3GRVA

Crystal structure of the complex between adenosine and methanocaldococcus jannaschi dim1
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
262
structure length
262
Chain Sequence
b'QCFLIDKNFVNKAVESANLTKDDVVLEIGLGKGILTEELAKNAKKVYVIEIDKSLEPYANKLKELYNNIEIIWGDALKVDLNKLDFNKVVANLPYQISSPITFKLIKRGFDLAVLMYQYEFAKRMVAAAGTKDYGRLSVAVQSRADVEIVAKVPPSAFYPKPKVYSAIVKIKPNKGKYHIENENFFDDFLRAIFQHRNKSVRKALIDSSKELNYNKDEMKKILEDFLNTNSEIKNLINEKVFKLSVKDIVNLSNEFYRFLQN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dimethyladenosine transferase
molecule tags Transferase
source organism Methanocaldococcus jannaschii
publication title Binding of adenosine-based ligands to the MjDim1 rRNA methyltransferase: implications for reaction mechanism and drug design.
pubmed doi rcsb
total genus 89
structure length 262
sequence length 262
ec nomenclature ec 2.1.1.-:
pdb deposition date 2009-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3grvA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3grvA01
4E32A 3CVOA 2ZZMA 3HCEA 2ZW9A 1Z3CA 2NYUA 5BP7A 3KPWA 2ZWAA 5LR6A 1X1AA 1U2ZA 3EEOA 5CVDA 3FTEA 5D1NA 4YUWA 4PYLA 1JSXA 1RI1A 3MGGA 1EJ6A 4R8SA 5KVAA 3G89A 1I4WA 2ESRA 2UYOA 3JWHA 1Q0SA 2H11A 3DMFA 4Y2HA 4B17A 2BR3A 3NDIA 2OKCA 1TW3A 2PXAA 3P9KA 3QV2A 3OU6A 4FSDA 4IV8A 4OA5A 2FK7A 3OE4A 2ZWVA 5E9WA 2AOTA 2FPOA 2C7QA 4GOMD 1VL5A 4QVKA 3EPPA 1XDUA 4RVDA 2B9EA 1D2GA 2HTEA 3Q87B 4GF5A 3IEIA 5LQCA 4IV0A 1NV8A 9MHTA 1G8SA 4GC9A 3FRHA 3GIWA 4RX1A 2ZIEA 5CVVA 1NBIA 3LDFA 3B3JA 1SUIA 1BKYA 3B5IA 3OCJA 2AN3A 1NBHA 3GRZA 2PWYA 4P58A 5DRYA 3EGEA 1P1BA 2B78A 2BR5A 5DLYA 4DMGA 4CXMA 4ISCA 2ZZNA 2ZVJA 3LSTA 4QDJA 3DMGA 5HIMA 4XUCA 5B1SA 2BM9A 1L9KA 3M6XA 3MCZA 4U7TB 5F2KA 1HMYA 2AR0A 5DRTA 5GIPE 3EVAA 1QANA 3OZTA 4P7FA 3THRA 4XUEA 4E31A 3GRUA 5EZQA 3SMQA 1SQFA 2G8NA 3FYDA 2EFJA 3M6UA 3PT9A 4POOA 4PYJA 2JG3A 1BC5A 3KHKA 3CCFA 4A6EA 3BXOA 2P3OA 2HNKA 3TKAA 1FJXA 5ERGB 2CKDA 2B25A 4RTRA 4ATNA 1NW5A 5E8JA 1MJFA 3HA7A 5E1MA 5HIKA 5DSXA 4HTFA 4RVHA 2IPXA 3CGGA 3HP7A 1O54A 5ICCA 1JR4A 4X41A 4OQEA 3BZBA 5CD1A 5CCBA 1WY7A 2ERCA 1V39A 1NKVA 3DOUA 4R05A 1Y8CA 3T0IA 1DCTA 1F3LA 3LDGA 2Z6UA 3AWIA 1VQ1A 2ZFUA 4OA8A 2XVAA 3HA3A 3IV6A 2P8JA 1AQIA 4QQNA 5GIOE 2EJUA 2Y1XA 4FT4A 3KKZA 5EHIA 5BW5A 3UJAA 1WG8A 3G8BA 3G8AA 1PJZA 3DLIA 3O7WA 5G02A 2QY6A 1JQ3A 5FQNA 1I9GA 3EVGA 4AZWA 5FADA 5E1DA 2IIPA 4RTNA 3V97A 4MQ4A 3FPJA 4PGGA 5GM2A 4BY9E 4QPPA 3UJ9A 2IBSA 1VBFA 4BLVA 5EPEA 1YFJA 2OXTA 1RJFA 3MQ2A 4FP9A 2IH2A 4LWPA 4PCLA 2BH2A 5FA5A 1XCJA 5ICEA 1WS6A 2I6GA 4KVZA 4ER5A 2OB2A 1B42A 1TW2A 2PXXA 5HZMA 2OB1A 2B2CA 4DA4A 4PNEA 2PLWA 2UYHA 3I5UA 3KQTA 4MIKA 4OQDA 4AZTA 2O57A 1INLA 3G2QA 3ME5A 2ONYA 4FSXA 2JHAA 5LSAA 4KDCA 3E05A 3KPUA 3TQSA 4M7RA 4RVGA 5DM2A 3KR0A 2ADMA 2ORED 2P35A 4PCAA 4ER0A 1QAMA 4YMHA 2YTZA 4DCGA 1VP9A 2QRVA 3PTAA 3EGVA 2Q41A 2JHPA 4IKPA 1R8YA 5K0JA 5K09A 4RSRA 3P9IA 4BP3A 4PINA 5K01A 5GINE 3FYCA 2FK8A 3FTFA 3G5LA 4AUKA 4PYNA 1R74A 2WK1A 5E2AA 3LCCA 4EK9A 5K0LA 5C9ZA 3KPYA 3KQYA 4NECA 2XYQA 2YUIA 2UYQA 2PV0A 2FRXA 2VDWA 1TPYA 3BKWA 3EGIA 3KQMA 4C07A 4EKIA 4UOEA 5DM0A 1EJ0A 2PVCA 4C04A 5E9QA 5FUBA 3MTEA 3TFWA 1XTPA 5H02A 3KQPA 3PX3A 1XCLA 3Q7EA 2CL5A 3IHTA 3TMAA 3CC8A 3ANXA 2YX1A 4DM3A 3FTDA 5KS2A 1KXZA 2OPBA 2QYOA 5JR3A 1PRYA 1YB2A 5FHRA 4V0RA 1EAMA 5DXAA 1NV9A 5LQJA 2XYRA 3DULA 5E9JA 5MHTA 1T43A 1KHHA 3O4FA 5K8VA 2NP7A 5BW4A 10MHA 2ONZA 4PONA 3S68A 3SGLA 