3GRRA

Crystal structure of the complex between s-adenosyl homocysteine and methanocaldococcus jannaschi dim1.
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
263
structure length
263
Chain Sequence
b'QCFLIDKNFVNKAVESANLTKDDVVLEIGLGKGILTEELAKNAKKVYVIEIDKSLEPYANKLKELYNNIEIIWGDALKVDLNKLDFNKVVANLPYQISSPITFKLIKRGFDLAVLMYQYEFAKRMVAAAGTKDYGRLSVAVQSRADVEIVAKVPPSAFYPKPKVYSAIVKIKPNKGKYHIENENFFDDFLRAIFQHRNKSVRKALIDSSKELNYNKDEMKKILEDFLNTNSEIKNLINEKVFKLSVKDIVNLSNEFYRFLQNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dimethyladenosine transferase
publication title Binding of adenosine-based ligands to the MjDim1 rRNA methyltransferase: implications for reaction mechanism and drug design.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 93
structure length 263
sequence length 263
ec nomenclature ec 2.1.1.-:
pdb deposition date 2009-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3grrA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3grrA01
4LG1A 1RI1A 4GOOD 3PFHA 5F2KA 3KU1A 4V0QA 4YV0A 3PX2A 3DOUA 5F2OA 1QAMA 2PY6A 3HVHA 5EMLA 3H2BA 3G2OA 4XUEA 2I9KA 2AN5A 2O0LA 2ZZKA 2NXCA 4HH4A 5CVDA 4E32A 4E31A 5CM2Z 3PS9A 1IM8A 2HNKA 3G2QA 4RTNA 3B3GA 5DX1A 1UFKA 3JWIA 2Z6UA 4QQKA 3L8DA 4OQDA 4H0NA 5GIPE 3A7EA 3C6KA 1EAMA 5DTMA 1DL5A 2UYHA 3QOXA 2VZ9A 5GIOE 3I5UA 3MHTA 5DM0A 2AN3A 2O57A 3FUUA 3C0KA 1SUSA 5DTRA 2FK8A 5CD1A 3B3FA 2ZZMA 1PRYA 1R18A 1BKYA 4DZRA 2AZTA 5CVEA 4RTSA 4GOMD 3PT9A 5F2NA 4C04A 4U7TB 3M6WA 5EEHA 2P1DA 4DF3A 4DQ0A 1RI2A 3G2MA 2OZVA 4QPNA 5GWXA 3VSEA 3P71T 4GOLD 5EG5A 2IBTA 1AV6A 2QM3A 3DR5A 1FP2A 2JHPA 3O7WA 4GBED 3RW9A 2HMYB 1WXXA 1KYZA 4HSGA 1VP3A 1WY7A 4C07A 5HZMA 1B42A 2PX2A 5DSTA 1JQDA 2PLWA 5T64A 5ICEA 3K0BA 4ATNA 4PYQA 1KIAA 2A14A 1UIRA 4RTLA 2XBMA 3F4KA 1N7IA 3I58A 4IV8A 4E30A 5EKUA 4PINA 1P1BA 1O9GA 2ONYA 4FT4A 1EIZA 3LBFA 3U81A 4YUYA 1JG1A 1JG4A 1NBIA 1Z3CA 3EVCA 3S68A 3FUXA 5E1DA 2OBFA 3KR1A 5HIJA 3DXXA 4C03A 1NW7A 1P39A 2PBFA 2BZGA 1JTEA 3HCCA 5E1BA 2OB2A 2XVMA 2E5WA 1ZGAA 3KPYA 3LKDA 3Q87B 1NV8A 2YXLA 4YV2A 2IP2A 2ORED 3UWPA 3BWCA 3CJRA 2FK7A 3DMHA 5CVVA 2AN4A 3THRA 4CKEA 4EVIA 2H11A 3HCDA 3CGGA 4FGZA 4FR0A 1H1DA 2ZIEA 5JUWA 1PJZA 2R6ZA 3UBTA 4M38A 1V39A 3KQSA 4PYNA 5FADA 3OU7A 2JH9A 1EJ0A 3SX0A 4ER3A 2AVDA 3O31A 3HP7A 5FTWA 4E2WA 3A26A 4GUAA 4IV0A 4LECA 4HTFA 4U7PB 3UJBA 4A6DA 5ICCA 3BWBA 4LWOA 1I9GA 2ZCJA 1T43A 1M6EX 4WXHA 2FYTA 4FP9A 3GCZA 3LCVB 5C9ZA 5K0EA 3C6MA 1X1BA 4PWYA 3V8VA 3EGVA 5T6BA 1WG8A 2PX5A 5E9WA 2CL5A 2G71A 2PV0A 1G55A 3E7PA 3G2PA 3KPVA 4HRAA 4EMSA 3P9IA 3ID6C 2BM8A 5DM1A 3UA3A 5EMMA 1YF3A 4WVLA 5LR6A 4O29A 4QDJA 5ICFA 2AS0A 2PXAA 3P9KA 5DSXA 3AWIA 3WSTA 1G38A 3ME5A 3MCTA 5DRTA 3ER9A 1FBNA 2OXTA 3ERCA 1JG2A 4PYJA 3LECA 4BP1A 5HIMA 4OX9Y 2CMGA 4P7KA 2PKWA 1P91A 1NW6A 2ZLBA 3NMUF 4RTOA 4E2XA 4KIFA 3DP7A 2ZIFA 2O05A 1L3BA 4P7GA 1IXKA 4AZWA 3VC2A 2JJQA 5HOQA 3IHTA 3MTIA 2UYCA 2I62A 5E9QA 3HVKA 3ANXA 3LDFA 3TKYA 1FJXA 4P58A 5HILA 4PYLA 3HVJA 3MERA 1QANA 2LD4A 5FA8A 2G1PA 5LQNA 5EZQA 4C05A 3DLIA 4MTLA 2OO3A 2P7HA 1U2ZA 4QTTB 3GRRA 4PNEA 4Z2YA 2ERCA 3EVGA 3T7TA 4KDRA 1YUBA 3M6UA 5KQRA 5HIKA 2PGXA 3C3YA 3DMFA 4EKGA 1M6YA 2IBSA 5HIIA 3UJ9A 1RJEA 2GH1A 3EVFA 5CCBA 2YXEA 4CWAA 1L3CA 2YQZA 1RI3A 5EZSA 4DCGA 3DXZA 5KS2A 3HCFA 3SR4A 3NW9A 5M5BA 2IH5A 4E2ZA 3PTAA 1EG2A 3R3HA 4FZVA 1F3LA 1ZHFA 4RYLA 1FP1D 2HV9A 2UYQA 3GXOA 3FPHA 2GPYA 3CC8A 2JHCA 3LHDA 4YMGA 2QYOA 3ELWA 4X41A 3HNRA 5GP1A 2V7EA 1XCLA 5LQAA 3FPGA 2IFTA 4KRGA 5DX8A 1WS6A 4OBXA 3TPZA 3B7PA 3BZBA 1Q0TA 2AOWA 2CWWA 4OA5A 2NYUA 1QYRA 1MHTA 3DMGA 4NECA 4Y30A 5K0CA 5K09A 3EVZA 5K05A 4GC5A 3P8ZA 3LPMA 3LGAA 2VDWA 5E8JA 3SSOA 3EMBA 3THSA 3GDHA 2ZWVA 1X1DA 3M33A 3NWEA 2ONZA 4GOND 3KHKA 1YFJA 1IY9A 2UYOA 3BXOA 1G6Q1 2HTEA 2IDKA 2P3OA 2H1RA 4GEKA 1R74A 2ZWAA 4HGZA 5ERGB 4YUXA 4RVHA 5BXYA 3KR0A 1AF7A 5D1NA 3B5IA 3P97A 3KQPA 1BC5A 1NW5A 2YR0A 3G7UA 4P7FA 3M4XA 1KHHA 5FWAA 2XYRA 3E05A 3LL7A 1KPIA 1NT2A 2F8LA 2V74B 3P2KA 5BW5A 1QAOA 3JWHA 3HEMA 3EVEA 2AOVA 3EGEA 4DMGA 3SSMA 1XDUA 3ORHA 3RODA 4HC4A 5DT2A 1TW3A 3BKWA 5MHTA 5DM4A 2ZSUA 1INLA 3DTNA 1SQFA 5K0JA 1P1CA 5KYGA 9MHTA 3KR2A 5K8VA 3GGDA 5EGSA 1SVUA 5E2AA 2P7IA 3FRIA 4CKCA 4BP3A 4EK9A 1Q0SA 5GM2A 1YB2A 3CJQA 1RJFA 4OBWA 2YUIA 3C3PA 5EHIA 5LQUA 2ZBRA 2EG5A 5K0LA 3RIEA 1JR4A 2OKCA 3IYLW 5CUQA 1NW8A 4AUKA 1MJFA 2NNWB 4POOA 1XJ5A 2AOTB 3FPEA 3R9XB 1TW2A 1X1CA 1XVAA 4RX1A 5DX0A 3FYCA 3KKZA 5DXAA 4C06A 10MHA 1I1NA 4DM3A 4BLUA 4X60A 3DULA 4HGYA 2OPBA 5EQJB 3TMAA 5DM2A 5BW4A 2YXDA 5K03A 3LBYA 3LX6A 1JTFA 5FWDA 3BGDA 4B17A 3ELYA 5CVJA 4XUDA 1VQ1A 4KW7A 4AZTA 1DCTA 1D2CA 1F38A 8MHTA 2EJUA 3SM3A 5KQSA 1JSZA 5C1IA 5GM1A 3A4TA 2NP7A 3GIWA 3T7SA 5D1HA 1XTPA 3FUVA 2P40A 3FYDA 2G72A 3BWYA 1R00A 1SG9A 2PSSA 3CKKA 3HM2A 5FQOA 7MHTA 2NXEA 3LDUA 2FPOA 2WA1A 1VLMA 5FCDA 4PYOA 1YFLA 2PT6A 4BLWA 4M36A 1XCJA 2PT9A 2QE6A 1QAQA 4CXMA 3FUTA 4ER0A 2CKDA 3TRKA 5K0FA 1KR5A 1ZKDA 4F84A 5C0OE 3TOSA 5EMKA 4YUZA 3DUWA 3O4FA 2FRXA 4GF5A 3FTEA 1RJGA 2ZTHA 3KQWA 3LKZA 5G02A 5CIYA 2ZZNA 5H02A 5K0GA 1VL5A 3R0QA 1KPGA 2DULA 2GB4A 1I4WA 3FPFA 2IGTA 3LCUA 2IPXA 1RI4A 1L9KA 3IV6A 3NVMB 