFSA 3D3NA 4OHZA 3SC2A 4FZVA 2PX3A 3UBTA 1TZCA 3PEEA 3VHXA 2HU8A 1NBMA 2VP0A 1C4OA 1ULBA 4Q0MA 4AWAA 3KALA 4EEXA 3EY9A 4YNBA 1YB6A 1QR2A 1YL6A 1SHUX 2IVFA 3LQQA 1NRIA 3UUWA 1UIRA 4NU0A 3C3KA 1ZHFA 3AW9A 3H9CA 1S2DA 1WB5A 1ZH4A 4QOGA 2VH2A 1ML4A 2IXFA 1L3CA 1SCUA 3RIYA 2OO5C 2RHRA 4LRUA 2I7VA 1UM8A 1M8JA 4TVOA 3MSXA 2EX1A 4XVRA 4H3SA 3JQDA 4Z3OA 4MUAA 1ZH0A 4ZKEA 5ITTA 2IV3A 2DPYA 2G9RA 1H22A 2QD1A 2O14A 1BJTA 2XYVA 4J7AA 2I8LA 2NZ8A 4JYMA 1F2DA 3HB4X 5E6UA 5LC1A 1NUUA 2IU3A 3I2JA 3RWMB 3BDIA 3AJRA 3LYLA 4BX8A 5GIOE 3CX6A 2JCYA 3E22A 5DJ5A 1FX0B 3E3NA 2FQQA 2CNBA 1N33B 1KEEB 1NMXA 2OM6A 2X3YA 3R2JA 5LU9A 2OZKA 1YRYE 4LYAA 3HDTA 5ER9A 2D13A 2CF5A 3GP1A 4BZPA 4RFSA 3NCTA 4I9UA 3JQAD 2ZDGA 3LQ4A 4TOIA 1PL7A 4FCTA 4C5AA 1NAHA 2WHPB 4NENB 2VDBB 1T3LA 3DMNA 4MKGA 1NJ8A 3DNPA 3OFND 3GLGB 3SZ3A 3LJKA 2HK9A 1Y8QB 2YXDA 4JVLA 5C7OO 1SXGA 3T5DA 5KTTA 2LGJA 1BGWA 1HORA 2W58A 1K3WA 1AK9A 3THXA 4OQNA 3P2JA 3ZCQA 4RETA 1SBZA 2FF5A 4LOLA 1BRMA 3ITDA 4K28A 4Q4HB 4MCAA 1RBYA 2PSEA 2QAGC 3F49S 1RWOA 5EQFA 5CLIA 1SUFA 4J3NA 5BNFA 3D2AA 1DGBA 4HEA6 1U3DA 2AG6A 2QHOB 3QQPA 3RK0A 4DIOA 5FH9A 1E4VA 4D0GA 4PGGA 3M1AA 5KMGB 1GZUA 1ODJA 1LRJA 1XDWA 2ET6A 2H4XA 2AQHA 2IPLA 1E69A 1W93A 3AHDA 3OPYI 4EI2A 1Y5IA 2PGJA 3SCZA 4RKYA 4JVSB 2V45A 3KOYE 1QH0A 2WDZA 3LX8A 4H4CA 1QIGA 4UXHA 4XIGS 2PRIA 3ZWQA 4DBVO 4JXXA 3EB9A 1Y3AA 5A4FS 1Z7YA 2Q46A 4EKEA 1XMOB 4KVFA 1XMQB 1FLVA 5H82A 3TIIA 2B82A 1ZGCA 3RAFC 3CWQA 4DV6M 3NG1A 4TXJA 4X84A 1J0AA 1KAMA 4OXQA 4YBRA 1W36D 4H7KA 2IGBA 1E2GA 4EPVA 1OYOA 1ZYUA 2I62A 2X22A 5H4GA 5IYZA 2RHCA 4PHHA 3SQMA 3WTBA 2H2GA 5EE9A 16PKA 1FRNA 1QK3A 3EZ2A 3L04A 3QEBZ 2GCGA 4PCUA 3L6EA 3RGSA 3ED5A 5LYJA 3OEEA 2QYTA 4F6RA 2J4FA 2DAGA 1UFVA 3GJQA 1QCDA 4BNKA 1J7KA 1OWNA 4LTDA 4XGNA 5BN4B 2XJ9A 2JH8A 3PFIA 4DV3B 2X3UA 1J0XO 4YDQA 2QSJA 4FX2A 5CT4A 1D0IA 3DZHA 4HSEA 4TT8A 4K87A 1V39A 1JZTA 4G8BA 4KJXA 2CV1A 4DR1M 1ORYB 3A4IA 3RHZA 5FEUA 1DCFA 2DYKA 4X20A 3HFRA 4Z86A 4EHIA 2XX3A 3SX2A 2BTQB 4G4QA 1QZUA 1WHSA 1PHRA 2ZB3A 3NIDB 5DEOA 4UVEA 4D9EA 4XXHA 5GONB 3THSA 5IVHA 5IKPA 2AUNA 4JI2M 1T4CA 3MOSA 3RD5A 2JLUA 1GTRA 5L3QA 4MVXA 3SVTA 2RRUA 3F8SA 1RLTA 1LRKA 3AUUA 2SKEA 3BWVA 1L7DA 1V71A 2JFBA 2J41A 3DXZA 2B98A 3WDSA 1WMAA 3C3BA 4M1KA 3IP3A 1LTHR 4NEHB 4F84A 3KWJA 1JB9A 4MV0A 4LRWA 4UTOA 1F6DA 3TPFA 4P4TA 4HB3A 1IY9A 3ZWNA 4GKJM 1YIDA 2C42A 3HQ4O 4M7OA 3BKXA 3SG0A 3MJ4A 3O4JA 3U31A 3PCTA 4MR9B 4EHFA 1PFVA 1MB2A 2ZAOA 1MVLA 3OSZA 1QV9A 3LNCA 2AFRA 2QRHA 4JU8A 4M0UA 4OX9M 2NYUA 4JBHA 4OHMA 1PS8A 2QX9A 3K8OE 1L5OA 1UBUS 4JR0A 5DK4A 3HO1A 1QHXA 5DCWA 1O8BA 3ZWPA 1FMFA 4UTVA 4FCCA 4FSDA 1FFXB 1YB5A 3S44A 1B3BA 1QUSA 1TU3A 2EX0A 2HIAA 5DB4A 5G0VA 1YNOA 5MN5A 3HPRA 2IXDA 4J2OA 5DHUA 3BSYA 1SVSA 3RVQA 3PWKA 3RTBA 2O3UA 4KPUB 5ALYA 5J2UF 2YZKA 4BKMA 3HSYA 4RE5A 3RYCB 1R4GA 2GS9A 3K9LA 4RSRA 2WJYA 3H75A 5FWXA 3T3MB 3I05A 4EGQA 3H83A 1DTWA 1M1XB 1RRPA 4MMZB 1FTGA 4A16A 1JPJA 3MUEA 1XELA 3SC6A 2W6ZA 4G0VA 1IZZA 3KSXA 4FS3A 1QRUA 4M9UA 2X6RA 4ROTA 4QOFA 2BGNA 1VIYA 4TUWA 4KXXA 2OQVA 1E98A 3ITKA 1Z4IA 4F38A 2HA5A 2HCJB 5CT6A 1PL0A 2LCIA 4GKJB 3D43A 1OIVA 2HMTA 1H6UA 4XJSA 3B7QA 3OQ1A 4YMSA 2NSJA 3ANNA 3KVVA 1TL7C 2R4JA 1XOIA 4IINA 1NUPA 3LUJA 1RJGA 4ZQEA 1VG8A 1YCFA 4PFQA 3JPYA 4PVDA 3BK1A 1DFIA 4EYOA 1GPDG 3CF4A 2JKVA 5B3AA 2XCTB 4IVPA 2EL7A 1E3QA 2DH5A 2V7TA 2ORWA 2XVAA 4YCJA 4LF4B 3E5RA 4H1TA 3JQ7A 2ZIFA 2JG3A 3SSMA 1D2RA 1QFZA 1IB0A 2ZJBA 3FTDA 2YHAA 2FWRA 2JJQA 2XZOA 3ABRB 3URKA 2XADA 3MWEA 4EG5A 5F3WA 1NE2A 4MM3B 4NENA 5KAPA 3SHQA 3I2KA 3QKRB 4ZDKA 4YUAA 3I62A 3GLGA 1QHHB 1EBBA 3TZCA 3THYB 3HO8A 3GVHA 5KSPA 3B1WA 4B8YA 2GBCA 