3T7SA 3HM2A 5CVJA 2P40A 2P3QA 3NJRA 4RVFA 2DULA 2HV9A 2VP3A 2G72A 5K0EA 2O0LA 3B89A 4RWZA 4RTOA 2ZLBA 1XXLA 3OZSA 5T6BA 3K0BA 2FHPA 4GOND 2IDJA 3HA5A 4HSGA 2VDVE 4L7VA 4DCMA 2ZCJA 3NMUF 2HWKA 3G2PA 2IDKA 1RI3A 4G56A 4X63A 5FWAA 2PKWA 2VDUE 3LPMA 2GH1A 1UFKA 2VS1A 2YXDA 3DXYA 4C05A 3MTIA 2HR1A 5LQKA 3BGVA 5DTRA 3CJRA 3ER9A 3MERA 4CKCA 2C7OA 5JUWA 4HG2A 4OBXA 5T64A 3O31A 2NXNA 1YUBA 2FYTA 2PY6A 3G2OA 3ID6C 5FWDA 2ZSUA 4EKGA 4RTQA 3SR4A 1NW3A 4YUVA 4GQBA 1M0EA 1IXKA 5HEKA 3ORHA 1YFLA 1RJEA 5LQRA 5K0GA 5EMJA 3I58A 2QE6A 3LCUA 3G2MA 3NVKI 2P41A 3R24A 3SSNA 3P97A 1JG3A 4Y30A 4MWZA 1I1NA 3JWGA 2KW5A 1L3CA 1FP2A 1YF3A 3UJBA 2AVNA 3AY0A 2OY0A 3KQQA 3MB5A 3SXJA 4DF3A 2WA1A 3M33A 3KPVA 5HIJA 3DR5A 5DX0A 1X1CA 3GRYA 4HGYA 5DTQA 3HCCA 1EQAA 3G88A 1DUSA 1FP1D 4AX8A 3GRVA 2P7IA 4ER7A 1N7IA 2B3TA 3P9CA 3KQSA 3KQWA 4FT2A 3GWZA 4P7GA 4DQ0A 2PWPA 4MHTA 1RI2A 4HGZA 3SSOA 2PT6A 2C7RA 3UJ6A 2CMGA 1Q0TA 2F8LA 4QTUB 3B7PA 2E5WA 2ZULA 3UA3A 2YR0A 3JWJA 5DXJA 3PFGA 2G70A 3EMDA 1N2XA 3LECA 2PX4A 1N7JA 5EIWA 3C0KA 3LL7A 2IH5A 1JQDA 2G1PA 2PBFA 1QZZA 2AN4A 3HNRA 4GUAA 1RI5A 2IFTA 3V8VA 5F2NA 5U4XA 3NVMB 4ER6A 1UWVA 3FUXA 3A7DA 1SQGA 3G5TA 2V74B 1YZHA 1P1CA 3A25A 1H1DA 3I64A 4YUYA 2I9KA 3G7UA 5IH3A 1X1BA 2I7CA 2PGXA 2ZBRA 4PIMA 5FA8A 3P71T 3RIEA 4PWYA 4X60A 3RW9A 3TM5A 2UZ4A 2IP2A 3ELYA 5EOVA 5FCDA 1ZGJA 3GNLA 4QQKA 5E8RA 4R6WA 3DH0A 4CTJA 4V0QA 1HNNA 4F86A 3A4TA 1RJDA 3CJQA 4PYOA 5EGSA 2CWWA 3CKKA 3SVZA 3PVCA 3FPHA 3M6VA 1MHTA 3GDHA 3P2IA 2GB4A 3T7RA 1WXXA 3DUWA 1FBNA 1FPQA 3OFJA 3SSMA 5DX1A 2OZVA 2HMYB 3DXXA 2XBMA 3PFHA 3R0QA 2AOVA 4ZTBA 3U81A 4DZRA 1AQJA 3MHTA 3MCTA 5T67A 3FPGA 1L3IA 1R8XA 3EVCA 3FUVA 1L1EA 2BZGA 2PT9A 3HVJA 2YXLA 5DT2A 1JTFA 4RTJA 3LCVB 3QOWA 1XDSA 1XJ5A 4GOOD 3UZUA 5LQAA 5EIFA 5EQJB 3HEMA 3KR9A 4KWCA 5EEGA 1KYWA 5BXYA 3HCFA 1AV6A 3LBFA 3GCZA 3TLJA 3BKXA 5HIIA 3ELDA 5K0CA 5DWQA 3TM4A 2Y1WA 3PB3A 4KRGA 3E7PA 3GRRA 4HH4A 3E23A 4C4AA 2FCAA 3JWIA 2PJDA 4FGZA 5EZSA 3HCAA 4OBWA 1OR8A 1O9GA 3EVEA 4XUDA 5GOZA 3C3PA 5K0NA 3UA4A 3F4KA 3UJCA 4A6DA 3BT7A 2CMHA 5EMLA 2AN5A 2EG5A 4PYIA 1JG4A 3FUUA 2K4MA 3KQVA 4XCXA 3UJDA 3VYWA 3C6MA 3A27A 5CM2Z 5E2BA 2GPYA 5KYGA 5FHQA 1G8AA 4HC4A 5K0FA 3OFKA 3B3GA 4WVLA 2GLUA 4BP1A 1JG2A 4AZVA 5FULA 3T7TA 3KU1A 1JG1A 3BWBA 5ICFA 3UWPA 1R18A 4PGHA 3R9XB 3BWMA 2BR4A 3BGIA 2LD4A 4E2XA 2NNWB 2O06A 4LG1A 5IKMA 1VIDA 3A7EA 1ZHFA 2AZTA 4JXJA 3P9NA 5CVUA 3BWCA 5GP1A 3RODA 4X61A 3SM3A 3TOSA 3UJ7A 1D2CA 3OU2A 4YV0A 4RTKA 4WXHA 4FZVA 4CTKA 4K6MA 3H2BA 2UYCA 3TR6A 2R6ZA 2NXEA 3M4XA 4MTLA 1JSZA 5LQUA 3OE5A 3HVKA 3B3FA 4YUXA 3GU3A 5EVJA 4F85A 3GO4A 3CJTA 2XYVA 5HOQA 3LGAA 3D2LA 2YVLA 2ZIFA 2GAFA 3NWEA 4RV9A 3E8SA 4QPNA 3K6RA 5EG5A 3AXSA 3P2KA 2EX4A 4R6XA 4U7PB 1VP3A 3LX6A 3HTXA 1O9HA 5KQRA 5EMMA 3TPZA 1VPTA 1SKMA 3CBGA 3HCBA 3LDUA 2P7HA 2EJTA 1DL5A 2AOUA 1ZQ9A 3GGDA 3R6TA 3LKZA 4IWNA 5EKUA 2O05A 4E33A 3A26A 4FR0A 2JJQA 2PX2A 4O29A 2IH4A 3I53A 1SG9A 4H0NA 3HVHA 1NW6A 3ELWA 3VC1A 2ZBQA 4R8RA 4YUZA 5LQNA 3AJDA 2OYRA 1KP9A 2GA9A 2A14A 4M36A 4KDRA 7MHTA 2GS9A 4PYKA 1VE3A 2WA2A 3EEYA 1P39A 3VSEA 1XDZA 1KPGA 2QRVB 1BOOA 5E1BA 5EC8A 3PX2A 1NW7A 3EVZA 5DSTA 4AZSA 3NW9A 4KW7A 3UFBA 5D1HA 2Z6QA 5K0BA 2AVDA 4YV2A 2Z6AA 1L3BA 2PX8A 3OPNA 5C0OE 3WSTA 2YXEA 1JQEA 1G60A 4C03A 4EMSA 1EIZA 3I9FA 5K05A 3HVIA 2R3SA 4CKEA 3KQOA 3EVDA 5CVEA 2C7PA 3UBTA 3LKDA 1NE2A 1AF7A 3KPJA 3DTNA 3GJYA 1QYRA 3MAGA 3QOXA 2YQZA 4HTFB 4QTTB 4ER3A 4EVIA 