3P9CA 2B2CA 3A27A 5HFJA 3M6XA 3FUWA 4GQBA 3EVBA 4PGGA 2DPMA 2NP6A 1TPYA 4KVZA 3NDIA 3V97A 4QPPA 4C08A 2YTZA 5DXJA 5FUBA 2ADMA 3OFJA 2B3TA 2R3SA 3T0IA 4AZSA 1AQJA 4PYKA 1UWVA 3VC1A 4GC9A 4CKBA 3KQYA 3OZRA 3QV2A 4MQ4A 4PIMA 1NE2A 3UJ6A 3GRVA 2B25A 4E2YA 4DA4A 3FTCA 1G8SA 2JH8A 2H00A 3HCBA 3NWBA 2ESRA 3A25A 5EIWA 2O06A 4ER6A 2CMHA 5E1OA 3GNLA 4PCAA 4MHTA 3NJRA 2GA9A 2BR3A 3AJDA 2ZVJA 5EHGA 1JSXA 5FHQA 4PYIA 3QOWA 5FQNA 5LQKA 2IIPA 5B1SA 3MTEA 1NV9A 4E33A 3AXSA 5K0BA 1QZZA 4BLVA 4RTJA 5BP7A 3A7DA 3UFBA 2HWKA 1VE3A 1XXLA 3G89A 2C7QA 2C7OA 5T67A 3NVKI 3FPJA 2IH4A 2I7CA 1YZHA 1ZG3A 2OB1A 1YZ3A 2Y1WA 3OFKA 4M37A 4R6WA 5EPEA 4RTMA 1ZQ9A 3SGLA 3LSTA 1OR8A 2EX4A 4YUVA 2VDUE 3BT7A 3EVDA 1JG3A 1NBHA 1L3IA 4ISCA 5LQCA 2EJTA 1O54A 3CBGA 1EJ6A 1FPQA 2K4MA 1NW3A 2P35A 3KQMA 3PB3A 3MCZA 1R6AA 2PX4A 4QDKA 5EKXA 1JQ3A 2G70A 5GOZA 4PCLA 2P8JA 2P41A 1AQIA 3UJ8A 2O07A 4JXJA 3TR6A 5EIFA 4EQZA 3OPNA 2AOTA 3KR9A 4FS8A 2QY6A 4KDCA 4QVKA 3T7RA 3UJDA 2AOXA 2Z6QA 2Q41A 3GRYA 4HG2A 4RVDA 1D2HA 3E23A 3SMQA 3ELDA 3OZTA 2OYRA 2QRVB 3OCJA 3P2EA 2Z6AA 3JWGA 3GU3A 4R05A 3MB5A 4XCXA 3MQ2A 3HA7A 5DWQA 5EEGA 3GRZA 3EPPA 5FHRA 2AOUB 3G5TA 3UA4A 4F85A 2JG3A 4RWZA 4QVGA 5HEKA 3M70A 4CTKA 5ICGA 4OA8A 4KIGA 1VBFA 2GAFA 3AY0A 3G8BA 4MIKA 5K0NA 3MAGA 5EMJA 4IWNA 3BUSA 4RV9A 3HA5A 2ZW9A 4CTJA 3OE4A 4RSRA 3UJ7A 4PONA 4OQEA 1R8XA 2PXXA 2WK1A 4FSDA 1L1EA 2PX8A 1VPTA 2NXNA 3SXJA 2I6GA 4RVFA 4X1OA 4AZVA 3BGVA 2FHPA 3KPWA 2BM9A 4DCMA 5LQRA 5U4XA 3EEYA 3FTDA 1SQGA 1JQEA 3OZSA 3GRUA 2GLUA 3I53A 3P2IA 4X61A 1KXZA 4Y2HA 2G8NA 3FTFA 5IKMA 4KWCA 1SKMA 2GS9A 3HVIA 5GINE 3UZUA 2JHAA 3PVCA 2FCAA 3KPUA 5CVUA 4X63A 4EKIA 3CCFA 2P3LA 1HNNA 2ZIGA 5IH3A 3E8SA 3TLJA 2VS1A 3GWZA 2HR1A 5EC8A 4BY9E 1N2XA 2N47A 5DRYA 4G56A 4F86A 4RTRA 2PWYA 3BWMA 3PFGA 2IH2A 3ER8A 4FSXA 3SSNA 5LQJA 3Q7EA 4YV1A 3UJCA 3P9NA 4E70A 1XDSA 3BGIA 3EGIA 2ZBQA 3B89A 3KQTA 1KYWA 4PYMA 2B9EA 3VYWA 1VP9A 2C7PA 3EVAA 1DUSA 3TM4A 2BH2A 4YMHA 3CVOA 2AR0A 2EFJA 5P8WA 3X0DA 3FRHA 4P7JA 5E9JA 4RTPA 5LSAA 1KPHA 3TKAA 3GO4A 2BR5A 1BOOA 3DLCA 2OY0A 3ELUA 1SUIA 3GJYA 1ORIA 5E1MA 3TM5A 4YUWA 4K6MA 1D2GA 3FZGA 4RVGA 1RI5A 3MGGA 3K6RA 2PXCA 4PGHA 2C7RA 1G8AA 3KQQA 3KQVA 1G60A 3R6TA 3TQSA 4ER7A 4M7RA 2ZBPA 2ZULA 5DPMA 4QQNA 3HTXA 5E2BA 2PJDA 1N7JA 2YX1A 2AVNA 1WXWA 3PLAE 2B78A 1X19A 5DLYA 5CCXA 3LDGA 1ORHA 3HA3A 3R24A 2PWPA 4V0RA 3SVZA 1M0EA 2WA2A 3DXYA 5E8RA 3I9FA 2BR4A 4R6XA 3PX3A 4RTKA 3REOA 3G88A 1R8YA 4LWPA 2KW5A 2XYVA 3B3JA 2VP3A 3OE5A 4PIPA 1WZNA 3HCAA 2IDJA 2NXJA 4A6EA 3IEIA 4ZTBA 4UOEA 5JR3A 4FT2A 3D2LA 1EQAA 3G5LA 1O9HA 5FA5A 3AXTA 3EMDA 3UJAA 5EOVA 3HCEA 3I64A 3KPJA 2P3QA 1NKVA 3LCCA 5EVJA 4ER5A 1ZGJA 2UZ4A 4HTFB 3TFWA 1HMYA 1VIDA 2PVCA 3BKXA 2YVLA 3CJTA 3M6VA 1RJDA 2ZFUA 4IKPA 3NDJA 5FULA 3DH0A 1BHJA 4MWZA 4R8SA 3KQOA 5K01A 2QRVA 5KVAA 3EEOA 4C4AA 2VDVE 4DKJA 3G8AA 4QTUB 3JWJA 1Y8CA 1KP9A 2AOUA 3OU6A 1XDZA 3OU2A 4L7VA 4R8RA 5DTQA 2XVAA 2Y1XA 4XUCA 2XYQA 4AX8A 1X1AA 4RTQA 3NTVA
chains in the Genus database with same CATH superfamily
4BKMA 3AI1A 3PFHA 4O8CA 2C9CA 2FPXA 5KO2A 1MRNA 1S8OA 4MVCA 1P7VA 5L3RA 4RTNA 4AY2A 5JNWA 3PEVA 5I3CA 1W52X 4IDEA 4YECA 4LZPA 3KFVA 4XPIA 3UH0A 1JKIA 1G5TA 2ZSEA 3DPSA 4JR0A 3AKYA 1KYZA 2XMSA 5LOVA 1UBLS 3EXHC 3I4VA 1WXIA 2E18A 5KTSA 3U81A 4ZOBA 1EK1A 2BZGA 2CHGA 3W6UA 3LKDA 2VZ0A 4GZ3A 3F7OA 2G7ZA 4BEJA 1GKYA 3IUSA 1NZJA 3PKZA 1FMJA 2B6HA 1E94E 2QW0X 2MSNA 2YWDA 5HNKA 2HRQA 3GPYA 5T6BA 2XA2A 3E1SA 3O0DA 5BWMA 5ALUA 1PZMA 4UUBA 4NXNM 3OO0A 3NOQA 1D4OA 1Z0FA 4NG4A 3JV7A 3U7QB 1L7AA 4D0RA 1JHOA 2L0XA 3PL1A 4Y3UA 2QMOA 1F60A 2Q3LA 4YP6A 2JGAA 3AM3A 1L2TA 2JJ1D 1SM4A 1ZW1A 3DVSX 3PR2B 1CYDA 5CDTA 2FN4A 4RV4A 5EE3A 4DA7A 1C7JA 4P0QB 3EMBA 2QAGB 1S0UA 5FI0B 1U0JA 3WLIA 4CU2A 5GV8A 4KX5A 3R0VA 2FMUA 3C3WA 2R68A 5D1NA 2D54A 1NW5A 2YFKA 4N49A 4XI9A 1RBMA 1FLNA 2KHZA 2LCQA 1KI8A 4B40A 4B6GA 4TZ0A 1VKZA 4HGQA 4V1CA 1DAFA 5CYPA 2WTNA 1RKQA 1AGNA 1LS6A 4Y2UA 4I9NA 1JTFA 4ZPXA 2I3BA 4NU6A 4XWWA 1D6SA 1VB5A 1EB8A 2HK7A 3KE8A 1XVTA 5JMPA 3RHSA 2BV3A 5HJEA 1YFLA 4TGLA 1JSLA 2C3UA 1NOKA 3D8UA 1LI7A 1D2MA 2CF6A 2CYAA 4F84A 5TQ2B 2ZTHA 1JGTA 4WGGA 3ZQKA 4P54A 1TC1A 3QKSA 4ZEMA 1IATA 1V1RB 2F3SA 2P9FA 3AL2A 1GN9A 4A2CA 3QVSA 1IVNA 4CKXA 2VJDA 1EGAA 5JMTA 1CR6A 2QRZA 3UANA 2PLAA 2JZ1A 5IAJA 1XJ0A 1E7MA 3BMNA 2QLTA 4MUNA 2H4HA 3FKEA 2PCLA 4XWOA 2V7XA 1DEKA 2J6IA 3N2LA 5FOWA 2A6PA 3KT8A 3FVVA 2CLIB 3D9QX 3AVQA 2Q41A 3ER6A 3LCJA 2MSWA 2C57A 5BSEA 3BSYA 4WZAA 1PWXA 2BIFA 4YLGA 2ZI4A 3CV3A 1WCWA 2H07A 4OA8A 1I6MA 4XWAA 4HXYA 4ITQA 1YR7A 4U8GA 3R0JA 2PKRA 2BFFA 1SKMA 5EZ5A 1AGPA 4UTVA 3KOYA 4GNRA 1M1ZA 3GLUA 4L8LA 3TLJA 2VSYA 3VHXA 2LVQD 2AFHB 5H80A 4E7PA 2BCGY 2IE0A 4II7A 3GUYA 5IAKA 2J30A 4DLYA 2C9OA 4WEQA 4BMOB 1YL7A 521PA 4EELA 2B8WA 3PHCA 3VU9B 4G5OA 1DRJA 3TRFA 5I47A 4JX8A 1PGYA 3WLNA 4OU4A 4CVNA 4JITA 1XN4A 4MZDA 2AWOA 4HQLA 1J00A 1H65A 4MO9A 1OFIA 2XD4A 3FOEC 4ZTBA 5I4KA 3A3YA 2HMUA 4BATA 2V6MA 4MCAA 3CJTA 2ID4A 3K0EA 4CQMA 4DUPA 2PU7A 1K3WA 4OHPA 4E4TA 1YRHA 1SXJE 3HDYA 3J7AC 3JQBC 3KJHA 3J7AS 2BMFA 1T5HX 1J4AA 4NRVA 1Y6ZA 4N03A 5DX1A 3RTBA 4QQKA 3QAUA 2MOKA 2HZBA 3CN9A 