3GRRA

Crystal structure of the complex between s-adenosyl homocysteine and methanocaldococcus jannaschi dim1.
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
263
structure length
263
Chain Sequence
QCFLIDKNFVNKAVESANLTKDDVVLEIGLGKGILTEELAKNAKKVYVIEIDKSLEPYANKLKELYNNIEIIWGDALKVDLNKLDFNKVVANLPYQISSPITFKLIKRGFDLAVLMYQYEFAKRMVAAAGTKDYGRLSVAVQSRADVEIVAKVPPSAFYPKPKVYSAIVKIKPNKGKYHIENENFFDDFLRAIFQHRNKSVRKALIDSSKELNYNKDEMKKILEDFLNTNSEIKNLINEKVFKLSVKDIVNLSNEFYRFLQNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dimethyladenosine transferase
publication title Binding of adenosine-based ligands to the MjDim1 rRNA methyltransferase: implications for reaction mechanism and drug design.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 93
structure length 263
sequence length 263
ec nomenclature ec 2.1.1.-:
pdb deposition date 2009-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3grrA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3grrA01
4YUVA 5DLYA 3EEYA 5BW5A 5F2NA 3D2LA 3DR5A 3JWHA 4P7KA 4AUKA 5EMKA 4YMHA 2Z6AA 2BR5A 5BP7A 1TPYA 1RJGA 1I9GA 2VS1A 3U81A 3C6KA 1U2ZA 2QRVB 3GGDA 4KDRA 1X19A 3UA3A 2OKCA 3M6WA 5FA5A 3G2QA 1YZHA 2ONYA 2ZIFA 3KR0A 4PINA 3V8VA 2O06A 5LQRA 4CTKA 3PS9A 1G6Q1 1KYZA 4MWZA 3T7SA 1RI1A 2AOXA 1XTPA 5F2KA 3MCZA 4RX1A 5EGSA 5FADA 5CVEA 2PWYA 5EKXA 4DCGA 2V74B 2ZZMA 4GUAA 3SVZA 5BXYA 1ZHFA 5GWXA 1V39A 3ELWA 3E23A 1EAMA 3EVAA 3BKWA 4FS8A 3FTFA 2AOVA 3T7TA 3I58A 1JG1A 3I64A 4FSDA 4RSRA 5E1BA 1QANA 2EG5A 3P9NA 5D1HA 5K0NA 4ER6A 5KYGA 1X1DA 3GDHA 3QV2A 4L7VA 3ELYA 2AN5A 2ZIGA 4RVGA 1M6EX 2YTZA 3I5UA 2EJTA 5LSAA 3CKKA 2H1RA 3OZSA 5CUQA 3KPVA 2AN4A 3VC1A 1ZQ9A 2JH9A 4YV1A 3P9CA 5MHTA 4PIPA 1N7IA 2IIPA 4QPNA 1INLA 1DL5A 3RODA 5FA8A 4CKCA 3KQPA 2PXAA 5M5BA 3BGDA 3TMAA 2YQZA 5E1OA 4OQEA 3UBTA 3E05A 4X63A 5LQKA 3BT7A 3OPNA 5LQJA 1NKVA 1NW8A 5EHIA 2IDKA 5DX8A 2GAFA 3CVOA 1RI2A 3HA5A 4NECA 5HFJA 4EMSA 5FQNA 3BUSA 4ER7A 2C7PA 4ATNA 3HNRA 3FPHA 4HRAA 1G60A 2AZTA 2ZFUA 5JR3A 4PCLA 1EQAA 5DRTA 2OXTA 3UJBA 4WVLA 5BW4A 2UYHA 1QYRA 2FYTA 1YUBA 3T0IA 5DSTA 3SR4A 1YFJA 3OU7A 3OE5A 2QE6A 4GOLD 5FHRA 2IBSA 5JUWA 5DM0A 1VP3A 2PXXA 2ESRA 2OBFA 3BGIA 2P41A 3KQOA 1IM8A 3PFGA 3GWZA 2CWWA 3EVDA 4FSXA 4IV8A 5DX1A 2NXJA 2O05A 2P40A 4GOOD 2XBMA 2IPXA 3KPWA 2AN3A 2PX4A 3UJAA 3NJRA 2NXCA 1VQ1A 4V0QA 2XYRA 4E2ZA 3EPPA 3P97A 4OBXA 2G8NA 2I9KA 4EKIA 2PJDA 3A26A 2BH2A 5KS2A 1G8AA 4RTSA 1UWVA 3GJYA 4OA5A 1BHJA 3PX2A 2N47A 1M0EA 3FTEA 4MTLA 3THRA 3C3PA 5HIIA 5C1IA 1DCTA 5GP1A 3G2PA 3ID6C 1R6AA 3T7RA 4DQ0A 1VP9A 1BKYA 5EIFA 3LBFA 3OCJA 5EKUA 3UZUA 2O07A 1WXXA 4AX8A 1XCJA 2OO3A 3P2KA 3HVIA 3GRVA 4ZTBA 3NVKI 1FPQA 1M6YA 2DULA 4A6DA 2GH1A 3R6TA 4HTFA 2GLUA 3GRRA 3LPMA 1AV6A 4RVFA 2B25A 2XVAA 5DT2A 3WSTA 4FGZA 5LQNA 1YFLA 3GU3A 2JHPA 3FYCA 2ERCA 2R3SA 3B3JA 3CC8A 4E2YA 5KQSA 5C0OE 3EVCA 3LKZA 5CVUA 4RTOA 4BP1A 5DXJA 1BC5A 1AF7A 5CM2Z 2BZGA 2DPMA 2IBTA 2ONZA 3I53A 3AWIA 3CJTA 2ZBRA 3HA7A 1P39A 3MQ2A 4K6MA 4AZSA 1RJEA 3DOUA 3SMQA 3FZGA 4QVKA 1R18A 5EEGA 5HZMA 1SQFA 3SSMA 1KHHA 2ZWVA 3NTVA 4R6XA 1JQDA 2HTEA 3KQYA 3SXJA 3FUUA 3R24A 3TQSA 1P91A 3R3HA 3SGLA 3HCEA 3SM3A 4CTJA 5DRYA 2PT6A 5EVJA 3PB3A 5FULA 3Q7EA 10MHA 1EG2A 1XDSA 2G70A 3B3FA 4YUXA 3K0BA 3TOSA 4YUWA 2WA1A 4PGHA 5EC8A 8MHTA 2QRVA 2K4MA 4DA4A 2G71A 3GCZA 1H1DA 4IWNA 1PRYA 3UJ8A 2HMYB 3PLAE 4GBED 1SVUA 3HCCA 1NW7A 3OU2A 2PXCA 2OY0A 5DTQA 2IP2A 2E5WA 3UWPA 3LKDA 1BOOA 2VP3A 5H02A 4A6EA 3EEOA 4X41A 5EQJB 5E2AA 5CD1A 4GC9A 2B78A 4PYQA 1JTFA 1NT2A 2G72A 3HM2A 2A14A 4O29A 4RVHA 2HNKA 2IGTA 3CJQA 3FPFA 4WXHA 2FHPA 3KR1A 1F3LA 2P1DA 3O4FA 1O9GA 3NVMB 2P3QA 5CVVA 1KIAA 1NW6A 3SSNA 3GXOA 3OE4A 4EK9A 5DSXA 2OPBA 5DX0A 3KQTA 5E8JA 1I1NA 2I7CA 2ZTHA 3DMFA 1SUSA 3C0KA 2UZ4A 3HCDA 3A25A 1SUIA 5E9QA 5IH3A 4V0RA 4H0NA 4ER3A 1D2CA 2PT9A 1HNNA 4IKPA 1AQJA 3FPJA 5E8RA 4QQKA 5ICFA 3M4XA 3REOA 3KQMA 1JG2A 2EFJA 1N7JA 3FPGA 5K0JA 5E9JA 2YX1A 4EVIA 2Y1WA 1ZG3A 5EMLA 4EQZA 5FWAA 4BLWA 4QTUB 1XDUA 2AOUB 1RI5A 1VIDA 4PYKA 4C08A 2P3OA 3NW9A 2ZIEA 3Q87B 4HSGA 2AOUA 4POOA 4FZVA 2IH4A 2ZWAA 5FTWA 3HCBA 3SSOA 2NYUA 2ZBQA 3O31A 1B42A 2XVMA 4OX9Y 4XCXA 4R8SA 4Y30A 3NWBA 3V97A 4LG1A 4KRGA 2PY6A 5DWQA 1G8SA 4U7TB 1IY9A 3F4KA 3M70A 4F84A 1KXZA 2NXEA 3B3GA 1JR4A 3BWYA 3M6XA 2AVDA 5CVDA 3SX0A 3PFHA 4C04A 3LSTA 3HVKA 3KPYA 1R74A 3FTCA 4FR0A 1NE2A 2P7IA 4FT4A 1Q0TA 2GS9A 2OB1A 3EVBA 3AXSA 4RTQA 4RTMA 4YV2A 2QM3A 4Z2YA 4YUZA 2IDJA 3C3YA 4CXMA 4DKJA 3JWJA 4E30A 3BWCA 3DH0A 3EMBA 1XVAA 2EX4A 2PKWA 5EEHA 3MTEA 4M37A 5GM1A 5FQOA 2V7EA 3EGVA 4PYIA 4QDJA 4YUYA 1ORHA 3TR6A 5EPEA 3RIEA 1JTEA 5K0CA 2ORED 4MQ4A 2ZVJA 1VLMA 3AJDA 3EVFA 2PVCA 2PBFA 2NP7A 1O9HA 4HH4A 5P8WA 3RW9A 4BLVA 2WK1A 5GOZA 4CKBA 4E2WA 1JQ3A 5K09A 5K0GA 3FRIA 1SKMA 2OZVA 3CCFA 3QOXA 2HR1A 5ICEA 4JXJA 3BWMA 3LDUA 3G2MA 3G8AA 4P7JA 4QVGA 1NV9A 4C4AA 3OZRA 2IH5A 5EZQA 9MHTA 3DTNA 3OFKA 3TKYA 5GIOE 3FTDA 3HEMA 3MERA 2KW5A 3DP7A 4QTTB 2JH8A 2JHCA 1RJFA 1RI3A 3KR9A 3GIWA 4MHTA 3AXTA 2NXNA 5IKMA 4YV0A 3FPEA 3UJ9A 1XCLA 3P2EA 2C7OA 4EKGA 2B3TA 1SG9A 2YR0A 2P7HA 4R05A 4XUDA 3NWEA 5E9WA 1NV8A 5F2OA 1VPTA 3FUXA 3FUVA 3FUTA 3LBYA 