1ZG3A 4P7KA 1M6EX 2IBTA 3ELUA 1QAQA 5DM4A 4PYQA 3EVFA 5CCXA 2ZIGA 5DPMA 4CKBA 5E1OA 4GBED 4BLUA 3NWBA 5M5BA 1RJGA 4RTMA 3DLCA 3ERCA 5C1IA 2OBFA 4E2ZA 4E30A 2H00A 4PYMA 3X0DA 1D2HA 2NP6A 1NT2A 2P1DA 1ZKDA 2ZZKA 4M37A 5ICGA 1G6Q1 3FPEA 2PXCA 3FUTA 3FZGA 5FTWA 4EQZA 2ZBPA 4Z2YA 5CUQA 3C6KA 3BUSA 5EKXA 3ER8A 2P3LA 3P2EA 3EMBA 5CIYA 1WXWA 2NXCA 3FUWA 5FQOA 1ORIA 4CWAA 1KPIA 5K03A 4QVGA 4FS8A 5EEHA 3SX0A 4YV1A 5GM1A 4C06A 1P91A 3M70A 3DXZA 3KR2A 4PIPA 5KQSA 2JHCA 5DX8A 3LBYA 3L8DA 2N47A 1X1DA 1QAOA 1X19A 3REOA 1KYZA 2JH8A 4LECA 3TKYA 4RTSA 3NTVA 1KR5A 1SVUA 4BLWA 4DKJA 1R00A 2ZTHA 3LHDA 3DP7A 3M6WA 1EG2A 4E2WA 2NXJA 3PS9A 4HRAA 4YMGA 2XVMA 2DPMA 1UIRA 2QM3A 3IYLW 2AOWA 3R3HA 5F2OA 4KIGA 4M38A 4LWOA 4OX9Y 4GOLD 3FTCA 4E2YA 4F84A 1IY9A 1IM8A 2AS0A 1ZGAA 5EHGA 2PX5A 8MHTA 1G55A 3FPFA 2JH9A 1KIAA 3OZRA 1KPHA 2IGTA 5HFJA 3KR1A 1SUSA 2AOUB 3EVBA 1RI4A 2H1RA 5DM1A 5HILA 4RTLA 3BWYA 1F38A 2PSSA 3BGDA 1JTEA 5EMKA 2V7EA 1R6AA 2OO3A 2BM8A 1M6YA 2AOXA 3OU7A 3C3YA 4E70A 1XVAA 5P8WA 1YZ3A 3PLAE 3THSA 4C08A 4RTPA 5DTMA 4X1OA 4KIFA 2VZ9A 5GWXA 4GC5A 1ORHA 2AOTB 2I62A 1WZNA 4QDKA 3AXTA 2G71A 1BHJA 3HCDA 3GXOA 4RYLA 1NW8A 2O07A 3P8ZA 4GEKA 3UJ8A 3VC2A 4P7JA 1G38A 1VLMA 3FRIA 3DMHA 3NDJA 3TRKA
chains in the Genus database with same CATH superfamily
1HNXM 1PZHA 1PNOA 2JRLA 2DJ5A 3I42A 2IHBA 1TYDE 5B57C 1YDWA 2H4XA 4LY3A 5K3FB 4RENA 5AYVA 1X39A 2A35A 5DHTA 1DP4A 4N5DA 1U2ZA 1LPSA 4CM9A 1KAEA 2EJCA 3GV0A 2VUUA 1CFJA 1D1TA 3TUIC 3BCRA 1QVWA 1ZSVA 5LXTF 5K9ZA 3MGGA 4OYHA 1THMA 1X1TA 2ESRA 2V5UA 4QOHA 3AUTA 4XDGA 3TVYA 3HDVA 2C07A 4DC1A 3LUJA 3JASA 1PJIA 3HZOA 3S55A 5L3SB 1DQSA 1VJ1A 2QM8A 4LBYA 1N2CA 2E1RA 2RFLA 3WLJA 4CGYA 1OVGA 5GGYA 3U40A 5KYKA 1KETA 2P5TA 3MYYA 3VR4H 2IC5A 3FNIA 2XGJA 1DC8A 3EY4A 2AE1A 2FRDA 4D6YA 1FW8A 2ZPUA 5F12A 1OQYA 4YRCA 5CVVA 5H82A 4DV7M 1XMPA 1Y80A 4I4TA 1NF8A 5ERXA 4ZGGA 5B3KA 5LPNA 4GH9A 2B8TA 2BFWA 3A14A 4KLCA 1NM5C 4L0QA 2GCOB 5DYTA 4G0QA 3TDNA 2WJVA 1P1BA 3JAMA 3G2HA 3A37A 4S0ZA 3LTNC 1Q1GA 4CQMD 3BIWA 4RLHA 1Y8AA 2A1UB 1PJ4A 3IOMA 4O4IA 5LOVA 1JHMA 1L9KA 2Z9CA 3IESA 1SCBA 1WO8A 1TAQA 2QV7A 5CBKA 2YZMA 2PQMA 2JCXA 4D3DA 4FNMA 4F72A 4Q01A 4YAFA 1XKLA 3D3QA 5G3ZA 1O6CA 3BJEA 1J70A 5BT8A 3A6HA 3ZX5A 2G8NA 3FYDA 1CRLA 3HWRA 3L6RA 3PT9A 3EWIA 2NUTB 2H4JA 1SU8A 4BYMA 4POOA 2R8YA 3WYCA 5A5FA 4CQLA 1C1XB 1ECGA 2QQ8A 3FIUA 1Q14A 4FHFA 2HNKA 4Z9XA 4A6EA 4B2IA 3AERA 4BO4A 3A3OA 4P4SB 2CLMB 4BFYA 3DMTC 1JI3A 2YJ4A 3NOOA 2OCLA 1EVKA 1A7JA 1D0SA 4PC7A 5HGJA 5T4HA 1PZGA 1EFUB 1WXQA 1RWMA 4ZO7A 4ZTUB 1FFWA 4W5OA 2HWWA 5U4QA 2J1LA 3D0KA 1MHPA 2N75A 3LRTA 4ALIA 1L5VA 2EEZA 2XUPA 3D6MA 4M7WA 4OQEA 1KF0A 3S4YA 2GHQA 5TEVA 1IMOA 2VR1A 3PGXA 4PG4A 1YRYE 3X2SA 4B4VA 2Z6UA 4DEYA 1T34A 1JU4A 2VJMA 2IPOA 1OAIA 4U7GA 1UFQA 3KJEA 3RTCA 2P8JA 2J6CA 2VHYA 3HRIA 1AIPC 1YBHA 2X42A 3P9XA 3EXIA 5IM5A 3EXHB 4MMYB 4IFTA 4YJHA 1ZN9A 5REQA 4BLOA 1V9LA 5DFLA 1WG8A 5G02A 2FMIA 5BR1A 3M6LA 3BB1A 2AJCA 4LOAA 1RM3A 5EWMB 3T7CA 2J7NA 2WILA 2O0JA 4JS0A 1EBUA 1RYBA 4DLXA 1R6BX 2D0OB 1KRHA 2QNBA 4LZWA 2FCRA 3OTOM 3DBRB 2IZ6A 3OKFA 3C87A 4XVHA 1VBFA 2W6JA 5DHSA 4GMKA 4JP3A 5AOVA 1PG0A 3O91A 3CZPA 1E2QA 1VKZA 4OMDA 4B3FX 4AZFA 2HPAA 4O8CA 2YHAA 4Q5IA 1FLVA 2LXNA 1H2EA 4YBZA 4QNRA 5HZMA 1T13A 2ZI4A 3C3AA 4NOOB 4RMJA 2IXBA 4DR4B 1AXEA 4GP6A 3C3KA 2O57A 2O7NA 1FFCA 2EHDA 2DBYA 2ONYA 3AL2A 1UAAA 1KFEB 1REQB 1K27A 1PGQA 4EVRA 5C37A 4AF8A 4IDHA 3GOHA 3RIGA 5JPDA 