3GRVA

Crystal structure of the complex between adenosine and methanocaldococcus jannaschi dim1
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
262
structure length
262
Chain Sequence
QCFLIDKNFVNKAVESANLTKDDVVLEIGLGKGILTEELAKNAKKVYVIEIDKSLEPYANKLKELYNNIEIIWGDALKVDLNKLDFNKVVANLPYQISSPITFKLIKRGFDLAVLMYQYEFAKRMVAAAGTKDYGRLSVAVQSRADVEIVAKVPPSAFYPKPKVYSAIVKIKPNKGKYHIENENFFDDFLRAIFQHRNKSVRKALIDSSKELNYNKDEMKKILEDFLNTNSEIKNLINEKVFKLSVKDIVNLSNEFYRFLQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding of adenosine-based ligands to the MjDim1 rRNA methyltransferase: implications for reaction mechanism and drug design.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
molecule keywords Dimethyladenosine transferase
total genus 89
structure length 262
sequence length 262
ec nomenclature ec 2.1.1.-:
pdb deposition date 2009-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3grvA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3grvA01
5K03A 4OA5A 2GPYA 3O31A 2G70A 1MJFA 5HFJA 2IH2A 2AOWA 2EFJA 2H00A 3ME5A 1R8XA 4CKBA 3BGVA 4PYQA 3NVMB 3IHTA 2AOUA 2CKDA 1G60A 4R6XA 4DA4A 4Z2YA 4PCLA 1EQAA 3G2MA 3L8DA 3FYDA 5E1OA 5G02A 3VC2A 4YUZA 3K6RA 3FPFA 3FTEA 2PJDA 4KDCA 4GQBA 4XUEA 5F2OA 3UJCA 3G2QA 5EVJA 2C7PA 3MCTA 3BWCA 4FSDA 5FWDA 3B3FA 3THRA 3ELWA 1X1AA 5EEGA 4E2YA 2OPBA 1O9HA 1NE2A 5DRTA 4ER6A 1R6AA 2ZBQA 4PCAA 2OY0A 3KPVA 3KHKA 3OU6A 4RTPA 3ERCA 2UYQA 1N7IA 2ORED 3G8BA 3FUWA 3CKKA 1NW7A 4GBED 4BLVA 4EMSA 5DX0A 2Y1XA 3FPEA 5LQJA 1Q0TA 4MQ4A 1EG2A 4R6WA 1VPTA 2CWWA 5E9JA 2G8NA 3UBTA 1KYWA 2O05A 2IDJA 2VDVE 1P1BA 3O4FA 2BR3A 3Q7EA 4ISCA 4DMGA 3EVCA 5EPEA 2AN5A 3HEMA 1VIDA 3GWZA 2HWKA 2ONYA 4P7JA 3ANXA 5ERGB 3ID6C 2G72A 2QRVA 4QDKA 3KPYA 5EC8A 1Q0SA 3DH0A 2V7EA 4HRAA 1JG2A 2NYUA 1KHHA 4RTLA 4OQEA 1B42A 5CVJA 1YFJA 1ZQ9A 1JG3A 3M4XA 3FPJA 5DXJA 4LECA 3MERA 2JHAA 5EMMA 4EVIA 4HGZA 3GU3A 1YUBA 2VZ9A 5DX1A 1JQDA 4GF5A 4QTUB 3TLJA 3DMGA 4ZTBA 2AS0A 2PGXA 1XDSA 3HA3A 3G8AA 3P2IA 4CXMA 2IBSA 5FA5A 4GC5A 1NV8A 3SSOA 2PV0A 1AQJA 4U7PB 2ZIEA 2FPOA 4RTMA 2O06A 2WA1A 2IBTA 3DMFA 2XYQA 1NW3A 3P2EA 1RJEA 1P91A 3QOXA 2YXDA 1WXXA 2ZZMA 3OCJA 5D1NA 4KVZA 1MHTA 3FUTA 2JJQA 3NWEA 1IM8A 4ER3A 3PTAA 3EPPA 3UJ6A 1WG8A 2QRVB 3PB3A 5K0FA 4PIPA 1RI1A 5B1SA 2PLWA 2OZVA 2XVMA 4DCMA 1RI4A 1SKMA 1L3CA 5LQNA 4G56A 5FA8A 5CIYA 2CMGA 3QOWA 3E05A 5ICCA 1D2GA 3OE4A 1YB2A 3EVEA 4QTTB 2ONZA 3HNRA 4C04A 7MHTA 4QVGA 4E2ZA 3EEYA 3H2BA 2AOVA 3AWIA 4IV0A 5EZQA 2AVNA 3F4KA 3G7UA 3EGEA 1AF7A 3BGDA 2WK1A 3B7PA 3M33A 5DWQA 1G38A 2A14A 1JSZA 3AXSA 4GEKA 3OU2A 4C4AA 4FSXA 4YMHA 5DXAA 4NECA 5KVAA 2HR1A 4X61A 1JQ3A 2FK7A 4M7RA 2Z6QA 3A27A 2H11A 3DULA 2C7QA 3KR0A 3FRIA 5K01A 3CJQA 1DUSA 2QE6A 3BWYA 2QM3A 3M6VA 1V39A 5LR6A 3EEOA 2O0LA 2Z6AA 2IFTA 4JXJA 2YXLA 1KP9A 2B2CA 3EVGA 3P9CA 2Q41A 4P58A 3QV2A 2KW5A 5DT2A 3P9KA 4YMGA 3B5IA 3LBFA 2P40A 4KW7A 2AOXA 3D2LA 1OR8A 1D2CA 3UFBA 4RTKA 1R74A 1UIRA 1ORHA 2GAFA 3IEIA 4HH4A 5T6BA 3C3PA 5LQCA 3C0KA 5K0EA 5CUQA 2OYRA 3NJRA 4IV8A 2VDWA 5E1BA 3TMAA 4BY9E 3P8ZA 2BH2A 1SQGA 3EMBA 4X1OA 3KPWA 4POOA 3HTXA 3OFKA 3C3YA 2PBFA 3AY0A 4QPNA 3KQTA 3G2PA 3BKXA 3LCUA 2Y1WA 5FCDA 3UWPA 3G5LA 2YXEA 3EGVA 4RYLA 3A25A 3OZSA 2R3SA 3EVDA 3OFJA 1UWVA 1WXWA 2P7IA 3FTFA 2OB2A 2ERCA 2HTEA 2NP6A 3JWIA 3P97A 5LSAA 4MTLA 3KQVA 5EMJA 3THSA 4PYKA 3M6UA 2YTZA 5EIFA 1YZ3A 2I62A 3BWMA 4DM3A 3A7DA 3SX0A 4MWZA 4L7VA 4X63A 3FTCA 3FYCA 3GRYA 3DOUA 3FRHA 3LPMA 2AN3A 10MHA 4RVGA 3AJDA 5LQAA 1XCJA 3OE5A 3V97A 3HVHA 1JTEA 3LDGA 3KQOA 4MIKA 4WXHA 2E5WA 3U81A 1EIZA 5FTWA 3TFWA 5DTQA 3EGIA 4HG2A 5EHGA 5T64A 2LD4A 1RJDA 3CGGA 4FT2A 5CM2Z 4QQKA 3VSEA 1QAMA 2P7HA 3EVFA 1XDZA 2PX4A 3HCDA 3NW9A 3RODA 1HMYA 1X1BA 1FBNA 3BGIA 5H02A 3NWBA 3UJ9A 2HV9A 2PKWA 3MB5A 3TR6A 4C03A 3OZTA 5U4XA 3CCFA 3HVJA 2OXTA 4AZWA 1RJFA 3DXZA 2ZBPA 3DLCA 3IV6A 2O07A 2OBFA 3NDIA 3SXJA 5DPMA 1T43A 3LDFA 2UYCA 4DF3A 1JR4A 4PWYA 1G8AA 3LDUA 1JQEA 4ER7A 4HSGA 4E2WA 1VE3A 5E1DA 2JHCA 4KIGA 3UA3A 1IXKA 3CJTA 2IP2A 1BOOA 1AQIA 3HCEA 1WY7A 3KQWA 5EZSA 5DM4A 3RW9A 3B3JA 2JH9A 3BZBA 1KXZA 1I9GA 4OX9Y 4IKPA 4RTQA 3R0QA 4LWPA 2NXEA 4E70A 3PLAE 2BM9A 5K0NA 2GH1A 1SG9A 4FR0A 5HIKA 3EVAA 5E1MA 5T67A 2NXNA 4AZTA 4PYNA 3NTVA 2P1DA 2YR0A 3MTIA 2YQZA 4C06A 5GWXA 5ICFA 4XUCA 1FP2A 3MGGA 5DRYA 5HILA 4X41A 1F3LA 5EEHA 4BLUA 3SM3A 3LECA 5DM2A 1KIAA 1JG4A 4AUKA 1Y8CA 1XCLA 3GCZA 3VYWA 2PWPA 4GOND 2ZVJA 4YV2A 3FPHA 1QANA 3UJBA 2VDUE 3BT7A 3ELUA 1JSXA 1XJ5A 4R8SA 4YUXA 3TQSA 1VL5A 4E32A 3P2KA 1PRYA 5HIMA 5D1HA 3TKYA 3V8VA 2AR0A 3TKAA 4C08A 4OA8A 5K0BA 3CC8A 3GDHA 5E9QA 4PYIA 3I5UA 3FPGA 1M6YA 1SUIA 1WZNA 4HTFB 3RIEA 4OQDA 3R9XB 5GIOE 5F2KA 4EKIA 2V74B 4AZVA 2ZCJA 5BW4A 3PFGA 2NNWB 3MHTA 1BKYA 1O9GA 5EKUA 1NKVA 3TRKA 3M70A 3LHDA 1NBHA 1NW8A 2O57A 2VP3A 4YV0A 3MQ2A 1TW2A 1L1EA 4KRGA 4V0QA 5GP1A 1P39A 5KYGA 5CVDA 5HZMA 4RTRA 5E2AA 1KPIA 1JG1A 3G2OA 4M37A 5DX8A 5DSTA 5FHRA 1VP3A 2YX1A 4YUVA 4A6DA 5JR3A 2CL5A 3P9NA 3FUUA 1PJZA 3LCCA 3SGLA 2PT9A 1EJ0A 2ZW9A 3GJYA 3MCZA 5EQJB 5EMKA 2ESRA 3UZUA 1M6EX 2JG3A 1QAOA 1TW3A 3KPJA 4ER5A 4QDJA 3UJ8A 2ZWAA 3O7WA 3KR2A 2PXXA 2ZULA 3P9IA 2PX2A 3LCVB 3PS9A 