2WSEF 2VPWA 4OSEA 4YYZA 3K73O 4BC0A 3V6MA 4MAFA 3PJRA 2ZJ4A 2RHOA 3TRHA 1JQDA 4RKRA 1EVQA 2RBEA 4C01A 3FD9A 2XVXA 1HE5A 2PANA 2WWWA 1IPEA 1PUXA 1NI5A 5JS8A 4Y2QA 4IV0A 4B3TB 3G0OA 1NJ6A 5IYZF 3MTAA 1SCJA 5CLIA 3V1MA 3HZZA 4R01A 3AEKB 3J27B 5AJXA 3R0IA 3M5DA 1L4MA 2HGSA 8ABPA 3IDAA 5J2TF 3LGXA 5L45A 5E9QA 3PXXA 3Q3HA 2BOVA 2GEUA 1S3SA 3MJRA 4L85A 2W5UA 4ENWA 1JV2B 4KX3A 3ZU4A 1JQJC 4MGKE 3GGPA 1YJAA 4O2AA 2GZHA 4B4KA 1DINA 2Y4OA 4OMUA 4XJXA 3WK9A 2O3UA 4D6XA 2AD5A 4EPTA 1JEEA 3DF9A 5FUYA 2JD0A 1WTAA 3GJ8A 4C6TA 3IPYA 4CM4A 2OHHA 4Z4IA 1G41A 2QZ9A 3U3JA 6CHYA 3CRMA 5EXEA 4GOND 4DCUA 4GVXA 4IVRA 3SFZA 3IBYA 1ZZEA 3B2EA 3FMOB 3DOIA 4AZ0A 5BWOA 3KR0A 5B7NA 1CJUC 5HMLA 1XD9A 1QIIA 2Q2EB 2W37A 5TF4A 1NUSA 2UYGA 4XCQA 2EJWA 3G0CA 4N9WA 1KI6A 3K4HA 4RV5A 2ZBGA 1Q7EA 3OT4A 2ETXA 3V7NA 1YE3A 2Q6IA 3G8CA 2XB2A 3JX9A 1LJUA 2H8GA 2Z2KA 1KEVA 1YQXA 2WT9A 2AA3A 5D1HA 4HX2A 1OH7A 2OBNA 4UW9A 3BQMB 2C3YA 2JAUA 1R0CA 3DFKA 2WUVA 2J09A 1Q2XA 4RF4A 1WB9A 5E95A 4RLQA 1KMHB 2PFGA 1N7HA 4TV9B 1W36C 2PKYX 4BQPA 3LHIA 1KQFA 1OIXA 1U63A 1SKQA 2PRJA 4P2BA 3TZLA 5ILOA 4Q1EA 5TPZD 3AHFA 3OSUA 4J2OA 4CUJA 4PCAA 4WKBA 4R2MA 1AC5A 5A2QS 3KCQA 3UVEA 4BDTA 2OWEA 1ZHOA 3HJUA 2WJ4A 5JEDA 2RGDA 1HC7A 4N4AA 3BT7A 1KEKA 1JR6A 1IIBA 2QLLA 3ZEAA 1J1ZA 3ESZA 5IDWA 4RORA 3SMQA 4HLQB 4RIFA 3K31A 5ECYA 2Z1DA 5LZ5A 1U7UA 2Z4RA 1WZCA 4U6SA 3H3JA 4EMTA 2BBSA 5AVKA 3DFMA 2RKWA 4JBGA 4HNGA 2R2AA 5TMDA 4XSGA 3DTYA 3MGBA 3RSOA 3A1TA 4Q7LA 2WWGA 4QU9A 1N9ZA 1ZIYA 2Y27A 4FJ0A 2DFKB 3G85A 1YRLA 1KDVA 5A7HA 3SATA 3L84A 4WLFA 3W5BA 1DEOA 3CVOA 3CVXA 5HKBA 2IHJA 2HLPA 2CXHA 5F1PA 3EH2A 2QB5A 1US8B 1JAYA 4ID9A 3I4CA 4O4JB 3PYLA 3PLAE 1MQ8B 1JEYA 4G5FA 3ZBQA 1O5OA 1OT5A 1N5OX 2Q5IA 3JYLA 3A31A 3PWTA 2NADA 1N5LA 3FF4A 4FMCB 4Q9DA 3I01M 3NDJA 3GQBA 4JQOA 3LC7O 3C14C 2CJWA 2YJGA 1DIOB 3KSUA 3WHKA 1DG1G 1XMJA 3K6KA 3NGXA 1P31A 4TL6A 1J7KA 2YJ6A 4D3XA 1O97D 2O4CA 3OD5A 1A8HA 4G67A 4A23A 2VIIA 2GK7A 2OHJA 2KBFA 2O23A 1O95A 2JKYA 1JLSA 2MCFA 3FNEA 1PGJA 2PO7A 5A7FA 3ITNA 1M2NA 3VKUA 1CQIA 4GPIB 3ZIDA 4U2DA 5FEUA 2WC1A 1EFKA 1OFUA 1PJCA 1N57A 1T8RA 1ND6A 3N7UA 4KQIA 2FVYA 2PU5A 1M34A 1JQ5A 1H2HA 5CT6A 4GHAA 5FI1B 5IVIA 1B8UA 4EGAA 5TARA 3L4EA 4BNVA 4G6ZA 5A4AA 3L5KA 5I7EA 2F7SA 5FP0A 3W5HA 3DYBA 1O6BA 2HPHA 1QV7A 1WGLA 1J5EM 5L3SA 2K9DA 3M89A 4MVJH 4IDCA 3KB1A 1YF3A 4J29A 1M75A 2ZI9A 3IAS1 3T6KA 4D43A 2OXTA 2YVQA 5K3AA 1R6BX 2MDTA 3OTGA 1KSGA 2VHUA 4F4FA 4IHJA 4U7GA 3GAZA 2YIVX 4NJMA 1FJXA 4KYUA 4KK3A 1RXCA 4B87A 2FE1A 4QQRA 1AKYA 1LBSA 3HA2A 3TIVA 3PUHA 4NZNA 4OQ4A 2GH1A 2G4CA 2PEZA 2UXBM 3Q2OA 2MINA 4DCTA 2DPXA 3I2HA 4E2ZA 3ZWQA 4L3VA 4B6SA 3ZS8A 3UGKA 1PWZA 2CFCA 3WLKX 1J9ZA 3AHHA 3GPIA 2AOWA 3O8QA 1XMQM 3EWSA 2IPLA 3NCHA 3LPMA 1E2QA 4LBWA 2QT0A 2KA6B 4HX5A 4HNQA 1W2HA 2HTEA 2XNDA 3GFBA 1DEXA 4RJIA 4DCSA 3E84A 3OAAD 3TKLA 4HAIA 3UKDA 1QHGA 2VQDA 4OEHA 1M5RA 1CYEA 1G21B 1REQB 2XDQB 1Z18A 1XVAA 1KRXA 5DXAA 1YONA 3IO5A 1A27A 3RSCA 5A5EA 1YA4A 1OJ7A 5F9FA 4JR2A 4HZUB 4Z3KA 4I5FA 4KR7A 3GRKA 3UWKA 5E6RA 4B2YA 2Y0QA 4LF6M 3K0AB 3K09A 1WPXA 1Z5BA 4KPEC 2A5YB 4Y0VA 4B4OA 4UFOA 3OHMA 2NZYA 4J49A 3GEDA 3QJYA 4AJ1A 4NNJA 3PQ8A 3ULKA 4IJFA 1MTOA 3OIGA 1EVJA 1ULTA 2EG9A 3JQ9A 2PA0A 3FGOA 3L1HA 1XHLA 5EJ2A 3UXEA 1AE1A 1JEAA 4MHTA 4QFDA 1LY1A 2XSZA 3DD1A 4RKEA 4QNMA 3PJFA 4IILA 4AQYB 2R00C 1VE3A 2YZ7A 1TAGA 1OJLA 6GPBA 2WIGA 2Q2VA 1XDBA 1JAZA 3VQTA 2NO7A 1JG3A 1FNMA 1XZQA 4GQAA 4EX6A 3ROKA 3TAXA 2XUJA 1WCIB 1TC2A 5CGZA 4BNUA 4MS4B 2AOXA 2PL3A 3ELDA 3OZFA 1HTBA 4D96A 4PZLA 2CNWD 2HQBA 2H06A 4C4ZA 2FE4A 4H2DA 5HEKA 1V5FA 3ZV5A 1Z17A 3HA5A 4P0PB 1IHYA 1N36M 1Q1GA 4MR8A 1L5OA 4QPCA 3GZNB 2JFXA 2L69A 2JIRA 5F12A 4DGQA 5ALXA 4YMIA 3PFIA 4CGYA 1XYGA 3QU5A 3L8EA 4K28A 4GWKA 1ZV1A 3UBMA 1E77A 3IXLA 1K7YA 1S2LA 5IS2A 1GCIA 2EFJA 1T9AA 1VDZA 3ELUA 4OI1A 1T3SA 4PVCA 4JP3A 2QRPA 3R74A 3HA3A 5HQTA 1M6HA 4F6LA 3VBEA 3L1KA 2EC5A 3GJ3A 2BRUA 2PR2A 1GZ7A 3NIWA 5CH8A 2Z56A 3PKIA 3N0WA 5H3HA 5C3UA 4K6HA 3NO4A 3A1CA 3UG7A 2O1XA 2QVLA 2IZ5A 4E5SA 2XUAA 4F11A 4WOKA 1R4NA 3NWLA 2NUTB 2WPDD 3PNOA 2Q5FA 1C3JA 4TV8A 4WQMA 4MVJA 1KDRA 1EAMA 2R45A 4HWRA 1G8YA 2PD3A 4AO6A 3RNLA 3MWEB 3QQPA 4KYVA 3GAFA 2AZTA 3ZWYA 3HBNA 3VR6D 4LI3X 5EAIA 1QQBA 5F9HA 4K87A 3D7MA 2OQ2A 5BYAA 2FPLA 1CE8A 4DJTA 3ENKA 1JG4A 4IVNA 4UJ3A 2NZVG 4C03A 4M1MA 3RE1A 4JK3A 1O94C 2IHTA 4IRXA 2PG3A 1G8MA 4RWEA 4IBDA 4M9SA 4RXUA 4ZZIA 3UB2A 2BPOA 4GMDA 3T15A 1PJ8A 2PZEA 1JB0F 4YPOA 1IHXA 2FOIC 1BDJA 4PAQA 5T41A 2XMCA 1V1JA 4TQAA 4YS6A 5JH7A 2R8BA 1YIAA 1MXHA 1FK8A 3UA3A 3MJVA 1BJKA 3WI7A 4F7WA 1JYSA 1JNXX 1H5NA 2OR3A 4FYWA 4MIYA 3ELBA 2PZFA 5KYUB 1ESZA 3EOBI 3UK2A 2WG0A 2Y0PA 2FDXA 2QG9A 1PR0A 2IYWA 3W9UA 1WQ3A 3M5CA 4AAYA 5FOVA 2GO7A 3EUAA 4DDUA 2EWVA 1MLDA 1WSAA 2CXNA 5BMOA 3K3PA 2FG5A 3K9NA 1XZJA 1OIVA 4JYCA 4GZLA 5AM4A 4ZYZA 1PX2A 4O2BA 2VBIA 4BBPA 2DFDA 2YH2A 1BC5A 2KI5A 4Z3OA 2H29A 2H9IA 3WK5A 3KOXA 4LF5B 4CV3A 2XADA 2BEKA 1MU5A 1T5IA 4PG4A 1NXPA 5KZMB 3ZHXA 1T2AA 4IJKA 3H8JA 1DQSA 2DUUA 2OCIA 3ZE1B 4CMKA 1IUPA 4BMNA 3OEHD 2VRCA 3QPVA 4LFAB 1BKSB 3BGDA 3GLHA 2A35A 3EC1A 3V3TA 1JX6A 2WMDA 3DAFA 2FLWA 1J1UA 3A4NA 