1TQHA 4KBGA 4PC3A 2DY0A 3W67A 3MERA 1HRKA 1EH5A 3S2FA 5I51A 5EERA 3N05A 1E3SA 4A6EA 4QDUA 4QTTB 3BWCA 3O0DA 1KVRA 3EPKA 3PXDA 2JGLA 3PTAA 2I7NA 1C50A 1NW7A 2JFOA 3SAVA 3QU9A 3AWIA 5GPBA 5FPTA 1IPFA 3JPWA 3ZGYA 3QX8A 3GJ5A 3GEGA 1UKAA 3IHKA 3K3PA 3MRTA 1H6DA 4P98A 2FSHA 3ROGA 4F2GA 4PRLA 1AGXA 1XCJA 2ZSUA 3FJ1A 1A9PA 3MJRA 4V0QA 2FW7A 2J3DA 4DR7B 1Z07A 2A3RA 1EFTA 4ALNA 3A6DA 2CNDA 3WKEA 1JDVA 1WNTA 2RGAA 1A5AB 5LQJA 3L8HA 5KVSA 1CZKA 2A59A 1SGWA 3OT4A 3I6QA 3PQEA 3Q2IA 1E7RA 2KDLA 1ACMA 1GCGA 1YJQA 3G9QA 5D3MA 1P8JA 3RVBA 1WV1A 1FTNA 5IWAM 3E21A 1E5DA 2C2XA 4PCZA 3G5AA 2P4SA 2PH1A 3SXUA 5F2EA 1I1QB 1W85A 3BHMA 2GJ8A 5JDCC 3V8NA 1OWLA 4HH0A 3ZV4A 3ROFA 3A0RB 1RXEA 4MCHA 3ETCA 1ZD9A 5C35A 5IYZF 4MGYE 3IAS6 2HT1A 3OTHA 3RSOA 1C4XA 5CG1A 4XR9A 1DU4A 3I9NA 4HYQA 5GZ3A 2PAFA 2P4QA 3GF4A 4I3HA 3DT8A 1EUZA 2W00A 4PSUA 1M73E 4XGQA 5BR1A 3W5UA 4GPIB 5AW3A 3MW8A 5IHXA 5LQCA 3GLIE 1E7WA 4FZJA 3U40A 1K6IA 1TM1E 2ZSFA 3E0QA 1NLMA 2C8JA 2ZI5A 4FGUA 5EIOA 4WXHA 5ES4B 4D02A 3VDNB 4EHDA 2J07A 1WWKA 1CJMA 2C0CA 4EG8A 5JCXA 1E6CA 1WKBA 3WDMA 4R3WA 1RLIA 5LDHA 3BHNA 4B6JA 2ZIGA 5FV7A 3P96A 1ECCA 4IZIA 5DDIP 2E4VA 3QXGA 4BE9A 4JQOA 5IDYA 1NNSA 3FWKA 2VHTA 2IQ5A 4URVR 1KWGA 4C7OA 3OPNA 3R3HA 3U4MA 1KHTA 3IX7A 4HWTA 5LOVA 4PAOA 3CIOA 4WVLA 1EXWA 4NV3A 1GUBA 3LBHA 1E9VA 1XYYA 1XZJA 2XGNA 2W2NA 3MJSA 1DAOA 4MHSA 4QASA 4LF5M 2SKCA 4ND5A 1WD5A 5JNLA 3TJMA 4FDVA 5I9BA 4D4IA 4C87A 3VTKA 5EP3A 2Y21A 2FEMA 1QNFA 3N8NA 3TQIA 3VZRA 1JT9A 2UZ1B 3KJQA 1TH2A 4FB4A 1E64A 2J5RA 2QMYA 4JI5B 1SO8A 2XBLA 2ZAGA 5DW3A 1WPQA 4CRWB 4J3FA 1GQRA 1JEQB 5LXTB 1RLUA 4QM7A 2OAEA 2HWJA 1T6BY 4NLLA 4R6XA 4TYYA 4JBIA 1BQ3A 3N8GA 3FNQA 5KPJA 3KZCA 3C8MA 3JQEA 4DLWA 3OA2A 1CR2A 3M9XA 3PPXA 1LFDB 4X45A 4MP6A 4BRUA 1CNFA 5HYVA 3HWWA 2PUJA 1FJ2A 2R9VA 2OB2A 4BASA 1FDUA 3GYGA 4XOIA 5JDIA 2AE2A 2BGRA 3EHEA 4BLVA 1N2GA 1JKJB 2P4HX 1ZISA 3KSZO 4G26A 2GH1A 3PL5A 3TR6A 3T34A 2QNIA 4MITA 3DZDA 1IBMM 1QDRA 1OGJA 5HFNA 3HZHA 4BWYA 2XMRA 4KHZA 3OM9A 4WK2B 2OFFA 2GEFA 2DSNA 5IBQA 4PPGA 4FOSA 3ZIUA 4BWGA 2DWLA 4LFBM 2CJYA 1NRWA 2HQ1A 2XMGA 4RF4A 1I8TA 2KB0A 3M1IA 2QJTA 2C7QA 1VBMA 3PHJA 4J1TA 2OK8A 4JR2A 1YDHA 1VLJA 1L7OA 3HYTA 4IDGA 1NHGA 3JSXA 1U3WA 4FLEA 4HJXA 1XZDA 5F52A 2NXJA 1EUDA 2WV9A 2IZ0A 2GHIA 5IP5A 3C14C 3D5EA 1W4BA 1HT1E 1B8UA 3L1JA 2PUAA 3G5UA 4Z0PA 3FFWA 4FB5A 3LP5A 3ZLTA 1HE8B 1KTVA 4C2UA 4DSTA 1B0ZA 1OFTA 1QQAA 2VWGA 1QHHA 3S7ZA 1XZLA 4JWKA 3WS7A 1AVTA 1Z2CA 3F5DA 2ORYA 1U9IA 1TJNA 3N3BC 1I5EA 4NABA 3HA3A 5ALSA 1UZUA 4JLAA 2Z0MA 4HDKA 3RSZA 4AW9A 2KX7A 1FDWA 2D1QA 2JIPA 3I9V6 4EFMA 4KE9A 5CEFA 4CEJA 1PGOA 1L7VC 1POWA 2DSTA 2GEUA 2FF7A 1I01A 2H2HA 3NBMA 4S2UA 4KFCA 2YCBA 4R3UC 2P3SA 4BMPB 3KPWA 4HH3C 1BXGB 1Y0BA 4JR1A 2ZSJA 4F45A 1X77A 3NYIA 1H4QA 1E9FA 2DU8A 4XQCA 2NXNA 4I4LA 2FPKA 3NMUF 2C9OA 4AMUA 4J2TA 2C9BA 3GI1A 4CTMA 5IT5A 3AWDA 1AZTA 3MMPA 1GGJA 2Q6OA 3ETNA 2W37A 3OBBA 5FA6A 3PEYA 3PQ4A 1YACA 2UDPA 4OXRA 2OCLA 3A9TA 2PVPA 2DMRA 4M8LA 4UTXA 3DV9A 1JAYA 1VJRA 4GMFA 4F7WA 2IDZA 2Q5QA 2GK3A 1WULS 4D92A 1FXSA 4WLVA 4DL9A 2J5BA 1N2JA 3RYIB 1TTPB 3G2QA 1I51A 1XNQM 4P1ZA 4AUMA 3MTAA 3A9VA 3DNFA 1O6GA 1XMXA 1KY4A 3WGLA 3KEGA 4KK4A 1AQUA 3PWSA 1RJ9A 1O9GA 4WXMA 4CMIA 1ZJ6A 4CEHB 3I04M 3DEFA 2DKLA 5FFMA 1HMYA 2CP8A 2P27A 3EG9B 3OE7D 2RFLA 3K09C 1N2XA 1EDEA 1F6BA 1PX0A 1WX1A 1XGKA 2VPWA 1AT1A 5C34B 1UDAA 5KVCA 2AOVA 4KN9S 5AJXA 4E2WA 3ZY3A 4BZWA 3FOFC 3VDQA 2NU6A 2BZGA 3BREA 3HJSA 1PWEA 5C8YB 3DLCA 3B6JA 3GLIA 3IMFA 3IT0A 2J30A 3KKEA 4CIVA 1DHTA 3QNMA 2ILVA 1KYZA 2BKUA 2X4IA 4HYEA 3A70A 3ASZA 4YT5A 4CKWA 1Y1QA 4ND3A 5JXGA 2MHCA 3AVYA 5ULLA 1XU4A 3U16A 