2ID4A 2TMYA 1G291 3CN9A 5CX1A 1DV1A 1EUCA 2OK7A 1PW7A 4WADA 3STXA 2P1ZA 1AN9A 1HDYA 1WV0A 2QROA 2WMYA 2ZDQA 3EXHC 1XEXA 4ZO9A 4I8IA 3SFZA 4YDSA 2FKNA 4NDAA 4NEHB 1K9VF 4P33A 5DK6A 1LQ2A 4ADSG 4NY1A 5DV9A 4UD2A 2F55A 3AI1A 2I91A 3WYNA 3IP6A 4IBIA 4QPJC 1RLOA 4XWAA 3UK0A 1G17A 2OPHA 3VKVA 5AVVA 1B6RA 2QL9A 2ZRNA 1KAOA 3E82A 2V8BA 4TVKA 5B1HA 1SHUX 3DOOA 4B2YA 2YKGA 2PU7A 3PEYA 4IGKA 3NIFB 2EJWA 5FL7A 3IT1A 1D2EA 2PAFA 1J5EM 1HDZA 3ZE2B 2PH1A 5DLPA 1GGVA 2Z2ZA 2DERA 1D0IA 3LBNA 1NE7A 2FKAA 4B8ZA 3D2CA 3ANXA 1BZYA 1PTKA 3QVXA 2MHCA 4H59A 1YK0A 2FLKA 4HAYA 3JQ8A 4IX1A 4Y6RA 1PN3A 1JECA 4BLRA 4F6LA 4DR2B 5LYJF 4P0PB 4HL6A 2CE7A 3LY5A 3NPMA 3UF0A 4HAVA 3I9LA 2F4VB 3R7DA 1T6NA 3LP8A 3AP3A 3SJBA 3SSAA 3NUQA 1DX6A 3H2GA 3T5GA 2HADA 2ZATA 3AHJA 4RTOA 2J5RA 5IXSA 2A9JA 3WL3A 4TQAA 1C7QA 1KJ9A 1ZOSA 2JPDA 4CKCB 2IY7A 3E3LA 2WIAA 2F9MA 5ITWA 4MV0A 4NFHA 2J87A 3PFFA 3SIPA 3GPYA 2HU8A 3MQ4A 5IT5A 4ZCMA 1OLUA 1IXZA 1YI1A 3BFJA 1PGYA 2VKTA 3OJOA 5C3MA 4LCJA 5CT5A 1RP1A 2R7KA 4JUAA 4DQVA 2ZQYA 1LA2A 3DJYA 3MTIA 2H5IA 5JSUA 4I5SA 1H5UA 2HBZA 2J46A 1U2TA 4HBZA 3DE7X 4RJ2A 1QO7A 3ZV4A 3TZLA 4ZMSA 2C7OA 3ITEA 4AZ3B 4BLPA 2L7HA 2GM3A 2ZSBA 3CSUA 3MEQA 2JFUA 3FOZA 1SB9A 4BU0A 1ZVQA 4MV5A 4UM9B 1Z15A 1G8JA 5AVSA 1Z5CA 3SHWA 6AT1A 1RXCA 3QBEA 2IBMA 1RJEA 1U8ZA 5LXTA 1S2MA 2LHGA 1ZD3A 3GUYA 4R2XA 2BGNA 3JZFA 3P97A 3AOEA 1CQJB 4Y30A 2QI9C 1RWKA 1MOZA 1PTJC 3R5HA 3PFNA 1NKTA 3N2GA 4CM3A 2AFRA 2X9NA 1DARA 4EAAA 1ENOA 3JU3A 2WFAA 3K73O 4QQRA 4TSFD 4YECA 5EY5B 3ZYZA 4DR2M 4LF5B 1EWRA 4V3BA 1YDEA 1KWKA 3T5DA 4BMPB 3DUFB 1FP1D 2ZRCA 1R0CA 2F90A 4MDHA 4C6TB 2NQ8C 1IFXA 1OZGA 2R97A 3VU9B 1SEVA 2H2AA 4QFMA 4B87A 4FX5A 1RXUA 3GLFA 4FZ5A 3DOJA 4O0LA 4CU5A 4BP9A 5KVQA 4MHTA 4HGZA 2VDOB 1U0BB 2C7RA 1ZOOA 3KZCA 3QYFA 5F35A 2WZBA 4QTUB 4LAFA 5EE3A 2E5WA 2ZB3A 3TIVA 4EJMA 4PG7A 3KXEC 1C5KA 4G26A 1CRWG 5DXJA 3CZAA 2XHEA 4R3DA 2ZS7A 3PIRA 3VNAA 1NBOA 3BSFA 1CPYA 1R0KA 2ZI5A 3OEHA 3Q8WA 5MDHA 3EQ9A 1EFAA 4YCMA 3IRVA 4CMIA 3AC0A 3MSCA 1HT0A 2AJDA 4JODA 5DT9A 3U3XA 4ZT2A 2PRZA 4CL0A 5BOSB 2ECPA 2O54A 4A6PA 1O6BA 2PL1A 2HHJA 3JATA 3SXUB 1J8DA 2I9KA 3E1SA 1DAGA 2IPNA 1SBCA 1XPOA 3H5VA 1P75A 3BC1A 3EIWA 3TRJA 4D81A 1TAUA 5IVDA 1JZSA 3A6GA 3ORSA 4UZSA 5TIIA 5E8RA 1DEAA 1UODA 5HQ3A 2FJUA 1DIBA 2DKFA 3M3HA 3WBKA 2ZK7A 1FNBA 3FHCB 4HZUB 4W82A 2AMJA 4DBLE 3P2IA 1PP4A 2OBNA 4JP1A 3TGLA 1E2BA 3RS8A 4PSUA 3I39X 1U0SY 3CKMA 4JLNA 4RD3A 4IVPA 1E20A 3TUZC 5DN6A 2HMYB 3DXXA 4M8KA 4ARZB 4DYVA 5JDIA 3TEFA 3K35A 1FTSA 1R50A 4UFOA 1UJ4A 2AUMA 2X6TA 4IJWA 1N33M 3ESQA 5DT2A 3UVEA 4E1VA 4LF9B 2POCA 5BRJA 1MNQA 2CYCA 3MAJA 4H7PA 1WW2A 2AQKA 1LKZA 2HWYA 3QXHA 1Q0RA 1UP4A 3I6BA 2B61A 2I76A 1YR7A 4GLLA 4H16A 1U8UA 4LUCA 4XPIB 4L07A 1YVDA 4KH0A 4URFA 1KYWA 3AUAA 1QRSA 5DO9A 5KTMA 2C94A 5F3DA 2IU0A 2X7HA 2V6IA 3RSFA 4PQYA 2QCUA 1ECLA 3WAJA 1Z68A 2QGNA 2GD1O 3NGXA 3B7ZA 2W11A 3BSWA 4OM7A 5JCPA 1MQAA 4ZQIA 1L1FA 2J9ZB 1FFXA 2B36A 3RUHA 3AI7A 4JEHA 3OFND 1CCWA 5K3CA 5GOZA 5J4YA 2L6OA 2JFFA 1MRSA 2OTCA 4GVLA 2B4RO 4B7GA 1H94A 1K8RA 3G68A 4P3OA 3HK2A 4G1CA 4PPNA 3H04A 3KQVA 2ZVQX 1QU3A 5KYGA 1PV4A 3MNFA 4BKRA 4ITRC 3WVNA 4MWEA 5EZYA 1MXFA 2GLUA 2RAPA 4E5NA 1PQWA 2W6PA 3BWBA 4US1R 1XRPA 4DLNA 2OHIA 2ZUSA 3BGIA 3QJGA 2LD4A 3K9OA 1FDIA 3BXFA 3HA2A 4TT3D 3V7FA 4BNVA 5AJWA 4AS1A 4C7OA 3IA2A 4WBSA 3IP1A 1ZHFA 3R4VA 5FPQA 1OSNA 4E7OA 4JXJA 4W9NC 3SM3A 4F38A 3WJAA 3SBJA 4RJKA 1Z47A 2WLSA 4TKUA 1YB1A 2YWRA 