1S8AA 5IARA 3GBSA 1GSAA 4CXMA 3TW0A 2CKDA 3ESBA 4OLAA 4R9NA 2YRXA 1RBYA 1OWOA 1AQNA 1G5QA 3JYNA 1ONNA 4K6GA 5T57A 5C1OA 1XZNA 1QH1A 1TPYA 1IBKB 2D7DA 5AW4A 3D1VA 3Q5EA 2VJQA 4QJ5A 2ZPUA 1YVPA 5GONA 4KRFA 4IPTA 2R6R1 5IRCD 4H1UA 3X1XA 1UINA 3AFOA 4QAQA 1NXXA 1YASA 2IEBA 4W1SA 4C4SA 2WNSA 1LKZA 1H5UA 4J7AA 4RL6A 4BQRA 1J9EA 3KQMA 4DZTA 3WDSA 1SB9A 3V76A 2XEXA 2Z08A 1BXZA 1K86A 1W29A 2X0NA 1DWUA 1PG2A 3C3JA 2TMGA 3N3BC 4X8MA 1PD1A 5C3MA 1K5PA 1YS4A 3EWAA 5FEMA 1GTVA 3DC7A 4IS2A 2K87A 3DDZX 2LV8A 2FWIA 3A05A 4F6CA 1TM2A 1KFKB 2OFPA 4X61A 4A8TA 3DFZA 4HLCA 1HLGA 2R0QC 2QRUA 4COOA 4RM2A 4IOMA 3EZ6A 1T8YA 2CEKA 3ZCSA 2ENUA 3WRYC 5JCJA 3UB4A 2Y1CA 1W47A 4R16A 4PS0A 1EE2A 4PQFA 4IY1A 2GF9A 3JAKB 4EZIA 2VK1A 5DV9A 4C0QC 3T7IA 2HV8A 3QEAZ 3UYKA 1KFEB 3HX3A 4TKLA 4F6RB 1TA9A 3ZDBA 1ATIA 3HB4X 4NCAA 1QH8A 3FSRA 2PL5A 4RENA 2YHAA 2BUAA 1KMMA 2JZCA 3HCEA 2VO1A 5EOVA 1Y3AA 3NVDA 2DQKA 1RYFA 7YASA 1G16A 5COQA 4IQ4A 4V1CI 4WI1A 2D7HA 3IE1A 4TVBA 3OVMA 2MYTA 5BUQA 3RVOA 4B5LA 4JLPA 4K2AA 3OC6A 3THYA 3PPVA 3E0XA 3UQZA 4MVXA 1SWWA 4BUZA 2RIPA 4UULA 4WP2A 1M8JA 4C43A 2Z6VA 3AT1A 3WHIA 5EERA 4F2WA 2RHTA 4OHRA 3BRQA 3WNZA 4BIIA 1RLJA 3F96A 1N2HA 5C4MA 3DMYA 1OI3A 4IIUA 1ZJJA 4AJEA 3T5BA 2Q50A 2XBMA 2HEGA 2OUKA 4H17A 4R1OA 4JYBA 3AR2A 2OBFA 4C29A 5E6SB 2VH2A 1Q50A 2FPIB 3HHYA 5CG2A 3HFGA 1K1EA 5DGHA 2G9NA 1V37A 3D4IA 1QVVA 3F3SA 4OO3A 4UQOA 4PHHA 4HQ0A 4PZ0A 4H16A 1MRZA 1H9BA 4ZWNA 4MIOA 2FPPA 8CATA 3SOZA 1E2NA 3ZQ6A 3LW5F 2FRDC 3QVXA 3AUTA 2DI0A 3ABRB 1RTKA 3HBFA 3KM0A 1U2GA 2XGSA 3NBQA 4KV7A 1T5DX 1T15A 4ITRC 3RS7A 1NRWA 3O38A 2JA2A 4DRXB 1PZXA 4FDTA 4L5CA 2DR2A 2XY4A 3U9LA 4BNDA 3DUFB 1L1FA 2JGFA 1IQ0A 3MT9A 5IBRA 5DX8A 1JDBC 3HCRA 3QFCA 1J90A 3LCRA 2HIMA 3THSA 1EAYA 1MHPA 1UOEA 2B83A 2ERYA 1X80B 3E21A 2FB9A 1W4RA 5CNMA 4EUEA 2JW5A 1IK6A 1B1CA 1ZMTA 4LCBA 5BW5A 3U6OA 2C2HA 1QWSA 3EULA 1Q7TA 1L7RA 3TLZA 1JR3E 4B6PA 5GY7A 1M2VB 4GVLA 5EI5A 3AVOA 5ALLA 3EY9A 2B8TA 1KJYA 1YBHA 2E3JA 1M0SA 2P30A 1LDMA 3KOWA 1TW2A 3LUCA 3GMSA 1HDGO 5FOXA 4WZBA 3IR7A 5A0FA 1V4BA 1KO4A 4DDHA 5ITZB 3TSYA 2G72A 1C1YA 5AI9A 1MC4A 4RH0A 3RGPA 5TSDA 4GF5A 3LWDA 1SULA 3AY3A 5HK9A 4OUDA 3TO5A 1DX4A 3QM1A 1YKFA 4I14A 4I9GA 4XTRA 1CVRA 1OZAA 3EXEA 3QV2A 2YWHA 5K9ZA 3W4JA 4G1CA 2MSEB 2XCSB 4W7HA 4XBOA 3QE2A 3AXSA 5ALPA 5IEBA 4LDNA 2ZWMA 5KC8A 1B0AA 5KNLA 4C0XA 1CQPA 1YU9A 2EBFX 4R68A 3ES9A 5GPBA 1P5RA 2I33A 3HACA 4OGWA 3QW4B 2Q3CA 3VZBA 3C6QA 4HG2A 3I3SR 3SHFA 3QE9Y 4R3NA 5LP6A 4Z1MA 1E1RD 5EEGA 2FF7A 5FORA 2W6QA 1KIFA 4OFXA 4QVGA 3KUUA 2FV8A 1KP2A 3MJ4A 3IL2A 3M2TA 5KNCD 3LBIA 2J5BA 3KPWA 1VHWA 4HPJB 3EEYA 3FTDA 3VYSB 3LQYA 3GQ5A 2C8LA 1Y82A 2FPMA 2HN9A 2WV9A 2RHBA 1E7SA 4UDXX 3GWZA 5F4ZA 4AICA 2AUMA 4NRDA 3KEFA 4L15A 3N8DA 3NGMA 2IZ7A 3PGLA 2GESA 3MWGA 1AS3A 3NDBB 2N75A 2X2FA 2JDIA 4XIIA 2Q9BA 1PZFA 2OECA 3U09A 2ODPA 3IP6A 3S2YA 1VLVA 3COPA 4JVMA 3VR3A 3PPWA 3ILSA 5K4AA 2CDNA 1OI2A 4R2LA 3FIJA 3H5LA 2VT3A 4RTKA 1GDTA 2IDJA 4Z1OA 4CCSA 1QP0A 3MRXA 1NMEA 1KYXA 5ABPA 4HN4B 3N70A 1MG5A 1JE0A 2J3QA 5TT0A 1FX0B 4WDQA 4L4UA 2XQFA 3EASA 3MQ4A 4Q48A 3NFYA 4EPYA 3OPYI 5I7HA 1R0ZA 2DE0X 4HFJA 5KNDD 5B1DA 1CIPA 4R0MA 4PSVA 3H3XA 2ZT8A 5BYJA 3VZSA 2UYHA 1DL5A 2VPTA 4L2IB 3WNBA 2X9QA 4N5HX 4WKPA 4JI8B 2RONA 4FC6A 3WQHA 1BA2A 4LISA 4FBLA 3UWDA 1D04A 3GGGA 5LKAA 3B1KA 2X77A 1AHNA 1DDGA 4PFJA 4F8EA 3PNBA 2R8XA 3BXZA 3FDFA 3IV7A 4UD2A 3TBKA 4I4NA 1GRQA 3KXLA 3JQ8A 5GGYA 3EHDA 1ZESA 3L40A 1T35A 1I1OA 2ZE6A 4N40A 3H8WA 2INGX 3A26A 2C2OA 4K40A 4B7CA 2IYZA 2V6FA 4WXHA 1UDWA 1MX0A 3F3YA 2P67A 1I7SB 1DJPA 2D62A 3HCPA 4ARCA 4BMZA 5BN5B 3UV7A 1C2YA 4OVZA 2CL6X 3HVUA 4XYMA 1YQQA 4Z2YA 2GO1A 5COBA 2XMBA 2H0AA 5H16A 2NTJA 3EVFA 1KI3A 2QN7A 5CCBA 2OZEA 5H3CA 3E4DA 3AY6A 1MGPA 1UH5A 4G89A 2O8FA 4D4GA 4K3VA 4M9RA 3IMGA 1NQUA 3EYWA 3R8FA 4DR7B 4P4LA 1L4FA 5EYPA 3V1UA 5CDGA 2Z09A 2DY1A 1LEHA 1IBSA 2GNAA 1QHHA 3Q85A 3VKHA 4OKNA 4RD0A 5HQJA 4YJHB 3FZNA 1CQJB 3D5EA 5LYJF 4XFDA 4Z8YA 2ZYRA 5KTTA 2J3DA 5IBPA 1Y7IA 5K20A 2DAKA 3QTLA 4CV0A 5D86A 1JALA 4OBWA 3QZUA 5C7OO 2A88A 2EG5A 3OF5A 5H3LA 2AOTB 3R9XB 4ZV4A 1OFTA 1LLUA 2X23A 2ZUWA 3O94A 4AY5A 2C07A 5YASA 2O1SA 4AZTA 1II0A 1D2CA 3A14A 2J0UB 5AK5A 2C4VA 4M8IA 3NR2A 5EJMA 4JB3A 3HO6A 2H92A 4J0KA 4ZMSA 2B98A 4KR0A 3DDNA 4PLZA 1GPLA 1KGSA 5JY6A 2P9GA 2ZE5A 3LVRE 5A2QA 4H7DA 1ZA1A 1VE7A 3EIOA 5J47A 1ZOSA 1SUFA 2NPIA 1UWVA 4EJFA 1EFHA 4G0UA 4FEYA 1H2XA 3WMRA 5BT9A 3VZRA 4CU5A 2Q4DA 5DNVA 2R60A 1LNQA 3CZMA 1C0EA 5MN5A 1AURA 1KJJA 1WZUA 2QZZA 1JL3A 2A3NA 2P6NA 1JWLA 1AS0A 1R6AA 4OOFA 4F4JA 5IN5A 4OYHA 1NN3A 3B7NA 4WCFB 3AV0B 4QTZA 3ON5A 4D5GA 2CXTA 4FBMA 1EFAA 3ZE9A 1ZD4A 3K5IA 1W0CA 3QWHA 5BQ3A 4LOJA 4MRVA 2YV5A 2WUDA 1OSNA 3H9EO 5HYVA 3AY0A 1XEWX 4US2R 4YCLA 3HWWA 3NETA 5LQRA 1JQEA 3I53A 4QYIB 2GQ0A 1C1DA 1AQ6A 2JIOA 5M04A 3N2ZB 3UJCA 2BP7B 3W9SA 4KR2A 2FSVC 4U02A 2I3DA 2WUWE 1YJ8A 3REFA 2EGUA 1ZH8A 2CWDA 4BFUA 3PQFA 3T7CA 2WAYA 1ML4A 2J3KA 1F8XA 2JCXA 1BDIA 5F3RA 3G88A 4QPDA 1GGMA 1Z0ZA 5FULA 1DAMA 4UUNA 3M1LA 3FIUA 4XUCA 1NVUQ 4S2UA 3T8YA 2FWAA 1XJWA 3HYNA 2O0LA 3RRYA 4QHYA 5JV5A 1SXQA 2UVDA 3WIBA 4K9RA 4R2XA 4HGNA 4UM9B 