4QPPA 1G55A 2PX8A 2NP7A 2C7RA 3UJDA 3KQSA 1FPQA 2OB1A 3K0BA 3M6WA 4HGYA 3HVKA 5C0OE 3TPZA 3LX6A 2PT6A 3DR5A 2H1RA 5FWAA 3PVCA 4K6MA 5KS2A 3T7RA 1IY9A 1EJ6A 1WS6A 1D2HA 1N2XA 1SQFA 1HNNA 2P3OA 3KQYA 2AOUB 3GIWA 2VS1A 5DM0A 5CVVA 1FJXA 3NDJA 4WVLA 2ADMA 5LQRA 2IGTA 3A26A 4BP1A 1VQ1A 5K09A 4RTSA 5MHTA 2IIPA 4KDRA 1X1DA 3G5TA 1RI3A 2GB4A 1YFLA 4P7KA 4AX8A 5CCXA 3LKDA 5BXYA 2EJUA 3A7EA 5HIIA 3GXOA 5BP7A 3DTNA 4RVHA 3TM4A 2BZGA 5CCBA 2AVDA 2XYRA 3JWHA 4EK9A 3ER8A 4XUDA 1TPYA 4QQNA 3G89A 4F85A 2GS9A 1L9KA 5LQUA 1G6Q1 3LGAA 3JWJA 4QVKA 3A4TA 5K0CA 3C6KA 3I58A 3MTEA 2G1PA 3C6MA 4PYJA 8MHTA 3PFHA 4P7FA 3AXTA 2AZTA 2C7OA 3HA7A 3HM2A 2F8LA 3T7SA 4E2XA 4FS8A 5EGSA 2JHPA 2EG5A 4YUYA 1Z3CA 3HCCA 3R24A 2Z6UA 3OU7A 5E2BA 2GA9A 1R8YA 3KQQA 3LL7A 2ZIGA 4HTFA 4C07A 3BUSA 3BXOA 4F84A 3FUVA 2OKCA 4GOLD 5E8RA 5M5BA 1KYZA 1N7JA 2GLUA 3GRZA 5GIPE 5LQKA 2ZSUA 4AZSA 4O29A 3DP7A 2IH4A 1BHJA 2ZZKA 3PT9A 9MHTA 1F38A 3G88A 3M6XA 4PIMA 1RI5A 1ORIA 3PX3A 4M38A 4Y30A 1ZGAA 2B3TA 3VC1A 2JH8A 4MHTA 4H0NA 3BWBA 2WA2A 3B89A 4R05A 1KPGA 4PGGA 4M36A 4PYLA 4EQZA 3MAGA 2I6GA 3CBGA 3GNLA 3HCFA 5CVUA 2FRXA 5C9ZA 4C05A 4RTOA 1XTPA 3EMDA 2FHPA 1KPHA 2P35A 3KR1A 2IPXA 2P41A 3E23A 3KR9A 4FT4A 5HIJA 3REOA 5GOZA 4DQ0A 2P3LA 3HCAA 1RI2A 2UZ4A 1FP1D 3DUWA 4EKGA 5EKXA 2YVLA 5IKMA 4PGHA 4BLWA 4P7GA 4LG1A 5GINE 1R18A 1RJGA 3FTDA 2BM8A 2ZTHA 3GGDA 2PWYA 3LSTA 3I9FA 4PONA 3E7PA 4RV9A 2IDKA 5E8JA 5EG5A 4ER0A 4E31A 3KKZA 3T0IA 4UOEA 2OO3A 1X19A 2IH5A 1G8SA 3ER9A 3OZRA 2I9KA 4CTKA 3BKWA 4RWZA 1R00A 5DLYA 5FUBA 2I7CA 2ZIFA 3IYLW 3X0DA 4GC9A 1YF3A 3HA5A 1BC5A 4RTNA 3GRRA 5IH3A 4R8RA 3UA4A 4ATNA 3SSNA 2ZZNA 3CJRA 3DMHA 5EIWA 1EAMA 1ZG3A 3LKZA 4HC4A 5GM1A 1DL5A 3GO4A 5HEKA 3GRUA 2CMHA 1QYRA 3P71T 5FADA 4BP3A 5ICEA 5ICGA 1ZKDA 4RX1A 3E8SA 5F2NA 2HNKA 4U7TB 5FQNA 4CWAA 3DLIA 3I53A 3UJAA 3HP7A 4XCXA 1P1CA 3LBYA 2XYVA 2PXAA 4GUAA 4LWOA 5CVEA 2G71A 2AOTA 1QZZA 5FULA 3NMUF 1AV6A 2PX5A 3CVOA 4CKEA 4FZVA 4E33A 1L3IA 1VLMA 2N47A 4PYMA 5K0LA 4V0RA 2XVAA 3NVKI 5FHQA 3SMQA 1QAQA 3SSMA 1NV9A 1XXLA 4E30A 2P3QA 2ZWVA 3DXXA 2HMYB 2BR4A 2B78A 2QYOA 1DCTA 4A6EA 1XDUA 5C1IA 5KQRA 4RVFA 2PSSA 4GOMD 5K0GA 4DKJA 4Y2HA 4DCGA 1NW6A 2K4MA 4RVDA 2P8JA 2DULA 3FUXA 2DPMA 2NXJA 3ORHA 1KR5A 4KIFA 5E9WA 1SVUA 3Q87B 1M0EA 2QY6A 1INLA 1O54A 3R6TA 5K05A 5P8WA 5BW5A 2ZFUA 3T7TA 2PY6A 4RTJA 3HCBA 1I1NA 3B3GA 2AOTB 1NBIA 3EVZA 2PXCA 3SR4A 4B17A 5DTMA 3KQMA 3WSTA 5EOVA 2FK8A 3KPUA 2ZLBA 3OPNA 4DZRA 2ZBRA 1NW5A 5EMLA 2YUIA 4FGZA 4IWNA 4YV1A 5K8VA 3I64A 1U2ZA 2FCAA 3KU1A 3EVBA 4RSRA 3GRVA 4KWCA 2XBMA 3DXYA 2EJTA 4F86A 5K0JA 5DM1A 5DSXA 2PVCA 4PINA 1VP9A 2AN4A 3R3HA 5CD1A 4OBXA 4GOOD 5KQSA 3SVZA 2B9EA 3TOSA 1XVAA 3ELYA 2B25A 2R6ZA 5DTRA 1YZHA 1VBFA 3FZGA 3JWGA 1X1CA 1JTFA 3UJ7A 1SUSA 4PYOA 5GM2A 5JUWA 1NT2A 1H1DA 2EX4A 2BR5A 3PX2A 3HVIA 2NXCA 4OBWA 3KQPA 2UYHA 1ZGJA 4X60A 3S68A 5HOQA 4YUWA 1UFKA 4CTJA 2UYOA 5FQOA 5EHIA 4CKCA 1ZHFA 4FP9A 4PNEA 1I4WA 2FYTA 3TM5A 1L3BA 3ELDA
chains in the Genus database with same CATH superfamily
2NSYA 1FA9A 2QF7A 1XMOM 3ZK7A 3FHOA 4KXWA 3T1HB 3L7CA 3HBJA 3AR2A 1DBSA 1G60A 1SOAA 1YZQA 2HBYA 1X74A 5IVIA 1BFUA 2MMCA 1XWFA 2VCHA 1L7XA 1P44A 2ZT6A 1G5QA 3MT0A 1UBOS 2PUFA 3JYQA 4CETA 1E89A 3FTEA 4D7AA 5ALVA 2QD3A 3C7AA 1BCRA 2OD7A 4W7IA 4YRLA 4FSDA 1E3IA 4TPKA 5EJ5A 3ZXXA 2O0HA 4YRPA 5FUYA 1OI4A 4EHAA 3TGLA 4LOKA 1L7EA 4RAQA 5I7WA 4FYWA 2Z3VA 4BQOA 5IAJA 4FOTA 4R5MA 1TF5A 2HSEA 3VR3D 4HLUC 2B7LA 2VKTA 3CKKA 4EMSA 4E3ZA 5DFAA 1HGXA 3PXXA 1BTOA 1CZNA 3L9WA 4MQ4A 3D3NA 2COUA 5AW5A 2CV2A 1GAXA 4IGKA 4ZPJA 4BNMA 3PPYA 4MRSA 3RUHA 4KLAA 1O5TA 1EUCA 1P1BA 1N5DA 2I99A 4R3NA 2K9DA 5DWVA 5AP9A 2AXNA 1HFKA 2XGMA 3H0EA 1E1CA 1WSBA 2CJFA 4NBSA 5FO0A 5SY4A 1EBUA 4RK6A 3L8MA 2FY8A 5JG7A 3L7MA 4M49A 1G5RA 2F3SA 3KOZA 3W1EA 3ZE8A 4N0EA 5HIAA 5KKCA 5H59A 4LECA 1E5XA 3NNSA 4BJ5A 2IYRA 4EVIA 1NMXA 1SURA 1O77A 2FOIA 2IIBA 3O83A 4TWAA 4BZZA 4GX5A 2V59A 4QOFA 1S02A 5JFTA 3A8TA 3SQXA 2VXBA 2XOXA 5DBIA 1RPNA 1US8A 3ZHUA 4PPQA 1NV8A 2BGLA 5P21A 3EQZA 3KT0A 3M3HA 5I01A 2O06A 4FVMA 1DU4A 1RLMA 3HG7A 4PHCA 2ZBDA 1WXXA 3LOPA 1U99A 4AMGA 3J81A 4JX9A 1KO4A 3F7NA 1QUEA 2WFMA 1IXRC 2Y0BA 4JJKA 3HKCA 6REQB 4HAXA 4BO2A 2EFGA 4D4GA 5HZKA 1F2UB 3GRKA 1DCFA 4LF6M 5JXJA 1JHRA 1ZRMA 5AOBA 1W4CA 1DDIA 3R3UA 4G37A 1EFRA 4Y2XA 4AZFA 2Q5FA 3DDHA 3W9UA 2AI3A 2LW7A 1MO4A 3HNRA 2VDRB 2D54A 1XRNA 4JEHA 2KDLA 5FR1A 3W8DA 2DY1A 4QZVA 1GSOA 2GF9A 2UYGA 2H8GA 1PF7E 1QE0A 3KM0A 2F5SA 2XRFA 5ERXA 3TH5A 4YBZA 1LF0A 3T3IA 3ICPA 3L84A 3OZVA 4RKFA 1YAHA 2CXPA 2HRDA 4BBAA 1TU3A 2ZWOA 4MNTA 3LZCA 4ZAWA 1M33A 2H16A 1N0HA 4TXHA 3F6BX 4FSXA 4DNQA 2XVYA 1BX0A 4TLLB 3BK1A 4HWKA 4M0LA 5G3ZA 2OTCA 1I0ZA 1TTHA 4JLUA 3HJRA 5JASA 2GN8A 2HI0A 4C21A 1T3GA 4F5WA 1QGOA 4ND7A 4DV0M 1P2VA 2OHVA 1FZQA 1K4YA 2Y0PA 3PGXA 2B9VA 5BRNA 5CFRA 1WP4A 1JIKA 2NTJA 4MV1A 2X5JO 2PMEA 4JA2A 2BMAA 4JWTA 1GFIA 5E3HA 4UUNA 3R5HA 5F5NA 2R4JA 3RROA 1KEEA 2OAGA 4RTKA 5CT5A 5KOHB 2FR8C 3DDSA 2IS6A 4Q1VA 1ZHHA 5K0EA 1U9ZA 1OC2A 2QHOB 2Q1XA 2VATA 2WYHA 3R4VA 4DARA 3NGXA 5ES4B 4GBJA 1DIBA 5KNDD 1PUJA 4HFRA 4L9SA 3Q8KA 4PXYA 2VBFA 3JQ9C 3OFKA 4JT4A 5CT6A 