3KQQA 2AOWA 2QYOA 4RYLA 4FT2A 4PNEA 5ICGA 1VBFA 4HC4A 4BLUA 1F38A 2ZBPA 3GRUA 3FUWA 2YUIA 4P58A 5E1DA 5EIWA 3GRZA 4XUCA 4QDKA 4XUEA 5DTRA 2EJUA 1R8XA 3DLCA 5E2BA 1P1CA 3G5LA 3CGGA 3A27A 2YVLA 4E2XA 5EMMA 5EZSA 1O54A 3NDIA 3MHTA 3HTXA 3B5IA 3M6UA 2VDVE 3HVJA 5T64A 2GPYA 2QY6A 4KIGA 5FWDA 3DMGA 4E33A 4E32A 5CCBA 2H11A 3LCVB 1QAOA 1JQEA 3TM4A 3NDJA 5B1SA 3KPJA 1NBIA 1L1EA 3LHDA 4R6WA 2FK7A 2ZULA 5DM4A 4GC5A 2OYRA 3TKAA 4DM3A 7MHTA 1FJXA 2AOTB 2R6ZA 4HGYA 3LCCA 3MAGA 2BM9A 3BKXA 3EGEA 3G2OA 4C07A 4DMGA 1TW3A 3HVHA 3IHTA 4KIFA 3G89A 4HGZA 1L3CA 2B9EA 4CWAA 3JWGA 3KU1A 3MCTA 2XYQA 5U4XA 4RWZA 1XJ5A 4RV9A 5D1NA 3DXXA 5DPMA 3OZTA 3M33A 5LQAA 2ZZNA 1EIZA 5K0LA 3UJCA 4RTLA 3G88A 3UJ6A 5FUBA 3S68A 2YXEA 1MJFA 1N2XA 1KYWA 2AVNA 3P9KA 4X60A 2FPOA 3LGAA 4C05A 1SQGA 3G5TA 4R8RA 1UFKA 1L9KA 2CKDA 3B7PA 2AR0A 3E7PA 3G8BA 4M36A 4RVDA 3BZBA 3TFWA 2FRXA 4RTKA 3A7EA 3IV6A 1DUSA 4PYMA 5EHGA 1UIRA 1KP9A 3LDGA 2VZ9A 4OQDA 4B17A 4RTJA 2BR4A 3UA4A 3EGIA 1Q0SA 2OB2A 4HG2A 3BWBA 3B89A 5LR6A 5HOQA 1X1BA 1R8YA 3HP7A 3R9XB 3LDFA 3KQSA 5K0EA 2H00A 5DM2A 3ER9A 1VL5A 1EJ6A 2ZW9A 5GINE 5DM1A 4GOND 4DZRA 1IXKA 1AQIA 1FP1D 5EOVA 4FP9A 5C9ZA 2HWKA 5DTMA 3GO4A 1ORIA 1ZKDA 3M6VA 5GM2A 2Y1XA 4OBWA 2B2CA 1KR5A 3MGGA 1YB2A 3UJ7A 3CBGA 3BXOA 4PCAA 3DLIA 3EMDA 3QOWA 1QAMA 4GF5A 2PSSA 1WZNA 3EVGA 4PIMA 2PLWA 2P35A 4PYJA 1Y8CA 2PX8A 2Z6QA 3DULA 4LWPA 4CKEA 4KVZA 4AZVA 3ERCA 3EVEA 3ELDA 4X61A 3IEIA 1X1AA 4M7RA 3GNLA 5CVJA 1MHTA 2WA2A 5LQCA 1G55A 5E1MA 3O7WA 4BP3A 3JWIA 4RTRA 2PWPA 3DXYA 3FRHA 3UJDA 3NMUF 1OR8A 2ADMA 2CMGA 2O57A 3KPUA 3HA3A 4LECA 4LWOA 4QPPA 5HIJA 4C06A 3L8DA 3VYWA 4C03A 4YMGA 5KVAA 3E8SA 2YXDA 2BR3A 1HMYA 3PT9A 1KPIA 3TRKA 2F8LA 4P7FA 5KQRA 4GEKA 4PONA 1I4WA 1NW5A 2GB4A 2PGXA 3KQWA 1JSXA 3R0QA 5T6BA 1P1BA 5K01A 1X1CA 5LQUA 3CJRA 4U7PB 1G38A 1WY7A 3GRYA 2FK8A 1XXLA 3LECA 3TM5A 1WG8A 1R00A 4DCMA 3C6MA 3G7UA 4PGGA 3P8ZA 3K6RA 3A4TA 3P9IA 2Q41A 3TLJA 1TW2A 1JG3A 1D2GA 2LD4A 2VDWA 5CCXA 5EG5A 4ISCA 1QAQA 2JHAA 1ZGJA 4UOEA 5G02A 4PYNA 4BY9E 1XDZA 4ER5A 4IV0A 1WXWA 1Z3CA 3DMHA 5K05A 3TPZA 1WS6A 2BM8A 2VDUE 2P8JA 1EJ0A 3ME5A 3KQVA 5K8VA 2FCAA 3IYLW 5CIYA 4RTPA 2Z6UA 2XYVA 5K0FA 3ELUA 2C7RA 1RI4A 3ANXA 2ZCJA 3VSEA 5FHQA 1FBNA 4KDCA 4PYOA 3P71T 5K03A 4G56A 5HIMA 3DUWA 5T67A 1VE3A 2UYQA 1YZ3A 4PWYA 2GA9A 4P7GA 3HCFA 5HIKA 3KKZA 3MB5A 1PJZA 1JSZA 3AY0A 4M38A 1FP2A 5FCDA 4PYLA 4F85A 2CL5A 2ZZKA 3KR2A 2CMHA 2JJQA 2HV9A 4DF3A 3KHKA 2IH2A 1D2HA 1NBHA 3BGVA 2ZLBA 3OU6A 5HEKA 3PTAA 3VC2A 5ERGB 2C7QA 4MIKA 4OA8A 4RTNA 4HTFB 3PX3A 3LL7A 3FYDA 2PV0A 5DXAA 1T43A 4E70A 5K0BA 2IFTA 3ER8A 1QZZA 3H2BA 3HCAA 3LCUA 1KPGA 3OFJA 4KWCA 4ER0A 1L3IA 5HILA 3THSA 3UFBA 4F86A 5EMJA 3PVCA 4AZWA 1RJDA 4E31A 3MTIA 2I62A 1L3BA 3I9FA 4QQNA 2G1PA 2AOTA 2O0LA 3ORHA 4KW7A 2P3LA 1JG4A 4Y2HA 5ICCA 2JG3A 1NW3A 3DXZA 2I6GA 1YF3A 1ZGAA 4X1OA 3A7DA 2YXLA 4GOMD 4GQBA 4AZTA 5GIPE 2PX2A 2PX5A 2ZSUA 3P2IA 3LX6A 3X0DA 2NP6A 1KPHA 2AS0A 2UYCA 2NNWB 2UYOA 3EVZA
chains in the Genus database with same CATH superfamily
2CXOA 2J6HA 5F98A 2O1EA 2B8WA 3MOIA 3OUUA 2QUKA 1ZCAA 1V3QE 4NICA 3HJAA 1V4VA 1BE1A 4KN6A 1HQYE 4W9NC 1Q02A 5KU7A 1XZLA 3FYUB 1OGJA 3CLUC 3FYUA 2IX3A 1Q7EA 3ELWA 2C58A 3GFOA 1UFVA 2X14A 3EXEB 4Q3CA 3EXEA 1XKXA 2GPNA 4N12A 2BRUA 1N8SA 2HF9A 4AP5A 4LBVA 4AKGA 2B4QA 1PKEA 3OLYA 4KFRA 2AH5A 4JEMA 4IZIA 1E8NA 2YC2C 1YJBA 1G3QA 4BO7A 5AM3A 2VEOA 5BW4A 1IE3A 3DW3X 2X5KO 3MC1A 3NR2A 1UOEA 2VT6A 4P2BA 2Z2JA 2GUGA 1EHYA 3CPJB 4O2BF 3AUXA 1XA4A 1GJTA 2Y68A 1UDBA 3D8TA 1QOZA 4MCJA 1NJ8A 4PHGA 4XOIA 3SJ7A 1LI5A 3NHZA 3BXZA 5A4FS 4EZEA 1SOVA 5FO0A 2DWLA 4J0CA 2IBTA 3CISA 3MQ2A 3SMQA 1U2RA 1NVTA 2XIJA 2MMCA 1UFQA 4YAKA 2M2IA 4MB0A 4GGPA 1RMYA 4H77A 3B70A 4PGHA 5E7IA 1N2HA 4BEBA 4GLOA 4A6EA 1TTEA 1WW3A 3HI4A 1PJ8A 5JMOA 1OFIA 5TSDA 2BDEA 5SZHB 1N36B 1XPRA 4IGIA 1HDOA 1ZG3A 2YCLA 5IUKC 1VG0B 2EX0A 2EF0A 1EESA 2NYUA 5LPNA 1F1JA 4DMUB 1IY9A 4EHBA 1L5NA 1KIMA 1E6EA 3DDZX 4BQIA 5EXSA 1NJ2A 4DABA 5JYDA 3ODPA 1Q11A 1J0CA 2X3UA 4E30A 2OFWA 4FNOA 1TKAA 4S12A 1IBRA 1MV8A 3WBJA 3RWBA 4PYIA 3TE7A 3B85A 4WOBA 2OPHA 3W1VA 1E69A 3I4YA 1M75A 4D6PA 4Q1VA 1TCVA 2C4HA 3RNLA 2BGRA 1DXHA 3KR9A 4YV0A 5IFKA 3HFJA 4QGSA 2GZHA 1PQPA 2EV9A 2HYIC 2COKA 1CUBA 5KCZA 4WINA 1KYQA 4IIXA 2V3CC 3CGGA 3LY9A 1SRQA 2D5AA 2JI7A 4NCIA 5DB4A 4YJ2B 5TMBA 4YJ2A 1TZ2A 1FJXA 1FEZA 2WYOA 1A98A 4WCVA 1P80A 4BFLA 2C1XA 2QHOB 3TZBA 3HN2A 5ALMA 1Q95A 5TPZD 1SFRA 2QT1A 1RCUA 2E4WA 4CM9D 1UXOA 4EO4A 5BWBA 4BPRA 2OV4A 3GUHA 3FMIA 1Q39A 1ADYA 1JDTA 4FLFA 1NBOA 3DQZA 4O4HF 1ZIYA 3NS7A 5BN5B 3VJKA 5BN5A 2BKLA 4PANA 2QX4A 2JF0A 4QBHA 1YE3A 3S27A 5FTLA 1UC5B 1XU4A 4B09A 3LE8A 1TH2A 4MGEA 4HMQA 5FOQA 2QN9A 5GONA 1PK9A 5JAOA 1CDZA 4ZO7A 3W77A 1SKQA 4J0KA 1NBME 1JLRA 1N6HA 1Z4JA 7REQA 3TNFA 4ISCA 4CMKA 4OUKX 2V54A 5JTTA 5JV5A 2F5OA 3KEMA 3QIVA 4LS3A 4UHEA 4I2VA 1EJ0A 4BNFA 2VTVA 5IJ9A 1ISFA 4Q4JB 4E5DA 3G6WA 5JS2A 1XMOM 3OCUA 4BAZA 5FFNA 3CKYA 5FX2A 1VBKA 5F7JA 3O3NB 1KZHA 2ZCVA 1JJ7A 2BFCB 3S2IA 1EDBA 3V8PA 3AVPA 1NBAA 1Z5ZA 1PVOA 2GJ4A 3F5FA 1X13A 5JNVA 4XD7A 3T1HB 2ZBUA 5J2UA 1YF3A 2LUOA 5I7OA 4EENA 3N9IA 1ZMWA 4J0GA 4KWHA 