5AJTA 1VLJA 4WACA 2DT5A 5SYAA 2B1IA 2PUJA 4G3XA 2P6OA 2R1ZA 4DG8A 4Q4JA 4RJ2A 2CE2X 5DTEA 1OLXB 3KTDA 1IU9A 1EUCA 2P4EA 5EG5A 3O1IC 3HKPA 1ZLYA 3SLKA 3MC1A 3A6PC 4LF9M 1JIKA 3NKFA 5I9LA 1OI7A 3U0BA 4Y6SA 3RFCA 1FBTA 1KJNA 4W63A 3FWZA 4WN3A 5CURA 4J1SA 1RM4A 3WIEA 2REBA 2HK9A 3ETGA 3N39C 1X39A 4D9MA 1SGWA 3OICA 1QOZA 1WDTA 4E2WA 1UM9A 4LIPD 3AF3A 5CT5A 3E7PA 3G2PA 3GLRA 1T2CA 3SF8A 4QOHA 4DLPA 3GPDG 3NP7A 1PK9A 1NHWC 4OHZA 1DT3A 3U26A 5CH3A 3OUTA 4ZO9A 3V8PA 3IAM6 1MOPA 2HQOA 3A4VA 3EXG2 1HRDA 1CLUA 3ZHTA 2HH9A 3GNTA 1PO7A 5C4GB 2J4FA 1V8FA 1IFXA 4ZHQF 1LSOA 3V8QA 1DQYA 1ZEMA 2W8BB 2ZKLA 5JNUA 4FZVA 4QLOA 3U17A 3WADA 3GXOA 3SDZA 1SZDA 3GLTA 1XU4A 4FEGA 4EJ2A 3HFSA 4B76A 3KT0A 1O96B 4AULA 1KH2A 4Z4CA 3O9VA 4OA5A 2OFXA 4W5RA 5BSTA 1LRKA 3UMJA 2OGWA 4PBSA 5TQVA 1P9LA 3IIEA 3U61A 4I50B 4G01B 1CLEA 3G2LA 3SYRA 4FYVA 1KPIA 4R8LA 1CUFA 3Q9SA 2ZDGA 4QRHA 4CQNA 1C8KA 1OVGA 4TTAA 2QZ4A 4AJIA 4P3PA 4TSRA 3U7RA 3FNBA 1T10A 5K03A 5IT0A 3E22A 2BGNA 4JCOA 4RJTA 3SZGA 2RHLA 3U3RA 4ND1A 2K6GA 3IUEA 1ZUWA 1W581 4UDNA 3ADOA 3SR3A 4B9EA 1RWBA 4MVJI 3CS3A 3N53A 2ZUVA 1CZOA 3IT1A 1UK7A 1WM1A 3F9IA 3LPCA 4YP0A 2I6QA 1OAKA 3V4FA 1E2BA 5FUVA 5BVGA 2VHWA 1G3UA 4CL8A 5C34B 2ZSIA 2QPAA 3ZLTA 5BUCA 1TF2A 4NEHB 2Q1SA 3EODA 1RYMA 1MUUA 2WSMA 3P0RA 2G76A 3GZ4A 1VB3A 1T9DA 2XWSA 1YLAA 1IPHA 2WJJA 1USUA 1Y80A 4UZFA 4MRPA 4NLLA 2GHIA 1U7DA 1BCSA 3V7YA 2JK1A 5REQB 1DV1A 2AG8A 2QZPA 4MDHA 5LQDA 4RFSB 1SU6A 2JI4A 3KJEA 4L7QA 1TJNA 4RCZA 3OLVA 1N8SA 3DMTA 2QNJA 1VE6A 1J8MF 2DTXA 2YWCA 3UHAA 3T94A 3PPIA 4KGXA 1MDBA 4GD3Q 2F64A 4XYGA 1MZVA 5HCUA 3CLUC 3TX2A 5G1PA 4MXDA 3WWEA 1YGPA 5JSZB 5JS7A 1J0EA 3VHRA 4EECA 3NHLA 3SIRA 4C87A 1P1IA 3SHGB 1XK6A 3VNRA 4EG5A 2E48A 4ENVA 3ODGA 2QPLA 4DILA 4V39A 5CFMA 2W2MA 4DC9A 3LXMA 3WGMA 5BV1A 3AJRA 1HNWB 1Z37A 4KXFB 3W78A 2I4NA 5EWLA 1II9A 2GXUA 2VDVE 4NBUA 2IJGX 1ZGGA 3BL5A 4GPZA 3SQOA 4OP3A 2A92A 4PLTA 2RHWA 3PFKA 2HCTA 2ZXFA 1JWAB 1VYTA 3DOHA 4JUFA 3A4MA 3ISJA 5FWNA 1Y33E 1OZ0A 3UNXA 2F43A 3DTVA 4YRDA 1NIJA 2XMDA 2C5RA 3AVPA 4LQCA 4KQWA 5KHOC 3IPLA 1COZA 4PC6A 1CCWA 1FLDA 4BLOA 1SOMA 4BAZA 3NAQA 1OGJA 1ECGA 1ZIOA 1U7HA 3K1ZA 1SKAA 3KV1A 3GF4A 1Z3CA 5HIJA 4LFBM 3WWDA 3SI7A 3JALA 3Q10A 1NULA 3CLKA 4FDVA 1EDBA 1JHRA 2H11A 3CGGA 5JUWA 3IHPA 1V39A 2W83A 1FUKA 1ZA2A 3SYMA 5B3LA 1NNSA 2HXSA 3R6WA 3CLUD 2PV0A 2DBVO 4NCKA 4PSKA 5FBKA 1CUAA 4RESA 5FTLA 4PAMA 3ERCA 3WKAA 5CA1A 1F4LA 1XC7A 1Q91A 3ABIA 3NT4A 3VH2A 1S2MA 4FI3F 1CF2O 2Z2ZA 4G0QA 4FC7A 4P53A 3M83A 4KDRA 4ARIA 1G8PA 1WHCA 1IBLB 1ODTC 2CLKB 2JUJA 1GVNA 2IH5A 1AKQA 3DVQX 1FP1D 1ZNWA 3Q7SA 4YMGA 2ZSAA 5B4VA 1E1QD 1Z25A 1T0IA 4QYWA 4OBEA 2FZKA 1WSBA 3DE0X 5IZ7D 1SJ9A 3FKQA 3DDUA 3SFTA 3WGJA 2R66A 1XNQB 3T3HA 1AF7A 1DI0A 3H9QA 1P0QA 4FQ8A 1E32A 2V7GA 3F5SA 2H6EA 1MO4A 2C3PA 4CF6A 3RODA 5DT2A 1INLA 5KCMA 1QQ7A 1OWMA 2HLDA 1P1HA 5DCYA 1C8LA 4HDMB 1NBEA 3PVSA 1TDZA 3CN7A 4UC0A 1QG4A 2FPGA 2FR1A 3WGTA 3DCNA 4R1QA 3WMWA 3GLFE 3K2QA 1CIJA 4BE7B 7REQA 3N6VA 2DWMA 5IJWA 1X7WA 3U3DA 4U1RA 2PGJA 5ELLA 2RG7A 1QR2A 3AF2A 2XXAA 3TFQA 3KQWA 1TF5A 4CLDA 5A06A 3HNOA 3GLGB 3LS2A 1FPMA 5DCLA 3IV6A 2Y66A 3SKYA 4PG7A 3MIZA 4KLRA 4D82A 1NE2A 3WLFA 3R6LA 2WKPA 4UCFA 2HWKA 1FFWA 2IH4A 5DI3B 1RBQA 1N9KA 2WFZA 2FQYA 3PSAA 4IINA 1RFLA 3R7LA 4Y2RA 4D02A 4PZUA 3ORYA 4FWHA 1DX6A 4R9UC 2QY6A 4RL4A 2R8ZA 4IUBS 1NUTA 1QGZA 1ORVA 2FW6A 3OECA 3M3PA 4MIKA 1KNQA 2I6SA 2H2AA 2B61A 5JXWA 2Q1WA 2UZAA 3JRNA 3T0GA 2AFRA 3DWFA 1LDYA 5IKMA 3S2ZA 1TLFA 5F7JA 1U3WA 5IH3A 1XZEA 4FYIA 1N5IA 2M32A 3IGFA 1DLIA 1YQUA 3ISTA 2FU5C 3RBZA 1XQ6A 1YOVB 3GBVA 4HEA6 1K0UA 3DAOA 1KPHA 3M7IA 2J41A 2GJSA 1AKRA 3UWMA 3B1ZA 5L3QA 3UXMA 4RHTA 4P22A 2C96A 2IHZA 1P7WA 1UWLA 5JXIA 2FR8C 5E8RA 3G49A 3B3JA 1RM3A 3IEIA 2OORA 3TSOA 1WPGA 3BXPA 3ETLA 2UZ4A 2L17A 2X1VA 5KTOA 3KYJB 1H6CA 2YIDA 1K8ZB 2XYQA 4KH1A 5IU6A 1OYWA 4C30A 1A7AA 2OMKA 3DA1A 5A4DA 5ESRA 4KI0A 1E69A 2VDMB 4EDFA 5CVDA 1V7PC 2O3RA 5KNBH 1WLYA 2P78A 4F3TA 4DC1A 3KLPX 3GCGA 4MUIA 4WCVA 2EP7A 4C0BA 1GTJ1 5JSFA 4M76B 5JFTA 1MAAA 3M3HA 3IAEA 1HFWA 4QJ4A 5FYQA 2X0RA 5K3CA 2PLWA 4BTVA 3ZJTA 3CA8A 3KNZA 4HV4A 2XWQA 2ONYA 4OGGA 2ODEA 4MGIE 1Q92A 3VK7A 3TQQA 2YOGA 1CTQA 1BE8A 3WAJA 1ISMA 4Z7OB 1EJ0A 3SK0A 4MQFB 3L18A 1BHO1 4BS9A 4AS3A 4CF5A 4GRDA 4GWGA 1YZVA 3TR0A 1EFDN 4MMZB 2CY0A 3EEQA 4KAXA 3OZBA 4URFA 2H2IA 1XHFA 1CW2B 3LECA 3CO0S 3D3NA 3IJRA 1M1YE 3KSRA 2RHMA 2LNDA 1UBGA 2CFTA 2XRZA 1VJ5A 5EZQA 2OFOA 2OL4A 1HT3A 2ZEJA 4FK8A 4A8JA 3LHFA 4QTXA 2IY7A 1QLJA 2XUHA 3H4IA 2QUAA 3B9PA 4YEDA 2CL7X 2QZSA 5IJXA 2I3GA 2R6JA 4CMJA 4J03A 3O75A 1RRGA 4JL6A 1O97C 4DV5M 1R9JA 1NSFA 3Q3GE 4BLCA 4HSEA 3I76A 1JI3A 2C9ZA 2J7PA 4X91A 1O87A 2CT8A 4QG7A 3Q7RA 4IXDA 3FDXA 5IXYA 3X1WA 4WJKB 1DXHA 1N34B 1K97A 1XWFA 1X7ZB 3QNUA 4JYAM 2DLCX 3D7KA 2ZWPA 4MKIA 2G9QA 2RJOA 1Z56C 3RVSA 4ZXPA 3AF1A 3U6EA 1RBZA 4OHVA 3E48A 4LF7B 4IWXA 2Q2OA 3HH8A 4P3OA 2FEPA 3F7NA 3OZWA 1GARA 3W9YA 5HFNA 1DGBA 4B74A 1G3MA 3LY7A 3FR7A 4H1TA 3GC6A 4TUYB 1YR3A 1Q7GA 5EHXA 1SXJD 2NQ8A 2UU9B 4AMUA 2LTAA 4TM7A 2AG5A 5AM3A 3RK1A 4Q9KA 1IWPB 1CG6A 3X2SA 5AK6A 2ZI6A 3QWFA 3EC2A 4JI5B 3DKIA 3LCUA 1XKTA 5JAHA 