5KJCA 2JNWA 4QNMA 1TK3A 4QEDA 3AY0A 4QPNA 3BKXA 2FGKA 1XTKA 3HQ4O 5HRCA 5FCDA 1YOVA 3L9XA 3PHGA 4E1AA 4BOYA 5JJKA 1HRKA 3DDCA 1QYXA 1B26A 1A27A 1ZD3A 1OFUA 3AHJA 4GVLA 5CBPB 4ZHQF 4YCLA 2ERCA 5LMUM 1NZDA 2GKOA 1X80A 1E1RA 2IHZA 4LX8A 4P4SA 5EE5B 4E7OA 1KXJA 4OLHA 2H18A 1ATIA 4G0QA 4KQGA 4PANA 3OF2A 1NR1A 1QCCA 3AUSA 3HXLA 1H0SA 1F6BA 1XLTC 4JUDX 1E5LA 4TMFA 4QKQA 2E55A 5EXEA 1YU9A 3MA0A 1RCTE 3HR4A 4G0NA 1EHIA 1I7LA 4ZVNA 4FM9A 2CFTA 2DLNA 4O4IB 1GG9A 4WL0A 4EO9A 5IK2A 3ABIA 2JBHA 1F9EA 5IJWA 4MV4A 2JP7A 3AKZA 1QMPA 2C42A 1F2DA 4AKGA 3O4JA 4HK4A 4ZCTA 2D7HA 2W2TA 2QU7A 2WZQA 2WJHA 1U8EA 3BRWA 3QX9A 3IHKA 3U44A 2X9NA 1UKZA 4LYHA 4WNCA 1RJDA 1WXGA 4MKZA 5CW2A 1MX5A 4CM1A 3ORFA 3AK4A 2IODA 3KP0E 4C5CA 1Z5VA 3CBQA 3EQ9A 4XR9A 1AUPA 4EAAA 1RWOA 3GGCA 4ZI2A 1UK7A 1WCV1 1YLAA 5IZCA 2R65A 1LI7A 2AEEA 5JZSA 1BJRE 1SVMA 1JAXA 3TLEA 3ZCRA 3ZEIA 4DMMA 3VR2A 5HR5A 3K0FA 1CRPA 3MCWA 2YOHA 1ZN2A 1HKUA 4W4TA 3LFHA 5D86A 2NO9A 2YV5A 4P34A 3L82B 4UAGA 3ZE2B 4KUHA 4FLMA 2JL1A 2VFAA 2IYUA 3N0XA 4Z99A 4HSGA 2VTDA 1VE5A 2Y9MB 3ZV3A 3CINA 3H7IA 2JW5A 4OIMA 1OFGA 1Z17A 2QRUA 2F4VM 4V24A 2ZI4A 3KQWA 1CIJA 3AUUA 1TJ3A 3B3JA 3JU3A 3K20A 3PR1A 5T3YA 4JR1A 4HQNA 4Q7EA 2A0XA 2H1OA 3SAVA 4KPYA 2QZZA 2PR2A 1W88B 4RJ2A 4GMHA 3V4ZA 5A5DA 5CH5A 1DT3A 5EZ6B 3ZVLA 1VGVA 4EI2A 3BMOB 4ZO6A 3ANLA 1PFWA 1H2XA 2DBVO 3SM3A 1E77A 1NU6A 2EEPA 2OLJA 2L19A 2Q9UA 4HB4A 5ESWA 3X1JA 4A0FA 5CDFA 1BRTA 2O8EA 2HF9A 4Z0TA 4E1BA 3AJRA 2X5OA 3GI1A 3ADPA 1UXGA 4GKAA 1CS4C 1XJ0A 4YRDA 5FJJA 1R0RE 5MGBA 1N33M 3D64A 1N6NA 2PBRA 4YRRA 1UT8A 1DOHA 4L1KA 4FQ7A 1N5KA 5E7MA 2AKEA 2X4IA 3Q3EA 4OFZA 3RG2A 4PG4A 5D1HA 1BH6A 5DE3A 3F6RA 4JSYA 1JZSA 2AWOA 3L6DA 5B6PA 2OM6A 2Q3EA 4N39A 1P1IA 4JIMA 1HJPA 1RD4A 5DB4A 5TPZD 4YROA 4ARBA 1Q17A 2WIGA 4OQDA 3R9XB 5DHTA 1B0UA 4FFBB 4JI2M 4M86A 4MIYA 1IOWA 1GPLA 2XCQA 3B2NA 2ZCJA 1C1XB 1FFCA 1GZ3A 3GJ4A 5DNVA 1M2NA 4R3UC 1NBHA 1P7VA 1I2MA 2BF4A 4E5YA 1SBQA 3DVQX 1TM2A 2MJ5B 3EH2A 1L1EA 2OGTA 4GPAA 3W78A 4F7DA 3HJFA 1IDN1 2V1UA 4B4KA 5KYGA 1E6CA 2W6JA 4FNMA 4JMPA 5AO9A 5I3CA 1JWAB 4TVBA 3RD5A 1LNQA 4EG7A 2Z8ZA 1K92A 3IC5A 1ZD4A 4IGFA 1B73A 1ZP6A 1IEXA 5FYDA 5FKJA 3R3XA 3GEMA 2CNNA 3OTQA 2V6GA 4KTVE 4BMXA 4WFIA 5LP6C 4CL0A 1AQNA 4ABTA 4M0EA 4UHKA 3RAJA 1NI3A 3VNBA 1X14A 3GT0A 2V3WA 4AIIA 4BQSA 5CGQB 4LHVA 1A2KC 3FKEA 2XAAA 2N42A 3E82A 3DFKA 3NHLA 4TLEA 2JZNA 2VZ0A 3A58B 3NASA 5DTEA 5FPPA 2OB1A 3IQDB 3ROGA 3SS7X 3PGLA 2HO5A 2WJPA 3RFUA 4G4OA 1EUQA 1R0CA 3LGXA 3KS9A 4KQHA 1SG0A 3AESB 5DEIA 3PVCA 2VAVA 1ZJZA 1DIGA 3AF2A 5CDHA 4D8TA 1D2HA 3SF8A 1NHWC 3I39X 3IMFA 4GEGA 4YCJA 1PNOA 2JIPA 3DAGA 4Y1RB 1HR0B 2YXPX 4AO8A 3TDNA 5HFAA 3HBLA 4G0XA 1X9IA 3OKFA 1FDWA 2O5VA 4XVCA 1YFLA 1X1DA 2YVAA 2H2HA 1RXVA 4C0SA 3ZDCA 1CEQA 3VZPA 1VG8A 3PCXA 4HAIA 4JGGA 4JL6A 1E1LA 4RF5A 1UKYA 3DO6A 3ENZA 5IZ4A 2ZSFA 1RSZA 2PM8A 3WGGA 3UTCA 3GEDA 2PUAA 1KL7A 4QQNA 4D79A 2PLAA 5EI5A 2H0RA 4JFAA 3I8XA 5KMGA 2AJTA 1CZOA 2R97A 1U0HC 4UTVA 1E6WA 2C7OA 4XVQA 4Y9SA 1X8LA 3V4OA 1OBCA 3R1IA 1RLUA 4MS3A 2XOKD 4MPPA 3ZGVA 4J1TA 1QMGA 5AI8A 5KYYA 1Q7BA 1SU6A 1WSDA 2ZUSA 2H0QA 4HAZA 3FLMA 4J3JA 1DAGA 3KYCB 2DPXA 1U98A 1GPNA 3T1YB 3BUSA 3FUVA 3N7TA 3LXUX 4DCPA 4Z54A 5B6JA 3JZMA 4ZODA 3F5DA 4OL0A 3KXLA 4BN4A 1JSLA 2PL3A 4AZSA 1O96A 4L76A 1P3JA 1WKCA 3PKJA 3HDJA 2FX2A 5LLTA 2H7VA 3IAHA 2C92A 1SBNE 1TQHA 3G88A 2YWCA 3A1FA 3Q2KA 3L0CA 1NJFA 3HB9A 2A4KA 4OVKA 1I6MA 2L42A 4WMLA 2ZB3A 3QWHA 1VL6A 5CLGA 3B89A 2FDXA 1FX0A 2FUCA 3N70A 1ZESA 2AXEA 4N47A 2NSDA 3B2QA 5ESDA 5A4FS 3DOOA 1LLDA 3RVOA 1U02A 4BRWA 2HSZA 3HCFA 2PYDA 4LBVA 2D1YA 1I36A 4Q3EA 4HTFA 1A5AB 2FHPA 2XGGA 4J0GA 4HAWA 1OE0A 2GTIA 3A0UA 4OJYA 3KSDO 3K2IA 4WFJA 1P81A 4EF4A 1JIIA 4B5LA 1XOIA 3U6QA 4INJA 1QH1B 4DLZA 1K4KA 3S5UA 4MDFA 5C7OO 1R5LA 2WM3A 3GELA 3PUXA 2XOEA 4FK8A 4QYXA 3KIPA 3TI7A 3WNVA 1R12A 4ER0A 2CVOA 1XRJA 2BM0A 2DH6A 1S7GA 1XTUA 2YICA 1IYZA 3GQ3A 2HA4A 3D6AA 4BMVA 2QIOA 3NATA 4BNGA 2ZJ6A 2GCEA 4ZO4A 2I7CA 3U6PA 2ZIFA 4YJ3A 1GVNA 1NXXA 4RF3A 3HKPA 3D4NA 4YJ2F 1M7BA 1N5RA 1II9A 2QTRA 4MVJH 1NVTA 5FUQA 4R8RA 3TTXA 5AH0A 2A8YA 1XUOA 4I4CA 3WBFA 3DQZA 3LQRA 3MHTA 4US1R 3ONVA 2H2AA 3GRUA 3SFZA 2YZGA 1ISHA 2B8WA 2EP5A 3HJGA 1N6LA 3E8SA 3R23A 1VSVA 2AR9A 3E7XA 3MWDB 4M1WA 4CWAA 5IKEA 2J0QA 1FUEA 3J27B 3UJNA 3BMNA 4EFNA 3L7DA 4F4FA 4CM9D 1TH2A 4LNAA 3DKPA 1NQTA 4F97A 5KI6A 2E6UX 1IPHA 3ENWA 2GBCA 1G98A 3T6KA 1S2NA 4GW3A 5I7RA 4PNZA 1Q22A 1NV9A 3AT1A 1ULAA 2UZ0A 4R1NA 2JAPA 1OBVA 4WSOA 5B30A 5JCJD 4LJYA 3Q0EA 3AZQA 1D07A 4RKUF 4WLFA 1MCZA 1UXIA 3GG9A 2CB9A 2Z2ZA 1RCFA 5JDIC 3IELA 1RYYA 2W6QA 5EMNA 4I3GA 1RM0A 1UFQA 1Y9DA 1Y98A 3BM5A 2LUOA 5GAJA 1T2DA 1U0EA 3PX7A 4E5VA 5KJ1A 1T9GS 2YYAA 4JDUA 2DULA 4NSRA 3A6DA 2WD7A 4AJ1A 1KR5A 1U3DA 2C2OA 4PBTA 1EJ2A 3X2SA 1MJ5A 4JITA 4RY8A 1ODIA 3Q87B 1F0PA 3PYMA 2NTEA 3ZCSA 1NSFA 2QGNA 3R6TA 3PJGA 4WKPA 3ZNQA 4S1TA 4FYPA 4H6WA 2PMDA 4LJSA 5CM9C 3T7TA 4HUQB 3Q7RA 5BMVB 2YRXA 4H16A 3KUXA 3IV7A 4JV5M 4Q3LA 2X0FA 1M2KA 1ZNWA 3ZI4A 4J1SA 2W4IA 1ZL2A 5EWLB 4LC9A 1W7AA 5JCOA 4C2TA 3T41A 4RQBA 4WUTA 4XYMA 2MSDB 2XEXA 4MUKA 3RYHA 1L5QA 2CDBA 5JYEA 2ZWPA 1XVVA 1E92A 