4Z9YA 1TDHA 3ESZA 3X1MA 1OLUB 2YVKA 2JGDB 2HRQA 4OLJA 3T7SA 1OBHA 3SAUA 2WE7A 1VEGA 1JR3D 4JJIA 5SYAA 1HV8A 3RK4A 2YHUA 4JB0A 4DTCA 3ZLJA 5KNLA 3KZXA 3UT0A 3IJEB 1QYCA 5EIAA 2BTQA 2XX3A 3LO5A 4Y6GB 1RWVA 4CN9A 4CR6A 2EKFA 4YP6A 1SBZA 3BUSA 2QYSA 2Y3IA 1WM1A 1A9QA 2J0QA 4XWWA 1HQDA 1Q22A 4DLLA 2CWWA 3NDRA 4LTDA 4MKXA 3JQGB 4F4FA 2F9MA 1T6XA 4IVQA 4X1YA 2HZBA 5BSWA 3CYFA 1O8BA 3PX2A 3ZZUA 4P4LA 1N4DA 4EITA 4DXDA 3RSQA 3QVKA 4MYSA 3TOCA 3D64A 2JJ8A 3HA2A 2XRYA 1FPQA 1Z8FA 1FNNA 2VF4X 1GA4A 1J0AA 4K86A 3GFSA 2SICE 1A71A 3EOZA 3F71A 4B31A 3RB8A 3ZLTA 1Q3BA 4X8HA 4DIMA 5LWQA 5A6SB 1BMQA 1JAYA 4DW8A 1B1AA 1FNMA 5G2OA 4PY2A 3LLSA 3U4HA 5CYPA 4FOTA 1A5ZA 3EE6A 2P6MA 2HNKA 5AVUA 4E4RA 3COJA 4H18A 3SZRA 4G0OA 3VDNB 4EG4A 2H08A 2OSVA 3IEXA 4N7MA 3V76A 2FJ0A 3DEFA 2A30A 1T2UA 3VJRA 4YA6A 3BSFA 1DOZA 5ITTA 1O97C 3PFNA 4RA6B 4AF8A 3NH6A 3HU1A 5E9AA 3C45A 4GX1A 5HP4A 5DWQA 3LW7A 2YZMA 5BUSA 1BE0A 4AP9A 4C04A 5KC9A 1JUDA 1IIBA 3AXSA 4CKZA 1NXTA 4QUEA 1SCAA 5EEHA 2HIAA 1RTTA 4WCFA 3VPAA 1JTEA 4DV2B 1IXZA 5JAQA 1LA2A 4D9IA 4BAGA 4EABA 2W43A 4RGVA 4CEHA 4DLSA 4YRRA 3OCZA 1A0OA 1VBFA 5IZCA 4BLUA 3ZHSA 2ZIXB 2XOKD 4F3TA 4G9BA 4D4KA 1HDEA 3I61A 4KUEA 3SYNA 4AS3A 3ZCVA 2BHRA 4JB8A 2OO5C 1FB5A 3BZWA 3D4BA 1QHSA 1EXVA 1PFUA 3QE3A 3HVHA 2ZJFA 3LRXA 4COOA 2HNBA 4I55A 2A58A 1RZVA 2GN9A 1YL7A 2XZUA 4HN9A 1EIZA 1UBNA 4IUDS 4Y0VA 5ER9A 2V4ZA 2AL7A 1E99A 1R0SA 4Q4HB 1L9KA 4GP9A 3EH2A 5E6SB 1T1GA 3BMQB 2WB2A 4Q4HA 1U0FA 3RYIB 5BR8B 4EQ6A 3RYIA 3PPXA 1GADO 3LDFA 3QKRB 4K9DA 4XQCA 5GINE 4HEOA 1PQUA 2A59A 1GLNA 1FVXA 1TADA 4WRRA 1KR5A 2VAVA 1N1MA 4LRWA 2JNHA 1HR0B 4BXOA 3F3YA 5G3YA 2Z1MA 4QBTA 4DGQA 3D0QA 4UTOA 3A46A 3V1LA 4BMZA 3E8SA 2BR3A 1BQ4A 1D04A 3ZQ6A 3KJGA 4J3JA 6PFKA 2FG5A 3UH1A 4Q34A 4K26A 3T15A 3I6YA 5EZYF 5KIAA 4L57A 4ZOAA 3VGJA 4WXEA 4S04A 5TR9A 4Y1GA 2FB9A 3AF4A 1ZISA 4RKEA 2A5JA 1AMOA 3J81k 3DF7A 1P0PA 1BFKA 2Y21A 1V26A 7CATA 1GPWB 3O2JA 3OIVA 2GFQA 3W6NA 1T43A 1RWWA 2CXHA 2IFTA 4RKYA 1PR0A 4WBNF 3AEUB 1P6UA 2B94A 3AEUA 4DLZA 3I9FA 3ZI4A 2VG8A 4OHVA 4P9NA 4WPGA 3FR8A 1U2ZA 5CYFA 2XBUA 2H1OA 3CLSD 2UVDA 4C7XA 5I4IA 3AHFA 1WEKA 4RKFA 3W9SA 2D54A 2PZMA 5CJ2A 4F6RB 3KTDA 4MHOA 2HRBA 3CH7A 1HDRA 1LRKA 5FPKA 3T34A 4FW9A 3ZWWA 2QTCA 2AN4A 1ZJ5A 2Y93A 1L5KA 5BWLA 2W4QA 4CIBA 1C2YA 3UPTA 4XDZA 1OIVA 2FQYA 3K70B 4NECA 4TS4A 1QNLA 3FPHA 3AF5A 1QO7A 1RYBA 4CLOA 3O8CA 1K6EA 4R2HA 4EY7A 5EWMA 3F92A 2O8FB 3DYVA 1U4SA 1Q19A 3BTUA 1NN0A 1Z8NA 4RK1A 1O4VA 5HJ7A 3O3MB 4BKPA 3ZPXA 3K6SB 2OFPA 5FPPA 4B6JA 3GRVA 3N2GB 3HKDB 3N2GA 2DUWA 1HX7A 3X1KA 3HKDA 4FDUA 5CEFA 1U7DA 2PXHA 4XIFA 2Z9DA 2OCAA 3AF1A 1OI4A 3V1TC 1ULUA 3VNBA 4FPXA 3C8HA 1H3FA 4Q4DA 5H70A 4AJJA 3EGXA 1ZXLA 2JVJA 3S2UA 4FVMA 5LXTB 721PA 3NPAA 2BCJQ 3ZE6A 3MSCA 2EA0A 4B7CA 4QOIA 3EHEA 1L1RA 1E1QD 1DJMA 1TMKA 2VT3A 1CB0A 4QM7A 1D9XA 3OIWA 2PT9A 4RLHA 1X6VA 2DMRA 5DBEX 4RVNA 4HZIA 2FX2A 1H2HA 1TIPA 1X8KA 4HGRA 5WRFA 4FZVA 2X9LA 5IBRA 4B4VA 2EFDB 3ICVA 4DUGD 3WLOA 3RFFA 2DH6A 1PG0A 3PFHA 4ID3A 4DIOA 3AY3A 2ISCA 2GKSA 4ZRNA 4FZRA 2DAPA 4YTEA 1KZYC 4DQUA 4RESA 2HBQA 1FFEA 3KOMA 5D84A 1KZGB 1Q1QA 3CLTC 5G0WA 2PL5A 1U94A 3ACDA 2VDQB 3KBBA 4OQNA 4TS3A 3AFGA 3F0TA 3GIWA 5ADWA 3OZDA 3AESA 4Q05A 4AK9A 3RNOA 3EFOA 1VA5A 1RYHA 1O54A 1I3CA 1CZNA 5HPYB 4ENSA 4LJ6A 3ZGVA 4DUZB 3H5AA 3HKBB 1Z7YA 2CLCX 2P4SA 1K3WA 1CEQA 2XEDA 5ITWA 3U9SA 2Q07A 3W5UA 3A9RA 2HW8A 3JWGA 3WGLA 2MJ5B 3KU1A 1P74A 4EATA 1H6CA 4YHHB 1DO0A 1MRZA 3VAAA 1RHQA 4DV4M 2BEWA 4C05A 5IFLA 1HDXA 3ZHBA 1FJHA 4AIIA 4IMIB 4WKPA 1WETA 5EFOA 1HURA 1NVWQ 1ZO8A 4PHCA 5T3UA 4N49A 4GOND 3D7LA 4PXYA 5C9ZA 4RHTA 3WAKA 5LVAA 4EB0A 4YP0A 2NZ8A 3TD9A 4FWTA 3DEZA 3WOVA 1KOJA 5C18A 3VR1A 4HV4A 3C85A 3UJDA 3E22A 1T9GS 4Q3BA 3RT7A 2ZJ2A 3BN3A 2O2EA 3IAS6 5H9VA 1C2TA 1AUPA 2PZGA 1T6YA 1XGKA 1WUYA 1GZ6A 3R9IA 4DCMA 1PIWA 1ZMVA 1GTRA 2JIMA 3RKSA 4JC0A 3WA7A 1NASA 1MX3A 2MHCA 4LC9A 2QZ4A 5E6UB 1OAOA 4N41A 5AKGA 2VQSA 3HHXA 4OXKA 2CMHA 4FDAA 1DDOA 3K35A 2OBXA 5CDYA 5BRJA 4Z5XA 2AK3A 3LLVA 3CNQS 4XM1A 2FWRA 1W36C 3WDKA 2BUCA 2BHTA 3V8MA 3CZ5A 4KP7A 2AD1A 1ELOA 4U1RA 3H1BA 5F2NA 1GT91 1R12A 4URYR 4S35A 1SVNA 1X37A 3CEAA 5DDIP 4MQEA 1G59A 4MA4A 4FDTA 2X8LA 4HAZA 4DADA 2XE8A 1AHPA 1MB3A 4LSGA 3E5MA 2EFGA 3FAZA 3IXQA 1RHJA 3K0KA 2M32A 3CKKA 3OQJA 3MG9A 5CUQA 3PPIA 5JANA 1JKJB 5BV7A 1JKJA 4XGRA 3TFQA 2LKDA 2GO7A 1QWOA 3CZ9A 1PBTA 3HB7A 2PTHA 4QA9A 5H37D 2OCYC 1A9RA 3DC2A 2AXEA 4GM0A 1NSYA 2QE6A 1UK6A 1ESEA 3W6ZA 3U4MA 2GXQA 5DASA 3A1CA 1H1LA 2YY5A 3WNCA 2G08A 3AUFA 1T5IA 3FVRA 2XXJA 4FONA 3FTEA 1U2DC 4HZGA 4EX6A 3FF1A 1VP9A 3Q7PA 4NOOB 3Q3CA 3RI3A 4NPCA 1H8ED 421PA 4WFJA 4NYMQ 4XCQA 1ICIA 3O2NA 1CETA 1A9ZA 2VQDA 5U1PA 3WLKX 3E7WA 4BWVA 4CTJA 2IP4A 1KFKB 1GGJA 3URMA 4A0FA 1XVUA 3DL4A 2ZTMA 4UBJA 3WWDA 5ITUA 3C16C 1A76A 4N0DA 4TTAA 1VHWA 2P79A 1JF8A 2RHMA 2O4CA 3NYWA 2E89A 5ICFA 4PLHA 3CH6A 4EKDA 1RQRA 2LXEA 4BJHB 3RJ5A 4LY0A 2R0QC 1L8OA 5L3SA 4GNRA 1A8IA 1M0WA 4FEAA 5JG7A 4MS4B 1Y4ZA 2J0VA 4GWKA 3AW9A 3QTLA 4E0BA 4BRSA 4ZD6A 1KZ1A 1FSZA 4C0WA 2WMYA 4IFEA 2P3SA 2O7SA 4L22A 2ZSBA 1VI5A 3KKOA 3KT6A 4DPLA 2OHFA 3CZQA 1NM5C 4RD2A 1BNCA 1GL6A 