2IGTA 1T2FA 3FUWA 1EH5A 1E9CA 1YIOA 3BPSA 4AECA 2JIBA 1KMIY 4PTZA 3L4BA 5G0VA 3KQYA 4LTMA 3ZBPA 3GR6A 5CPFA 4ISBA 2AG1A 1Z8FA 2ZVJA 2CNKA 1VJRA 3A3KA 3V9PA 1TM4E 3I6MA 3OFKA 1GP2A 2FW1A 1DSSG 4QYXA 1WTCA 3D8TA 2ZXUA 2Q46A 3VUEA 3DSRA 4V0ME 3MT0A 4B3DA 1HDCA 2VHEA 3PXGA 2C88A 2QMQA 4J1NA 1PHRA 3KX2A 2QVBA 2FWBA 2V6ZM 4R1UA 3QJ5A 1O08A 3AEQB 4IEEA 1YVRA 4I36A 3CIFA 2AL7A 5DF1A 3W2GA 3KTAA 3BWDD 3P9SA 2P5UA 2NO5A 1OKKD 2XR1A 4Q3OA 4YRCA 5AD1A 3QWIA 4JMPA 3O2QB 4LV5B 5DHSA 4ZARA 2J6HA 4PC7A 1R12A 4JROA 3PHHA 1H2YA 5LB2A 5KNBA 2BFOA 3VGPA 3GJYA 3IDOA 2UVPA 2ECQA 1CUXA 2AFIA 3C1UA 2RCNA 3FYTA 4CM6A 1TDHA 1Y1SA 2PX6A 2B78A 1EHIA 3R24A 3U6MA 2Q9UA 4X44A 3RUAA 2XOKD 4K9NA 4ALIA 3HCAA 1TF7A 5K1ZA 4Z5XA 2FMFA 2PMCA 3TNFA 5UKDA 2DWOA 5D6NA 3I04M 2M5ZA 3I9MA 1LA2A 5JG7A 1SR8A 4YJ3F 1X8KA 4GMGA 5AKGA 5A1JA 3NOVA 5KYNA 3BG5A 4HATA 3PX2A 2LBCA 5BNWA 1PT5A 1GL3A 1W5FA 1TYCA 3TLKA 3VPXA 4QTYA 3N28A 4CLOA 4HQ6A 3EEBA 1G3QA 1DBRA 1L4YA 3UGTA 5JCOC 3I1IA 1ZC3A 1RMYA 1BXRB 3IEVA 4OFWA 5J3JA 1V16A 1E63A 2X4AA 2P1DA 1RI2A 3C41J 3FYUC 1C3OA 3TQOA 3GVXA 2CBZA 1C1XB 1U9IC 1E3QA 1PQ4A 4ND7A 1P39A 4OPMA 3RE8A 1VRWA 2VRWA 4M2LA 2ZRCA 4DQXA 2V55B 1P3QQ 1H1DA 3ENQA 3E1GA 5LA6B 4N3AA 3M5PA 3SMSA 3ZU6A 5AJYA 4D2IA 4HRAA 4ED9A 4BLPA 4JT2A 4Q37A 3IP3A 5D85A 4CL2A 1VCHA 4IYJA 1VXRA 3G9TA 1DOHA 1ZD9A 3D3QA 3W0LB 2D5IA 1QCZA 4MITA 2V7QD 3HRIA 4HUQB 2F48A 3S7TA 5EWJB 2ZYDA 4FM9A 1V3TA 5H83A 2QSYA 5LD2B 1PJSA 4GO1A 2GQFA 4DYVA 1GSOA 1OTXA 2ZUUA 1QCYA 1ST2A 3WB2A 4AC9A 3P0FA 4REZA 1TECE 4AP9A 1TK9A 3A45A 4MAMA 3GRFA 4AJHA 2XWJI 2ONZA 3NUQA 2ILVA 2GN1A 2X9LA 4RHCA 2WYWA 2HK6A 2OQ4A 3BB3A 1WBJB 1XRRA 2HSEA 3IOEA 1TW3A 5DYGA 2C2WA 5IBCA 1SC6A 3BMCB 3QFTA 2Y0BA 1GTL1 4JQYA 2WB4A 4BOYA 4I4LA 1ZRMA 4IIGA 1XMXA 4NCHA 3AI3A 4A0FA 3HJSA 3WL3A 1MOSA 4YGXB 2FY8A 3AEUA 3CGWA 3M2PA 4E12A 3NEPX 3NS7A 3FYDA 3TTVA 1SG9A 3COVA 4CEJB 4BLWA 3I09A 3ORSA 3MWKA 4E6EA 2CK3D 4OHOA 3L7MA 4OKSA 5K0GA 2Q28A 1YAJA 3GFRA 1EQUA 1C9NA 1TFRA 3M6XA 3ND6A 1YVDA 2P0EA 1VI6A 4KGDA 4GZMA 1DJLA 4MPTA 3TQTA 1ZGCA 4KQKA 3ICWA 5IEJA 3A10A 5ALEA 3ZI4A 3DOCA 1E3IA 2YY5A 3SBXA 4OL0A 3A1DA 4L4XA 2XDAA 2QI9F 1FX1A 3CLHA 1XDGA 2ODTX 3PLRA 5CD9A 2QRVB 3QNMA 221PA 3MB5A 4G4SO 2CWBA 1CVIA 1AUVA 2JFHA 3P9PA 3W7BA 3OIYA 2YWEA 2A2ZA 4FZ5A 3A1EA 1MIOB 3OE4A 3I6YA 3TIFA 3ZHSA 1DZIA 1KAGA 4QDZA 2G0NA 4W6QA 5A5GA 3KB6A 4Z9AA 1JNYA 4HS9A 3KP1A 4D25A 4TX1A 1U7WA 2BELA 3SEFA 1FC0A 2AR0A 1F06A 4NJEA 3KKLA 2GNPA 4YRAA 2WD7A 5HDQA 1WRBA 2AI2A 2AVNA 3L77A 1DPFA 3J2PB 3ZYCA 3REOA 2WHRA 4EW2A 1Z0KA 2ZTLA 2BF7A 4QUAA 4YJ2F 4LXHA 3JZFA 4TS9A 4I55B 3IR5A 2VT7A 2QTBA 3AF0A 4DWWA 3K6JA 5AWFC 3U44A 3GJ7A 3TZKA 2VZEA 3BAFA 3L0ZA 2BI8A 1ODSA 3F90A 1M73E 5CW1A 2EFYA 2HNKA 1OXSC 3B3GA 1DXQA 1JEQA 1YDGA 3I5UA 1ZCAA 3W2FA 1OILA 2VYVA 4YT5A 3V1LA 3CEHA 4DPLA 1ORWA 3DV9A 3DVLA 2DBRA 5HFAA 4ATNA 2OHFA 5IUJC 2PKEA 3RJMA 2I8AA 2SNIE 3CMCO 2IP2A 1GGFA 3WNCA 1ONBA 1PBTA 3S2GA 1N6HA 3O31A 2PS9A 1R2QA 2A59A 3BB1A 2ZQYA 4NG5A 3K9WA 2C92A 2BM8A 5CHEA 3PIIA 1QVAA 2RCYA 1AT1A 3T3OA 3T6PA 2KLBA 1Q2UA 5ITUA 4ZVKA 3MERA 2CMFA 2E89A 1JG7A 1Z7WA 3DMFA 4FJ2A 3BEDA 2YYSA 5H0IA 5G4LA 1W8DA 3EDYA 4Q4HA 3QUTA 3LVFO 3BWEA 2BFBA 3U1VA 1LBTA 4NZZA 1L4NA 4UEKA 1QHIA 2IP1A 4KAJA 2RHJA 1JH9A 3M0EA 3TK1A 5G41A 2OV2A 4XDHA 4GP9A 4JI2M 3CF0A 5LMUB 2AOVA 1XRPA 1PU2A 1NLMA 2QSUA 3EF3A 1D8TA 3JU3A 4IOKA 2HU2A 3D7NA 2WJ3A 4EJSA 2C97A 2EU8A 3IYLW 1HDIA 1E6WA 3EN0A 5K3OA 1LF0A 3HM9A 1FZQA 1T6ZA 3Q40A 5T7BA 3MD0A 4FOOA 1FSFA 3E9MA 4UAJA 3E9NA 5G0SA 4IF4A 5U9CA 3O03A 2BBOA 5FCDA 3RFTA 3G9UA 3STHA 5AVRA 3KQUA 2PM8A 4NFYA 1BAPA 5EMKA 1EX9A 1R4MB 2OBLA 4K0KM 1ZNYA 2AZDA 4YHHM 5TVKA 3BC1A 2HU5A 1AQUA 3NXSA 2WYIA 2GM9A 3BRCA 4RETA 3EGWA 2Y0DA 4M1SA 2XOEA 4P7BA 3UAOA 3MA0A 1LW7A 3A6EA 3UMCA 2BGLA 5C32A 4MLCA 3DWIA 3UATA 1EX1A 3ZVNA 2WSBA 4IXNA 3DVAA 4Z6KA 1VRVA 2HFJA 4TVKA 3TRDA 2QD5A 5AVWA 1RC0A 4PCLA 2P8JA 4PRLA 1AQIA 5AVJA 2AZ4A 2BC9A 5KHAA 6Q21A 5CT9A 1B74A 3JWGA 2HSDA 3G0IA 4P83A 1NYTA 2BMWA 2QLFA 3EXHA 3VPDA 4BO9A 3WRXC 3CNOA 1UK8A 1NASA 2ORYA 4ZA2A 2D0DA 4DCMA 2J85A 1HDXA 1GG5A 3UT5A 4ZQEA 4FUTA 4WXPA 1Y3FE 4QGBA 1TTEA 1X38A 3AKZA 3IP9A 4MGZR 1FL9A 1E9SA 1BRTA 4KQHA 1ZPDA 2C7PA 4MVYA 4EJ0A 2HXYA 4KUHA 2B8EA 2G28A 5E1MA 1JB1A 1MGOA 2KJQA 1D07A 1UKYA 2GJ9A 4W82A 3TPFA 3NC1C 3LDGA 3PU6A 1BZYA 2JEYA 3GMDA 2BMVA 1Y6GA 4II2A 1M7HA 3ZK9A 1L0BA 4CM5A 1FSGA 1J5XA 1MJGA 5FA5A 3DS8A 1E1LA 5TPWA 2HF7A 4QT0A 1VIDA 3DLHA 4GPAA 1B7GO 3EQ9A 4QFMA 1JPUA 1Q16A 3PRHA 1FJ2A 3IEXA 4HGOA 1UXHA 5J9FA 4ZI7B 1DQPA 2GI4A 5DSZA 1JHDA 4Q03A 3CLVA 4F9TA 2X8JA 4Q9HA 3DWGA 5DNAA 1CUDA 1WBDA 4E15A 3KXDA 1FFYA 1X9GA 3C5CA 4IR7A 3DAHA 1ML3A 1XK7A 4EQ6A 4R2IA 4HFNA 3V3KA 4ZAXA 2FQXA 4NK5A 1CNMA 2VYFA 2D5CA 1QK3A 5C8XA 2WJ6A 1UMCA 4B8YA 5EJAA 5JZSA 1MAHA 2LBPA 3LUFA 4LMAA 2NTNA 4EG7A 1Z7BA 3CU5A 4WOBA 2QUBA 1FP4B 4PWYA 2PX5A 3LP6A 5HK8A 3DT6A 4FIZA 4JSYA 3U4QA 4MRNA 3DDSA 5K3DA 1UMDA 4IGIA 1XZHA 1O89A 4BO2A 5HG0A 4Y9DA 1E2KA 4BNGA 1FNBA 1YTLA 4FDAA 4EBFA 1DPGA 2OO3A 3QEJA 3NEAA 4EKGA 3L7AA 1H69A 4NZYA 3OA0A 3M4JA 4OHKA 4EW3A 1OVMA 4NSOB 1BHSA 1SD5A 3GGCA 2LW7A 5I01A 