1X1QA 4BX9A 4JLAA 1NM5A 1JPUA 2OV3A 2PTHA 4MR8A 4TS1A 1KO8A 5FP0A 3VZQA 4MGYR 5BWCA 2I76A 4PQEA 4PG7A 5K0ZA 1QZEA 2I2XB 2X0DA 4FFLA 4EPYA 3V32A 1T3TA 3KVYA 4CL8A 3ZIAD 3CO5A 4L4SA 1U0GA 2KHZA 2VRNA 3CUKA 4HLCA 5CNJA 3T3PB 4F45A 1OFHA 1TCCA 3O95A 2VJMB 2R6ZA 4JLVA 4UFOA 4WZAB 3V8RA 4B76A 2WB2A 1SOUA 4RFSA 4DC9A 3GFQA 3T06B 4X45A 1OIWA 2Z3XA 3AGQA 3OIYA 1F7VA 1W35A 3DOEA 1C8VB 2D1TA 4PLVA 1N7GA 1NULA 5GVSA 4OI2A 2G76A 1JHZA 1GL9B 3IDFA 4HN4B 4A0GA 5JY1A 5KSYA 2PBLA 3GQ4A 2VXOA 4ZJYA 3VC3A 4Y2SA 4BVHA 2NT4A 3H05A 3UENA 2DUNA 4MMXB 5KKAA 2C8LA 2V7GA 2H00A 3AEXA 1R0ZA 3BGVA 3L6EA 5BSKA 5JJIA 1U5CA 4R6XA 4Q3DA 1RAIA 3IURA 4BGIA 2XTZA 3ZHXA 3RV4A 4GPEA 5BSHA 1ND5A 1U2PA 3FYDA 2GJ8A 3N6RA 4CM6A 3RTBA 1UPTA 4NMWA 3TQQA 1OWOA 5BWNA 3OHSX 2P9YA 2C7PA 3B48A 3HUDA 4TQGA 4OP1A 5FAKA 4FZ5A 2XRMA 1HO3A 5I4KA 4WK2B 3R3YA 3D0OA 4PPNA 3PJRA 4IVPA 1TRKA 3KPVA 2YIJA 2R0QC 2FPRA 3RABA 2R44A 1B15A 1LSOA 1N75A 4BLVA 5ADHA 2Y1XA 1KEUA 3UQZA 1Y6ZA 4YT5A 2P6OA 4L73A 2YIDA 2I2AA 2IDJA 2Q5QA 4RULA 3O3CA 2P9JA 5ALXA 1E3MA 1VB3A 2AN5A 4JMLA 3CU5A 4DN6A 4QGHA 1FYWA 1MG5A 2ZK7A 3GZ4A 2N3ZA 2PTGA 2REXB 3ZHTA 1L9XA 4BO7A 4P82A 2EA0A 3T3DA 5DF1A 2OG1A 3IQEA 1E99A 3ZCXA 1Z6PA 3J81S 2P0EA 1A71A 3B36A 4R1MA 5HBRA 3GROA 3QVXA 1DMSA 2AG1A 5K4GA 3AVXA 1AE1A 1FU4A 3TD6A 5HCUA 4QBHA 5HQ3B 1CUIA 2PGXA 3RVRA 4EQ6A 1OIPA 3D6NB 3GJXC 2ZITA 3AEQB 1KJQA 1UCFA 2IPAB 4JI8M 2HHJA 3FYSA 2XUJA 1YRBA 3RJ5A 1ZPDA 3VDQA 4NYJR 2Q3HA 1NW3A 3FMGA 3O4IA 3QOXA 1YJ8A 2I22A 3J7BA 5A3QA 1RYHA 5AI4A 5D1NA 3STVA 2A0KA 4XX0B 1PS9A 1PWXA 3B5JA 3U1TA 3R8FA 3P9SA 3DBVO 1A69A 1Y8QB 3MUOA 3L1KA 1Q12A 1TEHA 1E6EA 2VJKA 3M5DA 2Y8EA 4L72A 3DZGA 4MSUA 2W58A 3KALA 4D97A 3Q4GA 5K0FA 4WNIA 1SVIA 4JI4B 5FD8A 1N32M 1RYNA 4QU8A 1PAUA 1VCMA 1L3CA 1EUCB 4G56A 4IAOA 3RVJA 3UB3A 2I33A 3I2GA 1KY4A 1NJ5A 2D06A 4K81B 3EEYA 3RUCA 4IG4A 3MFQA 3JQBA 3KEMA 2CNWD 3DSRA 4P98A 4Y6LA 1M8FA 2D5CA 2ZYSA 5KSWB 3HPRA 3FX2A 3L92A 3RSQA 5LZ2A 1ULHA 4NYIQ 1KAHA 4PRZA 4QPJC 1YZNA 5KVQA 4YRKA 1MN6A 2QQ5A 4MWOA 2VT3A 2R8YA 1SPXA 4UCWA 1KGDA 2G0AA 4M7RA 5JCJA 4C0AC 1MFPA 1OAIA 1AKMA 1XTBA 2BKUA 2SCUA 5CXSA 4N0MA 5B64A 3Q8XA 1TYCA 4C76A 5LZ9A 3ORRA 1Y1RA 5AJYA 1KAQA 4HQ6A 2QPTA 2HBQA 3ZDQA 3ONWA 3EVGA 4LNUA 4E1VA 1UKEA 4E2FA 3PENA 1Z7WA 1YO6A 1EE8A 2HRQA 1PZFA 1KI7A 2W93A 3O73A 3RSSA 4M0DA 1N2BA 1TEZA 3ZBPA 1VPWA 1J2YA 1NI5A 4OX9B 1RQRA 3D2LA 4Z86A 1D2CA 5F35A 2FG6C 3R3JA 3OIWA 4DR1B 1E3TA 2J0SA 3GLKA 1ZMBA 5KNDA 1XB2B 4MMYB 4ZOLB 2JGFA 1IN5A 3EIHA 4G8CA 1NBMA 3DBIA 4LNHA 3V1UA 1YL6A 4O59O 1K8ZB 3PI7A 4IV8A 4IHJB 5K8JB 3ZJUA 1E6LA 3N8IA 2VP5A 1QX4A 3E03A 3M6MD 1Z8FA 3PJDA 4LI0A 5E6SA 2I29A 2WICA 4NWIA 1H8HA 4POOA 3E46A 1W4LA 3UOGA 2BGNA 4HDQB 4TMYA 1YL5A 4BV2A 3JARA 2LVNC 2F64A 1XJWA 1MXFA 2XUQA 4RGQA 5FOWA 3T4XA 3NYRA 1H3FA 2YS7A 4HN2A 3L25A 4PQYA 3SIXA 4J6FA 4BO3A 4BVFA 3M89A 2WT9A 1AHHA 2FN7A 3OFJA 2HLHA 3CVJA 3PC4A 3KFVA 3CE6A 1XRMA 4WNAA 4NYMQ 1H2YA 5HUQA 1A9QA 1HH4A 3IPYA 3GCWA 3ORYA 1NN3A 3OURA 4TUYA 4UUQA 1N4AA 3EGWA 1WWKA 2OXIA 5C3MA 1K1EA 4M6WA 4XFKA 3CUYA 2R9VA 5CX4A 2QD1A 1X3LA 2GZDA 1SIWA 5KTYA 3VJMA 1NP6A 1CEXA 4CLRB 2X4LA 4KJXA 1KMIY 1NVUQ 1DRWA 1DXOA 3TUZC 4Z8XA 1Z6GA 4NG5A 3MHPA 3RE8A 1II0A 4CHGA 3HFJA 2CF5A 3Q3CA 4FYVA 3F6SA 5FTWA 4DJ5X 4Q9NA 1LXCA 3EGIA 3VC7A 3W6UA 4CW7A 1YL7A 5T64A 5TE9A 4MAMA 4AS3A 4ETNA 5JZVA 4FT2A 1CCWA 2B0JA 1EK5A 1U7XA 2PX4A 2QKYA 3INRA 3VVCA 4BNKA 2NAPA 4EF6A 3MTGA 3WLKX 4R9VA 4WADA 4DT1A 1V11A 4M88A 2CE2X 1A8SA 3B9RA 4CIWA 4X85A 4OO3A 1PS0A 4M9UA 4V0ME 2YV4A 1CZUA 3L4SO 4UD2A 3LZ6A 2AG6A 3K1AA 1XP8A 4OG2A 5A03A 1XPRA 3JQDA 4DR4M 3V7UA 1T1RA 4YY3B 1RWNA 3PQ3A 4J07A 5DYTA 4BL5A 1EXNA 2H5EA 3GCDA 4LJ5A 3LPNA 2CLSA 1A8PA 2GEVA 3PDUA 4HEQA 4I8DA 5TQ0B 1XZ8A 2O6LA 4MUJA 4ER7A 1JA9A 4HYYA 5ALRA 4NOKA 1MB2A 3ND9A 1SRRA 1E2LA 5FBQB 3ZI0A 4E6PA 4QXAA 2Q9BA 1CZLA 4X3PA 5IFKA 3IA2A 1DE0A 1KMHB 1ABBA 1JAYA 2NUTB 2YWRA 3HBNA 1MJNA 4A26A 4DM7A 4YMSA 4MXDA 1M2VB 3LYLA 4GX1A 2WUWE 4Q12A 4UHBA 4N1AA 1ND6A 3MTIA 2ZT5A 3NHSA 4B74A 2VNHA 2LE0A 2JGKA 2GHQA 3KOYE 2W71A 3FJ1A 4MW5A 4ACAA 2JARA 1IVYA 2FR8A 2FFQA 5FI5A 4IDOA 3OX4A 4MVXA 5KUTA 1JG4A 2XXAB 4XD2A 3GCZA 2I7NA 1FVXA 4RFLA 3JALA 3LLVA 4QTYA 4CQNA 3DGEC 4MWGA 2SICE 3N3BC 3UJBA 1I7PA 4FWIB 1WB9A 1QG0A 1H22A 2JGAA 3JAMA 5H37D 1FVOA 2WSLA 3ZN2A 1YMVA 4FHDA 4WZBE 1VSTA 2GFIA 4TTTS 1ZVMA 3EXIA 1XD8A 1ZW1A 3PNMA 4PYIA 3UXMA 1I24A 3I5UA 4A4DA 3U2QA 1S9DA 7ABPA 1ETHA 1PGJA 2G1AA 2V74B 1HEIA 4YECA 1NSYA 3PFGA 3KXDA 3GJ7A 3QF4B 4IOJA 5DCLA 4Y2TA 3G2IA 4N3NA 3P96A 2W6ZA 1C7JA 3FCAA 3GLQA 4OB8A 5IJ0B 2PUGA 4Q4HB 3KU4A 4PSKA 1SQ5A 3FNHA 4KRGA 4POAA 4AY2A 3T1HM 3N2KA 3K1ZA 1EDDA 3C3AA 2WVAA 3GP5A 4OW0A 2HKIA 3FIUA 3JQ7B 5JLAA 3DMYA 2H2GA 2KZSA 4RK1A 1U6KA 2EKFA 4XIIA 5DX8A 4ZCMA 3HJSA 4KH1A 5I47A 3RHSA 1NNLA 3MT7A 1IG0A 3WWPA 4LOJA 5B2ZA 2XDWA 1R4AA 4PCUA 4BB0A 5FUVA 1H6AA 5B7PA 3JQ8A 3FR8A 3EBLA 2O7VA 3KUDA 4ALKA 4TKUA 2WSCF 4RHTA 1IB0A 1HOTA 1Y1LA 2HBZA 2ZULA 5D87A 3MJVA 2FUNB 3TUIC 5AVKA 2C7RA 1DGBA 1JW9B 1FMTA 3L1IA 4MUIA 3UJDA 2V7VA 3KBOA 3Q7TA 4YRNA 3WFJA 2EU8A 2IUYA 3JX9A 4HGYA 4YIHA 4NNPA 2WWGA 4KAXA 3HDHA 2PAAA 