1XR3A 4M87A 4CT0A 2WMOB 4X93A 4XX1A 3THWA 3IDOA 4MTLA 1NVVR 1L5YA 5T57A 5DBEX 3DM5A 1C0LA 4BGUA 1Y1QA 2PD3A 3NEJA 1EQ2A 2EERA 3TQCA 4QAJA 3WGYA 1DXOA 5JJLA 3AQ4A 1XTSA 2I1QA 3FSEA 1ITZA 4CKXA 5HX7A 1AVTA 5BN3A 3E1KA 1VYUA 2IF2A 3M1LA 2PL9A 3VNBA 1W34A 4QE3A 4KPUB 3D6UA 1DAOA 4IX9A 4R3WA 5ALJA 3D64A 4ZGWA 1L4MA 4MS3A 2Y0BA 3GLHA 1DL5A 2AOUA 1XMVA 1PJSA 4NWIA 4OGLA 3Q8MA 1I7DA 3LCJA 2JZ1A 2XTMA 1P72A 3U7QA 4DIDA 1JLRA 2J9YB 1IZ7A 4DY4A 1OYOA 3OEED 3L49A 3G0CA 4B7ZA 5BWMA 5JJBA 1EBBA 4O4IB 4DSAA 1TT5A 1QOPB 3KAKA 4GYYA 4TQUS 4N41A 2YVUA 3C4VA 1QHHA 5BR8M 3R77A 3U3OA 2R60A 3C5VA 3CNNA 4YUZA 1VBKA 4N18A 1WEKA 1YQDA 2GS9A 2JFBA 2BFAA 3HV2A 4JOSA 3AF5A 4M3NA 1KPGA 1DO0A 1NYTA 4PAWA 5KDLA 1C3XA 4NZMA 1M7BA 2C04A 5LUBA 3VA7A 3DC7A 1PD0A 3BM5A 3Q41A 4QRDA 4DV4M 3GUHA 4RH1A 4A23A 1RYYA 2W6OA 4BX3A 4U7JA 4B2PA 3MTBA 1QRDA 1U0EA 2E6KA 3OJCA 4G4SO 4Q9NA 5EIXA 1U7DA 3IUYA 1Y81A 3HJBA 1NXPA 3KOUA 2XCSB 1ZR2A 5FWXB 4QTTB 2JUJA 2V55B 1JQJC 4PEVA 2B0JA 4TTAA 3W8DA 1M6EX 4RY8A 4ENPA 5KPDA 5ADWA 1FVHA 3FGOA 1NVWQ 1QKIA 2P6NA 4NNOA 3B20A 1YQQA 3EVFA 2DUMA 1W46A 1VLZA 2D8MA 2FMFA 5E1OA 3GLIA 4K6OA 1GCAA 5BV0A 5EMHA 1R3DA 3KLPX 4D96A 3IKMB 4BX8A 1ISJA 1CJUC 3BA1A 2PS1A 1E2IA 3G2LA 1QV6A 1HWYA 3PPWA 1ZBQA 4R1OA 2GJSA 3VO9A 4J0CA 2GN2A 1QB8A 3T1HM 3H1AA 4KV7A 4Y9SA 3QA9A 4NCBA 1KEUA 4YCBA 1AHPA 3THXA 3DGFC 4DSTA 5JTUA 4GDMA 4CWAA 3O2SB 4KE7A 3DWGA 5E6JA 4LJYA 4ZMRA 1GCGA 4LRUA 4MVJE 1NM5A 3M70A 3UMYA 5CYFA 4J76A 1MH1A 4GZ3A 5IJWA 1C14A 1R2YA 4R1NA 4GD3Q 3S99A 3LGSA 3TK1A 3QPBA 3DJFA 5LM3A 1CZLA 3UGKA 4MVWA 2ZRFA 4JI3M 2IT1A 3AP1A 3NM5A 3MFYA 3MBOA 1ZZGA 1Q2UA 5C1DA 5ICMA 2WT4A 3H11B 1JAHA 1E62A 4H7IA 3CLTD 3LPDA 1D07A 5J4LA 3QF4B 4IGFA 2X14A 4XXHA 4JDPA 1EKXA 4QXAA 2XNJA 2O7RA 1XWWA 1Q95A 1TO2E 2P69A 3CRVA 3LCMA 3LVRE 4KXXA 3WGJA 1ZLXA 4DSUA 3K31A 3ZCQA 4NS4A 4TYYA 2FMHA 1Z33A 4NOJA 2HA4A 2OCBA 3WB9A 3FOBA 3WL8A 3QX8A 4DJFC 3IELA 4KLRA 3B1ZA 2ZAYA 3X2EA 3HHXA 4JBLA 2WT9A 4K2AA 5HILA 4DHEA 4F2DA 4UDNA 1K3WA 2VXBA 1R6AA 3SC3A 3VKFA 2NACA 4M9QA 1U8EA 3JQ9A 2ZJ2A 3GARA 1PD1A 2F5OA 1I10A 1K86A 2YYYA 4I5GA 4KXQA 4RA6B 4QG7A 4X1OA 1U80A 1ZU5A 4M0FA 2DLNA 2Y99A 1H4QA 3F6SA 3PE4A 1QDRA 1Y8QB 1WMBA 1UBRS 2L18A 5I8PA 3DT8A 4M1QA 5J4HA 2D2VA 3EXHA 4KBYA 2A30A 3AR7A 3AZQA 5D7NA 5AKGA 5KAPA 4PN7A 5ECDA 3C8ZA 2KDLA 5ITYA 1PYDA 4NV0A 1M10A 3RVDA 4HMPA 2NYUA 1JHDA 2ZWAA 4LQ4A 3DMYA 3UAGA 4JK3A 3EW9A 5DLQC 2FEPA 3T9CA 3W1WA 5IP5A 4CF7A 3HJHA 3T7EA 4HNUA 1MJNA 1TL7C 4IOMA 3UAOA 3UB2A 2YINC 3FJOA 2DR2A 4AJLA 2XCLA 3LZCA 2J7OA 4NARA 2YW2A 5G1OA 2OKCA 5EKSA 2DBZA 3U9LA 1R0XA 2CNKA 1NU8A 1GG8A 3G5AA 3JRNA 3N07A 2DT5A 4RNCA 2H1SA 4IIGA 3GMTA 5AW2A 4DCSA 2GEUA 3R0XA 2W4MA 4CG0A 3I8XA 4TT3A 3UB3A 4ABYA 1NJGA 1EVEA 2GN4A 5LP6C 1NPYA 4U7WA 9MHTA 1G8SA 4ES6A 1ISPA 1D2MA 1ETHA 1Z7EA 4JU9A 4K9KA 3QPWA 4RHTA 5T4EA 4KDFA 4U8HA 3OPYB 4DCTA 1NUTA 4J0EA 1M8KA 5GAJA 5EJCA 2PEZA 3AKEA 2IV3A 2HB6A 4CISA 3PNKA 1E2GA 1S2GA 1XD9A 2XD4A 1KQFA 5DWVA 2RSLA 1VE5A 2BH9A 1VRVA 2I4RA 3AKCA 3H1EA 5FXMA 5JXJA 4MS4A 3SMPA 3A4IA 5GQSA 1BE8A 3WIDA 1X9GA 5CM8B 1IDN1 4Y9DA 2JNHA 1DJNA 4MPRA 2R1ZA 4KMOA 2JLWA 4Z6YA 1CUHA 2J5QA 1RAFA 2NU6B 3QEJA 1F20A 4HPXB 2DR3A 2R65A 1SC9A 4GZLA 3LC2O 2FGKA 3D7MA 3G17A 3QX7A 2VXCA 2QX9A 3QVKA 1UMDA 4AXXA 2LKCA 1UBSB 1H8HD 5ALWA 2KHZA 1QUEA 5THKA 4BKMA 3CO5A 4MKRA 3BL5A 2DLDA 4KRXA 3CZ9A 4ZYZA 1LPBB 2IEYA 4M4SA 3D4LA 3PJFA 2ECQA 2BP7B 3E9EA 3CGGA 3Q3JB 4JEUA 