1ILWA 1KJZA 4QQFA 4O4LB 3CC8A 4DVGA 2WHEA 3HZHA 2WPNA 3EJ6A 4N6OA 4A6PA 3WA7A 1HK7A 1EUZA 3QVMA 2NYVA 3LNCA 1VA4A 3R76A 2Z8YA 3M4ZA 5ECGC 3S3TA 5AHRA 3EZ9A 4ZYTA 1V8BA 4YCDA 4JV5M 1X37A 4TMFA 2DAIA 2NQTA 4K8RB 3H83A 5EIBC 2VPYA 4Z0HO 2REQA 1GEGA 1V3QE 4P81A 4F1JA 2ARKA 4B9AA 1ENOA 4Q7KA 1L4UA 3AIMA 1F2DA 4XZ3A 4XEUA 4FOLA 4GBJA 5KTKA 1UJ2A 1J56A 2FWJA 1OD6A 3D8BA 2YS6A 2GEFA 4YQFA 1UWCA 3ANTA 1W2GA 3VZDA 2ZRIA 2ZM6B 2IKSA 1XJQA 4ARSA 1DBWA 3SQDA 3X1YA 4B0PA 5DN6D 1NVKA 3ZW7A 1AZTA 3DV0B 3JSAA 3X2FA 1HETA 3LYUA 3N0VA 1PYOA 3QK7A 2AT1A 6REQA 4XX1A 1YR9A 3ZIUA 2P90A 4C4YA 4CIZA 4PZAA 1UPCA 3JQBA 2ZAMA 4P32A 3IUBA 3A7DA 3DG9A 2W6ZA 3T9FA 2JIZA 2QN2A 2ZSBA 4MB2A 2EX4A 3ONNA 1Y3BE 5JQWA 5JZOA 2WTAA 3GEBA 1UOPA 5B30A 5JPDA 1ID1A 3QV1A 4YQZA 1N5RA 1I4TD 2OILA 3IQZA 5ITXE 2NV6A 1WO8A 2CV1A 3VSAA 2VP4A 1K98A 4ETWA 4CTMA 4RWZA 2RKBA 2YVAA 4KI7A 4CV1A 4ZU6X 3EIWA 4QICA 2WYUA 2FN7A 1SBNE 2G08A 3C8DA 3UAXA 5EIBD 1BYUA 5D3MA 2RK6A 3AVTA 3VPFA 1N2XA 5AK3A 3VYTB 2PUAA 4CKYA 3FHLA 1Y6QA 2QL9A 3HR8A 4HO1X 2D5AA 4LYYA 3GNSA 1ZOIA 3GG2A 3Q9UA 4FWBA 5JBIA 4MEJA 3HCWA 4QD3A 2K47A 1L6IA 4BE4A 4JZYA 1O4WA 4UHBA 1SA0A 3L6DA 2O7NA 3JYPA 1QUSA 1AK1A 1YVUA 2GAAA 2H7CA 4D98A 1CERA 1J5PA 5CX1A 1KZ6A 3EQZA 3WXBA 5I8PA 3ANNA 4U7JA 2LDBA 5BV8A 1CPYA 2WKQA 2PDAA 1DO2A 3F5MA 4KMOA 2HSWA 1JR3D 4JA0A 2LHCA 3S27A 4XUEA 1ICEA 4PG6A 1DAPA 4XB1A 2MR6A 4YN3A 1ZITA 3NXKA 3Q0EA 2ZZMA 4FWTA 3SJ7A 4ZYYA 4RK1A 2HMYB 3QPAA 1T3GA 1TLTA 4YRZA 3IG5A 4PSDA 3K1AB 2C5LA 1PJAA 2HU8A 3TFOA 2DF8A 3GEMA 3EGDB 1KC1A 1SQ5A 2Y77A 2IZ0A 4QJIA 2XB9A 1RNLA 3TBFA 1YDEA 3WMGA 4LA4A 4M0DA 3HBLA 2G1JA 1ZOPA 1I80A 2PFSA 2P9JA 3N74A 5F78A 2AE2A 3RRBA 5AW1A 1C0IA 2OGTA 4DYDA 4XGIA 3WZMA 4H77A 4CM8B 3BRWD 4IDPA 4LW8A 5KI6A 2N35A 1OBCA 2QD4A 3ZNOA 1F2UA 5KJEA 4K26A 4LZNA 2CJXA 5LQNA 5FBWB 1A9OA 4GYWA 3M1AA 2ERCA 1M6YA 4KZPA 4G5RA 1M8FA 3EGCA 4X1KA 1KRWA 3PTAA 3FDZA 5GZ3A 4BECA 4AJJA 5C1DA 4M4SA 5C35A 4G2NA 1U3DA 2GEJA 1UPXA 1PJLA 4RD1A 5KTYA 1VLLA 1E9AA 2NSLA 5E4FA 1RP1A 3EQ6A 1VEJA 1ESCA 2PUTA 2Y1EA 1L7NA 4RVHA 1Q7RA 2EZUA 3ZUGA 3PF9A 1Y6JA 3I0MA 1HGXA 4KFUA 4NE9A 4YYEA 1QAOA 3BMNB 1OX6A 1ZK4A 1SUEA 1YSCA 1JDVA 1WDLA 5ALOA 4TWRA 1JZTA 2R97A 4FE4A 3T54A 4J9UE 2EBUA 4CM9A 3C5HA 1FW6A 3L6EA 3ZNPA 1YE5A 4JUDX 4X3PA 1A8QA 4WZAB 1M2JA 3IRVA 4HDOB 3ZHYA 3KLMX 1NUQA 3KKKA 3DR3A 3B36A 2COUA 3T5DA 1BMFD 4DLBA 4FFWA 4XR9A 1BNCA 2BFFB 2SHKA 5AHXA 4FYMA 1OAIA 1XRQA 3L1UA 1RXYA 2QK4A 2F5PA 1VECA 4TOIA 2B2CA 4IJ5A 4BVKA 3IBFA 3V97A 1Q3KA 2IIQA 2ZJOA 3P9RA 1GNSA 3I34X 4JLUA 2ESRA 3T7AA 4X8LA 4UNQA 4XD2A 4H27A 3ZXXA 4KOEC 3UF0A 3ZX4A 3H0EA 4C7OA 5ITQA 1MA0A 5JPCA 1ZP6A 1H3FA 3MCZA 5C4IA 3FGZA 2EX1A 2NV0A 1B6TA 1UBRS 2FW7A 6NULA 1ADCA 3F6RA 2PAFA 3T9AA 1IBMM 1U0NA 2W0SA 4GM1A 4BVHA 2GAFA 1QCCA 1ZOOA 4TL8A 4LNUA 3ANMA 1E5VA 3B5JA 1CB0A 4LEIA 4FCTA 4KMSA 1ZD2P 2B4YA 3L26A 3WNQA 2HUNA 3VX3A 3BWVA 4OJYA 4BO6A 3PV0A 5HCNA 1XCOA 4F5DA 3P94A 4N54A 5KQDA 3W8NA 3BGIA 4BJ3A 3BCUA 2Q6LA 1UFVA 2R25B 1VDMA 1F17A 1IHPA 4BB5A 4NYIR 4JGIA 5IZ4A 2WF6A 2OPHA 4EF4A 1EB9A 2H31A 3MFQA 1AKWA 1KOLA 2ORIA 3CNBA 5KJFA 2FX2A 2ID9A 3PX3A 4BVGA 5CIWA 1IIRA 3EZ2A 3LAWA 2D2FA 1T13A 3BREA 3EMDA 3NWPA 4JB8A 5L8VA 1Y4DE 1B8PA 1RHMA 1ZH6A 1NRIA 3QU7A 2RBGA 4MV4A 2VNAA 2SBTA 5F2OA 2CKMA 1TU3A 1XA0A 1TVMA 4NOKA 3QG1A 2X4DA 1J97A 4FHFA 1GU1A 4PFKA 2ECFA 2JAHA 3ZWPA 3T7EA 5CNKA 1A9XB 1J2YA 2P9CA 1EJ2A 4ND8A 2NUPA 4BX3A 2R62A 2PFKA 2WAXA 5I4CA 2VH5R 2XRMA 4KXXA 4A7PA 2JHPA 3GD7A 1R0KA 3LT2A 4LS3A 3NM4A 4C07A 4Y28F 4YRBA 3GEIA 1Y8RA 3DL7A 3I58A 4C6TB 1N2BA 2CLEB 4Q4CA 4FT4A 4CM4B 4QG3A 3NHBA 5DVZA 3ICCA 1QH9A 2HBQA 1O57A 2XTZA 2DFLA 2REOA 5J4VA 4AZ0B 4YGYA 4M1KA 2DFVA 4Q12A 2IK8A 2GCOB 1QUEA 1LXCA 3C6MA 5DGIA 3V8VA 3EC7A 4IEIA 1YZQA 3QKTA 3DYVA 4Y2VA 3EAFA 1F6BA 2GYUA 4Q15A 4P7KA 2EP5A 2NO9A 3OPYB 4QOEA 3UY4A 3W5AA 4AG3A 3UT6A 1GNQA 2FE8A 3QIAA 4Q9LA 3RUDA 1Y1LA 3O8CA 2MMCA 3QA3E 3AI2A 1QQ5A 4PG8A 2VDRB 3UV6A 1KSFX 2B6NA 4YI3A 1Y7TA 2R00A 3E9DA 1RRPA 4LZOA 5JAZA 1M0WA 1DE0A 2WPDA 5KX5A 1USIA 4XWGA 2ASVA 3ORFA 2R8OA 1GGVA 3O8LA 2IUEA 3UCEA 1NIPA 3WYBA 5AW0A 2ZKIA 3RU2A 3S1SA 4X66B 3QEMA 3KEGA 4FGKA 1K06A 1UEJA 3BVPA 4BFCA 3MGAA 2CL0X 3BXOA 3PIRA 1LC3A 3FZQA 4TV9F 5FWAA 5BR8M 2ALJA 2NO1A 3L7KA 3JD2A 3WWCA 4KACA 1IXZA 3FMGA 5LJLA 1BH6A 3HYRA 1E5XA 1GT6A 3LLCA 3QVKA 4ZMBA 2PYDA 3MUFA 2FWPA 1USGA 5AW2A 4ARZA 1C14A 1VDLA 1XRNA 3HGIA 1Q15A 4L4ZA 5K6TA 3OUZA 1ZONA 3JASA 4WXMA 3A4TA 3QBEA 3E2PA 2H2FA 1A8PA 3MRVA 2HRCA 1T2UA 1QTIA 3NHPA 5BY2A 1X7XA 2FUKA 3PUZA 3F1LA 4JP5A 4BX2A 1B00A 5KKAA 5CIYA 1GQFA 1X7YA 1UADA 4NYIQ 3KL2A 5A2GA 3EY4A 1GCOA 2B5WA 1RVDA 3M7GA 4QOGA 1NUAA 1MOQA 4MQ4A 4TSFA 1CUKA 1KDYA 1EIWA 3ZJ4A 3W5DA 1CHDA 2RDMA 2FSIA 2VP6A 3MQFA 4QLBA 4BFYA 3T9EA 4J4HA 3BMXA 4DIFA 5GV7A 2C99A 3HHWA 1ZVVA 3ESDA 2XB6A 4O4JF 3C5VA 5T4EA 2C95A 3GQBB 3OCJA 4LRYA 5FHRA 4DCVA 5ICGA 1ADYA 1XMPA 4ZKDA 1E9RA 4FMCF 4MQEA 1TF0B 1O94A 5AKEA 5U4XA 3DF7A 3WGUA 2F8SA 2C29D 2G04A 2FOIA 1SD1A 2ZT6A 3IECA 2W2NA 4CCYA 5FOUA 5AESA 1N32M 3T1HB 1QBGA 2IOHA 1ZMXA 2OHOA 4NV0A 2B20A 3CHYA 2LWXA 2FWMX 1WNTA 2Q2NA 1GWNA 4YUAA 2H1SA 1HBJA 