1FVXA 2MSEB 4MVJA 4D46A 2B69A 4FE4A 1Q1EA 1Z74A 5E6RA 8ADHA 3AU9A 3ASYA 4S0ZA 2HHAA 4HAUA 1RD4A 1O57A 3LE8A 5CW2A 4W5OA 2UV8A 2H17A 3FUCA 5COAA 4GMQA 1IM8A 1CF2O 2H3HA 2VPQA 2W2OA 2QB5A 2GYUA 3C1OA 2IYVA 3M2TA 3WNDA 4WKGA 3JQ6A 4ZVKA 2P69A 4ZGBA 1HR0B 4BP1A 3WOHA 4DNOA 2XDQA 1XIVA 4PO8A 2B8WA 1JYEA 3RUFA 2VBIA 5H1YA 5AFSA 4C3OB 1F8YA 4FN4A 821PA 1M6EX 1QO7A 1J99A 1N2OA 1DRWA 1L7RA 1QE5A 2PN1A 2VUHB 3KJGA 1COZA 1R3DA 4I1PA 3PFGA 1EUQA 2FWJA 4NARA 1JE1A 5EVJA 1T8PA 4Q5IA 3VV2A 4LGCA 2DCMA 1S2MA 4X7BA 1NXPA 2V3VA 4JCOA 3T4UA 4GMKA 1PR3A 1E3IA 2HYDA 4C7VA 4C0SA 1XWFA 2MH8A 2UYOA 1UQUA 4PGHA 4EF6A 2HDWA 2RG7A 2CFOA 1XVTA 5K3SA 3Q7QA 4E33A 3NHWA 3PDIB 5K6RA 3OAAA 3ZTWA 2X9LA 2H16A 3NNSA 4ND8B 4RTQA 1X94A 3I83A 4ZYWA 3E48A 5E6SA 4BHTA 2HSWA 4S12A 4WN9A 1TEZA 4XARA 4D4GA 4PYOA 1QF9A 4ARZA 2LIVA 1BXRA 3OLVA 4KN6A 3DZKA 3JWIA 5EEHA 4KL8S 1Z4JA 3NXSA 3NUZA 3TLEA 2VDMB 3JWJA 4KITB 1APBA 4UM9B 1KQ3A 2Q50A 2R8BA 1QFYA 1E5XA 1Y9ZA 3UH1A 4YHHB 1Y6FA 1ST3A 2Z58A 4IOLA 1ZN7A 3RU7A 4IGFA 1UKEA 1GM5A 2Q5CA 4CQMD 2HWUA 2ZZKA 4QE3A 1DQZA 1G4HA 5A7FA 3GA5A 4LMBA 4MWDA 2Z3VA 4PR0A 5CDTA 4UBLA 1HGXA 4J0CA 4FFDA 2WWIA 2B30A 5A4AA 1U02A 3NNDA 5LKAA 1PZGA 1C4WA 4B9EA 1M1YB 4K9RA 5TY0A 4F85A 1SU6A 3TNDA 1VI6A 2GK7A 3AM4A 2EJWA 4RHYA 2GI4A 1XEFA 1WXHA 1U7DA 1NZDA 3SK0A 1KRWA 2I4MA 2J9GA 2VPPA 4O4IA 1LJUA 3AB8A 3GVXA 3G0DA 3QH4A 2WG0A 5KSYA 4PPNA 5L3VA 1SVWA 4X91A 1YJAA 2G04A 3FROA 4GOXA 4NCIA 2JLCA 1J1UA 1M6VB 4XSGA 3ABOB 3CX3A 2QCUA 2JFGA 4IIEA 5CX1A 4ZT5A 3ES9A 3B89A 2W6IA 2QRLA 2VSFA 4ZAGA 4MWTA 3A1SA 3QEOA 1MBZA 1ZW6A 3LXUX 2GVZC 2V7VA 3B78A 4WY8A 1P0PA 3IQEA 1RPJA 4LZJA 2O5VA 2OV6A 2P11A 2A0XA 3ZNQA 4JI6M 2FX5A 1CIVA 1GFZA 2FR8A 4JEHA 5TF4A 2P9BA 2C5AA 2F5PA 3T3DA 1YR7A 4IR7A 4PSKA 4R9RA 2Z04A 3ULKA 2Z1NA 3WNQA 4XEUA 3HXPA 4DREA 2I3AA 2O8VA 3C3YA 1Q7EA 3HEMA 5CT8A 1OT3A 5EE1A 5F4BA 4HI0E 3WMXA 2VYCA 5HIMA 3H2IA 1UBNA 3KLOA 4M54A 5HX7A 2A94A 5EIAA 3GLVA 2IIBA 4M53A 4A9AA 1TCVA 1USGA 3PI6A 3SHFA 4RIIA 1CJCA 1MJGA 4O4HB 4TSRA 4GQBA 3SYTA 1SIUA 4DC9A 5JROA 1DIBA 2Z8ZA 2ZEJA 4GZLA 3I52A 4LCEA 4U9HS 1ZH6A 4IIHA 1P2DA 1YHYA 3Q5GA 3ETDA 3ZY5A 2NO9A 3VK8A 1Y34E 2GWRA 2JL1A 2XE6A 5A4IS 5FOQA 1FSPA 2YV5A 4X8MA 1LRLA 1ESNA 2ZWOA 1HDGO 2PKCA 1YULA 2CCKA 5IC5A 2E18A 1EVLA 3C5EA 5EZ5A 2Q6LA 4D25A 2Q5HA 1SXJE 1HTBA 3A06A 2GLTA 3MT0A 4L9WA 1DI0A 2WMYA 4X5OA 2JIOA 1CUVA 1ZMVA 1HLPA 2A30A 1IXZA 4MQLA 1OKSA 1KI4A 1GXSB 4JIMA 2WFZA 3GPIA 3Q7PA 1U8CB 2PKYX 2JI8A 3ET4A 4GMDA 1JI3A 4ZTZB 1WDTA 3FF4A 1C30A 1OFIA 2X6TA 1L4YA 3USZA 1HSZA 3G0GA 4FBMA 5DIZA 1ESEA 2BR4A 3KB6A 3WVNA 3GROA 4K2AA 1OXBB 3D3KA 4ZV9A 4BNMA 1USVA 3FTNA 2X0KA 4ISBA 1KJZA 1J07A 1OX5A 1CUYA 1JEYB 4KYUA 3CF0A 2JNHA 1PNRA 1CP3A 2BFBB 1K7YA 3HXKA 2PJZA 3NHAA 3X1ZA 5AJUA 3D3WB 1LTKA 5FTJA 4EQ6B 1ABEA 4TKLA 1Y9AA 1PT5A 4PC1A 1UBMS 2G77B 2E4WA 2PEYA 3M9WA 4S0XA 2WFLA 5CM2Z 3T12A 4AN4A 1TFRA 4YRBA 2WSYB 5HFAA 4BYGA 2Y76A 4RPGA 3P9KA 2FFRA 1P44A 2XCSB 1H69A 1DKOA 1X8XA 4FEEA 4RVNA 5CJPA 1TE2A 3S3TA 2E21A 2XDQB 2ES4A 1FLDA 2G82A 1I6MA 1FDIA 3LY9A 1FYWA 4HEA1 5FOVA 2BYTA 2J3EA 3ICEA 2OAQ1 4EPYA 1DAKA 4LRTA 3EH1A 3LLUA 4UBMA 5T64A 2Q8NA 4MYUA 4PQEA 5EESA 4FZ5A 1ZDMA 3K9CA 1FBTA 1QKIA 1NVVQ 2C1ZA 3AR3A 3I09A 3MFQA 4G5FA 4HX5A 5AM4A 4H2DA 1ZVVA 3AJ9A 1K6EA 4O0MA 1JH9A 3ZIAA 3PE3A 1P3QQ 4BUJA 2BKVA 1ZN2A 4RY9A 4D57A 1E3TA 3BT7A 5I9MA 3CNNA 3WHPA 5JBIA 5ITXA 4L07A 3E18A 4IJ6A 5ITQA 2Z3WA 2CB9A 5TR9A 1DJLA 4LYHA 4K1XA 5EHIA 4BP3A 1NATA 2Z30A 3BSSA 3A26A 3IAS1 5E3JA 3BFJA 2F1KA 1Z3IX 4LJ8A 1BXRB 4R4JA 1R16A 1RHRA 3L6BA 4FJ1A 3UFXA 1IBRA 2OZLA 3LWBA 3HU5A 4Q3OA 1XTTA 2WILA 2Y0EA 1ZVKA 4M99A 