3PHIA 4MRVA 2DHYA 4PQEA 4WXEA 5A1TA 2J9FA 4C7OB 1WR8A 3UPDA 3ZXSA 1JH9A 2AF4C 4QYIA 2MYTA 2AT1A 2XEXA 2X3UA 1V39A 1Y6JA 5CU7A 4BNZA 1SBYA 4FKBA 3GAZA 4TLAA 1AZLA 2LWIA 3CVVA 1G64A 4E3WA 2LVBA 3KL4A 1CUGA 3P7MA 2ZR8A 2XE7A 4AN0A 4C2AA 5KSZA 3TLGA 4HEOA 3A04A 3O0DA 4JITA 3O4HA 1W85A 3RT7A 2GWRA 2X2FA 1GG5A 2GPNA 3H1GA 1J5EB 1XVVA 4Z9FA 4RD0A 4CMIB 1YDGA 3M0EA 1YOVA 4HWOA 1OFIA 4A3SA 2CDBA 3WQHA 4URXR 2RHJA 3U4QB 1J8YF 4YRDA 1CV2A 1P7ZA 4L4UA 2IITA 3IG8A 1TPZA 1W52X 2RG1A 2ZRAA 3RS9A 1Y4AE 3ZHQA 3A28A 4DIBA 2J5YA 4P8RA 5C1BA 5K8CA 1Z0IA 3SHTA 5THQA 4JBGA 2FRVA 1O0SA 3BFPA 2AZXA 4LBVA 3CVUA 3EPHA 4L73A 2X15A 4RD4A 1JLKA 4UMFA 5LBIA 1E8DA 2HEGA 3A4MA 3U7QB 3RYCA 2WLTA 4S2UA 4LMAA 1N77A 4OOEA 4DHWA 3PGJA 1K7SN 4MW1A 4OP3A 4IIXA 3N3BC 2IVFA 3L0CA 2D2XA 2R46A 3CQ9A 3VHQA 2AUNA 1MNAA 3E05A 4MAMA 3ROKA 1NHWA 3N2GB 1IN6A 2FN9A 2QZJA 4G0ZA 4DLKA 4QU5A 2NLOA 1I36A 4C2TA 4Q93A 4U7HA 1FU8A 3BB3A 5ELLA 1CRZA 1O96A 3O8RA 1HDGO 4MDEA 5G4LA 3RVSA 4I46A 2PANA 2RGDA 3RKSA 4DNQA 1JT9A 2QORA 1R74A 3AHHA 2CWBA 3OEHD 2CT8A 2NQTA 2GO7A 3HB5X 3HQ4O 3JAWB 3N1UA 4XM2A 5CM9C 4NDNE 3H4IA 5DI3A 2RHTA 3UJHA 4D0LB 2DQ4A 1OI3A 3EGIA 4UOEA 3IT2A 2JJ1A 2JA2A 1I4TD 4JC0A 5EESA 5EQDA 1ZCJA 4TL8A 4S1WA 4LYEA 4BCDA 3CZQA 4M6WB 1PRBA 2EBUA 4M0WA 2Q3DA 3TS1A 4OQQA 4B0OA 1FFXB 5KU1A 2Q3BA 4ALKA 1M1YE 5BOSA 1LS1A 2ZIVB 4Y1FA 1GL9B 2ZAGA 2PM8A 2XYRA 3ZQ6A 1OI7A 4M8LA 3MIIA 4JXXA 4ZZ1A 1DAFA 5KOJB 2I29A 3X1ZA 3ZWYA 1ZOPA 3EGCA 5I6DA 1PI3A 3F67A 1DQYA 4IXMA 4L4XA 1L1TA 1T8PA 3CWQA 2JI7A 1P2VA 3OOSA 5GV7A 2I6UA 3AHGA 4C14A 1WUJS 1H0RA 2VDPB 4HSGA 4BRSA 1AB5A 5A7HA 2G9ZA 1EWVA 4L0CA 4ZO4A 4BE9A 4F3TA 2ZJYA 4DIFA 3BMCA 1G8GA 3VZCA 3L01A 3TTVA 5DTEA 3IXMA 3K0AB 1IOWA 4JLBA 1ZXLA 5EUBA 5JALA 4EHJA 1RHKA 1QIJA 3LPMA 4XLTA 3VSBA 4TUWA 2O8EA 1VYTA 1LJ8A 4LFCB 1J8MF 1Y9DA 3A4LA 3S7ZA 5I4IA 1Z4LA 1G1MA 2PT7A 5CFOA 4DNXA 3KS4A 4UREA 2Y9MB 3DCIA 1Q0PA 4OBXA 4Q37A 4J0IA 5DYWA 2Q3EA 1YI0A 2CVZA 2V6GA 3GQBB 5DE3A 4ZYLA 5KSYA 5IF3A 3DSRA 2WWWA 5ETJA 4YQYA 1U1GA 1RJWA 4QECA 4EHBA 3DHWC 1FX1A 4HZGA 3RRZA 1M0EA 5K99A 1TCVA 5KYNA 1CQZA 1QGZA 2RGWA 4CG1A 1BMQA 4JJIA 1FCJA 3NVKI 1M66A 1MRZA 3KIPA 4WUVA 5FTKA 2AF3C 1Z6PA 3VMFA 2NO5A 2FUKA 1CIJA 5K3SA 4IBEA 3JD2A 3Q6IA 3TNLA 1MRNA 2WTMA 3VKHA 1VB3A 4R9VA 4BN4A 5T4FA 4WOJA 1JE0A 3TDKA 2A33A 4MW0A 4UAGA 3DR5A 3O21A 3UAZA 4ZCIA 1CYEA 4X7RA 3GGJA 4OBBA 3QKTA 1A95A 5HQJA 1JWLA 1TA9A 3G88A 1FDOA 4GMGA 2GUWA 4EFNA 2P7IA 1XPJA 3LT5A 4NFSA 1COZA 5IRCD 4M1SA 1UWCA 5IJ9A 2SNIE 1P31A 1EFHA 2OG1A 3D81A 5ALVA 1J22A 1LC3A 4BDSA 1KK0A 1C8VB 4CBVA 5LLTA 1VI6A 3VISA 2FZGA 4HKTA 3BBPA 2WPDD 1LSJA 3VGJA 2J41A 4AMVA 4E22A 2FSUA 3AIMA 3EMDA 4TRJA 2FFJA 4ENSA 2G1PA 1NDUA 3NNDA 2B4KA 4K6KA 3KZMA 1E3WA 2YHBA 2IW1A 3T06B 1Z16A 4RMNA 1KYXA 2DSNA 5U4XA 3RS5A 5JWOA 5DBIA 3Q72A 1X8LA 5J63A 2CXRA 1YZHA 3GIDA 1ANKA 1U0LA 1WXDA 3H4VA 3VPFA 3WSWA 4L5CA 1WKCA 4ZO8A 3WP0A 1AZWA 4D5GA 4EG8A 3BF8A 3KT8A 4W99A 3HCNA 2BV3A 3ROXA 2Q49A 2QD1A 4ENVA 1YBFA 3QVLA 4ZC1A 5IBQA 2IP2A 4GPTA 4IBBA 3GVIA 3U44A 3K4QA 3CR8A 4HLUA 3B82A 5TJHA 2W98A 2F8SA 5IASA 2PUEA 1B4DA 9ATCA 1O6ZA 4X92A 3FSGA 1BVHA 3DVRX 3M6VA 4KN5A 5EUCA 4J3NA 3PZRA 3TLCA 3IUQA 3ZWDA 4C0LA 1W4RA 1HJPA 2NZXA 3COSA 5IPFA 4GL2A 3ZU5A 1FBNA 1NOJA 1Y98A 1VL6A 1VIAA 3F5MA 4F46A 3RHFA 1X1SA 3QU2A 4XA8A 3Q5GA 2MSDB 4D0GA 1LI5A 5KNDH 2CDAA 3DL0A 2XYPA 5A3RA 5BN4A 1UPBA 1Z4PX 1ZMXA 2J3QA 3PGKA 4LYHA 4WBNB 2AFHA 2XOKA 3AYXB 