1X9HA 2A9JA 1M73E 3PXUA 2JCGA 3PNBA 3OFKA 4P08A 2RH4A 4QM6A 1RI3A 4MHTA 1C0EA 2FOIA 3KT0A 1V6AA 4AF7A 2C3YA 5K51A 1EVJA 3LBYA 4M0UA 1HFEL 4JP2A 1IIRA 1O2DA 1L5GB 5FUYA 4EKNB 3CU5A 3BQNB 3H6KA 5IZ4A 4GVLA 2G82A 3NDIA 2YYSA 3KP0E 4ZMRA 2O52A 4RKRA 1M5TA 2HJGA 1YBFA 3WLNA 3IMFA 1KRWA 1UOPA 5FOSA 3CRVA 1VDZA 2GNAA 4C07A 4P83A 2KA6B 4OQPA 4ZAFA 4GAEA 2P65A 2HAEA 1E6KA 3O8OB 3QEOA 2FEPA 3O8OA 1RW4A 4DA8A 3SNHA 4I4LA 2N35A 3PZRA 1I4OA 4LDJA 3MMNA 4PLGA 1UBSB 3CVUA 1L5ZA 4NU8X 1L5VA 2EQ5A 4WURA 2XNKA 5AW8A 2I29A 1M2OA 2JARA 4IBGA 4LA4A 3FPCA 4U2DA 3O7WA 4P34A 3RASA 2OXEA 3OD1A 3GW8A 2EWVA 3JQEA 4PSUA 3CEJA 3ZCXA 2J3IA 1CX9B 4WMLA 1C9DB 4ND2A 1CZKA 3A98B 1D0KA 4R0VA 5LN1A 1BGXT 1JB9A 1GA6A 3LJKA 4AO8A 4JYZA 2ZCJA 2VPXA 1C7YA 5B2FA 2WIDA 4G56A 3RFXA 1FUUA 1EFLA 2DU8A 1O89A 1FFWA 4TT3A 2ZT6A 5HEKA 1XMPA 3PQ5A 3FMFA 4TTRA 5JJLA 3ER8A 1TVMA 1FF9A 4XK8F 2OYSA 3BBPA 1DBQA 1NQAO 3RSHA 4KPUB 3M7GA 2NU7A 2G9QA 1XRQA 1J6UA 1HTWA 1GTZA 3QW4B 2Q3MA 2C4WA 3DR5A 3A4LA 1PF7E 1NTOA 4MVJP 4FWGA 3PUKA 5JJ5A 1UJ6A 1I7LA 2WAYA 4F2DA 4G25A 5CBPB 3T1QA 2F2TA 2ZPAA 1IBMM 5JD5A 5C81A 2BGKA 4XTCS 3LWNA 4GUAA 1E9RA 2KS6A 1EAMA 4OUDA 3X44A 2ZSJA 4CLHA 1VPLA 1Z33A 4QC2A 1A9XB 1XVIA 1MFPA 3LH5A 2ZSFA 5DT9A 1II9A 1A9XA 3ANSA 4L7VA 2VRBA 4C30A 4HQRA 2J30A 4FOPA 1KGSA 4ZVRA 2JUJA 4HNRA 4C6TA 2V7UA 2GZDA 1ARZA 4BLTA 3EIEA 2OENG 1CJMA 4XPIB 3L6BA 3GJ3A 2J1LA 1ULAA 1FPMA 1YE8A 1TUBA 2V65A 4E07A 1ZS9A 2FJUA 1A9YA 3I30X 1LJLA 1YUMA 3H18A 3R40A 3IAS1 2PZKA 1UWVA 2GZMA 1J7KA 1B1CA 2V9PA 2H1VA 5DTIA 3GEEA 4YCMA 3RRJA 1VCMA 4BU0A 1QRAA 1H9AA 2XVAA 4Z0PA 3WWYA 4QLAA 2ECPA 4P3NA 3VXKA 2CMFA 2HQSA 4XWTA 1JQBA 1ODIA 1M1YB 3VH1A 3O38A 4RY8A 1KDRA 4HQ6A 3CPSA 3LKBA 3O5AA 3TOSA 2SHKA 1EP9A 3KW6A 1JILA 1FU7A 1E7WA 3OP4A 3PLAE 1W6RA 4U7FA 5T8KA 4ND5A 1YCFA 1A88A 1R66A 1W88B 1VCIA 2WF6A 2V4MA 3WK9A 2OLJA 2DT5A 8GPBA 4KQWA 2MINB 5KOIA 2ORWA 1UM9B 2ONCA 1DADA 2MINA 4D6XA 4S2EA 1T36A 2ZPUA 1HNNA 2FEKA 1QQ6A 1DC3A 3V55A 3WRVA 1YA6A 1OFHA 4DL9A 3AFHA 2V7BA 3L0IB 1EUQA 2QW1A 4PX5A 1Z45A 1B42A 5BOVA 3UMJA 2AVDA 4DR1B 4I9NA 4B9EA 1L4YA 3D4NA 2DWOA 5AM0A 3S28A 4CKYA 2WU8A 3IG5A 3L7YA 1J9EA 3I1FA 2PBFA 5LLSA 1SC9A 1H5NA 4HD8A 4V0KA 4HYTA 1PDWA 1XZCA 2Z8YA 1E1CB 3TZLA 1E1CA 3KB6A 2NQ8A 4O4JB 4O4JA 2XLCA 2QAGA 2E0IA 1LVGA 1PT7A 4BWFB 5EIWA 4TMYA 5FJJA 4ESEA 4PC3A 2KB0A 5H82A 5CXQA 1NOJA 5GJCA 4CM1A 1T1IA 3I2YX 1DX4A 4HS4A 4KIFA 4CDGA 4ZOLB 3VX3A 5F5LA 2GK4A 3ASVA 3DSRA 1ONOA 4RF2A 1T1RA 3JZDA 4BB5A 1YE9A 4F9GA 2LVNC 5GGXA 4JWTA 1WLYA 4RJTA 3OZUA 2CJYA 3PA6A 5KNDD 4YWJA 4EUKA 5JAMA 3D1VA 2NVUA 4RQTA 4GPTA 5DWVA 4XX1A 5LP6A 4MRMB 1MJNA 1SK8A 4UVGA 3ABOB 3WP1B 1GP2A 1UMDB 5KTMA 2ZAYA 3EJ6A 3DCYA 1PBNA 1J9GA 5BPHA 3OPXA 1RXVA 4Q9HA 4L6V6 4O1HA 4X6UA 3R4VA 2E18A 1U1FA 1DUIA 1QMPA 3V8RA 4BNWA 3OJCA 2E5LB 4BOYA 4IF4A 3UB3A 4PYNA 4BCCA 1BN6A 1RYYA 2VFAA 1CQPA 2ATVA 3RTEA 2QMYA 1PM5A 1LFDB 3PKZA 2F4VB 1W4ZA 5DI9A 1UDXA 5HIKA 4BVEA 3O92A 2C99A 5F3DA 1THZA 3ZWOA 2NLOA 3IQHX 3OU6A 2CJPA 2PUJA 3ZTTA 4WJZA 5CX1A 3SDZA 3AL3A 1LPOA 2JJ2A 2I62A 1TF0B 4RF5A 4QJ3A 4V24A 5C51B 1JWLA 3FZYA 4IM7A 2O1SA 2QRPA 5GZ6A 3DZKA 3DDCA 3JQBA 2ZRHA 3IOYA 3KVNA 3DBVO 5BNFA 4ZAVA 1FX0B 2JLBA 4CF7A 1XLWA 2AUNA 4BNDA 1LDNA 4YP9A 4HL4A 2EUCA 1XTVA 3BRWA 4IWYA 2PRKA 1V8DA 1I2AA 3OVMA 3AFNA 4UTVA 3HCNA 2J0UB 1GDDA 3PGLA 2W7TA 2J0UA 3QKIA 1A8QA 3C5EA 3H9GA 2OPFA 2JJMA 1TZCA 3K7EA 4MRPA 5ITZA 1DKPA 5EKSA 3P9YA 2UYGA 5CPFA 3OHMA 2BONA 2QPLA 4HUTA 1P7WA 4NF2A 1LSSA 5FLXA 1FW6A 1GGKA 3IT0A 4LYHA 3ILSA 3ROEA 3FBTA 3I72A 2IUTA 4HWSA 3B2EA 3TW6A 3DL7A 4ON9A 1JEQA 2OXRA 1F2UB 4FXOA 1L1TA 5AHWA 3F9CA 1YCDA 4PPQA 3AWIA 2NZ2A 1ADJA 3FFBA 3TCXB 2H9IA 3LUDA 1SVUA 4IP0A 1NDUA 4IY1A 3MWEB 2LWIA 2BGMA 1JHAA 2QQ8A 2W70A 1WMDA 3RE1A 2PE5A 3AVVA 3NT4A 2H16A 3H97A 3KQMA 2BHSA 4JLKA 4IMJB 4JASB 4R9SA 4HN4B 1ZOPA 4S1OA 1G6HA 3B6MA 1D9ZA 2UUCM 2WZJA 1BCSB 1O7JA 4Y30A 2Q0HA 1GGNA 2EEPA 1OYOA 4KVAA 3PXGA 2AWOA 1ETUA 4QFBA 4L3OA 2XD4A 2LHGA 4OP2A 3NWLA 2JIZA 1GNQA 1TEXA 4CR7A 4LQDA 4UUAA 1KZ6A 4DV6B 1Y6QA 5TMPA 2NV6A 2ZM6B 4FJ2A 2IHZA 5LB2A 2B4KA 1B8VA 2R7AA 3ADKA 4AKIA 1TTPB 5FL3A 3W0FA 2ZWOA 5BSKA 4B43A 2NQ2C 2C04A 1I80A 3JSXA 1F38A 1DGGA 3GG2A 2XMDA 2EZTA 4IH4A 1F9EA 2H1LA 2VAWA 3HMKA 2NPOA 4D5EA 5K8JB 3E7XA 3FX2A 1NBEA 1U3VA 1Z2CA 3TKAA 3IR7A 3IPRA 4M0PA 2YASA 1PJ4A 4TWJA 1DG3A 1CUUA 1U7OA 1BVYF 1Y6ZA 2XCOA 3LUJA 3UJCA 2F90A 1BJRE 4KQFA 3LQKA 1L1FA 2O2YA 4BFWA 2R8RA 1NNSA 5KYUB 4KXUA 3V1NA 2ZJ3A 1JEEA 3HS3A 1MA0A 4GLJA 4MLPA 4WEQA 4DMCA 4GPD1 1PQYA 4MKFA 1DXOA 1YLAA 3W68A 5K1ZA 4DQLA 3VRHA 5JO0A 3EA5A 1KFCB 2NO6A 4R2MA 1SXPA 1SUCA 1QYIA 1ZH8A 1IZYA 3L8DA 4NDNE 4YMGA 8OHMA 1XD2B 4CRWB 3QPWA 1XD2A 2C20A 1CY4A 3K09C 2AYXA 5BT9A 2A7QA 2C2HA 3RWOA 1OIXA 1NNI1 3DMHA 4JVSB 1BDMA 2BZ0A 3NATA 2CWBA 1EB8A 3FTQA 3C98A 5EESA 3RC9A 3NQ41 2B69A 3MBKA 1IHXA 1C9EA 1YZ3A 5JD3A 3IOBA 1VRWA 1W4CA 2QLNA 2WP0A 3FB4A 2YWHA 3GDWA 3P0FA 1C0KA 1NQUA 2ZI7A 2O2SA 4HXFB 4S2UA 2HJRA 2X0NA 2LVQD 5DXAA 2G09A 3S4YA 2CJWA 1KAQA 1WXHA 4NS4A 4BFTA 1L3BA 1UC4B 4MVCA 2I6GA 2MR5A 1WU7A 1FFHA 3ZX4A 1G21B 4K9LA 4JY7A 4B1FA 5D87A 4KQ9A 1J9ZA 5EP4A 