4LDJA 3W77A 2JGLA 1LK7A 4O2AB 1CUWA 1OTHA 3IXLA 4QGAA 2MGWA 3K15A 2OHOA 3X1YA 2FI1A 3SZOA 1N2XA 3BRCA 2VJYA 1K8YB 4B7HA 3UWKA 2Q8PA 2IU3A 2NZ2A 2Q46A 2ADMA 2PLRA 4HD8A 4IBJA 1C1XA 1J25A 1PWZA 3L8FA 3TOVA 3TW4A 4BP1A 4FJ2A 2X5KO 2FPIB 1O4WA 3TQIA 4CMEC 4Y6QA 2P30A 4DTIA 3IUEA 2NG1A 3NIGB 3TLYA 1PR4A 5REQB 1XYYA 5TS3A 3DTNA 3VGPA 4F4CA 1XCGB 1FVHA 2VUIB 4G5YA 1P0FA 1KETA 3OLCX 3L0BA 4P54A 2ODAA 2PUHA 5A3SA 1ODFA 2RGBA 1BJTA 3EYWA 3MJFA 4UMDA 2BFWA 2UVPA 4C0KA 1E2EA 5C8XA 2RIPA 2QNIA 3F5SA 1WMBA 3C6MA 1AKWA 2XUDA 3MF4A 3NEYA 2D2EA 3C3CA 3K5WA 3MS4A 3NM4A 4JYMA 2HF2A 2F8LA 2XMPA 4R7GA 1LNSA 4JY7A 4DRXA 1R4NB 4NU6A 2TS1A 2JXNA 1NFQA 2NO6A 3JZAA 4EB0A 2IXFA 1R8YA 2Z1MA 1C4XA 4C07A 3NHJA 2L18A 2Y93A 3ENNA 1PKEA 2QR5A 3U6EA 1GZ4A 2F3QA 1E9BA 5L7TA 4YT4A 1N7JA 2BEVA 1U4SA 1XA0A 2QP4A 4YJGB 4FI3F 3VR5A 4MEBA 4J2OA 2R6GA 3DP7A 4EM6A 2H4XA 1OH6A 2YDXA 5A4IS 4IBDA 4PT5A 1ZMUA 2FRVA 3B1ZA 3TVTA 4TV9B 3PX3A 2DPHA 4CQLB 4KLZA 4AO7A 1HX7A 1P1KA 4I66A 5CNIA 1J1UA 3EGOA 1OLXB 4PLPA 4XWYA 1O94A 3VH4A 1D9ZA 1YS9A 3ZDEA 2ZJ5A 1H9BA 3Q15C 4Q4AA 4Y9DA 1RZUA 1ZXXA 3TS1A 2O9JA 2WNHA 4XVUA 2D7DA 3AJIB 3REOA 4H6VA 2APLA 2JI9A 4CMBA 2GEKA 4RUKA 2YWHA 3DHVA 3L1UA 2BUAA 3BAZA 3NKFA 4NBLA 5E3JA 4URVR 5A3RA 1KY2A 5MFPA 5C80A 1KDYA 3L7BA 2C2BA 3BMXA 4JLPA 3GVIA 3MGCA 4P7GA 4U6QA 4UM7A 3WGOA 3OWXA 5HM8A 1I2DA 3I9FA 4B75A 4QASA 2Y77A 4X7RA 5J2TF 4RW0A 4YLYA 5EHXA 1P8JA 3GQ5A 4M53A 4DSNA 2O5EA 4XWKA 3IPCA 5EJIA 3ECCA 4CTKA 2UXCB 3BMQA 2CXHA 2YUTA 1K8QA 2WIFA 5KPJA 4R3DA 2GBPA 4PTLA 2P6MA 4ZOEA 2AYZA 2PSHA 4LJLA 5AWFC 4PSCA 3P2YA 4ATNA 4BY9E 1L1ZA 1AH2A 1ORTA 1FNMA 2YY5A 1KHTA 5K3BA 2DU8A 3ND8A 1ESCA 5IAGA 4DOMA 2IE8A 4N18A 2JCBA 3K32A 3NP9A 4RX1A 3SJZA 4U7TB 2I3ZA 4DLSA 4CLOA 3TXYA 5TSDA 2ODTX 3HP7A 4L22A 1BCSA 3H2HA 3RANA 5CVEA 1E1NA 2ZDHA 1MN3A 5BWOA 2AOTA 1J1IA 3WHKA 4O5OA 1X1RA 3DZKA 3EDOA 4RD0A 4MZDA 5C8YA 2CFCA 3NMUF 1ETUA 1IZ0A 4PCVA 2BOVA 3OQBA 4JIGA 2YW9A 1BHSA 1CHNA 1KAGA 1HURA 1WGNA 1NUPA 1VLMA 2NM0A 2WNSA 1MDFA 4DQUA 7CATA 2GVDC 2OBXA 3RIHA 1XXLA 1VCIA 1J24A 3SSMA 4E30A 4NH0A 2ZBGA 1QG2A 1U9YA 3VZBA 2VHWA 1H5NA 1OFVA 2YIMA 3FFXA 2X7JA 1UBCA 4U9IS 1YIOA 3MCVA 4MQ6A 1SCIA 2B78A 4COOA 1ZNQO 2W98A 3VJRA 1G3MA 4QGGA 4ENSA 4EFMA 1LDGA 4PDIA 4DDTA 3O9ZA 5K0GA 1XU7A 2P9HA 2WIKA 1FS5A 3GLTA 4DV1M 1CR0A 3JAKB 4KFTA 1T9GR 4BDTA 3PITA 1ZD8A 2VJPA 2LNHC 4UKDA 5BUSA 4L4YA 1R0KA 3U13A 4KIFA 2J3JA 1U3WA 1HYQA 2BJVA 1I2BA 1VKJA 2HT6A 3AHGA 4FMCB 5JSZA 1UC8A 2BLNA 2XLJA 3WFZA 4B8ZA 1CY4A 3OT1A 4ND8A 1FX0B 3NNDA 3UXHA 5CEFA 4O4JF 1RPJA 5H3HA 3GT4A 3IERA 4BNHA 3L05A 4O2LA 1E4OA 4B44A 4OXXA 4WZZA 1PZEA 2GHRA 1OXBB 3Q1LA 2WPNA 4M9XA 1BWPA 2QVLA 1UEXC 3QI2A 3V34A 4LPKA 1A2QA 2FK8A 3KPUA 1X2EA 3FOEC 1RW4A 3K9BA 1NW5A 2PE5A 3EASA 4A3SA 4I9HA 4QARA 1NC3A 3KU1A 4GYJA 4K6FA 4DM4A 4CM3A 3CN9A 1N9ZA 1PR5A 4KWCA 5BSGA 1XNQM 2EJWA 5DM1A 3AFGA 3PNYA 1TM3E 5U1PA 1T0PA 2BKAA 4BKPA 3SVZA 1VE7A 2O2JA 4JR0A 4BX2A 4D3XA 1X70A 4RA9B 4OFXA 2VDLB 2Z43A 3H9QA 2XMRA 4GWLA 2K6GA 1BWRA 5A9SB 4TXLA 4I3FA 2GUWA 1M1NA 1F2UA 2J3HA 1H1DA 2EX4A 3O4RA 5EQTA 3PFCA 1TQ8A 4P22A 3V7FA 4AMZA 3Q8LA 2DECA 2PZ8A 1PSDA 1ZGBA 2J5RA 3B70A 5HOQA 4IIVA 1C0PA 4NZZA 3FAZA 1QFJA 1L4NA 2HCBA 1UFKA 2W6IA 3LVBA 5CFOA 4KK3A 3I4YA 4KL8S 1CULC 5F7ZA 1DXQA 1ZA1A 2FYTA 3OIFA 2YNMA 4HDAA 4OGGA 1UBMS 4YMUA 3EAFA 4MRAA 2ZI9A 4IEFB 4L5AA 1T9HA 1U2GA 4ZVVA 1G0OA 3G1WA 1Y8RB 2XHEA 3ZHCA 3N28A 4Y98A 2PL1A 4CMJA 3JATB 4IUBS 2QTWB 3B7NA 1Z5ZA 4P16A 2PJDA 3DZ8A 4IQ0A 3DO8A 1SY7A 4FKMA 3RADC 1ZWLA 1E1CB 2FFRA 3BWCA 4G67A 3RYFA 5CFQA 5KWSA 1O96B 2Z9BA 4E2YA 3EJ6A 1QHYA 3GZTB 4TXNA 3QKRB 4E08A 3WQBA 3U7FB 2KRKA 4KZPA 2CMKA 2ZBQA 1EUDB 2H2IA 2WHQA 3E3LA 2R7MA 3M83A 3QQ5A 2ORED 4P4UA 1BSVA 4ERXA 4IGAA 1GD1O 5DN9A 3FCCA 3HCPA 4J2HA 5D8DA 3UK1A 5J2TA 3K09C 4P08A 5H8WA 1EG2A 3ZHBA 1R0SA 2D1RA 4ZQHA 5L51A 3QWIA 4ZVRA 3COYA 3OQ1A 1UWKA 3DUFB 1MFZA 4KYTA 4WK6A 4BNIA 3GT3A 4D6YA 1ZGZA 2PUWA 2X1LA 4C4SA 3HKEA 1WEHA 4K28A 5CVJA 4OKSA 1MAUA 1Q92A 4TWBA 1V8BA 1AHNA 4GR4A 2VKQA 5DXJA 3C4VA 4EMUA 3VU0A 3BCHA 4BO9A 4TQUS 2HWXA 1JXQA 2CEKA 1JEQA 1NRWA 4PC1A 1C0KA 2PRSA 3O8NA 2I03A 4GC5A 5DCYA 4J91A 4K6KA 1FOEB 4MRPA 3WK8A 2PV0A 5DHQA 5BOVA 3UT6A 5IF9A 1E2DA 4RTMA 2WA1A 4RHYA 1QNLA 4EJSA 3PGKA 1BHQ1 1Z5WA 2HPAA 2RAFA 4OQFA 5AVXA 3N3AC 2PLFA 4DVJA 4U8HA 1MHTA 2FJ0A 3H3FA 2FWIA 4QUEA 1GDTA 2A5GA 1F60A 2P79A 3NFRA 1K7FB 4G36A 4WCFB 4EPXA 4J4HA 6Q21A 2BFPA 3EF3A 3HV2A 5C5DA 2E4AA 4QYIA 4PIPA 4U2EA 2J31A 1W44A 3MT9A 1PNRA 3GN2A 3C8DA 3MBIA 2XAUA 3RC8A 3AWDA 1DEHA 4YMIA 4RABA 3A1VA 4HJXA 2I1LA 3F3MA 3WK9A 3WLFA 3DVAA 1RWPA 2ZE7A 2WU3A 5CHYA 4CEIB 5FF9A 3LZDA 3OOHA 4IDCA 3VKWA 3ZNNA 2W6JD 2MINA 2XCUA 4D6PA 4LQ4A 3W68A 2IZ5A 4BUZA 1PK8A 4KO4S 4YY3M 1JT9A 1NVMA 2D8AA 2ETVA 2IEBA 3QY0A 3AU8A 4BMPB 5CVCA 1C9NA 3DVRX 2XSZD 1GGHA 2OUKA 4YMLA 1WPXA 3DDZX 3MRXA 5ALSA 3IP9A 1LTKA 3Q2OA 4GPBA 1ZWKA 2A58A 1T24A 4DBGB 1ZK1A 1PW5A 3FTNA 2ZVPX 1FK8A 3A27A 2VPPA 3FMVA 4MCJA 3WRVA 3KWMA 1H65A 3CVWA 3EEOA 2G9ZA 2PQ6A 3V7YA 3HEAA 1MBZA 4QRHA 4ZI7B 2YXLA 4ENQA 1V6SA 1LDMA 2CL7X 4PBRA 1GTL1 1ZVJA 3NHFA 1EFKA 3LFUA 1T10A 3QYJA 3OIUA 