3JQBC 4ZVVA 5C53B 4KTVE 2JLAA 1G38A 4C2AA 2AX4A 2XUDA 1F3LA 2WRZA 1N6HA 3HY3A 1D1SA 4K9NA 1JXAA 2B78A 2XYQA 1NF3A 3DR5A 1RC1A 3ESDA 1TZMA 1L5SA 4FX5A 3TLXA 3OLYA 3O47A 1MRZA 3T7CA 3VSEA 3DLHA 1EB9A 3MGKA 1IIRA 4Y3UA 4GXTA 1KVQA 2OTCA 3QYPA 1ODKA 2YJ6A 4HUQA 4GEWA 1TVMA 5JXJA 1I94M 2PS9A 4X62M 4KGZA 2NZWA 4OJYA 2RB5A 4UU8A 3S2YA 3VMMA 3W2EA 2XUFA 1CDDA 2O4UX 1YZYA 3AIOA 3EWIA 5IJ9B 1XVAA 3K0CA 2ADOA 3GG2A 3PLNA 1LTQA 4RZHA 4EYEA 1QOQB 5KTOA 3U4IA 2EZ8A 3OICA 1SBNE 3KV1A 5BVHB 3BHIA 1XRJA 3M49A 4YC7A 5BN3B 3OLZA 5CX1B 2O8EA 4IH9A 2XE8A 4FM9A 3L0BA 1ZGGA 2JGEA 5C4GB 4NCAA 1PIWA 4ZVOA 5REQA 3SSAA 2JD0A 1P7VA 3IQFA 4MQBA 2WU4A 4U3JB 1AKYA 2YQ5A 1CUGA 1CY6A 2H11A 13PKA 3CH4B 4BNYA 4YUZA 5J4VA 1G6HA 2YC4C 2VQFM 4IDEA 4B6RA 1GVHA 4IRUB 1WXGA 3LZ6A 4PR3A 2R4TA 4RO0A 2NPOA 4JU9A 1KS9A 1OAAA 1BMFA 3LS2A 2WE7A 1A2BA 3EQZA 3PXBA 3LQ1A 4FFPA 5J4KA 3ROZA 1KDYA 1YA4A 4UMFA 1GQYA 4R83A 4QUHA 3GLHE 4P5PA 4WVFA 1RZRD 2ZTLA 2W6QA 3KZOA 1L5HB 2ZI9A 5FL7A 5DH9A 4C30A 4LSGA 2ZR9A 1ZK2A 3IVXA 3TNFA 4GGPA 1JLLA 4ASUD 3DMHA 4H4EA 2H2IA 3S2ZA 4BVLA 4L6V6 4D5GA 1CV2A 3C48A 3E1GA 4M1EA 1I5OA 4MI3A 4W7IA 4ZJPA 4UVIA 1GSAA 3SF8B 2AEJA 5D1HA 1P1KA 5IBRA 4QATA 4ARSA 4M0KA 3ZD8A 2YIDA 1RKUA 1BMFD 1NM5C 1SPXA 1SZCA 4QUIA 3WHLA 1J33A 3BWYA 3DMYA 3QV2A 1I2DA 3Q6NA 4RZIA 4FEAA 3RSSA 3AVPA 4LTMA 4YYEA 4HS4A 2WKWA 4QUKA 1PUXA 2N46A 3L06A 1CPYA 1YRBA 1E8DA 4O29A 2DFVA 4O4IF 5CK5A 5AR1A 4A23A 4CV2A 3DOUA 2D5IA 1UC4B 4HCJA 1OBHA 1NVVR 1Z5GA 3MK31 4Y6SA 5AT1A 3ROEA 1OREA 4N6OA 4OFXA 1HDOA 3H2ZA 3UOWA 5JD4A 3EBOA 4P31A 5EIXA 1MW8X 2JRLA 4P93A 4BQNA 1OB5A 1N7JA 2OC4A 1OILA 3TFQA 2C31A 2F6RA 1V5IA 1OZAA 1E8NA 1VPWA 4FS8A 1J21A 1Q1AA 2BGUA 2OK7A 2WYUA 3M3HA 1U0LA 1JLKA 2DWCA 4FE3A 4RPHA 3VR0A 2A57A 1OPXA 3M6UA 1KH3A 3HTXA 2LTAA 4JLKA 1CNEA 4B3CA 2ZIVB 4IW3B 1NMZA 3V76A 1P4GA 4IDFA 3NRCA 2YZNA 3P97A 3D3WA 4BNLA 6Q21A 8ATCA 3H4VA 2YOGA 3LVRE 1P2SA 4OM8A 1YZLA 1KK3A 1KJYA 1PNTA 3AILA 3FLEA 3IIEA 4N65A 3PCRB 3TQQA 2WWWA 4LF5B 4LGMA 2JZCA 1W5BA 3ZY4A 4V0KA 1ETHA 2GETA 5KDLA 2PKXA 1XZCA 5C4IA 4EX7A 1ODTC 1U9YA 3HU3A 3ORYA 4REMA 4HGYA 2A1UA 1N9GB 2QRQA 2WNIA 4IY1A 5TPZD 4A0HA 5H16A 2Z7JA 1I2MA 4MKFA 3SF0A 1JU3A 1EFLA 3ZGXA 2XCIA 1O5OA 3GYBA 3PEFA 5IKMA 3CW2A 5CVJA 5EJ9A 4O4JF 1F0PA 3AGPA 1G19A 1XZQA 3VZDA 3EEQA 1VG9B 2B1JA 2CNWD 1BIFA 1DZ3A 3CRW1 1P33A 2NZVG 3TKAA 3I4VA 1SC1A 4EA9A 2VTBB 4FCWA 4KDRA 3HVUA 3VYUB 2GM4A 4KXMA 4HBZA 5JVDF 4JI7B 5BV7A 4BMDA 1P73A 5FFFA 2HHLA 5CRIA 4HLUC 1NI3A 3IELA 4BKPA 2WR8A 3LT5A 1W5SA 1XXLA 1UPTA 3X1KA 1XDZA 1L4MA 4KT0F 2UU9M 2ISSD 3I3SR 3PDCA 4XTRA 4HGNA 2POQX 3A32A 2DM6A 4AJIA 4B48A 5JH7F 2A9OA 3EXIB 3A11A 3ND5A 3NXKA 4ZFNA 1AQ6A 4KDCA 3I4YA 4WBSA 5BORA 3SVLA 2LRHA 4TV9F 3PSHA 4PZZA 4ZAYA 2A9KA 4D6YA 2QE6A 3DHEA 5F51A 1DT3A 2ZR0A 2JD1A 1M1ZA 2ID9A 2ZTMA 5KAMA 4DUZB 1ZUWA 1XDUA 2P9JA 1E79D 2AJLI 3B82A 4U7JA 4EB8A 4RTLA 3HBMA 4ID3A 4P3NA 3KKMA 4F5EA 5J2TA 1DO8A 1C1YA 3NCHA 3LUKA 5I5EA 3COYA 1E2QA 4IBDA 3DP9A 3VZQA 3AH8A 4JJIA 4WBNF 2IV7A 1YRQA 3CXRA 2GX6A 1NONA 5HMMA 3N2GB 1LPBB 2IEIA 2QW1A 4V24A 5I8ZA 4M8NE 5CIYA 3O26A 4GX2A 2BEJA 1KZ6A 2HU2A 2JA2A 1SEPA 4AJPA 4LI0A 5HILA 4ZZIA 4JS0A 1K5DA 4MMXB 2PLAA 1QIEA 2IOFK 3L43A 3WGYA 2WHYA 3HEBA 1YDWA 2C2YA 3ICWA 5DOZA 5BP7A 1PGNA 1HE2A 1J42A 2BUCA 2JGNA 1UEXC 5F12A 4BB0A 3AUKA 1KK2A 3IBYA 3OZGA 2B92A 2QGZA 3NKFA 3ZXUB 2XODA 2SECE 3Q88A 4LV5B 1PV2A 1XQ9A 2PFKA 1LBIA 5JAQA 3STXA 3ZPXA 5JRDS 2BGKA 2ODEA 2EIXA 2BV3A 4P4NA 5GP1A 5ALKA 1FL9A 2AWOA 2I2XB 3RU3A 4F2WA 1HEIA 2LHGA 1K9VF 1NP3A 1X87A 3OUZA 1X3LA 2BBTA 3IT2A 5IMSA 2LDXA 1QIIA 1R8QA 2VP6A 4GD3Q 4GGMX 3K0EA 3CRRA 3VM6A 3U26A 