4IQ8A 4CM4B 3HJCA 1T3HA 4MW9A 2WW8A 2JIBA 1MUUA 4JDUA 5LQDA 1DZIA 3LRTA 1HLDA 1M1NA 1Q6YA 2PWYA 5A7HA 1P0QA 2ODTX 1PCXA 3JW8A 1V9CA 3UK7A 2HQOA 4GE0A 1DO8A 2HLHA 2PTGA 1X1DA 2ZB8A 4IIYA 3RJ9A 3TS1A 2ZOSA 1XZHA 3VNQA 3RVLA 5MHTA 2BGGA 1Z7EA 3ECAA 5ITYA 4EUEA 4DNXA 2X2FA 3BEDA 3UBTA 4G6ZA 4J4HA 1SQ6A 1NW8A 2GAFA 2WFLB 1NIJA 4OHUA 4S1PA 4M88A 3K16A 4TKZA 4FMCF 4WVLA 4KQHA 3LCRA 4NRWA 2OWDA 4LE0A 3VZRA 3R09A 4DXHA 1QV7A 4ZYLA 1E77A 5HOEA 3Q6NA 3PC6A 3LYUA 1SHKA 1TTHA 3SOZA 2NO0A 1ZGZA 3TLGB 3TLGA 3V6LA 3G2PA 4FVTA 4AG6A 3T3EA 4C2TA 3C5WP 3HSSA 4MV7A 3TTUA 3TRJA 1IOZA 2EFHB 1KMIY 1DWUA 2DBZA 2OMKA 2D7GA 2IOFK 3B7QA 1GUBA 3MAAC 3U61A 3GNSA 1ZD3A 3LPAA 3O82A 4TYYA 3PYMA 5BUQA 2EW8A 3PB3A 1II0A 1DU4A 4GPEA 1R64A 3TLCA 5IU6A 1A7AA 3L06A 1R4GA 4ZHSA 4KSBA 3OEHD 4WXHA 4LZNA 1E2JA 1NFQA 3QKWA 2ZE7A 3EXHC 3PEFA 1C1XA 4REZA 2O8VA 4HQOA 2VI5A 1XDUA 2F9LA 1RI5A 1VLHA 3Q87B 4POOA 4N6GA 3P26A 4UTPA 2DFTA 4C20A 3BXHA 3QSGA 4JMPA 1K06A 4LRSA 5HE9A 4F84A 1KXZA 3BWYA 4ARVA 3L0BA 1E79D 4ZT7A 1W4LA 3W79A 2ZSKA 1BX3A 4KK3A 4IDFA 3WNBA 4CUJA 2XFSA 3HO6A 1NLYA 2DXIA 4BN0A 1JGTA 1ZVMA 5LYJF 5G3ZA 1XZJA 3IA7A 1BGVA 2HYDA 2X9QA 5C8VA 4A8JC 2JH8A 4BEWA 3GLUA 3QYPA 2QR3A 5J47A 5AVVA 2W11A 3LPCA 3H5OA 1SCJA 2R8OA 4DSOA 5K0TA 1E2EA 3BTOA 5DTRA 2NZWA 4YCCA 2WYUA 3M6UA 5T64A 4YMUA 4GPIB 4YRBA 3AVXA 4M9ZA 3BGOS 4XSGA 3LX5A 3BE5A 4MR8A 4E6EA 3WICA 3AYZB 3G88A 1Z15A 2QXUA 2X58A 1DDGA 4TUYA 5IT9S 1WZIA 2GAJA 1EGVB 1YB5A 2LV8A 2CXUA 1CJCA 4MQ5A 5E4YA 4CIAA 1CRPA 2OSBA 3FMVA 3MPOA 5B12A 1Y1LA 1EA7A 2MTBA 3TOZA 2OO9A 2HRCA 3EW9A 1HQCA 5DTMA 1I9CA 3TI7A 4HAVA 3H9CA 1KBQA 4YT2A 2P35A 1DAMA 1WQ4A 3C41J 3C43A 2NYVA 4RMGA 4QL3A 5EHZA 5JPDA 2DFDA 2WA2A 3D4IA 3W78A 3OX1A 4RJKA 1D3AA 4B83A 3K2LA 1SBCA 1CKEA 2PGXA 2MOKA 4RXTA 3Q8XB 2GCNA 3Q8XA 2HKIA 3O8DA 3EEQA 4TZ6A 1ZCJA 3VUFA 2L2QA 5K3OA 3ESDA 4IV0A 4R2WA 2AMJA 3NIFB 1N36M 2Z6UA 3R0JA 3KQVA 1EBBA 4IIUA 4R16A 2XNSA 2CDAA 2BFFA 2C7RA 4S1NA 1XAGA 5BN3A 2DBRA 1JEAA 3NEYA 4CMAA 3ENVA 2DQYA 5AJXA 1HNXB 3TNDA 4E70A 5JS6A 4Y6PA 1PWEA 2DC1A 4HPJB 3THWA 1AXGA 1J56A 3B3QA 5FOTA 3LLCA 1V6SA 3Q8LA 4W1PA 2WT4A 3P2JA 4KYTA 2D00A 4Q24A 3K9NA 2HA4A 2X0IA 5HFAA 3BF8A 2KHHA 4Q1BA 1Z0AA 3X2EA 4L76A 2OQ2A 4HB3A 5FRDA 1N6OA 1V25A 3A6LA 3PKJA 1UDRA 2C1ZA 3ROFA 3E35A 1NULA 1U0TA 1JAHA 3FOFC 2GN0A 4DCPA 4MDYA 5H4GA 2W6ZA 1YIDA 3RV4A 2ZRDA 2E37A 2PZAA 5LQKA 1DTEA 1TUGA 1M72A 4Q1AA 1EQAA 2AR7A 4BQFA 3WIDA 2BV3A 4N3BA 1G98A 1WV1A 2XMCA 4L5AA 3GCWA 1LSOA 1LY1A 1VQ1A 1OBOA 4EG7A 1GPKA 3SBEA 2PPLA 4LDRA 3NHPA 2CHFA 4ZJUA 1YQXA 4LMBA 5JC8A 5J9FA 1I6LA 2R1TA 2GLUA 1TA4A 4IHJF 3EVCA 5BMVF 5ULLA 2BFEB 3PXBA 4PO9A 2BFEA 3AB3A 3HDYA 1JN0A 1JIIA 1LW7A 3TB6A 3CB2A 1DKQA 1I24A 1HA3A 1SVMA 3BGSA 1WO8A 3FCCA 2ADOA 4GXNA 2R18A 1VL6A 5JTUA 3L0DA 2VHCA 2VP3A 1L4KA 2X1VA 2ZDGA 5KYVA 1RQ7A 1ZXBA 2EL9A 1XR3A 4ALLA 3OZXA 3X1ZA 3PHIA 5JLAA 3SQDA 1TKCA 2NU6A 4LPKA 3CSSA 1U6KA 3QI2A 3MOSA 4M0KA 4QSMA 3T1HM 1RXEA 4MUGA 3LVWA 1U2PA 1T5TA 2GYUA 3N2NA 1RE1A 3KYIB 3BSYA 1C8LA 3EVBA 4QUDA 2QLFA 2IXFA 4OGKA 3FCUB 1F8FA 4BL5A 4JI4B 5GONB 2A7XA 3MOGA 2OGZA 3ZU2A 4RV5A 4X9XA 2HGSA 2BIFA 4Y2UA 7REQB 2DWQA 5GOZA 2HH9A 5AJHA 4GR9A 4MEAA 4QPDA 3L05A 2FZWA 3FCEA 5IJ9B 3UK6A 5JAIA 1VI6A 1E62A 5A0TA 3F96A 4XJXA 1P7CA 2XRMA 2ETVA 2ZBEA 5MGNA 1RIIA 4OLAA 3ESBA 3B5IA 3PDCA 2VPZA 4PRYA 3SAWA 1D09A 3GMSA 4CNBA 4IIDA 1TYDE 2XXBA 5B1SA 4YRFA 1QLWA 2HPHA 1CUWA 4MGYE 3C4VA 4X71A 5J2UB 4W9MC 3EDYA 1IY1A 2GPWA 2HCFA 5DHQA 3PL1A 2PD4A 4XSVA 1NXVA 5AVQA 3F9RA 3HX3A 5T6MA 4RD3A 4HBZA 3UKDA 4QEKA 4DLUA 1XZPA 1C7ZA 2AR0A 3G8BA 3ZQ4A 4L4ZA 1BFUA 5JWHA 9ATCA 3MBOA 4UNQA 4WFQA 4ZC8A 5HK8A 1I4LD 4FDLA 1YC2A 1G0NA 3TUIC 5J40A 4UM9D 3KVOA 2B2CA 1FMLA 4U7HA 2X76A 1NE7A 3N0VA 3TZQA 2BTQB 2Z6QA 5EJ8A 4BP3A 2A9FA 2Q46A 3X1WA 1R2ZA 1N7GA 5KVAA 4BNXA 3C74A 3FKJA 3WKAA 1FSGA 2JASA 3O95A 5D5HA 5A1TA 4Q48A 2CBGA 1I2CA 3L28A 4X1YB 1NNUA 1QPZA 3F7OA 1DBVO 1SJ9A 1M6HA 1CIJA 4J07A 1DP4A 1GYPA 2YV4A 3SAJA 4B79A 4J9VA 4MKGA 3UJHA 4WL0A 2F1KA 3Q7RA 3A6ZA 2ZAGA 2IJGX 3NJ4A 4WKNA 1ZD1A 5MF6A 3HBAA 1V8OA 3MEQA 3VISA 2PZBA 4DV2M 4Z9XA 2OFOA 4F21A 3A6PC 3MJRA 1GG5A 3ZXSA 3GLKA 4KBYA 2X40A 1YRYE 4MGZR 5FJIA 2GD2A 4QD3A 3QJYA 3L84A 4PTYA 5AJZA 1X1TA 3GRFA 3KFLA 2YWFA 4CF6A 3PUVA 4YRGA 1JJVA 3AC0A 3CUVA 4B85A 1KK1A 1GIAA 3EC1A 1K5HA 4EL5A 2IDKA 1AURA 3MPUA 3WRYA 1WXIA 3F2VA 5DM0A 4WCFB 1QQ5A 3ZDBA 2XH8A 1IHPA 1XC8A 5BR8M 2BKAA 3ZOZA 4K9NA 1YOVB 4WESA 5EWJA 1YOVA 4CEHB 1EXWA 2AQHA 2EU8A 3LBFA 2CV0A 4URFA 1HR0M 1FC0A 2KZSA 3M34A 5TQ2A 1QU2A 1AGNA 4F4DA 1T4DA 1ISGA 2D8AA 3EGCA 5KPRA 3F6RA 2Q5IA 3INNA 1ZVQA 1VI2A 3RUEA 1DPGA 3H4MA 3FHTA 2FMHA 3R3XA 2IZZA 1JU9A 4PR0A 4I55B 4DIUA 2RJ3A 3W3AD 1VBMA 2ILTA 4FJ1A 5DFLA 3DEKA 3KR1A 1O9GA 4IEEA 2AEMA 3W0LB 3G5AA 2ZYRA 2Q7DA 3FYTA 4LF8B 4BX9A 4ZHQF 2E9SA 2H57A 4EQ6B 4RSMA 2L4FA 3C5HA 3WDMA 3AHDA 2X2EA 3BJEA 8CATA 3CGWA 3B74A 5TEVA 2FPLA 1YR1A 3H4VA 5F1PA 2HCTA 4GECA 5ECGC 2K2QB 4DPKA 2WU1A 4DDKA 4BXOB 1TJPB 5E7MA 1VG1A 2BGJA 3RBXA 2OHVA 2JK1A 3GGGA 1V9SA 3T9BA 4FYVA 2B6HA 1TA9A 2UXCB 2WZCA 2PUFA 4NBVA 2ZRMA 3ENKA 2AI1A 3RVPA 4G24A 3HSYA 2QQEA 3WLEA 4IDHA 