5MF6A 1QDTA 1WKBA 3QI7A 4LSWA 3UWOA 1KYTA 1GG8A 3NAGA 2JI7A 4L7VA 5DTQA 2B2XA 2Y1XA 3DV2A 4H7HA 5BN1A 4WLVA 4ZVSA 4AY6A 4TTJA 4XIFA 1UXJA 2ZRMA 1BXKA 1S2IA 1P5FA 3W3AD 1WDKA 5DTMA 4HMOA 5SZKB 3CF4G 1R27A 5G3YA 4CTOA 1K4MA 4R5MA 2ZSKA 3KFLA 2RE8A 1S2NA 4PU0A 1HKHA 4Y6OA 1T4MA 3PFCA 3OPVA 3MF4A 3ZKWA 1V33A 4TVOA 2AC7A 1ZD3A 2D2EA 4N5LA 1NQAO 4QU0A 5SY4A 2VAPA 1H94A 3K0SA 4L4SA 2EIHA 3D8RA 4DG9A 2NTEA 4M38A 2YMMA 3F6YA 1TUBB 2HPAA 2ZCJA 3AM4A 4KLAA 2CDCA 1P18A 2GCEA 3BDIA 3SS7X 1DTWA 5J43A 1QZEA 3JQFC 1TJ5A 4YHBA 1P91A 4F9FA 3HXPA 4B75A 4IGFA 1TK2A 1RQLA 3OTOB 4B7AA 3B82A 4WWHA 3S5JA 5E6RB 1WUIS 2V8OA 3UGJA 2WFLA 1JQLB 5AW6A 2GKSA 5GJCA 4NYMR 3KXKA 2F4VB 4IW3B 3ZWKA 1RYNA 1DAEA 3MOGA 5CB6A 4CKWA 3WL5A 1GYPA 3EPJA 1DXOA 2O2CA 3ESYA 5CB4A 3D6JA 5BSVA 5HTOA 4LSZA 3UJNA 1ZVQA 1IN5A 5B7GA 2WUEA 3Q8KA 1SY7A 2HF2A 4F4IA 1KDOA 4RLFA 4EHHA 1HUQA 1U31A 3U7HB 2W82A 1WP4A 2QTAA 3VRHA 8ATCA 3RC8A 4AX4A 2FR0A 1GQOA 2JASA 4JC0A 4TWBA 3ZJUA 3CO5A 4GP6A 2ZBRA 3WRYA 5K51A 1K2VN 2GZAA 1GV1A 2QP4A 2V6IA 3OZUA 2O2DA 3S40A 2A9JA 5DM2A 2PUDA 1KH1A 3H16A 4EFKA 2DX7A 4JEUA 1YE9A 1Q95A 1W5AA 2YFYA 5ALKA 3I6QA 5GM1A 3BDVA 3DOEA 1NC1A 1PNOA 3LDUA 4MR8B 3GHYA 2ORVA 3HJBA 2KX7A 4JVNA 1XJCA 1H5QA 3KSZO 3A42A 4CGYB 2IHUA 3CZ9A 4B3JA 1LUAA 4GXQA 3OY7A 2W2KA 3IILA 3ZJYA 2JIQA 3AIKA 4Q3CA 2WV7A 4UCXA 3WLLA 1MENA 2AC4A 5CIQA 1M6NA 1VZ2A 4DGSA 1M54A 3ZV4A 4K9OA 4UMVA 4LBYA 4PDGA 5KVCA 3AU9A 3AI7A 2E4AA 3QOWA 3BQ9A 4WMLA 2OHGA 3FE2A 1SC1A 2C7QA 3TEJA 1KZ4A 3IP5A 4BJ6A 1WMAA 3SM9A 2VR1A 2QR2A 1XA4A 2GN4A 2WILA 4LCJA 1CUEA 3RUFA 3JYQA 1ECBA 4QLAA 4RMHA 1V9LA 2EOAA 3EPPA 2GARA 4Z4QA 3P27A 1QPBA 4OB6A 1R4NB 2VTVA 1LQUA 2I6GA 1L5LA 3GIDA 5CHYA 3U3ZA 2JJYA 4LYFA 2XDWA 1KXZA 1IUNA 4B3FX 3DKPA 3LY5A 2F1JA 2GD2A 4A27A 1G64A 4ADSG 1C7FA 3CUSA 3VYWA 1HQDA 3WV4A 4I5GA 1SUIA 4L8WB 2H5XA 2FAXA 1MD9A 5IJ0A 4DQLA 4ZOQI 2FRDA 4B08A 1IUOA 1XDWA 1SXJC 1CE8B 1QFZA 2WJAA 3JQAD 2H2GA 3GGOA 2HWJA 4KHPM 1RXUA 4JI0M 1DKMA 2QTCA 1J23A 1F8FA 1E5LA 2BFEB 4LJKA 5P21A 1EFPB 4TS4A 3QU9A 3G2NA 2FMIA 3Q3IA 4PCUA 2V6GA 5JH7B 4JXXA 1KETA 1V7CA 3U1BA 1J0AA 2HAKA 3VVBA 4KQFA 1QG0A 2REXB 3J7TA 4MDYA 1N25A 4PQYA 2F55A 1E1RA 4YLYA 4NYMQ 4AWXA 3FNQA 5L6LB 2E4UA 3PKJA 4OQDA 4H0NA 1ABFA 3QI2A 1GGHA 3C0KA 1Y5LA 1I36A 5AFSA 4WN9B 4Q3DA 4MI1A 4IP0A 4RPHA 5B7PA 1GJTA 1ZUIA 5L3VA 1EXMA 5LM3A 2AJ8A 3WSWA 1KY5A 5FI5A 4MV6A 4EO9A 2PBZA 1KVTA 8GPBA 4FR0A 2XI4A 2QCUA 4HWPA 4EYKA 1CQXA 3F6EX 2RHDA 4M1YA 4NP6A 4Q9NA 4EW6A 3E4RA 5ICCA 5FXMA 4DBGB 4KHZA 1NRXA 5C52B 3EG9A 2EFCB 5A3JA 2C2XA 1RM0A 1N1MA 4BN4A 5EMMA 3OZAA 4X93A 5CDHA 2KMLA 1P5HA 4AROA 5EA2A 1NC3A 1U2EA 1PI3A 4GGPA 4JFAA 1E9VA 1SPXA 3PC3A 2PMEA 5HUHA 4EATA 4WESB 4LXTA 4KQ9A 4EEKA 3TINA 3NZEA 1A2BA 3H2SA 2FH0A 5K99A 2J3MA 1XTJA 1C29B 4G5QA 1A2KC 4FVTA 4D99A 1JAHA 1UBHS 1UFRA 3G9QA 1WS6A 3D8HA 2OM2A 4NF2A 2JANA 5BUSA 3GRAA 1DU4A 1QH1B 4E03A 1QHNA 1OV6A 3KHKA 3DTTA 1E59A 2EW8A 5GONB 3QLJA 2NZUG 3QVOA 4YP5A 2YR0A 3B13B 3NTUA 4N3BA 2F8LA 2Q62A 4RA9A 3HWRA 3A8TA 4TN1A 3LX4A 3AVYA 1I7DA 2WVAA 3MMNA 5FPPA 5LLSA 4OGKA 3T12A 4K1XA 1G4AE 2WHXA 3HJNA 1CEYA 2OLKA 4FYJA 3OOWA 1CUHA 1CKEA 3ZU2A 4JJ8A 4EVSA 3AYZB 1ZM9A 4R83A 5IHXA 4AMVA 1BE1A 1PFVA 1UAAA 4TTTS 1XCJA 4KNYA 2VDJA 5J4LA 4EL0A 3QXGA 1RJGA 1NMSA 3FPFA 4EHKA 3H0CA 3ZWCA 4F96A 4KE7A 2Q5LA 3NVMB 2EKPA 3H9JA 4LX0A 1VC2A 3N86A 3PYMA 4Q1CA 4GC9A 1Y5IA 3F5QA 1OREA 2A7XA 2GPJA 3AJDA 3VKVA 5LQKA 3BSWA 5K0BA 4LBZA 3V4LA 2GCIA 4D9EA 1CY2A 4KZKA 4D9KA 1PHPA 1S8NA 1XCBA 1RPNA 3K1TA 4QUBA 1SG0A 2PYIA 4ZT4A 3PTZA 2FZWA 4GFDA 4UPEA 3IUMA 1EVKA 3FYHA 4JLBA 4IH4A 3PG5A 4B3SM 3MWDB 4I4TB 2R8EA 2J3HA 1FFXA 2MYNA 4DQKA 2ZSJA 3THYB 1SMKA 2I8CA 4WW0A 4TT3D 3A4LA 1ZK3A 3UMFA 1NI4A 1B1AA 2GVNA 3PFGA 2VUIB 2IV3A 2O54A 4OQPA 5B6IA 3ZGOA 4NBRA 4K3UA 1YQEA 3GJTA 4ENPA 2KYRA 2O8VA 4JLAA 1Z2PX 3FGNA 3GCDA 4F4DA 5TRTA 2YV4A 3L7LA 1QNFA 3S2UA 4DUZM 3PXUA 2GHTA 3GPXA 3VDUA 1EDDA 3LHKA 4M53A 1WZNA 4QOJA 4YREA 1TJYA 1HEIA 2DPLA 2IYOA 1H6AA 3K0HA 1BCRA 3PPXA 2AMLA 2FPPB 2BTEA 1NR1A 1X2BA 2PTGA 2A57A 3OH8A 5I7VA 4OGLA 3HJQA 4BKOA 3V8NA 1WUYA 5NLLA 2PH1A 1LH0A 4XK8F 1ZN7A 1Q14A 3LJKA 4EB0A 3UW1A 2LPMA 4JI1M 3SC2A 2DCMA 1W46A 1QS0A 3N1UA 2JEZA 3FUUA 4BLRA 4FFOA 3CF6E 5LZ2A 1IY0A 4XM1A 4YAGA 2DPGA 3E27A 1RAGA 1AV6A 2DWZB 1RW4A 4I0WB 2RD2A 4N5DA 3WDLA 1XWIA 1NKSA 4KNWA 1P1BA 3NV9A 5KQMA 2WJIA 3LBFA 4WJLA 1ZS9A 3VVMA 1M3SA 2XQIA 3R4VA 5THQA 1GUFA 2QUJA 3R3WA 2WZCA 1S9HA 3WLSA 1W93A 1XZPA 1FRVA 2VPZA 4DMCA 2VF8A 3ZTTA 5FFMA 2UZIR 2YV2A 4LC1A 4PLGA 4FU0A 3RBXA 1H1LB 4I8OA 3MJCA 5I4BA 1C80A 3LT1A 1RIFA 1VG8A 1L3BA 5F21A 3DGEC 4CLRA 4XX0A 3M6UA 3AJAA 3HDQA 2HD4A 1K4KA 1QZMA 2G5GX 3DXZA 1OZFA 2J33A 3LWNA 1MMFB 2UYQA 1I32A 1KJ9A 5LYYA 2A58A 4OUDB 1W4CA 5TB5A 4RNAA 1XHEA 2Z5FA 2F90A 2W2LD 4BWVA 4P6VF 3SSOA 4GPBA 4DXDA 5A4KA 1XLVA 1FDVA 1RAFA 2JRLA 4U2EA 2P2SA 1B6GA 1XZGA 1UKCA 1MPXA 4MS3B 1EGVB 3DZIA 4A8PA 3MB8A 1RJ9B 4GVPA 2CLDX 2NLOA 3E4CA 2CZCA 2P7IA 1PX0A 3UAVA 5CUQA 2X1MA 2HDHA 2XX3A 3CG0A 1ZXLA 2NNLD 2Q1XA 1L5MA 4F71A 5BSMA 2FSVA 5LP6B 2ZJAA 5IDYA 3LX6A 4TTQA 3WFZA 5IP5A 4YASA 4XIJA 1Q77A 3L6CA 3T7SA 4Z9XA 4D4IA