1ZOLA 4D9KA 5TT0A 2H1IA 3FOAA 4CMCA 3VR5A 1CB0A 5FJIA 4ZKDA 4KFTA 3M6VA 4QXMA 2G8LA 1PG5A 1W1IA 4CGYA 2EYQA 721PA 3STWA 4YAGA 2BCGY 4NCJA 4DM7A 2IKQA 2H1RA 2FG5A 1O97D 3AR9A 1TECE 1V5EA 2AC4A 1ZKMA 2DLNA 1IUKA 1ZIXA 2V4ZA 4HTFA 3T5GA 3ZHBA 2HT6A 2QTHA 3ICPA 3WLPA 3HUTA 1YZGA 3CEHA 1E1KA 1E6EA 4PCLA 1XEWY 2DC1A 4TS9A 1EJ0A 4EGFA 3FUUA 1C9NA 2R97A 2ZTCA 1U3VA 2ZBPA 2G0NA 4U7TB 2ZI7A 1H65A 2C5FA 3FTEA 3DTVB 4QFMA 1SJ9A 2ZB8A 1HNZM 1K8ZB 3PUJA 3LKZA 4H31A 4IF6A 3ZBPA 1WXFA 5DP1A 3CV3A 3Q98A 3NTRA 1VMIA 4Y2UA 5H59A 3OHMA 1TI7A 3IV7A 3KVRA 3D7RA 1K7FB 4LGVA 4N3GA 4WGGA 3RIEA 3OCUA 1SCQA 3HLTA 3U7QB 1GAWA 1FVHA 1YJ5A 1OD6A 2CVFA 2FSFA 2P1RA 3B1YA 3DFKA 4LTNA 4QEZA 5TJ9A 2RDMA 4DV1M 1V35A 2OECA 3SC2B 3NHBA 3H4MA 2X49A 5H0IA 3OLCX 1XF1A 4XEHA 2NQTA 4YRSA 4FHCA 4CV1A 1H3NA 4F4IA 1DOZA 3ZWOA 3GRVA 4NULA 4C22A 3AEUB 3SEAA 1JIIA 4ABYA 2IHTA 4LF7B 1J39A 2HSGA 1U1DA 1N8KA 5AIAA 2MIIA 1H1TA 4Q6WA 1NC3A 3HZJA 3EZ7A 4QFBA 1AHHA 3GDGA 3HCRA 2DTEA 5JAZA 1DAHA 4HNQA 1LZLA 4QOHA 5FI0B 1T29A 4XIIA 4CM4A 3T7RA 3AVXA 3E0XA 4G41A 4RD1A 5CNKA 1Z75A 2CLLB 3R0VA 2FW8A 1PZMA 4ZEOA 4ARUA 1OLSB 2BGJA 3QBDA 4R8SA 3MCUA 3A2KA 1CQJB 1T5TA 1VE6A 1ZCZA 2XIQA 3H84A 4O2LA 3PEUA 2J9YB 3COJA 3UC9A 4LW8A 4C0KA 2QX6A 4MV1A 5KJ1A 1N9GA 2HV8A 2WA2A 2ZRCA 1N5IA 3NI2A 2XXBA 3LWDA 1M1NA 3ADPA 2XBMA 1EAYA 3EUWA 4CIWA 4P5DA 3WK5A 2VNJA 3HKBA 3BE6A 4B4KA 5KWSA 1G1MA 4LXHA 1BVYF 4XBOA 3GOHA 4OG2A 1WZUA 4GICA 2ATXA 2RB4A 2Y77A 1D2MA 4Q39A 2GGSA 2WHPA 2I8AA 2XH8A 1KZ4A 3BXXA 3G0IA 4AJEA 2D74A 1WCWA 4PAQA 4HLUA 3TLZA 4A82A 1ND5A 2PZKA 2VZ9A 3RT1A 3ACBA 3MSCA 5A5GA 2ZJ8A 2RMKA 3MBIA 5ITWA 3B5EA 5HWSA 4QAQA 4RQBA 5LL6P 5CLGA 2BWEA 2QU7A 2RGHA 4B4DA 4Q4HA 1X6VA 2FZ4A 2KW5A 4PN3A 1GGFA 1IBCA 1IZ7A 4EB6A 2PWAA 4KFSA 1M7BA 2JGFA 4S2EA 1U3CA 1KP3A 2E7ZA 4F2PA 2EQAA 3U6BA 1CYDA 1IEQA 2D1YA 1HDYA 4UHDA 3D4BA 1HNNA 1F5SA 1PAUA 3USCS 5AQ1A 5KOHB 4W5NA 3B52X 5KMGA 3K30A 1KZ9A 1W4ZA 1IVNA 5FO1A 1Z5WA 1OBVA 1RXSA 1GO2A 2XI4A 1S7GA 2JFPA 3PL1A 4B7CA 3T5CA 3D6HA 4HXFB 3HJRA 4I1VA 4X8OA 1F0NA 1XPUA 2G3QA 2E85A 2I4NA 3NJ4A 4E46A 3RS0A 1D04A 1SC6A 5DI9A 4RTOA 2ZUEA 4K6GA 4YECA 3S1AA 1B76A 1BWPA 1EKXA 3FXAA 3PVCA 2VHYA 5JWRA 1ZI6A 3ZLVA 1N77A 2PZJA 1PJTA 1ODCA 4ZVPA 3ZG6A 3W8DA 1XZEA 2VQFB 1GAEO 1EI9A 3ELUA 3BUSA 4Q3KA 1ZCBA 2R6DA 1XLTC 4EKDA 4TKUB 1KA9H 4CQJA 4PHTA 4NG4A 1B16A 5B1YA 8AT1A 2IE0A 5FAXA 2JDID 4N5LA 4Y28F 4BVHA 1JNYA 1MF7A 3M1LA 4MR8B 4JLSA 3SMVA 4BATA 4D9HA 4UU1A 3ANLA 1IJEA 4B79A 4DQ0A 1WQ3A 2ZXEA 1NU6A 3ME5A 2ZZMA 3VZPA 5BPVA 1Z5NA 8CATA 3V7FA 2MJ5B 1FQWA 2J3KA 1Q84A 1XDBA 3EE6A 3ETLA 2IYQA 1Z2DA 2VYVA 3M0EA 1GP2A 2PQ6A 1DO0A 2WWTA 4N01A 1KR2A 4WY5A 3PHBE 2TECE 3SR3A 2ATEA 2O48X 4OAQA 7YASA 1WE2A 2NUPB 4QXQA 4R8MA 2H2FA 2R84A 1MLDA 4G09A 4ZRDA 3LSYA 3SBEA 5EN4A 2C9MA 2QN7A 2XUIA 4KWIA 3A31A 3AR5A 4N6GA 4NJMB 3TNLA 7GPBA 2LZ0A 4Q7KA 1EDDA 3DE4X 4ZCSA 2JGIA 4EAAA 1FJGM 2AJ8A 2XOXA 2IEGA 1AQIA 3KKQA 1G8YA 3ONNA 4ZHSA 4LXQA 5DBFA 4IP0A 4C03A 3MWYW 5L40A 4IEFB 4DZZA 2GK4A 1AMUA 1K89A 1EFAA 3G89A 4B7FA 1Q0HA 1T9BA 3HYSA 1UC5B 1OXVA 4QDJA 1D7AA 3ZJ4A 4DLYA 3CUKA 2P9CA 2PZBA 3B5IA 3ZHRA 4BO7A 1XQXA 4ZAXA 1TO6A 5DNYB 5F1OA 3GRFA 2VDPB 4YAWA 4W5TA 2HJVA 2HK8A 5JS1A 4PLGA 1V2HE 3DBIA 3KYCB 4KDFA 2RGNC 4TS4A 4EZBA 4KPUA 1E1LA 1H8HA 4QU5A 3ZWXA 1BA2A 2AMJA 4PRZA 4DCMA 2Z5VA 3F8WA 5FWXB 2CBXA 2WKPA 4TZ6A 4AMGA 1OLXB 1ZPDA 2WP0A 3WWDA 1SC4A 2NM0A 3BEOA 4QWMA 3QPBA 3V8QA 2ZJ4A 2CXOA 2VP3A 2X4DA 3GJTA 5K8UA 4S04A 2G4LA 3NKLA 4RWZA 4JC5A 2ZT7A 2SICE 5FIUA 4KDEA 1SWVA 1VRCA 3I6ZA 5LUBA 5M29A 1L4HA 4WE3A 4BUCA 2QR2A 4H7EA 5B1DA 3D6AA 1QKJA 4R2KA 3KXEC 2OG2A 1QP7A 4KR2A 