3KRTA 2P75A 4QVGA 2OE2A 1GV0A 3DP7A 2AB0A 3EF3A 3QVMA 4C3VA 2QM0A 1LWOA 3D6NB 1BIFA 4JBLA 2QQ5A 3HB0A 1N6KA 4OMCA 2BFMA 2C61A 2DVMA 3WB0A 4UQPA 2QMQA 1RXIA 4E33A 5F9MA 2XUZA 4WIAA 4FNAA 5EQTA 1ECFA 3AB8A 4W7HA 3N8GA 3PGJA 2J7OA 3N8NA 4DMGA 2BOVA 2XRZA 2R68A 1YDGA 2J6IA 1YJXA 3KKLA 2VNHA 1XU9A 3IJPA 1P60A 3M6LA 4OM7A 1MJHA 3EWSA 3SMVA 1XEFA 2JA2A 3GLHA 1T8UA 4KO2S 4S05A 4J6FA 1ZEMA 4F71A 1LPPA 3PIIA 1XIVA 4CI9A 3WKCA 4UAUA 5GADl 1FQJA 4FR5A 1TJ4A 3S44A 3UJ7A 1NG9A 4KO4S 4EHDA 1UBLS 4EFDA 3FI9A 3ERCA 1N2JA 1CUAA 5LQCA 3KZMA 4IXWA 3F67A 1BA2A 4KPYA 4NCXA 4NSRA 4C03A 1ZK0A 4ECAA 4ZZ0A 3RC7A 5CT8A 2C88A 3CJRA 4BGDA 2RKWA 1R50A 3LQ1A 4CLOB 3DFZA 1BVHA 4CL0A 1QHNA 4JQSA 5AVZA 5FWXA 1SEPA 4CV2A 3I8OA 1XXHA 4LRUA 4TWBA 4YYEA 4FYMA 5EWMB 4E3ZA 3UBMA 3JATB 3JATA 1C80A 4JJZA 4ZVKA 5HIMA 4EGCB 4G09A 3KOOA 3HWSA 4CKXA 1IY2A 3EZ7A 4D0SA 1N75A 4BX2A 5A9TA 2J3KA 4WBSA 1EUDB 4L4SA 1EUDA 1N33B 2J3LA 3ORHA 1A96A 1NJ6A 3IXMA 5DCWA 2XADA 5IAOA 2XTZA 5KBYA 2Z6AA 1VYTA 1YULA 2O7QA 3EGXB 3GT3A 6Q21A 4COKA 3JAMS 3UA3A 1D1SA 1HLFA 4P3PA 4YO8A 5JY1A 2P6RA 2HDWA 1XTPA 2WC1A 2VYQA 5LL6P 4UBOA 4XQ9A 3T1OA 1WDKA 4XWOA 1E2NA 1N2CE 5JEEA 1AKNA 4MGKR 2QR2A 1AHNA 4DUZM 4ZKEA 2E4AA 3P9CA 5E6JA 1NRWA 3LUPA 4ONEA 4XE5A 3STUA 1BE6A 3TW8A 1TQ8A 5CNMA 2W6JD 4K9PA 3UT5A 4I0WB 4YHHM 1WCWA 4JQYA 2RFLA 1XF9A 1KNQA 3IESA 1SVIA 3KQOA 2FG6C 5CA0B 3BMXA 1JLHA 2QXTA 4UCWA 3JPYA 5CA0A 1QF7A 1VXOA 4MVJG 2Q1TA 4K88A 4E12A 3DHWC 4CJXA 2H5XA 3KP1E 2J07A 2KE5A 4Q3KA 1W2HA 1JLMA 4GGOA 2V7VA 3AESB 1CUFA 4UHDA 2F67A 1USWA 1J00A 2I3GA 2K0BX 3GLGA 2QMHA 3EFOB 2C7BA 1JEDA 3K1YA 2N3ZA 5B58T 3F4BA 5D8DA 4EJSC 2Q5FA 3FY4A 5EEGA 4EKEA 4YQFA 1UAGA 2G0TA 3EVTA 4ZCMA 3GAAA 1JDUA 1JWAB 1XKTA 4YUXA 2XH9A 2BT4A 1CZLA 2WJVA 4CMBA 3LOPA 5BUCA 3K20A 3ZWXA 1GQ2A 4WLOA 4MVJA 5JHHB 3WK8A 1BU8A 2BEWB 1P18A 3SSNA 4JJ8A 2QZPA 1IEWA 3BWEA 4BEVA 5IH3A 4M9SA 5LMCA 3REOA 4X7MA 3IAXA 1FS5A 3SP1A 2VOEA 1YL6A 3TNLA 3IBGA 4PICA 2AT1A 1G8SA 1V96A 1OAKA 1HG1A 4XJSA 2GFIA 5M2QA 1NP7A 3FW1A 3R6DA 4RTQA 3E22B 3G0CA 4EB6A 1EGQA 4UVDA 1YRBA 1CD5A 4EW3A 2HO5A 3WXMA 3NHLA 2J5BA 2YNMD 3NYIA 1WMAA 3IILA 2XF3A 1NX6A 4NSNA 1SCQA 4PG5A 4L0MA 2P5UA 3KAQA 4GI3A 2I1QA 3NM5A 5ICGA 5G4LA 1JFFA 2PMKA 1G8KA 1H2YA 4A8HA 3QP9A 1JQEA 2VDLB 4L07A 4M3NA 3VSBA 2APJA 2KLBA 2BCGY 3D3JA 4QRDA 4PGFA 3IVXA 3O91A 5TC4A 5CG2A 1FXWF 4LZPA 2WAXA 2W2QA 4O5OA 4W99A 4RE5A 1YVDA 1NAHA 3BFXA 4US0R 3E7DA 1ZK3A 4RTKA 3IV6A 3DFKA 3R75A 4MQEB 3RAEC 1JIUA 4HG2A 3UQYS 5B37A 2R1ZA 2DPXA 4B73A 3PEWA 4A16A 1Z4PX 4M9CA 1MQ8B 1WCIA 4GPBA 4OQYA 3F73A 1ZA1A 4BVGA 4DJDC 1X1AA 3SMPA 2CRUA 5D3KA 2D0DA 1IK6A 5GQSA 2VJQA 2OHJA 4LGVA 1R16A 2W2KB 1J20A 2VDWA 2W2KA 5GJBA 3CLKA 3T4EA 3CR7A 2FCAA 3MS7A 1H1LB 3ANXA 1VPWA 5E6RA 3RRNA 3RROA 2JLUA 1JA9A 5BRNA 4CBVA 2GMWA 4AROA 4HH3C 2ZJ5A 2YYYA 3KJNA 3HB4X 4MIKA 3MAJA 1ACMA 3A4NA 5DBFA 3DFUA 1UMKA 3WIEA 5ITQA 3R9KA 2WU3A 4XCVA 1CVIA 4KXQA 5EGSA 1PT5A 1RWBA 1KI1A 4ZV4A 1ZUHA 3QUTA 1U9ZA 5A9SB 2VJPA 3SQNA 4RSRA 5A9SA 1W47A 3NNSA 3R7WB 3VC1A 3R7WA 4MV1A 1Q44A 4R9NA 1FYVA 4CG3A 1N5RA 1CZHA 5L3SB 2R4EA 2A67A 1IL0A 5KTNA 1ESMA 1DEXA 2DFPA 3HA5A 3E2PA 4JJFA 1W1UA 1UQUA 2OQVA 1X15A 1XA0A 2FYTA 1Z28A 2XXAB 2XXAA 3HH8A 1DO2A 5KPDA 1A5SB 1QYDA 5DF1A 5DX1A 4BASA 4ZP1A 3EIHA 3ICWA 2W2TA 2D1QA 5B1DA 4X6YA 4CQNA 1V33A 2ECQA 2NAPA 3RTAA 3H13A 5TARA 2JRCA 1KHTA 2VK4A 2IE0A 4D9NA 4HDNA 2GCOB 5FH9A 2GCOA 3G2LA 4Z99A 1F8XA 1MC4A 1RYZA 2C54A 5FOUA 2KMLA 5T4HA 3L02A 5LD2C 1NBMA 3LUAA 5GPBA 2B35A 4QFCA 3K96A 1RRMA 1U6IA 3N5KA 3CLRD 5K9ZA 2O0KA 2PXCA 2ZTLA 1KWKA 1BOOA 4L72A 3CW2A 4O29A 4RVHA 3I9LA 4U9UA 3D6HA 3WK5A 1V7CA 3UCFA 3VTZA 3PVZA 1QR2A 2AV6A 4HWOA 2Q1YA 4ZANA 1GEGA 2EARA 1E3LA 1IQ0A 3SSOA 2QQGA 4M8NE 4Q7KA 2J33A 2Q4DA 1M2OB 1AZSC 3FZQA 4QYMA 5FSWA 2WUEA 5LIPA 1UXIA 4Y18A 3ZWKA 3EXAA 1NQ5A 3GO8A 1LNSA 3MWDB 2GHRA 3MWDA 1JQ3A 2JDIA 1UEIA 3SYKA 1C7IA 2AHRA 1ZRSA 2AN1A 3GROA 4BTLA 1E3DA 2ZT5A 4H7FA 4G8BA 3IVRA 1ZMOA 1E2HA 1NVKA 3VU9A 5AW0A 4B4DA 1U3CA 3PQFA 1WQ1R 2UUPA 3KYBA 4Z7OB 1FDOA 4L9WA 4F7WA 3DMGA 4WK2B 4E32A 2HHAA 3SM9A 3NYRA 1K3UB 4MV8A 4OMDA 3GFGA 1VCHA 2FW6A 2NU7B 1E9CA 1GUZA 2IWHA 3K9GA 2W2MA 1VLJA 4RV9A 1DNPA 3COZA 1VHTA 1ZN2A 4CQJA 4FQ7A 3CO5A 1KQNA 2OXIA 3ML1A 2BI7A 4JFAA 1E2GA 5IC6A 3DXFA 1K08A 3NT2A 4TS1A 4G8CA 3AF2A 1W8DA 1OZFA 2IYLD 4OUDB 3J27B 5HS6A 4AMYA 3HBMA 2ZB7A 2HA3A 3D54D 1J0BA 1ZDMA 5LA6F 2ZYTX 4C6TB 2RGYA 1E9EA 3GFRA 5HIJA 4C06A 4W5RA 2CF6A 1H85A 4F9EA 1T2NA 3QY9A 3VBCA 2R6DA 4U7PB 2CFOA 1OXUA 1XXLA 1QONA 1JE1A 1TUBB 4Y6LA 3QEJA 4Y0AA 3K0HA 5BPFA 4DR6B 1GG8A 2P8JA 3IYLW 3O3OB 4URUR 3DLHA 1L7MA 3RVRA 4ZGGA 2H5IA 3TJZA 3GYGA 1C3JA 4EGAA 4AO7A 4UDXX 1UJMA 3E9CA 4MS3A 3WDLA 2J7NA 1ZMUA 4UMVA 2C31A 3RS7A 2C78A 2YKGA 4DR1M 2BFOA 4HNSA 4KU4A 3TTTA 4XD7D 4NJMA 1TTQB 3IIJA 1PZNA 1OBFO 1GKIA 2PD6A 5K8TA 2YBDA 2YXLA 1Q0QA 5IJZA 4LX8A 2HJVA 1KJZA 3B48A 2ODQA 3S8EA 2Z8YM 3UMGA 1RKUA 3I42A 4PRZA 2QD4A 1KFEB 3G79A 2AOXA 2I4LA 2B4RO 3K9BA 5A3QA 1T36B 1KEZA 3T7DA 4A82A 3NHWA 3W2FA 4DYHA 1BHSA 3VPGA 2P6UA 4HR7A 2ANBA 4BNMA 2ZBVA 3F98A 2FH5B 3M9XA 4F60A 4LMPA 4DZTA 1VJGA 3D8UA 3A32A 3CXRA 