1EHYA 4JFRA 4W63A 3QVSA 2QP3A 3HDGA 3E84A 3QBVA 3PXXA 4I9GA 4OREX 3DL7A 3PPVA 2QVZX 1WSDA 3V4ZA 4WZZA 2WB2A 3WV5A 4I1OA 3GPIA 3IAFA 3L4BC 4Q0MA 1BQEA 5JAIA 3ELDA 5M7EA 3L4SO 2EAUA 2KNZA 2FFAA 1TM4E 2JJ2A 3FTNA 4HPWA 4KRGA 4L2IB 1WZUA 3KUDA 3M3DA 4PDGA 2B82A 5HKBA 2FTKE 1F5SA 4POAA 4DBZA 4DV4B 3L7IA 3WYFA 1BVSA 2B1JA 1BO6A 4AUMA 4IEFB 5IXJA 3QKRB 5IKXA 3COJA 1PJTA 4OBWA 4TUYA 4LV5B 1OB5A 1SZPA 1I2AA 3F4KA 1GV1A 1YS7A 2CGEA 3MRXA 4NYJR 5JATA 2GLTA 1Z5AA 2CHVA 1IE3A 2AHMA 1FX0B 1J2UA 2GILA 2NO6A 1H6UA 2NVUA 2WYVA 5BUSA 3NBFA 4YGYA 1PGPA 2X5NA 3G0HA 3QJ5A 5LNK6 3V1LA 3HN6A 3NBQA 3H83A 4G07A 2XT0A 4KAJA 1JNYA 1GAWA 4I55B 4E09A 3R9KA 3UWPA 5KWEA 4XASA 4Y8VA 2C7GA 3I9KA 2VJDA 3GRAA 1IXSA 4EJSC 2NNWB 1DRJA 1XWIA 1E1YA 1L4EA 1UFOA 2EQAA 2W2QA 2XAAA 3EMVA 1REQA 5EIHA 3T3EA 3ZLUA 3ZZMA 1D0MA 3IUPA 2P27A 3C6ZA 4WI1A 2CRUA 3UMRA 3ZWQA 3OOYA 4P36A 1QB7A 4CTKA 3QEMA 1EQUA 3PF8A 4CNBA 2UXDB 4ASUD 2CZCA 3M4XA 2VP9A 4MVJF 3ANTA 4KQJA 5SZJA 2E82A 3GU3A 3Q11A 4OP1A 3TG8A 1ZO8A 2XR1A 5AHXA 1SUBA 5EXPA 1Q16A 1JGTA 4FFOA 1M2EA 5AHKA 1P2UA 3TCXB 2I7PA 2QHXA 1N2OA 1YD7A 2JCSA 2NNLD 3BJZA 1F8GA 1C0PA 2XADA 3EC7A 4QFDA 3VHRA 3IMGA 3QHPA 2VL7A 2IS1A 3HHYA 1FJGB 1XYYA 2MROB 1GTG1 4TWIA 1VPTA 2OORC 3NYQA 4A73A 3PJEA 5CB0A 4YWHA 5UKDA 1WZEA 3ADPA 3PVSA 4Q3NA 4QUAA 5AESA 2O2EA 4RZ2A 1W75A 3AUXA 2EZUA 4BTEA 3IA7A 2JJQA 2HZ7A 621PA 4YMSA 3HS3A 4UU0A 3BK1A 3DDNA 4I81A 2AK3A 2GK4A 2FEXA 3PQ5A 1U9CA 2R8EA 4RA6A 4YJGB 1M67A 1XZAA 1ZMTA 2A9FA 2Q99A 2X41A 4JYPA 4PRLA 5IWAM 1DLJA 3VNSA 1I6KA 3F5FA 2WA2A 2G07A 3EOAI 2AEFA 1LEHA 4R4JA 1SKBA 3WDSA 3QTBA 3QUCA 2XCTB 2VQSA 1CY1A 3HBNA 1P77A 1ZIXA 3NIWA 4IIJB 1X2BA 3DE4X 4OU5A 3CZ4A 1TYAE 4PR3A 5LQDA 4B3GA 2X5KO 2QVBA 2A88A 1WB6A 1EA7A 4RXUA 1SM4A 1GTMA 1SG6A 2FHSA 3H6HA 3HZZA 5CVEA 4MP8A 5JD6A 4Z53A 1C9JA 1M0SA 1QYRA 1R6XA 1YC2A 1WQ3A 3K0KA 3PC7A 1THGA 7REQB 1X7XB 3H4JA 2RGNA 1EIJA 4D82A 3A3YA 1GSOA 4FX2A 1GSAA 2XDQA 2YHIB 5DM4A 4CDRA 2AI3A 4RA9A 4DR3B 3KDSE 1Q39A 3D8HA 5DHPA 3WGGA 3HL4A 1W36C 2Q3FA 3VYSB 3NHUA 5KSWB 2JI4A 1CR0A 2DM6A 4OFWA 1VPVA 2CEAA 5B1DA 1ZC3A 3HZHA 5C1IA 4C7KA 2FPWA 4YLYA 4D1YA 2EOAA 1A8UA 3HB4X 1VE1A 4FONA 2OFXA 1CF9A 4M37A 2EC5A 4REQB 5KZMB 3CWCA 2CMDA 1V5GA 4J2TA 4IH9A 5FI1B 2WWTA 4Z2YA 2IHVA 3TNJA 1L7PA 1LNZA 3OMLA 1FTYA 1K6MA 5CIYA 3N0XA 5FQOA 5AJHA 4RPHA 3URKA 3VR6A 1BE1A 1XZCA 4FS8A 1H8ED 4FYVA 4DQXA 3BEOA 3MS4A 3AEQA 4JNCA 1U4OA 4DARA 1NU6A 2DYKA 2H1WA 5DX8A 2RRUA 3ZX4A 5BYJA 1NOIA 1X1DA 2FPKA 2IF0A 2HNAA 1SIWA 2O1SA 2XMPA 1T5OA 1V2HE 1FDRA 2DX7A 4L1KA 3TSAA 4MR8A 3GY0A 2IYNA 4H6VA 4JLDA 4N03A 1PJBA 4BJ6A 3WYAA 1OH5A 1UT8A 3NONA 4UTOA 3TTUA 4RPLA 1Q7GA 2K2WA 3C5HA 2P2ZA 5C7LO 3L5OA 4JJ4A 2R96A 4JJ8A 3TAXA 5EHGA 2C54A 2JY5A 1PUXA 1WKBA 2OQRA 4MR7A 4AQYB 1K89A 4BNYA 1GPKA 1TUGA 2ECKA 2JAQA 1C9EA 2YFKA 5CX4A 2ODNA 1J0AA 3KJNA 1DIGA 1HI9A 2X5JO 1F2UA 2X6QA 1USKA 4KNWA 1XTBA 1RTKA 3NAQA 1P62B 4LF6M 4AQ7A 3RFXA 4EWLA 1QFYA 5DTMA 3GP1A 4FWDA 1FP4B 1QVVA 2QL5A 3RIMA 3ASZA 4FBGA 4QUHA 1BN7A 4INPA 4ND2A 1RKBA 5I4BA 5LYYA 3CCCA 1YRQA 3IIMA 1TFUA 2HMAA 1CR6A 3INNA 4NJMB 1GU1A 1E0AA 1QLWA 3U44B 4YP1A 1J21A 1YOVB 1T5DX 4HK4A 4B6QA 5MN4A 3H4MA 2XEPA 1X1AA 1XKTA 4JT9A 1FUYB 2XNDA 3NHBA 1JQAA 4ML3A 1JDVA 2XSZD 1MT3A 3OETA 1NW4A 3BHIA 1NJ1A 4Y2HA 4Y28F 3UAWA 4AKIA 2BR3A 4LYDA 1TW3A 1W4AA 3H19A 5KAMA 2PZJA 1NP3A 1Z74A 4FN5A 1LDYA 3R7LA 5A1JA 1O8CA 5C80A 1O57A 2XUHA 3KSJA 3QUQA 1FRZA 1W4BA 2GCOA 2AKAB 