1X80A 1CZLA 2XB4A 2XTZA 3L77A 4IOJA 1TM4E 3GARA 3AHHA 5CBKA 1XLVA 1FSGA 2UVDA 3B1XA 4EGSA 1NVBA 2OKCA 4JB0A 2JK0A 2G76A 1DP4A 5AXBA 2JI9A 4PXYA 5A9SB 4RQUA 3FKSA 5EVCA 4YJDA 3QBTA 3U5ZB 1NQOA 1W73A 2FMFA 1BO6A 4K8RB 4N18A 4OFZA 1LW7A 2VL7A 1KSGA 1S6YA 4AC9A 3WAGA 2HWWA 3FMOB 1SOUA 2ZDHA 5IT4A 4KBFA 3JQ7B 3HKBB 3QJGA 5E1BA 4FGSA 3LCUA 4IX1A 1A8IA 5BUSA 2J9ZB 2AVDA 1XZHA 4X62B 3PFNA 3R4VA 2XUOA 4GHWA 4XLLA 5SZJA 3X2EA 1Z7BA 3SXJA 3QKRA 3SOZA 4R1UA 1WW8A 2VRCA 4IKPA 1FDSA 2IK8A 1E2FA 2HF2A 4G4GA 4GZMA 3W6NA 1GWNA 1WEHA 2O06A 5CP8A 4JLWA 1Y1TA 4I99A 4MVJD 3JWPA 2D8AA 4MW2A 3LAWA 4TL8A 4FXOA 1VLQA 1V11B 3ZE9A 5U4XA 2R44A 4BX0A 1E3EA 4RPIA 3UXEA 4TGLA 5JD6A 4IIDA 1JFLA 1ULTA 2VS1A 3ABZA 3IMGA 3DTYA 3IB3A 2B7LA 5KOHA 5GGYA 4YCBA 2GCPA 3HJHA 4F4FA 4EJFA 3C6MA 4KHPM 3IMKA 1WUIS 3WICA 3T1HB 2GKOA 4YT2A 4ZAFA 5H70A 3LQYA 2YIMA 4OATA 3OCXA 1C8VB 4HRYA 3VO1A 2HNKA 4C5BA 1YSCA 5CHYA 3WP1B 2E5LB 3TB6A 3AR6A 1DWOA 4JLNA 3GGJA 3NHYA 3FH0A 3R7AA 1G6OA 1QV6A 4NOKA 1Z4OA 1N5LA 4C0QC 3Q3CA 1YR9A 3A2LA 5HKBA 3PA8A 1KE1A 3SFVA 1UAYA 4V3BA 5LR6A 1UWCA 2ZYUX 4AZ0A 3JAMA 2Z9DA 2FPPA 3DWIA 2BMEA 4RTJA 3NTLA 3QOYA 1JDBC 4GEKA 3UOAB 3EVNA 2PL9A 3PQ3A 1NIJA 4H7FA 5DPMA 4BUZA 1U2EA 4FDAA 1Z0ZA 3GVCA 1X7XA 3STHA 3QSGA 2X2EA 2YN0A 4WPGA 5ERGB 3W9SA 4AUKA 3DE5X 4EA7A 4OYLA 2AYYA 2R6GA 3P2IA 4MV3A 1A7JA 4IMPA 4C2BA 1WCIA 1MTZA 4CIBA 1AQJA 4C0LA 1JH8A 1ZRMA 3M3DA 1SOMA 5BRJA 3DV2A 4JLVA 3AFGA 4GFDA 1EU1A 3R0IA 5CBPB 5LWQA 3ZD9A 1T9GS 2CXQA 5ITUA 1Q3CA 2JWSA 3E9RA 4W1QA 2QW8A 3QG1A 3KAQA 2JFXA 3D7LA 4PLHA 4F46A 1TTEA 1TCCA 1TF0B 4RV9A 1CUKA 4Q3BA 5K8LA 3PGKA 1ZNQO 1ZOPA 4IQFA 1DOAA 4B43A 1YLAA 4N7JA 3VR5H 3WKDA 4CISA 2GVNA 1F9AA 1MV8A 4G1MB 2GJ4A 3I9LA 2Q3BA 4A0GA 1J5XA 1GZ6A 2XMPA 2CJXA 4UVHA 2DPLA 3LFHA 2Z2ZA 5HJ2A 3L9XA 4HNTA 4KE6A 2AHRA 3CVVA 1V4NA 3BS4A 1CZRA 4UCFA 2W6OA 1XRNA 2JIQA 4G37A 1ZK1A 3X1JA 5F5LA 4BFCA 1HK7A 3GGGA 2RD2A 4NOLA 3TS1A 2FRDA 3IRUA 1QYIA 2OO7A 3SEFA 4FI3F 4W7SA 5JC1A 4S3MA 1RU3A 1R0KA 4M0WA 1P5RA 4HL6A 4QBFA 5GOTA 3DFZA 3EXG2 2AWNA 1RR6A 4GRAA 5DRYA 4X85A 1XL0A 5LZ7A 1VE3A 1G2IA 2H2DA 4M0CA 2BMDA 3NFYA 5EWLB 3UW1A 4TYQA 3ET5A 2HPHA 3BK2A 2J31A 2R87A 3B1ZA 4HB2A 4EECA 3NWBA 5GQSA 5ERYA 4UZSA 1X2BA 2VPXA 5G40A 1S89A 5AHKA 2TSYB 2V1XA 2GAFA 3CSUA 5D1NA 1RRGA 2QL7A 3FSJX 5SZIA 1PNQA 5TV2A 1QUTA 5WRFA 2Z6QA 4R2WA 4RHFA 3P2EA 4A2PA 2YY6A 4C76A 3KQWA 3K2QA 3PGMA 3IMEA 3N8IA 4BC0A 3GW8A 2CNLA 2Q0QA 2XEDA 3BCSA 3T1HM 1ZNXA 4YS6A 1O94D 4Y6QA 4ZAWA 3FZGA 5HJ5A 3B6ZA 3GLFA 1QC5B 3FMIA 3QUQA 1JLHA 4RZXA 4BQQA 1PT7A 5B30A 5TF0A 1GZVA 2JLQA 4EJ6A 2HEGA 1JTFA 2QMQA 4LG2A 1LFAA 1ZSYA 1TT5B 3E6AA 2R6JA 1X80B 5PGMA 5AM3A 5BYKA 1CUHA 2QRNA 4KIGA 1TMYA 2HBYA 2ZRAA 2XAUA 3KYDA 2YY7A 3IKMB 1MOZA 3ENNA 3WYFA 1HR0M 4DCPA 1MJHA 5HF6A 1XAHA 3T52A 3EVBA 4M7PA 3AOEA 1GNLA 3BG5A 2OPHA 1M9NA 3E22B 2YVKA 2V9CA 4WXRA 3WDLA 4R01A 2J6BA 5EFZA 1CB7A 1EUDB 3PC8C 3PQDA 4F6LA 1E1RD 4ZI5A 1WTAA 3GZNB 1IZYA 2YNMC 3ONVA 3RGGA 4ZJZA 2QDXA 4XD7A 3QX9A 2B0JA 3H8SA 5L4NA 1H5UA 1PKEA 1GTZA 2R3SA 4OGWA 1UFKA 4P7FA 3BIJA 4L1KA 1OU0A 3G2HA 4Z9BA 4B82A 3QEJA 3UAXA 2IF0A 1LLQA 1I3LA 5DWDA 2UAGA 2W8BA 3GJXC 3OE5A 4RJ2A 1EFRD 2HO4A 3LM8A 1HM5A 5DEIA 1C8LA 3JD3A 5CR9A 5EKDA 4DKXA 3BKWA 3SJBA 2PKQO 4BLTA 4I5DA 3MQ4A 5JZOA 4RLSA 4A8JC 4HDKB 1IONA 1SXHA 4TL9A 1Z35A 4HN2A 2ZIAA 1U7OA 4UUQA 4WLOA 2AG8A 3DHNA 1V11A 2BKAA 4JKIA 4F91B 2G1PA 1H3FA 2Z3XA 4MP3A 4NBWA 3R75A 2NUBA 2YHUA 1A5SB 4RJLA 1E8MA 1V5FA 3KOZE 3RODA 5JADA 5JMTA 3FPBA 4DF3A 1T2CA 4KVZA 2LP4Y 2I3DA 3MTEA 2P77A 3W4IA 5KNBD 4D8YA 2J09A 5EC8A 3FFBA 1F1JA 1ZGJA 4CMGA 5F1YA 3NWJA 4H77A 3FYCA 2PGXA 1JHVA 