3R7BA 2UYHA 2AK2A 1VJ0A 3OU7A 1TIBA 5FHRA 1VP3A 3K9HA 2CT8A 2QSZA 3ETLA 2ONJA 4HDSA 2YW9A 4EFMA 5EL0A 1V7ZA 3EDMA 1SCDA 1QQAA 5CVTA 4P22A 3JQ9C 4KIWA 1YAJA 1KEEA 3CIOA 3U9LA 2QAGB 4WXRA 1NUQA 4W6QA 3ZI0A 4D0RA 3LZ6A 1IRIA 1F4PA 1NWHA 2VUUA 1AUXA 3GC6A 1N77A 2WM8A 2AHOA 5M34A 2X4GA 3A58B 5U4QA 3FNQA 4N01A 1KEWA 5IAKA 2E5LM 1A95A 1XZFA 5EJMA 4BCDA 1P2VA 4AFNA 4XWGA 4EPWA 5FI3A 2F4VM 1TO6A 1O0CA 2Y27A 2IXDA 2PR2A 3L8HA 1FSPA 3LK7A 4H0NA 3KZNA 4A8PA 4NFHA 5JAUA 1V1MA 1Y4SA 2O2DA 5H4HA 4KEAA 2PBZA 3PFKA 4FKMA 3PX7A 4OM8A 2NVUB 5JI3E 5LP6B 4U7TB 4MB2A 3G1TA 4XAQA 1QCYA 4HDMB 4DCTA 1EWKA 3HBNA 4HDMA 4U7WA 4YUZA 2HCBA 3QE4A 2V7EA 5EE5B 2JAOA 3GEDA 4BLOA 2H1FA 1XMQB 2O2IA 3B1KA 3ANNA 1ZRMA 2VJBA 3LDUA 1SVOA 2IU0A 1C3VA 1GZDA 2UZIR 1EAYA 2O3TA 3RDPA 2Y99A 4GZ5A 1Q1EA 3AKEA 4NOJA 3ZWBA 1ZNYA 4HFRA 4BJ3A 2JFUA 1CYDA 4I81A 3UAOA 1Z34A 4JD5A 1CQXA 1FFDA 1W73A 3HXKA 5LBTA 2XE6A 1A8SA 5CX1B 4F2WA 4O08A 4ENRA 1L1ZA 3PNPA 1D8AA 1PK8A 2AFVA 1MJ5A 1OD6A 4JZKA 4HNHA 4S1TA 3DVAB 4OYRA 3WLRA 4A3VB 4KRFA 1Z2AA 3DVAA 2A0FA 3SDBA 2X4LA 2ZXUA 1B2RA 3D9QX 4YT4A 2Q9CA 5IJWA 4OAPA 1QWSA 2NUBA 2GBLC 4BNDB 3M1IA 2I3AA 3A3PA 4QBGB 1NUSA 4L8LA 4BQPA 3RAPR 3TL6A 2RGUA 4IDAA 5CCEA 3T5BA 2XY4A 2NAFA 2HM7A 1CP3A 2YIJA 4OQQA 4YRSA 2YMQA 2KJQA 1F4LA 2VJOA 1M2FA 1VLVA 3OMWA 2CXTA 3WL7A 1EHIA 3WB1A 5ITZB 3IHLA 3UB2A 1RAGA 1X1CA 2W48A 4V02A 4Q5IA 3ZCTA 4D41A 4CL3A 4X95A 2YXNA 3R44A 4YBRA 2BBTA 4DSTA 2CVFA 1QGAA 1PJZA 3PPYA 5AI4A 1MLDA 1X39A 4P2GA 2Q3HA 4U63A 4OA8A 1JEQB 5DNCA 1SK9A 1B23P 4TT8A 4G0ZA 1G17A 1P44A 3D81A 1U2EA 4UDOA 3HJ8A 3P2IA 4DV6M 1SGWA 5FF9A 1NXPA 1WU8A 2ZM6M 3PSAA 3DKPA 3G5UA 5G40A 3ASZA 1KI3A 1P2SA 3HEAA 1W87A 2FMIA 3SE7A 3EPLA 4TYMA 4A27A 3CVVA 2QD2A 3EEFA 2M6SA 1RQPA 3G8CA 3O3CA 1T8TA 4YMLA 5LOVF 3QNUA 4XEUA 2XUFA 2G1AA 1GCGA 4ANFA 4KNYA 3SC6A 2CD7A 4A10A 1RRCA 3WMGA 4EJ0A 3C6YA 3K70D 1PX2A 2FUKA 2V59A 1QGYA 4EJFA 1JSCA 3HBJA 3HXMA 2PUCA 2CP8A 3IBFA 4DZZA 2CUTA 3ZU6A 2ECKA 2FRVA 2XUGA 3A26A 4H1TA 2QTHA 5DM70 4LJ7A 4DRZA 1Z0UA 3PXXA 1RPNA 1THMA 4JC8A 3NVKI 3NXSA 2M6KA 2W0MA 2R96A 2FTKE 4G84A 2WVHA 1E61A 4AUNA 3DVRX 1P29A 3AP2A 1ZD2P 1JALA 4GMFA 4KXFB 3JU3A 4QRHA 2Y1GA 1MN3A 5KYWA 4GW3A 1T6ZA 4QJIA 1V9LA 2HA5A 4YBZA 3V42A 1SAYA 4TMTA 1VKZA 3AJEA 4JUFA 2CLFB 3CEPB 1ADGA 2Y71A 5FKJA 4I19A 3VTKA 1YFZA 1GR0A 3M4XA 3WHIA 5FI5A 3SZUA 3G2KA 4RZSA 2CKMA 1ABFA 1YQWA 4H31A 4LOAA 1PR6A 3I9JA 3FTCA 1UXHA 1EZ4A 2CWDA 4OFZA 1OLXA 1Y3FE 1K5PA 4M37A 1ESZA 3LRPA 4H7HA 4CKWB 1ISRA 4H1UA 3MILA 4MQ4A 1GNVA 4OSPA 4CKWA 1TKBA 2H1IA 1QP8A 2CE7A 1VYHA 1NA5A 5DE3A 1O95A 3LYHA 1MH1A 2FN9A 4OXXA 4AX4A 2HBZA 2A8YA 5KUTA 3QBVA 1RJFA 1YQUA 4R0MA 2EERA 5E2IA 1SIBE 2XJ9A 4IFTA 3U3ZA 4B3DA 3QU4A 5DNUA 3PQEA 3ZIUA 3LDHA 1U7XA 2JKYA 3AHHA 1GPNA 2JGKA 5DBOA 5B4TA 2CJWB 3NB0A 1V8FA 4KAJA 3LCVB 3U09A 5LZ2A 3H99A 1M6VA 4GC5A 1WL8A 2YWCA 2FH0A 5KQGA 3KKPA 3ZS9A 3N53A 2XQGA 4MR7A 4N54A 3EQ8A 4J75A 4UTXA 4XLTA 4DLPA 4ZEMA 4EB8A 1RBMA 4YXWA 2ZKIA 3KT3A 2CNKA 1M1NB 4IIBA 1HE5A 1Z07A 3HU3A 1GRVA 1ZNWA 2YCBA 1IXKA 2X86A 4YJ3A 5J63A 3ZNPA 2GK6A 2PPVA 3BHNA 2OCIA 3H5TA 3V34A 4LZOA 5HW0A 4P92A 1D1QA 3NMUF 5BSVA 4QU5A 3IE2A 3B2QA 5KQRA 4BO4A 2CNBA 5LQUA 2PKQP 4OOEA 3CBQA 1DAKA 1Z37A 1HSZA 1J2YA 3BK1A 2RGDA 4C29A 4WERA 3UFXA 2EHJA 1CY1A 4G4SP 2QMEA 4WKOA 2HFKA 3BAFA 3M81A 5CW1A 4AMUA 2IYOA 2BEUA 3IKJA 5D5QA 4IHAA 1Z4QA 1PWZA 3UN1A 3FMGA 4YASA 2HA6A 1XFAA 3HZZA 1ZPDA 4DF3A 4GBJA 2C7QA 1A5TA 2QQFA 2HV8A 2LCQA 3U61B 3RVQA 5HQTA 1G9TA 8ATCA 4QOJA 5ARBA 3K9CA 1PEYA 4P3OA 5LZ4A 2NTEA 3NT5A 2FSFA 4PU0A 1KU6A 2J0EA 3SKYA 1ZIPA 5B1YA 2JLCA 1CNMA 2C5HA 2BWEA 2NMVA 2NZYA 5HUHA 2BGWA 4ITQA 2OYCA 1GCAA 1C1XB 3OZSA 4D1YA 4EG8A 1U7ZA 4ETMA 4MXDA 2NTVA 1SHTX 3GDFA 5IN4A 3TG8A 2YQZA 4LRSB 3AJAA 1XQ9A 4M6WA 5DHAA 2A92A 3BREA 3D3EA 3PDJA 4QVIA 1M8JA 5KTRA 4FSXA 4Q01A 1JXAA 5KZMB 3VYTB 3BHJA 1PGPA 3AVTA 2G8NA 1JVNA 2PJDA 2BH2A 3H3JA 3WXBA 5IT5A 1BMTA 3N1UA 4TVOA 2HF8A 3GN1A 1MC8A 1XCJA 4JBWA 3O9MA 4PZ9A 1NQOA 6ABPA 3NFYA 1D6SA 4EMTA 2I54A 2DLCX 2DAIA 4XB6B 1MPTA 1OAAA 4MGIR 2K7ZA 4YY3B 4GOXA 2PT6A 4ZO8A 2I55A 2PJUA 2VNIA 4ZAXA 4UM5A 2GBGA 1P1KA 1L4MA 4MR8B 4QREA 4B3MB 2G5TA 1AG9A 1TAQA 4Z1MA 1WCYA 4PYQA 2X19A 1EQ2A 1JQ5A 5DO9A 4TUYB 3RRMA 1V92A 3ZJYA 4I9GA 5HBGA 3NKFA 3QGMA 4UOQA 1WB9A 1WXGA 3HHWA 3KG2A 1DQPA 1HNXM 3RJMA 2XZOA 4LV5B 4OW0A 1LTHR 3UKJA 3A6HA 4RD0A 4R1OA 1D03A 2XNJA 1SQSA 2YH2A 4QXPA 1ZIXA 4JI1B 1VKJA 3KXDA 4HDRA 5DISB 1R74A 3EWAA 4OHZA 3D8LA 2Y0BA 3ZYCA 1IJFA 4QU8A 1Q3TA 1TE2A 2BAGA 3VMFA 4IIWA 1RCTE 2GQ0A 4D3ZA 2HU7A 2PT5A 4UARA 2YHBA 2JXNA 3UHPA 2PVCA 3ZHUA 1SKMA 2G3QA 5M29A 4P7JA 1NUAA 5TQVA 2YY6A 3KQLA 2BFFB 4NCNA 1P5HA 3DT6A 5BN3B 4DNFA 3W4JA 5CFPA 3F47A 4C7KA 4OBEA 4Q3OA 1H0KA 1Z6TA 4PCVA 3D0RA 2ZJBA 5TY0A 2XNDD 1YCGA 3OTGA 3THWB 4XJVA 5J1TB 3SJAA 1S7CA 4LGCA 1IOLA 2HLNA 4E08A 3BWVA 5HJ2A 3AK4A 4DC1A 3WSVA 1TAUA 2HDNB 1PL8A 4CMHA 3EY9A 1XOIA 3WL8A 3MTQA 3HP7A 4K6GA 4GOKA 3UWKA 2ECFA 4I5SA 3GO4A 4YRJA 2CYBA 4G0PA 4B35A 1LK7A 4MQMA 2QF7A 4AF6A 4R1MA 1L5FA 2I1WA 2PLWA 4JJKA 1MHTA 4YLYA 4E5VA 1IZ9A 3WJ1A 2HU8A 4HL6A 4TTIA 1Q84A 2D0OB 3ZKAA 4D79A 3B1YA 