2PEYA 1AA9A 3FZEA 3N86A 4OQYA 4WKGA 2CV1A 1UUFA 1T0JB 5E2IA 1L1FA 3WMEA 3L6BA 3K9HA 3X1WA 1LQ2A 2WJGA 1ULUA 4EMBA 1H6BA 1CF4A 5JXGA 3F98A 5J59A 5JMTA 1O58A 4REQA 3IBGA 2NV6A 2HU8A 1MT0A 1OAAA 2RARA 2QLJA 3OZDA 4LN1A 4CM4B 5IULC 2EHJA 3TMAA 3IS3A 4DIUA 4MHOA 2ZVQX 1TTEA 4DR7B 3KKNA 3M1AA 4RK5A 1I2AA 5FWYB 3D8SA 1UDBA 1CP3A 3PC8A 1EVEA 1JA0A 1HG1A 1M1YE 2FFJA 3BMOA 4D9HA 4M2LA 1C8KA 1Z7GA 2F1HA 2XB6A 2IWRA 3VO1A 2B4KA 4XXHA 4B7UA 1YMQA 4FS3A 4KGVA 2IPLA 4LMBA 4LJ6A 1X42A 4COKA 1PSWA 1XEWY 1XEXB 2HAKA 5EWJB 1C7RA 2FP3A 3Q6IA 4BB5A 4S0XA 3GMTA 3N8HA 3UWOA 4V1CB 4MA0A 5AW0A 1U5AA 1M54A 2V7XA 1FLVA 3F8WA 3FG9A 2X8LA 5EIFA 4Q19A 3A1SA 4BFWA 2I4OA 3BVPA 3RI3A 2XKAA 1RU3A 2FZLA 3NOOA 4U5QA 3WBBA 1Y8ZA 1YZFA 2VDJA 3JY6A 4E5MA 4EGCB 2HQSA 3QVTA 3GGGA 4Q7KA 3FYCA 1SCBA 4M3NA 1H66A 1EXMA 3L02A 1YAJA 1BRMA 2QGZA 2GWHA 2HZBA 4IVNA 2OFOA 4GZ3A 2B8EA 2ZU6A 4CUJA 4DMKA 3T3GA 4MIKA 4P2BA 4WXHA 2JGIA 1A7KA 4PZYA 2IELA 3GP1A 4X94A 5DTIA 1U0FA 1OLUA 1ZI9A 2W2PA 4HG2A 3ZWWA 4ARVA 5KBYA 1JQJC 4L6V6 3OEYA 2MDTA 5FPHA 2ODNA 3EARA 4W7HA 2A7XA 3FE3A 4TKZA 2CY0A 3VI3B 1YJQA 4NOMA 1GYQA 4B2LA 1I5OA 1GV1A 2IQIA 2O2SA 4IEIA 3PUJA 5TPWA 4GSKA 4AI6A 4MR7B 4IJ5A 1TFUA 4D9MA 2TMDA 2O2IA 3DLCA 3NDIA 1A1SA 3QBEA 4EABA 1GNRA 1G7SA 4HX2A 3VU9B 1R9JA 2NQ2C 1JR4A 3GUHA 4NOOB 2D59A 1M0WA 1AY0A 3AL2A 4QU5A 1FNSA 2E49A 3V6LA 2ACWA 4KDEA 2OHHA 1U8UA 3RU2A 4UQLA 1TVKB 1S2GA 1FFXA 3P52A 3I1YA 4CMEA 2GTPA 1FB5A 3T5MA 5LP6B 1W2HA 2WB4A 3FMIA 3LSYA 1BYIA 5FI0B 4FVTA 4NARA 4QG3A 2YR0A 3BOSA 3BJEA 4O2RA 4DBLE 5IDQA 1MNAA 4UXIA 5ICFA 4EJ6A 3SOPA 2Y67A 1F3LA 1XCOA 2ZSKA 4B09A 3R5FA 2DBZA 1I9CA 2DWNA 1P6UA 2W90A 4Y1FA 4KYIB 1P3DA 4D4MA 1W47A 4YV2A 1O8BA 4X0EA 3CNNA 4UASA 3VR4D 2AT1A 4NU8X 1AIPA 4G3XA 3SP1A 3ELUA 2B92A 1QXSA 2JWSA 2KBFA 4WCDA 3ZXUB 1EVKA 1O89A 1R0LA 3HCRA 2CK3A 2ZJYA 2ZUWA 3NDPA 4OHWA 3DNMA 5BV2P 1EG7A 3HA2A 1DZ3A 2GRUA 2P65A 4GS5A 1YUMA 2B1IA 2QRHA 2WJ3A 3JYOA 3LY9A 3RTGA 3S4YA 3VOBA 4IRUB 1XZFA 2ZR8A 4AG3A 4HCJA 3O93A 3GY0A 1UEIA 2QYSA 1VRVA 4MPJA 4DCCA 5IT9S 2Z1NA 1DBQA 4YN3A 5ENVA 1U2GC 3ACBA 4HSEA 3RREA 5KKNB 5EKUA 1I80A 2AF3C 3TRKA 1RXYA 2W8BB 2DJ5A 2JKVA 3WTCA 4QA9A 2F5PA 2AZ4A 5I45A 5KNLA 2K7FA 1RM5A 3TVDA 5ER6A 2RHOA 2O52A 1VFNA 1NKSA 2XE8A 1I94B 1HE5A 1JG1A 3GZJA 4Y28F 5LA6F 4DQVA 2JLXA 1GLVA 3CNOA 4QDZA 4MS4A 3UKJA 1E2JA 1WMDA 3LC2O 5K3DA 1WKBA 3B7QA 3VOSA 1X2BA 5FBZA 5T6MA 1H2EA 3IE0A 1RNLA 3G0CA 4C3OB 2J45A 3W5VA 2R1VA 2V8OA 5KO2A 3FSJX 3L5KA 4FX2A 3BN3A 2G04A 3K4HA 4KHZA 3BTSA 5KSOA 4RZQA 2IP1A 2X0JA 3KR2A 2VCEA 1IEVA 2HHAA 3KOUA 3UFXA 1EUDA 1AQYA 2XGNA 4IDFA 2PPLA 3K0BA 1UT6A 4FDMA 2C4NA 4KFRA 3OPVA 3ZGLA 5AVZA 3QKUA 4QODA 3RK1A 2OBYA 1Z18A 1HQYE 1RBMA 2CJPA 1X1SA 5BSVA 4FCCA 2XR1A 4U7WA 1EUZA 4PG6A 4TSFD 3QE4A 1FBTA 1LVHA 3RSGA 3VR6A 4P38A 4FCVA 5AVRA 1QQTA 3P0JA 1IPFA 5LA6A 3COVA 4IDGA 1U7ZA 4Q4HA 4Y6GB 1SC6A 5CVVA 2PANA 5FBLB 1UBJS 4DVGA 4B3GA 3QF4A 1WMEA 3ZXSA 5MHTA 3QVJA 4NK4A 3CUEF 1Y8GA 3I9JA 1GCGA 1T0UA 1DEOA 1NN1A 3GA5A 2OESA 2WG0A 3DV0B 4HZIA 3S8MA 4AZTA 1C1DA 1U3CA 2WHYA 1ZI6A 3ZQJA 2EL9A 2X9VA 3C4JA 3IAAA 1DJLA 1U7OA 3O75A 4FMCF 5ALHA 5BSEA 1Z5PA 5IS2A 4P0QB 3IOMA 1XIVA 2FN3A 3OJEA 4IZOA 4UEWA 2X9LA 4TROA 3IKLA 3JWJA 1ENPA 3FCSB 5TC4A 2XMDA 3BQMB 4M98A 2GI4A 1ZNXA 2AC7A 2I4IA 2YINC 3T34A 2F48A 4Q3BA 4AW9A 3CQ9A 5E6JA 1JR3E 2JC3A 3GBSA 2O1EA 3T52A 4MJLA 3U5ZA 1G8KA 5TJ9A 3VHXB 3ICWA 4ENWA 2E5LB 3D8BA 1EP1B 1W75A 1XTVA 1ESMA 2F59A 4W1PA 3KQQA 2G9NA 1N6OA 2JJ1A 3PSHA 3U37A 5AVWA 2LVQD 3AR3A 2HA7A 4OHUA 4EB6A 5HVNA 3AOEA 3QKRA 3IEKA 4FBLA 3GRZA 4EFKA 2EL7A 2I3BA 1RRPA 2DH5A 2G6BA 1VSBA 1FTYA 1JPVA 2CBGA 3FB4A 3JSXA 5TY0A 4UUBA 3Q12A 1JEJA 2HF8A 3KE8A 2R84A 2BTQB 1GSAA 4Y6OA 5EZ5A 1P2DA 3W5CA 2WY2D 3VDPA 1D6NA 5BNZA 2DQYA 4ZCSA 5LOVF 2IZZA 1FFYA 4QAQA 3D7SA 2X22A 2AV6A 3O4HA 4I46A 2BUCA 1SBYA 2JFBA 3TNLA 1DAPA 5K5EA 3R3VA 4KSBA 1X94A 3EMDA 3PLRA 4ZANA 2X4AA 5EXTA 4B0OA 1JLHA 1OIZA 3F1KA 3TWLA 5J2UA 2Q0SA 1AKVA 2HADA 4ALLA 1EB8A 3SQNA 4D9CA 5J3JA 4W9NA 3S28A 3GGDA 4M83A 3ZIAA 4CLHA 2QUBA 4JT9A 4QXMA 1I7NA 1OPRA 1V7PC 2GEUA 5DM70 3AM1A 3TZBA 3ITKA 2QRZA 5AKZA 3KP1E 5E0OA 1LV8A 1R4ZA 3MEQA 5GGYA 3AU9A 3QW4B 2NUAA 2W2NA 3JQ9A 3DQPA 2UXBM 1R0YA 1OX4A 4KIUA 3HSKA 4HPWA 1WCWA 3QA3E 6GPBA 3N76A 2PGLA 3I9MA 4FONA 1VIAA 2QXUA 3M2PA 3NGMA 1VL1A 5F3DA 4NJOA 3WVNA 3ZV5A 3EULA 2FSIA 3GH1A 2X58A 4CG0A 4K9OA 1ODTC 4MGZR 2RGCA 2FGJA 1DL5A 2CMHA 1ZKDA 3HFGA 4KH0A 1O03A 3OZCA 4IIBA 1JLLB 3NBYC 1XQ9A 2BFEB 2O8NA 1MH1A 1L5OA 2WKWA 4HDMB 2LHGA 1L4YA 1ECFA 4YC7A 4MZXA 4HH1A 1QZZA 1I6WA 1RPAA 1W52X 2N1MA 4YDHB 4UE3S 3ADCA 3CVOA 4FMDF 1WSWA 1UJ6A 3V9PA 5IKPA 4B0PA 3RUIA 3LP6A 4EEKA 1I6KA 3ONEA 3IPXA 3QTLA 2XVAA 4PYMA 2ONJA 4NFHA 4GDFA 2VBGA 3Q72A 4FMPA 3CEPB 2VSYA 2VDBB 4H60A 4ITRC 2RB4A 5L95A 4TYWA 2ATIA 3QPCA 1P9NA 4L6IA 2BD0A 2BR4A 2OYCA 4P93A 1Z5UA 5K6AC 3A6FA 1AURA 3CG0A 1UBUS 4RKRA 3UAYA 1WMSA 2GJSA 2ZUCA 3VJKA 2Q4TA 3GJSA 1Y7IA 1CW2B 3OICA 3U6SA 4O1HA 3X43A 5FEMA 1Q77A 4DNFA 4Z51A 3PYLA 5I7SA 2X49A 4HZUA 2VQEM 1A2OA 2DPMA 2O1SA 3ORHA 3ZVMA 3QNUA 2QTLA 4IDPA 5LQSA 2HOQA 1QK5A 2GD6A 1DAFA 1ISSA 3FKSD 4JU8A 1I4EB 3M4NA 