3DB2A 4I1SA 4BPBA 5FNVF 4AW4A 3NPAA 5I6DA 1I9GA 1Z9BA 1PM5A 3ZVMA 1LPMA 1RRFA 3L4BC 1XWWA 3LIIA 4UEQA 3SEZA 1E5VA 3BD9A 5BSFA 1OHHD 4ON9A 3UV7A 1OKKD 4MV4A 1N3YA 4OP1A 2PKEA 2YWGA 4WHMA 5AMXA 4LXUA 2P9QA 5TQVA 1DEXA 2LTUA 2FQ1A 5FCDA 5IYZB 1WW3A 1DLJA 2XCQA 3NVAA 2V0NA 1Z5PA 1YUNA 3GZ4A 2RSLA 3F5SA 3E5HA 1I4LD 1TM2A 2B1QA 4OL9A 4BGUA 1K0FA 2XVMA 2IHKA 5FD8A 5DTMA 1D4OA 3B51X 1O8CA 4TYPA 4GKAA 3OJOA 1FZTA 3CE9A 3E58A 1I13A 3I9FA 1FJHA 2VUUA 3ID6C 3Q0EA 4FGLA 4M1TA 2H65A 2N1MA 4R2MA 5CG2A 4JP5A 1K5GA 2ZJ1A 4E12A 1JQDA 1AUOA 2DOKA 2X5XA 4QC2A 3TZQA 1AG9A 2IPAB 2A4MA 4X9XA 3VR5D 2MROB 2G9NA 4YH1A 4G86A 2FEXA 2Z98A 4UDYX 3PE6A 3C3AA 1WBDA 2NU6B 1BD4A 4IBGA 4RW0A 3GQ3A 1SVUA 3HVIA 4X65M 4X20B 1PR9A 5SY9A 4L6AA 3VDRA 1ZN9A 1R6TA 2ILTA 3LP8A 3A25A 1CR6A 4L73A 5FBWB 2N9UA 4D7AA 5LQRA 2WM9B 2RH9B 3EGWA 4DR2M 4KIUA 3ZDRA 5CVTA 3Q7RA 4TZKA 5IWCA 2M6LA 2NSYA 4WCDA 1GKKA 1QQ6A 5GVSA 3OZDA 1YJ8A 3CO0S 4PSDA 4WJZA 1JEEA 3T5MA 3QLVC 4HBGA 3E5NA 1IHXA 2BM0A 4IYJA 3TEFA 3K70B 3QLUC 3NBIA 2RHDA 4ARVA 4KXFB 4H0NA 3COZA 3ZHSA 2UUOA 4NZZA 3AFNA 3A36A 2QMHA 3QV1A 4BP8A 1Q0RA 1MDFA 2ADMA 3V3KA 1YGPA 1XJQA 3OZ7A 1MJFA 2HIMA 1E59A 1Q7CA 3T1QA 1SUIA 5LN1A 2XECA 3WLNA 5FDFA 4DFDA 2FE1A 4NAUA 1CJUC 2JI7A 2YVUA 3V8VA 3KWMA 2Q4TA 2I54A 4A03A 4UHKA 1L9XA 1AK1A 2ORVA 1CEYA 1O9HA 4HFNA 2PZLA 5K0ZA 4MHTA 1AGNA 3RFUA 3W1WA 1MN6A 1K7SN 2ZWMA 1G8GA 1N2SA 1PW5A 2TMYA 3A3NA 5IBPA 3Q8GA 1EZ1A 1EIWA 3U6LA 3TTUA 1G9SA 1F12A 2XYHA 4WDRA 2BGTA 4GRIA 4TS3A 2XWPA 3DXFA 5CK4A 4KR0A 3FHOA 3SN6A 2G1KA 3MPUA 4ND8A 3RWOA 1KEZA 2NT4A 1FUYB 4W4TA 3IHWA 4UU7A 4ARZB 1NHGC 4HWPA 2CLDX 3UAWA 4KU4A 1SVKA 3NDJA 1IOVA 2G17A 2W2KB 4IBKA 1RYMA 3EVGA 2Q2WA 3KJZA 4MRNA 5DASA 2YBEA 3ED1A 5KHAA 3T95A 4KXQA 2ESRA 3OHPA 2QAGA 4JVOA 1R4MB 2BONA 1IIBA 3QWBA 3S2UA 3GUYA 1KQFA 1W19A 3WGGA 1SQGA 5ALRA 4A8JB 1K9SA 1TT5A 2YJ5A 1ZIDA 2HHJA 1MP0A 1ZCJA 2DPHA 4RA6B 4Z99A 3NVDA 1AUQA 2KBFA 4ARIA 4YO8A 3LHFA 3LIPA 4KUEA 3SIWA 1P1IA 2XOKA 3D8UA 4IF4A 4IUBS 1G63A 1J97A 2XUKA 2OO9A 2IP2A 2IYXA 3NONA 4PYRA 4XH9B 1N4AA 4UD2A 4YRRA 1MH9A 3GFTA 4CMBA 1RAEA 2E6UX 1MEOA 5CFOA 2QW0X 4EKYA 2Q62A 1KI2A 3JAKB 2MOKA 3LCMA 4OH7A 1Q7GA 2AG1A 2H9YA 2LHCA 1QG6A 2C84A 3MWEB 5ED4A 5F3WB 1Z4NA 2XMQA 4PTZA 5JSQA 4Z0NA 5TEWA 3WLFA 5T6BA 2R18A 5CDUA 1T1SA 3UWMA 4OAOA 4J0EA 1OIWA 1QFJA 3ZQ4A 1TZJA 3BFXA 3Q8MA 3FJOA 4GNKA 4JSYA 4MUIA 4ZO8A 2F3TA 1P4JA 4NH4A 1YFJA 2OUIA 2NU8B 1JDBB 3WJ7A 3RAGA 1XF9A 2OP0A 1XJWA 3FCUB 4UZEA 1L5MA 3WK6A 5K6TA 1RYZA 2W2VA 3QVOA 4BZZA 1NW6A 4DBLE 1AZLA 3TWMA 3PPIA 2R1UA 4TUYA 3GR6A 2V1CA 1IY1A 5BW6B 4LV6A 4N82A 3S1SA 1E2BA 2D2VA 2F3UA 4F4JA 1GHTA 2P3OA 2L19A 3EVEA 1U0OC 4NRWA 3IH5A 3D6MA 5ALXA 3BRWD 1XX6A 3EZLA 3BGOS 4RHUA 3ZE6A 3EISA 1A3CA 2C2OA 4P92A 5EIFA 3AHEA 3O8DA 3Q85A 5CEEA 4R41A 3L3BA 2C4MA 2JAXA 3RJTA 3TNJA 1HZZC 2FHPA 2ZZNA 4GWKA 4TN1A 3CRZA 2AZ4A 1FS4A 4EJ2A 5IEBA 4GKBA 1UPBA 2H31A 4W1RA 5ISMA 5D3MB 5M04A 4MW6A 4L22A 3NC4A 1DJNA 1LPPA 1C1DA 4RD3A 3SR0A 3RVDA 4YCMA 2JJMA 4PNHA 3MIIA 4DG8A 5JOQA 1NPDA 4EI9A 3BRWA 2VEDA 4TTIA 1TCBA 2UZ4A 4EQZA 3JQRA 2B2XA 4EFNA 1HJPA 4J2HA 4O0LA 5HUQA 2FDCA 4IIWA 1HDRA 2CD7A 5KKCA 2OFXA 1SVLA 2G25A 3HCNA 3P27A 3R40A 2EDAA 4NZ9A 5L7TA 3FPGA 3HBJA 4DA4A 2SNIE 3HDYA 1YFZA 4RDIA 1M8GA 1QV7A 5CH5A 3DQZA 1C1XA 3DBOB 3QKSA 2OYRA 1IHUA 1RJDA 3FZQA 1I4EB 1YR2A 1PK9A 1YZQA 3INGA 1SIWA 2I4LA 4KAXA 2HLNA 3E9SA 4H6VA 1V34A 1PT8A 4WURA 1C9KA 1K4YA 1N6KA 1Q1NA 2GJ9A 2XLCA 4I8XA 2HCBA 4L02A 5BV2P 4U2EA 1E20A 2PGDA 2B21A 3EEFA 1UM9A 2HJRA 4YJ3B 3GPDG 3OZFA 4RMIA 3VTFA 5TRTA 4IIXA 1K2WA 3NYRA 4NCKA 1N9ZA 2W98A 4HNRA 1P4HA 4OHKA 4TM8A 4Q37A 5JNRA 2R62A 