1JPVA 1W52X 2IE8A 1EVQA 2CFSA 1ZJ6A 4I50A 1HOXA 3A36A 4ZCSA 2KNAA 3FCSB 1KQGA 3W3ZB 3CTWB 3BQMB 3DDSA 1YONA 3QK7A 4TT3D 5F4ZA 5JSHA 2PO5A 3LK6A 4PYRA 3KJZA 2R1TB 5GZ1A 4W8HA 2J08A 3H9BA 4A2QA 2J6BA 3SWWA 1WPXA 4KW7A 2W71A 4RVSA 3PP8A 1FS4A 4JI4M 3FUCA 3WL4A 3BIOA 3FLBA 5KHLB 4BNGA 1BMFA 5DMHA 5C5DA 4YMHA 2V6FA 3NEAA 5C8YF 3U81A 3L1UA 1NRXA 2OZLB 2O06A 2OZLA 3A70A 4F4IA 1M6NA 2WYHA 3ZBUA 4J2TA 2Q3DA 3IXLA 1GTVA 1L7OA 1FTWA 3VZSA 3SS7X 3JQFC 1PSZA 1G7RA 4YWHA 3ON5A 3C3CA 2NU6B 4B3BA 4S3MA 4ZN6A 3U40A 5B7NA 1L9XA 3AQ4A 4G1EB 2I4OA 4LZZA 1KC1A 1H0RA 2JIOA 1L5OA 1RS0A 5BVGA 5D51S 1LBTA 2J5RA 2J87A 3AFIA 2V3VA 3RO7A 5F3RA 2P1RA 1B6GA 1I3KA 4LGYA 4JH0A 1K9VF 3G85A 1NR7A 3W1EA 1IOVA 1QGUA 1G8AA 1USKA 4CGZA 2KNVA 3THRA 4Z53A 1XQXA 2OOSA 3UCXA 1WSDA 2PMBA 1L2TA 2GH1A 1UUFA 4EH1A 3R23A 1IZ8A 3A04A 3HRIA 1AHIA 5KWIA 2YWJA 4OSOA 1Y6JA 3AWDA 4TLDA 3EARA 1PLJA 1N34B 3W67A 1S89A 3A14A 2HF2A 1T1EA 1VPEA 4WV3A 2VZEA 1HI9A 3ZHCA 5ALQA 3F1KA 5ELXA 1NW6A 3OE4A 4FYKA 1IUKA 4Q47A 4LVUA 2V8BA 3DDUA 3MTBA 2ZRQA 2WE8A 2F3UA 1KFJB 1ZYUA 4I66A 4F96A 3BD9A 3FKSA 3O93A 1VBNA 5JASA 3LUFA 3ZZ1A 3C5CA 1VG8A 3IDOA 3F4KA 3UMYA 5HUJA 1I4EB 1V3TA 3DCJA 5BSGA 3LSTA 2JZ1A 3OFNA 3QWBA 3IIMA 1I30A 1QUSA 2QCUA 5BV2P 3BWCA 5JLJA 2DKFA 3DQPA 3LLUA 4D2IA 2Q0XA 3MMPA 2CVZA 1G20E 5EIBD 4C4AA 5EUMA 3ESCA 1KMQA 3WNZA 3D0KA 2QDKA 4I4TF 4QASA 5K6AA 3M6IA 4WQMA 3U7RA 5CDTA 2G17A 1QO0A 2NPIA 5AKIA 3JYPA 2GEKA 5K4GA 1N0UA 2AC2A 3LOUA 4JBNA 2VF7A 4IDQA 4KE8A 3RG8A 3GLIE 3PUXA 1FRFS 1WW8A 2AQIA 3A31A 3EZGA 1UOOA 1OXSC 4B6GA 4RKQA 2EAUA 4NHEA 3WMXA 5JMTA 1VE9A 5IUJC 4ENQA 4OFWA 1P0FA 3FDXA 1E1NA 3IAHA 1KFVA 4DMMA 3LWDA 2J3HA 2F59A 4TVSA 2WJPA 3SQXA 3O4HA 2V7GA 4UXJA 2EHDA 4MX8A 3GLFE 4MRAA 4LPSA 1W0KA 3CZPA 2DR0A 2RK3A 3VKFA 5DVZA 5EE1A 3PIRA 3H19A 2QX7A 1UK9A 2VC2B 1C7FA 1N1EA 1PN3A 1O94A 1ZRNA 3KEFA 2GVZC 3WISA 4LF8M 3Q1LA 1H6BA 4D56A 1CNFA 2FWBA 1PU2A 3HL0A 4NEGA 1E6UA 1W5FA 4BATA 2VH2A 1DQZA 4WESB 5MN6A 4MUYA 4O4IA 5EWJB 5D01A 3WIOA 3GVXA 3BA1A 2IEBA 3ISTA 4A23A 3A1TA 1YK1A 2H52A 4PD2A 1H4TA 2IHBA 3SZ3A 1Z6PA 4NESA 5AO9A 5TQ2B 4EPRA 3LCUA 3BIJA 4JFRA 3A6EA 2DAMA 2JJ2D 3PVCA 1G8MA 2KZUA 3HLTA 3MS4A 2PZ8A 2UXCM 2VHYA 2YZKA 3V97A 4BFCA 2IZ1A 1M2NA 3GPDG 1RJGA 2B92A 5T57A 3VPCA 3WK6A 2B1IA 3EH1A 3RS3A 2OZEA 1YQGA 3IS3A 2ADFA 2A6PA 4UUOA 3BRWD 4GMHA 4J16A 1OZ0A 2C3MA 5JEDA 2ZSAA 2OTCA 2XUDA 4UD6A 3STTA 2FZ5A 1SH7A 1EEXB 3MJ4A 2I6UA 2MR6A 1NY5A 1TT7A 4EG1A 4U4AA 4WTOA 4IDCA 3V8BA 1TU4A 2RHWA 4TV8F 4PAQA 2ZRBA 2A35A 4D4MA 3PE6A 2P2DA 1A2KC 1OFUA 2FA9A 1N3IA 3NHUA 3L8EA 2O05A 4EA7A 3GXBA 4NXNB 3U6CA 1UP6A 4ZPJA 1Y6GA 1EX9A 3C48A 1ZN7A 3OLZA 4MEJA 1VIVA 3T0GA 5IKEA 2VBCA 4XW2A 2MMGA 3GJZA 4RUKA 4KJZA 2ONKA 2ZETA 1DG1G 4N1AA 3MXTA 1EE8A 2X5JO 3OG9A 4Y9TA 4AYXA 3BK7A 2D2IA 4MGHA 4EELA 4CU2A 2GBIA 1XELA 4V1CA 1JAZA 2QW8A 2RMKA 1NTRA 2AQ8A 2XOEA 1J1ZA 1Z5BA 4KLNA 2ZJ0A 5KJEA 3KO8A 3AEXA 3UUFA 1DKLA 5FL7A 1VIAA 5BR1A 3GOQA 4P7BA 3GLHB 1AQJA 2QBYA 2C98A 1XTBA 3IR5A 2ZYAA 2F6RA 1RMQA 4RSHA 3AETB 3LG2A 4N3GA 3AETA 1N33M 1GV1A 1VMAA 3SE0A 4J1NA 4PPNA 5EE0A 4MVJH 3M70A 1JZQA 5EHNA 5IXYA 1Q0LA 4ZAWA 2O19A 1ZSYA 2CLSA 4JLOA 1EJBA 3MT0A 4FT4A 3KSJA 2JIZD 4AJIA 2OMEA 3WNVA 3ZW9A 5CA1B 5CA1A 3FLAA 3RW9A 4MI1A 4B46A 1RYFA 4CUZA 3ADOA 2WR8A 5FWXB 4PXAA 5EJFA 1XXHB 2XDYA 1DC4A 3TZEA 4OHXA 1NV8A 4EFNA 2DPHA 1E4EB 3TIGA 3SARA 1BEZA 4BO8A 1E4EA 2GBCA 3QOFA 2O3QA 1IG0A 1MNAA 4HDCA 3KCQA 2Z1NA 2C8JA 3M4YA 3DKRA 2NWQA 3SJUA 2QVYX 1C9NA 5SV2A 2A3NA 2C0QA 3ZE8A 1E3MA 1K88A 4MLDA 1MABA 2Q1WA 3BD6A 4U7DA 3EASA 1RWXA 3A4YA 3G89A 2P9JA 1R5BA 3GA0A 3N7UA 5U4XA 2ZROA 4FOOA 5D1NA 1N6IA 3UJ6A 5HA5A 4PO1A 1FVOA 1MW9X 2ZRCA 4X65B 3AZOA 3CQ9A 4M36A 4CDNA 3BZBA 1AF4A 2JC3A 3EXG1 1RDFA 4R2IA 5DNWA 1T13A 4IHKA 5JS8A 3LT2A 2O01F 1FP1D 1DGQA 1FTSA 2NX2A 3E46A 3BXOA 4F46A 5HJ5A 1WZNA 2WPNA 4J1TA 2IELA 3GLSA 2PX8A 1CR1A 3X2SA 2F7SA 1FDTA 3TW8B 4KQEA 1LBEA 3MS2A 4RHXA 2HSGA 4IOKA 4AMGA 5JZBA 3IUQA 4X20B 4X20A 4NP6A 4F4JA 3ZH9B 3UT5B 1T91A 1MP0A 3CX3A 4LXYA 3QFTA 3UGQA 2HSJA 5IJXA 5DHRA 4BDTA 5AKJA 3WYCA 5BW6B 3RF6A 2J46A 3B1JA 4KQ2A 3AOEC 1B6SA 1JAIA 2WWWA 3KKZA 3VOAA 2GGSA 5I5EA 4OI4A 3GN2A 4GZ3A 3DAFA 5DJ5A 3L01A 4R3UC 2OCDA 4QATA 1ULHA 1KI4A 2ACVA 3GLGB 2PK3A 3IOEA 3VDRA 1TZBA 2AOTA 1PG5A 2C4KA 4NZOA 2EZ4A 1DC7A 3EVZA 4D9CA 4MV6A 4YROA 3U3DA 4J91A 3H2JA 2D3TA 3KOZE 4MUXA 5AKEA 1U31A 4CEJA 1USVA 2V6GA 5KJFA 1PS8A 4TMWA 2JCBA 3A1NA 2QNRA 3D59A 1WIVA 3IECA 4KC0A 2RJNA 2R25B 5EJGA 5IEBA 4U2BA 3OJFA 3K73O 3BMNA 1G16A 4B6QA 3AV3A 1PHRA 3B9QA 3H04A 3SQMA 3M3HA 4CM8A 4PO8A 2G6TA 4ZZ2A 5KTSA 2JLZA 4M89A 2HF7A 4YRMA 3BDVA 4EB6B 1TK2A 4AJKA 3L4BC 1TCAA 4PT5A 5FAKA 4IUBS 4R69A 1TAHA 2CZGA 2XYRA 3FSGA 2I87A 3PEUA 2QB5A 3AHJA 4MWEA 1TR8A 3VU3A 3PRHA 3DMPA 1GKKA 3H11B 5ESDA 4DMRA 3BIFA 4D97A 3H11A 2JZCA 4UAGA 3HRHA 1ZWLA 1JECA 3GFPA 2XWSA 1JFFB 2RSLA 4BKMA 1SOAA 5C3UA 5C3MA 1BX1A 5C34B 4M54A 3FZGA 4J2HA 3SSMA 1CUXA 1VJDA 3MYRA 4N4AA 3HB5X 4UU0A 1Z5WA 4OI0A 1Z9BA 1WHCA 2GJKA 4Q4CA 3TLAA 2GA8A 1E7RA 2Q1UA 5E8JA 5TPWB 1E9SA 1VIYA 2RC5A 1DG9A 5TPWA 5A4DA 4D98A 1E7SA 4L7QA 4EDFA 2W98A 2VL7A 1K7FB 4UU8A