2A0UA 2FXVA 2NYVA 5EIHA 2R7NA 3ROQA 3VPCA 1W87A 4R2XA 1DJOA 1G3QA 5A06A 5FOXA 4B17A 3PNOA 4S04A 5B53A 1QC5A 2DVMA 1GCAA 2G09A 3DZJA 3FCEA 4NENA 1E7SA 4AN1A 5JSQA 3N2ZB 2OOBA 1T3HA 4TLDA 2C9OA 2NPIA 3DV9A 4M87A 4MX8A 3TZQA 3LS2A 1R2QA 1WZEA 4QWMA 3IBCA 2G63A 4ONEA 3VGJA 1ZRNA 2PD3A 3R40A 1GZUA 1PE0A 4DSTA 4BEWA 5CD1A 2CHGA 3PUKA 5IVPA 1PHPA 4ZKEA 3TNYA 4R81A 1KK1A 2C4MA 2LZ0A 3LBHA 3LUDA 1SWVA 1DX4A 1G21A 2H2WA 2F9FA 2PRJA 1TMOA 3IP5A 3JWGA 1O5IA 4HDRA 4J0QA 4MQEB 4PYOA 1ARZA 4F60A 2QI9F 3A4IA 3EIXA 3OTOB 2WTXA 4PAQA 2FZCA 1B6SA 1BJKA 2Q7DA 4JB8A 3RTDA 3C3MA 4QLBA 5BORA 3WG9A 3BJMA 3VYSB 4K05A 1K7SN 3I8SA 1KGSA 1TYDE 3MMSA 3DEAA 4CKCA 4F72A 3G2HA 1KC3A 1ZCJA 3DA1A 3GOHA 1DV2A 2FPIA 4U3JB 1WPRA 3B6IA 2X40A 3BD6A 3DEYX 2VUTA 4TL7A 1B93A 3ZH9B 4LXIA 4V0LA 1S2OA 4BGEA 4DCUA 3QEBZ 2VYCA 2IH2A 4UUOA 3K0HA 1T8WA 1XKLA 3IIEA 3QVSA 3WKEA 1Z4IA 3OT4A 3AVYA 3TBHA 3LYUA 3RSHA 4RJTA 4G4JA 3S2YA 4N9WA 4B3RB 4GQBA 3D0KA 4B6PA 1VMDA 1Y3BE 1NQXA 5KINB 3V1YA 4UD6A 2YV3A 1X1AA 2PN1A 2VJAA 3R5KA 1Z33A 4RC9A 1UBNA 1NP3A 3ZQ4A 4YQYA 1O3YA 3CH5A 3FI9A 5IBPA 5FLXA 1R6AA 2B1GA 1X87A 1L0BA 3OU6A 3RU9A 3T3EA 3EXG1 2YY7A 3EZ6A 3G8CA 4JFRA 5I9BA 3W2IA 4YYEA 1TUGA 3PHIA 4YRIA 3UV7A 2LTAA 1Q95A 4ZCPA 3SJCA 4LEIA 3MGKA 2WVJA 5IX8A 1XVLA 1YCHA 3NOQA 5AJHA 5BYJA 2DAGA 1TQ4A 4H1UA 3MZ0A 3IPAA 4X44A 4BQEA 4BNVA 2HKJA 3AR5A 3EFOB 1CFJA 5ADWA 1CBUA 2ONYA 5ERGB 2EYQA 4PQGA 2G72A 2G9VA 2QRVA 3KPYA 2JLZA 2Q2QA 5FO1A 1DQSA 4BFCA 1H94A 2V6IA 3TIXB 4JZYA 5FI1B 1NJ8A 3HWWA 4UM9B 1T2CA 3I45A 5FOSA 5FLYA 3GU3A 2VZ9A 4B3SB 5A0TA 1PFQA 1DJPA 4MWCA 2KWIA 5IJXA 1ORDA 3FGNA 3A3OA 3P2IA 1W8IA 3GJQA 5FA5A 1Z4NA 5MDHA 3WFIA 5FQOA 4DBVO 3NZEA 4KXXA 3C1OA 4ISBA 1V43A 2GCNA 2PFGA 3ENQA 1S3IA 4MW0A 1QU3A 4IGEA 2K0BX 4QRIA 2C29D 2R2AA 2ZS7A 3HE3A 1XMVA 1PBNA 4K9QA 4KVZA 1LFDB 1ZJ5A 3BIFA 4L4RA 2XPCA 2R00C 3KDPA 5T8KA 2PH7A 4Q48A 1ODKA 1DC6A 1JDBC 1OAKA 1I3LA 4FZRA 5F2EA 3WRXC 4B3TB 3ILKA 3AX6A 1J1ZA 1BXGB 3I30X 4X5OA 2OZVA 3LUCA 2VEDA 3DONA 2EIXA 1WKVA 1GUBA 1PP4A 1MIOA 1ZN8A 2O48X 2EFEB 1WHSA 3OP1A 5C4GB 3UK6A 3UC9A 1JHMA 4BEJA 4YCMA 3LJKA 7MHTA 3CB2A 4MRMB 1YQ9A 4OIFA 1OREA 2GPSA 2YC4C 1MQSA 2BKLA 3ILXA 1MC5A 2XUPA 3L7IA 5AXAA 4MR8B 2ZI3A 3NBFA 2LRHA 5JATA 3PHLA 1DG1G 2FUEA 4QYSA 3MRTA 1T2UA 2RHHA 3PDIA 3R7WA 1YRQA 2A0FA 3KSXA 3C45A 3H5AA 4UVEA 2ZCVA 3DB1A 2NUTA 3W5HA 3WA7A 4YMHA 4MI9A 1G7TA 2G4LA 3HR8A 4CF5A 2OV6A 4ZT7A 3Q8MA 1SUBA 3TZ6A 3VX3A 2H11A 3DULA 4TTSA 3KR0A 1YDFA 2Q4OA 4DJAA 1IBRA 2KRUA 4F71A 1IHXA 4GKJM 1N1EA 1G19A 1VJ0A 2A1UB 1MIHA 3W3ZB 4QJBA 4LIPD 1TQDA 3AOGA 4EUFA 3OZAA 2A9OA 1MX3A 3EY9A 3HBMA 5ISMA 3GYGA 1FTSA 1WB5A 5LYJF 3AJEA 3USCS 5BYKA 1L5SA 1I13A 1OWNA 5B3JA 1NWCA 3AR9A 2FE4A 3GUUA 5ETJA 3RTAA 5ED4A 1KRWA 3HS3A 3LDHA 4ZYLA 1LTHR 4IHKA 4UAVA 2OCGA 3AETB 3RQSA 1VHWA 2OYRA 3T7EA 2Z2YA 1NQAO 1Z2EA 3IQGX 5KQMA 3UAVA 2Q5OA 3N8KA 4NXMM 1KU6A 4X7BA 4M0KA 3GVPA 2JS7A 2XUAA 4DG8A 2OZEA 2BH2A 3G82C 1K8RA 2PGOA 3F9RA 1W85B 3KSZO 2GBFA 1CY1A 3RVLA 3WGMA 4EUEA 2YIVX 2H9IA 2GMWA 4KOAA 4PIVA 1QYIA 5B3JC 3HHZA 3LX5A 5I9TA 1PWEA 5KVSA 2YXEA 1FDUA 3CSDA 3EGVA 4FYHA 1G18A 3UT5A 1T2AA 5KNBH 4HUTA 4IIEA 4YGYA 3VHQA 1XE3A 4FYJA 3FTFA 3HTXA 1JECA 1G1AA 2HTEA 1CE8A 3WP0A 3PXBA 2QN1A 2V4MA 3QQPA 4NS1A 3THSA 3G2JA 3D0QA 4EB3A 5LP6F 3BJRA 3G1UA 5ILQA 1LNZA 3M81A 4M89A 2Y2UA 4DWJA 1T6BY 4PFJA 2FMHA 4LRQA 3FTCA 5IAEA 2NO7A 4QDOA 1NTOA 2IXBA 4C4TA 3U4IA 1G7RA 1W0KD 4AKEA 3VHRA 4RVGA 2FPXA 2NUBA 5JZ9A 5LQAA 1UPUA 3W1VA 1B0ZA 3KNZA 1EK2A 2E89A 1U9IA 4WA7A 1KJWA 2L7IA 1U0TA 2OXEA 4CNQA 1WVIA 2O0MA 2JFYA 3HRHA 4DW8A 4IDNA 1Y1TA 3MYRA 1MF7A 4YASA 4F11A 3MTQA 2BWBA 3O0TA 5FJIA 4B8WA 1E8NA 3R41A 3THXB 2K2WA 4OXYA 1XDZA 1FUIA 1HMYA 2I87A 2OCDA 5H02A 1NVVR 5SV2A 3RAPR 4OMUA 1GTSA 4AD8A 2V97A 2VQ3A 4GICA 3IRVA 4QUIA 3GR6A 1GCIA 1RJFA 3H4MA 1THMA 3BZUA 1YD7A 2GBGA 3DBHA 4MKIA 4CQMA 5B4TA 2F8SA 1WDWB 2FWMX 3IAS6 1C3XA 4PZUA 1PQPA 1I3OA 2ZIWB 3K4PA 3QIVA 5AICA 3VVLA 1LTQA 2QM8A 4MR9A 3UBMA 3PD0A 3KKLA 2ZRCA 3ETJA 1YIDA 3LX8A 3LUKA 4D3ZA 1UT5A 3MWEB 3PP8A 4TRNA 3IUYA 2IEGA 4ZVQA 4KQIA 1I9GA 3FOCA 5BR8M 4YBRA 3N1UA 3CNLA 2ID8A 4OXNA 1XK7A 5K0NA 3UY4A 2P67A 4H35A 5ITXA 2YH2A 1ULBA 4HQ0A 1QZMA 3DP9A 4NZOA 3S2FA 4G26A 1BN7A 1SK8A 3I04A 4OI1A 1N9KA 3QVMA 2VDOB 2BGGA 2PPVA 1W9MA 4AMYA 1GR1A 3AF0A 4DCSA 5DNAA 2IYQA 1PR3A 3P9QA 2XJ9A 5J1SB 1H2ZA 4RNCA 4JOSA 3ZCQA 3L2AA 3BMQB 1QIJA 5AQEA 4IJKA 1SZCA 1PUIA 3LECA 4KQEA 1KIAA 3TLKA 3ZGYA 4YRTA 3HJBA 1C1HA 3WI7A 4ZWNA 1LBHA 2ZVJA 3PQ4A 1GFZA 3Q3IA 3N7UA 4RIEA 1OLOA 2JCGA 5GVRA 5HXAA 3CKLA 2E5LM 1D2NA 4Y2PA 4ACBA 4PXAA 1BXZA 4BEVA 1E9RA 3TQSA 1I7DA 4EG1A 3MJ5A 3H2JA 4GMDA 5D5QA 1L7RA 3A6ZA 1K3XA 1YWGO 1Y7PA 3BWXA 1KZ7B 1S2DA 5E9QA 3RDPA 1BQ4A 4UUAA 3CLRD 5JNVA 1QDEA 1M6YA 1Z8DA 1X7HA 1A9SA 1PI3A 1UBEA 3QTTA 4NV3A 5AJUA 5IW8A 4YRSA 1JYEA 3IJEB 5ITQA 3BSYA 3KWFA 5D7NA 2O19A 2H1WA 4GGMX 4JHXA 5HRAA 2PCLA 1FSPA 2WE8A 4XM2A 5HP4A 1QS0B 3KHSA 3RF6A 4HMPA 3W90A 2PIDA 2C2YA 3LOQA 4OSEA 2CUNA 3M5PA 4K0RA 4O4IF 2DAKA 1E64A 2XNCA 2ODQA 2JFXA 5ESRA 4OKNA 3ZPXA 2YX1A 5F4ZA 1NOJA 2XCOA 3F6CA 3WJAA 3MTDA 3HY4A 4F4IA 1E9SA 5AM3A 5LQMA 