2JLXA 4LHSA 5C9ZA 1RAGA 1U8UA 2V6ZM 1UCFA 3TIVA 4BGIA 2XTJA 4D3XA 5HM8A 2BFFB 4QLBA 3D1VA 3PG5A 2C3OA 4RVDA 1E4EA 1XK7A 2DH6A 2FPGA 4Y2XA 2COUA 3H19A 2QU8A 3FTPA 1MAUA 4HAXA 4L75A 4AU1A 3ZU2A 1VMAA 4I66A 1LNSA 3KEOA 1WXDA 3CLSC 3L1KA 3ZCPA 1ZGBA 4JQYA 2LXEA 2QVLA 4L9RA 5FOXA 5BN5B 3LDFA 5CM8B 3UJAA 3W6ZA 4IV0A 2VT6A 4DV5B 4G0NA 2FU5C 1VZ2A 1ENZA 1WD7A 2K5UA 3NTUA 2UZ1A 4DOMA 1TGVA 3BQ9A 2IX3A 2MINB 3QMVA 2O8CB 2WW8A 2CE2X 1EXNA 3RJZA 5IMBA 1J8MF 2PY6A 1JLMA 1SAYA 4HAYA 2FN4A 1GRNA 2H5LA 3BVPA 3ITNA 4PZ9A 3PDJA 3EPJA 2ZBUA 3ZCSA 2CW5A 2WG1A 3FDXA 5T6MA 2Q9CA 1G2QA 2V7WA 2I7TA 1SELA 3DEJA 1M7HA 1NUTA 1U65A 1QVAA 1YJCA 2RAUA 3T1NA 4WKNA 3RVPA 2R0IA 2WMNB 2VNAA 3CB2A 3ESBA 2E37A 1EFCA 2A9JA 2QLFA 4G1CA 2H2AA 3RFCA 3OU6A 1DBWA 5I7FA 5JPCA 4JP8A 1F20A 3LXRA 4RJKA 2BT4A 4J75A 1R4MA 3KX2A 1FFBA 4QHYA 3AUFA 2FRVA 4JI8B 3VGJA 5BV0A 4EATA 3CLUC 4FQ5A 2NTNA 3UY4A 1L4EA 4K9LA 3RIHA 1VE5A 4CKZA 2IF2A 2C2HA 3KXLA 4DDVA 1SQSA 2ISQA 5G0TA 1IWOA 1GZ5A 1L7BA 1LQ2A 1Z5OA 5EJ6A 1YAHA 4G9BA 2XZTA 3GN2A 2QD3A 3GP3A 4XZ3A 4YN3A 1V0JA 2B35A 4ZXFA 5CCXA 4FOOA 2ZJ2A 4FDTA 1E7SA 4ZOQI 1C0EA 5ILQA 1JECA 1SCAA 4OOFA 4DIUA 2FVYA 4JK3A 3VO8A 3WK9A 3L1UA 1GARA 5CA0F 1Z8DA 2CWDA 4Y9TA 5TLSA 3VDMA 2XWQA 1VIMA 4E03A 1OH7A 1TIBA 4R9VA 4NJEA 4G67A 4H1HA 3J81S 5CLJA 4RVCA 3UXYA 4WERA 4LDNA 2NUTA 4PX9A 1TCAA 1EA7A 1WQ4A 1CQZA 1P0IA 1PGQA 2X5NA 2C54A 2AK3A 3MUFA 2HA4A 3N0WA 1ZR4A 2V3CC 3BK7A 2WF7A 3A28A 2C00A 3A10A 3O4FA 3VPSA 1DDIA 3HJQA 1DPGA 3IULA 2YJGA 3F6SA 1A27A 4Q02A 4K05A 3KS4A 1KK1A 2NU8A 3UJCA 2FVXA 1E0SA 2ZRBA 2JD2A 2LVQD 3R3XA 1U5BB 1DQYA 1EZ4A 5ENZA 2H0AA 4RBNA 4XX0B 3HP1A 3AP1A 3CSDA 1RCTE 2VT3A 2GN4A 2HC9A 3CWCA 4MW7A 2ERYA 2JCGA 4QTYA 1FVOA 2NOAA 2YC2C 2DKNA 1L5HA 3KU1A 4CFYA 1VG1A 4I0WB 1OH5A 3L6OO 4HMPA 4JXZA 5CVCA 2O0HA 3H6GA 4EUNA 1JLLB 1TTTA 3CVXA 1PJLA 2XB9A 6PFKA 3TSWA 1IQPA 2PSHA 2W43A 3EWNA 2Y1CA 2H3EA 1B3RA 2XMBA 3WDKA 1OTXA 1RI2A 3HY6A 4Q21A 2XLJA 2R4QA 1JBQA 4RXUA 2HSJA 3IAUA 2Y67A 1PLJA 2RBGA 2RHGB 1PR0A 4RH0A 2VQEB 3O2NA 2WDPA 4G0PA 2Y1XA 5EG5A 1Z33A 3NVMB 3H65A 3O8LA 1N4DA 1DC7A 2E5WA 3FKQA 5AXAA 4B7AA 1ZK4A 3BMXA 3VVMA 3G7UA 4B3FX 3QI7A 1B14A 5AW5A 2FDXA 2QUKA 4R0NA 3IKVA 1RJ9B 2FRDC 3LVWA 1R3UA 5H4HA 1P31A 1CUUA 1QB7A 2AV6A 4H16A 4Q93A 4RSHA 4RSMA 5KU7A 4IJVA 5HXAA 3A6HA 3C24A 2H7YA 1AJEA 4N7MA 1VECA 5I4IA 1G3IA 3Q72A 4W1PA 3QKSB 2HAKA 4W5HA 1TJ5A 4U00A 2RC6A 4N48A 3N39C 2H9AA 5EL0A 2UYYA 2OHJA 2O59A 4M37A 1OIZA 3PFBA 2B0CA 4XCQA 1AU9A 2XGGA 3K15A 4CQMA 3ZHYA 2YFYA 3QE2A 2YYSA 2BDUA 3VKGA 2V96A 1FSFA 1UM9B 1J09A 4RK4A 5ESDA 4EPWA 2D7JA 2EP8A 4GH5A 4JJ6A 1DEKA 1Z0UA 2V58A 4QTUB 3ZV3A 1UQTA 1FRFS 5BT9A 3WYEA 1QU3A 3T7JA 4M22A 1C7EA 4UHCA 2WQZA 4D98A 1PK7A 4POAA 5U1PA 1ND6A 4PTLA 3WAKA 2BFFA 4XYLA 5BWBA 4MVJP 2A1UB 2EHJA 1WR8A 2FPGB 3JZIA 2XYGA 4HRXA 1RHUA 3PNSA 4I55F 2PL1A 3U39A 1T3GA 5F2KA 4ZQGA 3V5NA 1L7QA 2CNKA 3KWFA 2F1OA 4AKIA 3U4HA 3WIUA 3WWPA 4J0FA 2W2XA 1G8AA 2EJTA 2C7VA 4GM0A 4ETIA 3KFVA 2Q1SA 3B8HA 3E9YA 3SLGA 4Q4CA 5KYWA 2OGSA 1DPFA 2GFIA 3ZV7A 2DLCX 4HMOA 4G5QA 2WZJA 4XVHA 3RRXA 2ZR7A 4XWWA 2AEFA 2O8CA 2R48A 3MGGA 4OH1A 2QG9A 1MRNA 2PX4A 3ND6A 4MIOA 3TW0A 2QJOA 4UQLA 1JLRA 1H0RA 1XNGA 2Z5FA 2I7DA 4UTZA 4GWGA 3RIMA 4BFSA 5AUPB 4B3MB 4DSUA 3WWEA 4DLBA 4B6EA 2EWMA 2GXAA 4PNEA 2PGOA 1C9JA 3O4VA 2HK6A 1GRCA 3C3EA 3VDXA 2IS2A 1RLMA 2ID4A 2XY4A 1AKRA 2W6CX 3UJDA 2D5LA 1JJ7A 1Z22A 2QQ5A 1JT2A 3OHSX 2JAUA 3UMBA 5I47A 2JBWA 3T1OA 2R66A 3JD0A 5KTMA 2A58A 3AM5A 1R8SA 1DRKA 2BFOA 4BGVA 3EQ7A 4DG9A 3ZNNA 3ZCBB 1SULA 3HN7A 3H5VA 1H6CA 2V9ZA 5BSMA 5KJEA 3BGDA 1T5BA 2Q8QA 5AM0A 4C6TB 4UULA 1EPUA 5LQUA 1PJ8A