2B3DA 3H0KA 5KEIA 5KOYA 2Z30A 1M6EX 2VUHB 2DCMA 2H9AA 3F3YA 1H8HD 3ABOB 1T6YA 3AV3A 4W9NC 4GPZA 3WGTA 3ZW9A 4WBSA 5EJ8A 1KEKA 2JVKA 1CJCA 3GVCA 1XPJA 3RJTA 4V39A 3GLSA 1MIOB 2R85A 4JUFA 3QU4A 3L8YA 1FPQA 3RSOA 2AA3A 3T15A 1V9SA 5D85A 1F4VA 3TQOA 3HMQA 2OPHA 3RT9A 2QUHA 3V4LA 2ZQ5A 1IM2A 4ZGBA 3OF3A 3SHOA 3E7WA 2PS0A 1B2RA 3LUFA 4PLTA 4RK7A 3I04M 1TT5B 3T7DA 1W0CA 3ZBTA 4DV6M 2POCA 2GD1O 4OY3A 1KYQA 3K6SA 2H2DA 3MTAA 2DSNA 4KXFB 4C4ZA 4MVJP 4IQ4A 1L4LA 1G5FA 1QFMA 4DRZA 4Z2AA 3U7HB 1DUVG 1RP1A 1N0UA 1AGXA 1NBWB 3GQBA 4AX4A 1WLYA 5K2MA 2EO2A 5DK6A 4AZ0A 4MWSA 1CSEE 1WVGA 4BQNA 5AYVA 3M2TA 4DR4B 3IR6A 5KNCA 1J4AA 3TEFA 4WAUA 1AUAA 1NXTA 2OC9A 1QTQA 3G89A 4OI0A 2GS9A 1E9EA 1P62B 1E3JA 2X7XA 1EBBA 1EWTA 1SHLA 4KO3S 4S1OA 4C7KA 3IHLA 2DHRA 2ZYGA 4L8YA 4EB8A 3CLTC 2QJFA 4LY3A 1N9GA 1SN7A 2AZTA 4CEHA 4OAOA 3C74A 3PRHA 4LJ9A 4RPHA 5KOJB 2QD2A 4C29A 4QDXA 1U7UA 1K4MA 1HDEA 1JDPA 1ADFA 2I55A 3KJFA 4LRWA 1H1LB 3N75A 2V55B 1JQ5A 1KYZA 1TE2A 3QKSA 4FHFA 4RSGA 3OM1A 1IL0A 3GJTA 1CLEA 4GM1A 4HNGA 3ASUA 5G4KA 2YN4A 2NVBA 2QY9A 1J42A 5BXQC 3U60A 2FQXA 1SKAA 1QQ6A 1KSJA 3H0CA 3OX2A 1XMPA 3RUDA 4FILA 1YBFA 1S2MA 4D41A 4ES6A 4OMDA 2JH8A 1C9KA 2JJYA 3M34A 3RAGA 1KY5A 3SR0A 2WJ6A 4LE0A 1BA2A 2C5BA 5CGZA 3D3QA 4ZA2A 1E5TA 5EZYA 2I6UA 3CRW1 4Q3OA 4LY6A 2JY6B 2I6GA 2CC2A 1G5IA 1EXWA 1T36A 3EXHB 1WU8A 2H06A 4WEQA 5DP1A 4C6TB 1X13A 2ZYWX 3BCRA 3E22B 3BBPA 4G81A 5GOZA 3BREA 2H92A 4KVAA 3UH0A 4BQFA 3O3NB 4NVRA 2E4ZA 4YONB 2IPOA 2Q5JA 1AA6A 2FTKE 5KPRA 3LA6A 1T5IA 3H13A 4MARA 2L0XA 1CDDA 4UOEA 1P18A 4DTCA 1Y3HA 3Q8WA 2DKFA 4EHNA 2JLUA 4GKKB 1RS0A 2WHPA 2ID7A 1E9CA 3DTYA 4D02A 1MQ9A 1O95C 1VKHA 2DPYA 3ORSA 5TARA 3D8TA 3X0DA 1KI6A 1H8EA 2VPIA 4KNWA 3WJ2A 3BQNB 3E4RA 5ALWA 5I8ZA 4FXPA 3PQ2A 3WLMA 2BSQA 2PH1A 2Q6VA 2XTMA 1EEHA 4GZ5A 1JHDA 4HC4A 1RQ7A 1ZG3A 4KVFA 4OOEA 4PFQA 3K8QA 3M6IA 4RV4A 1N2EA 2XGOA 1LLFA 3AKEA 4M9SA 1Z56C 3MINB 4L8WB 1P9WA 3HB7A 1X86B 2PKQP 4H1HA 4M8NE 2RH8A 3A1NA 2CLFB 1ELOA 1VLZA 3HL0A 4GUAA 3U4AA 4RMJA 1KE2A 2O2CA 4JI6B 3RUEA 1U7PA 4FYKA 2PX5A 1K7CA 1QK4A 3COPA 2Y0QA 2GPWA 3FAKA 3FSGD 2ALJA 1T4CB 2N47A 4IQ8A 4J1QA 5FPSA 4JI5M 1X7XB 3FYUB 5TRTA 3FI0A 4K8RB 3EZ2A 1O1YA 1V5FA 1H4TA 1QZXA 3I76A 5A1TA 3PA6A 1AKRA 1UBTS 4N7BA 4WP2A 1PFUA 3AF5A 4Q7JA 3IV9A 4FQ8A 5AUOB 2DETA 3GPIA 3THXA 4NATA 2AZDA 4FDUA 4DCGA 2BEWA 3GIDA 1LW6E 4WKNA 3EGDB 3T95A 4EY7A 3OOYA 1VPDA 5KJ6A 3BSWA 1WW8A 1CV2A 4QGSA 3DFFA 3O21A 1W5AA 1DDGA 1E4VA 3UKOA 3VPBA 3T0GA 1RVV1 5G0TA 3D5QA 3PTLA 5JEDA 3D5TA 2ACKA 3UGQA 2NWQA 1D4ZA 5TQJA 2XF3A 2J3LA 4I1RA 4PHTA 1N2HA 2H4JA 1DAEA 2OZLB 3HO6A 4QOJA 5BSWA 4MAFA 3DO5A 3MJRA 2F5QA 5CVTA 2MSCB 4I7EA 1FQJA 4Q3AA 1JLLA 3TQFA 3CX7A 4BV8A 1ZHOA 3ES9A 2HH9A 4FGZA 1J2TA 4IWNA 4TTIA 5B37A 3RS3A 4JI0B 2IU0A 3J7TA 1I5RA 3CUSA 5IUKC 2BKEA 1G9TA 1T6OA 3M7IA 4JOCA 3ZZ0A 2GAIA 2IYWA 4DUYB 3JARB 1VJDA 2OA0A 3A42A 2B9EA 2YN2A 1OX4B 2XA2A 1TD1A 2DT5A 4BJ3A 1SU4A 4YA6A 4PLGA 4US2R 2EVWX 3HLKA 2AFIB 2FW8A 2GCOA 3MIZA 4KNVA 1QDUA 1AU9A 1JTFA 5M04A 2HFKA 5JI2E 3B85A 2BR5A 4WBNA 1KORA 2WMOB 5JYDA 4PZPA 1POWA 5GZ6A 3I6QA 1ZGJA 1XQ1A 1TJNA 3PLNA 4H7KA 8OHMA 4UHFA 1K68A 2EWMA 5J2UB 5CJ2A 1PGQA 2M60A 1RE0A 3Q7SA 1QVZA 3SQDA 3JW8A 1CYDA 2C9BA 1CKEA 2P9FA 2BE7A 3KJIA 4BN5A 4B3JA 5CX1A 5JD6A 3T5PA 4L85A 1DB3A 2OQIA 4MP8A 4JXZA 3WV4A 1KF0A 4HDSB 3ELDA 2DEUA 2FSSA 3O31A 1XC7A 2FSGA 3ME5A 2XW6A 4M1ZA 4CKWB 2UUAB 4JL5A 5MN6A 4QBKA 5DBOA 4EEXA 2R5WA 2V6ZM 1G8GA 3N6XA 2FF7A 2FPPB 4G5OA 3G2MA 4H15A 3PICA 4UU1A 3CRQA 5E1OA 4KQMA 4NXNM 3NM6B 2TSYB 1F5NA 1KWGA 1YF3A 2J8ZA 5KU1A 4S2EA 4KRFA 1ZJWA 1U7HA 4LYJA 3GPPA 1NVXQ 4X91A 3V80A 4ER6A 2ZB4A 1I94M 1IMJA 1IC6A 3DTVD 3CWQA 3QU9A 4I2NA 1WZUA 2IEZA 3D8RA 5AOCA 3SHVA 4BO0A 5IYZA 2J85A 5L3ZA 3OD5A 2JKZA 3SJ7A 1CY8A 5K4HA 4EIWA 3CM0A 1N1GA 1U8FO 1BFKA 3QTBA 3ZKWB 3WAJA 4L15A 1EP2B 2C3MA 1E1QD 2SKDA 5LNK1 5I7FA 1AC5A 3SHGB 1Y3FE 1E59A 1W2GA 3BL6A 1JH8A 2JD0A 3KC2A 4PZAA 2OQ2A 5THXA 2J7PD 3SDZA 4XLLA 3VPDA 4BYGA 5BMOA 5AKJA 2I91A 1Q0SA 1IOLA 4KI7A 3OTHA 3S29A 3NGLA 3P1JA 4LQLA 5EINA 3ZK8A 1JG3A 3G5UA 5BUCA 1V5GA 2R8PA 3BWVA 3UOAB 1OU0A 1WW3A 3LT4A 1WVMA 2DF8A 1SOWA 3BIOA 2Q07A 5DX1A 1QCZA 2ZJFA 1J8MF 3FNRA 3TLJA 2KNVA 3A3KA 4ZTBA 3U9TA 1TVCA 4X7MA 3QYAA 1OLSB 2BGWA 1JYFA 2AZMA 3F67A 4Y1RA 2IBTA 1AKYA 5TGZA 4D0NA 5HQJA 4PD2A 4V2UA 2NU9A 3VPFA 4HRVA 3T5DA 2XTJA 4H4CA 4ARUA 3A6GA 4HL4A 2H52A 2VK4A 4N3AA 2F3PA 1K08A 3DKRA 3ETGA 5BR7A 1YXMA 2FPSA 2QM7A 2WYOA 1Y1KE 2D1FA 3IAUA 3RTEA 2FEPA 3E3NA 3LYAA 3ZHYA 1RWVA 1Y5IA 4MGIR 1M34A 2QDXA 1LLQA 1CJTC 1YULA 1I7SB 1V5IA 1N36M 3FDZA 3GA7A 2WAYA 4D8WA 4HNSA 1SG6A 4EENA 1UANA 2GCPA 2A30A 3QU2A 5JJLA 3G0BA 3U3OA 3UB2A 2AQIA 2IXAA 4HKTA 2A14A 3R76A 4Y0AA 4CF3A 3VA7A 4CMGA 3OU2A 1PFVA 3RRZA 4U7HA 1N7HA 1CUZA 3NP7A 2Y1OA 1PNQA 1N3YA 1XLWA 4DA9A 4RMIA 3BB4A 4ZT3A 4BWFB 3CVUA 1MAHA 3WISA 1Q3HA 2GQFA 2ZE8A 4PHGA 3WK5A 3PA8A 2B8TA 2RC5A 2A9PA 3B1VA 3MPOA 5GGXA 4KBGA 2SBTA 3IUMA 5JARA 2H2FA 3E8XA 4NU5A 5JTUA 2P6UA 2JGDA 3AY7A 3A9SA 4OREX 1VG0B 2P40A 3N2LA 3OM0A 3VR4H 4MYHA 4A23A 3I8OA 1U8XX 4ZZIA 1FYDA 2OK8A 2IV7A 4ECAA 3GLHA 2ZRBA 1ORHA 1NUQA 1UXOA <