2OV4A 3LUAA 1ZGHA 4BWFB 4JI2M 5DVZA 1KDVA 4CLRA 3I9OA 1XTVA 3U6LA 3UCFA 3QXJA 4B4DA 1X74A 2FWNA 4B3XA 1S1MA 3B5JA 4RFVA 4TTVA 1CUEA 4ZJZA 2A9PA 1R4MB 4BGDA 1PZNA 3A3KA 1GEGA 1H2RS 1SUIA 4ZYUA 3CTWB 1IULA 1E3DA 1WXEA 3EBPA 2I71A 3U4HA 2PWYA 3VR5A 1S8AA 2A67A 1A7KA 2CFSA 2VNAA 4P58A 4QDZA 4RKYA 3L06A 1ZK0A 4DLYA 4NBSA 3KTFA 1MABA 5AVUA 4MUGA 4UDXX 2WVAA 1PWEA 3V33A 4F5ZA 4REOA 3MCZA 3I5MA 4BMZA 2ASEA 1U65A 1L4NA 3GHHA 4HFNA 4YJ3B 3SX4A 1LF0A 3AEYA 1N2HA 4FDUA 4OQNA 2I80A 1GCUA 1GLNA 2FW1A 2C8LA 1NPTO 3J81A 1G0OA 3QENA 1VKOA 2L17A 2PUTA 1ISRA 4EF6A 2NSYA 3DF7A 3MRVA 3DVSX 1XZFA 3FPBA 2ZYTX 4LXYA 2O20A 4I55A 4L4YA 2H5XA 3O5AA 3ZOKA 3U6BA 2XE4A 2DFNA 3MCWA 3S2IA 1RHQA 3AYZB 4CPDA 1KZGB 3BD7A 3IO3A 1JR2A 4G8CA 4AYWA 4B7HA 1BH6A 4EMUA 1T4GA 4B6OA 3AHEA 2LKDA 1G2PA 1T1EA 2XQVA 3OZWA 3FI9A 1LVUA 3QWAA 4NZZA 4S12A 3N2ZB 3O3MB 4WKCA 4Q03A 4ZCQA 3AF4A 3SYNA 5AD1A 2I4LA 1U3TA 2JFYA 1UAGA 5FDFA 1CQWA 2VUHB 3J2PB 1Y8RA 4BGVA 4UEJA 4EABA 3W8EA 1G6HA 1P81A 4O33A 5DK4A 3QI7A 5IDWA 1OE0A 3UJAA 1PVOA 1NO1A 1P4HA 2HK7A 4QYIB 1OJLA 1V48A 3V1NA 4A0SA 4ECEA 3PRHA 1UXOA 3NRCA 4J0KA 3ZNNA 4CGZA 4NCNA 2W5UA 4U02A 4RGBA 1K6IA 1RWWA 3E7DA 5I51A 2L09A 1JHAA 2XECA 1U11A 4YAUA 5JSFA 2DCMA 2PLRA 2J45A 2R6FA 8LDHA 5ALEA 5EPEA 1M1XB 5LMZA 4G2TA 4B3SM 1GZVA 1YU6A 1QYCA 2VBGA 1WP9A 3IEKA 1BU5A 2B1GA 4ER5A 2D13A 1HE5A 1N2IA 1Y7LA 4F1KA 5L3SA 3GJZA 1D7AA 1M2OA 5DLEA 2I2BA 2M6RA 4EPYA 2QG9A 3FCAA 2HDHA 1PJJA 1F6DA 1K63A 1YDHA 2QD5A 4CLHA 4YV7A 4NULA 4OQDA 4Y6GB 1ZN8A 3TMYA 5JQGF 3O83A 4LYJA 4C4XA 2JHAA 5BT9A 1G7SA 5LSAA 3N2IA 2R44A 3FLBA 2YIVX 2OO9A 3ZZ0A 5J23A 1M2NA 1X7ZA 5BSVA 4PW0A 5FEMA 3WGKA 1AQUA 4DBGB 1UK6A 3OTWA 2I2WA 3MWJA 4JZYA 5TX7A 2F4VM 1NJ5A 4BP3A 1UBLS 1F48A 3U7RA 3V4OA 5AUNB 2FK8A 5DNYB 1ZJYA 4PYNA 3CX6A 4XRRA 5KQGA 1VE9A 5JARA 2QMEA 1N2ZA 3T3PB 3D3EA 4N39A 2VXOA 5C9ZA 1N5RA 3JQ8B 3CF0A 1ODKA 3UYKA 4AO8A 1WCWA 4B7XA 2Z8XA 1F6BA 1RC1A 5HKKA 1V5FA 2UZ0A 4B5KA 1T1GA 2FX5A 5LYJA 3P27A 5E9QA 5EKTA 4Z7JA 1JEAA 2IP1A 4UULA 2NUTA 2IU6A 1JT2A 2QX6A 4ZANA 2HRBA 5ITSA 4U5QA 2GYVA 2X9VA 4HX2A 5K6AA 4MGYR 1NVDA 1S9DA 1KP2A 3KD2A 3M82A 2WZQA 4NZYA 1UOOA 2QLLA 2CXHA 3EE6A 4EHDA 3GQ5A 4I5EA 1LZLA 4UTPA 3F9CA 2CDRA 4DSZA 5C2JB 1Q19A 3OJXA 2VRCA 2P6RA 2BLLA 1PL8A 2ZXFA 5BW4A 5JHGB 3H2SA 2WZDA 3CPJB 3GCDA 3NHLA 1GKYA 2H18A 3PD1A 3N8GA 1ND6A 2GEVA 4XD7D 3I04A 1RAGA 3NORA 3ZI7A 1IDOA 4BNKA 721PA 4S05A 3OZBA 3RHTA 1IPHA 2ZLBA 1HETA 3AW8A 3ECCA 3K0BA 3W06A 4DMMA 3SYLA 1OX4A 2DECA 1E3QA 1PR4A 2OV6A 3AEQB 3N28A 4L0DA 4NVRA 1L8OA 4X8OA 1T0UA 1XFDA 1M1NA 2IDKA 4EY3A 5CCEA 3MJDA 1XQWA 1DGGA 3I2GA 3PNYA 1CHDA 1A98A 4KIWA 5DYYA 1CHNA 3SIRA 3TBHA 2PL5A 1ZIDA 1H2WA 1UFKA 2YXBA 2VK8A 2Y1OA 4O2LA 4Q39A 4CG2A 5DTRA 4NG5A 2GHIA 2PX0A 1VCOA 4DA9A 4NTZA 4G1FA 4QNNA 2E7ZA 4MUYA 4TLEA 3RC7A 3KELA 1W8IA 2OCPA 5HM6A 1Z0KA 1TYZA 2ZBEA 1XXHE 4M60A 2WJZB 4QGHA 2O8DB 1MTOA 5HEKA 1I01A 2HSDA 3T5PA 3CSDA 1JIVA 3R0JA 5A04A 1N2CE 4XB1A 4DR4M 1M33A 4O4JA 3Q1KA 3OIYA 4OX9M 1DEOA 2NTEA 5CK5A 3O1HB 1C7IA 3QIAA 1VCMA 4IJ5A 4OAOA 4TN1A 4D0NA 2AVNA 4ROSA 1XD8A 3WIBA 2VFAA 3PEUA 3Q85A 3AG5A 2WM2A 1JHUA 1EK0A 3MRTA 2VYCA 5K45A 3IXQA 1WPGA 4PBRA 4ND1A 3TVDA 4KQGA 2QNIA 3VSDA 4B6SA 4QT4A 2XKJE 1BN6A 2MSKA 2W2XA 3LFUA 4NRVA 4LX8A 2RJOA 4O2AB 4MWOA 1D3AA 1DDOA 4B4OA 3HJFA 1K4YA 1P0FA 1YT5A 2FVYA 4WOBA 2G8LA 4MROA 2OBMA 4PWZA 3GQ3A 2GYWA 4R7TA 5DN6D 1AQYA 3OLYA 5KTTA 4O2BF 1OHHD 5FLXS 4HCJA 1SCQA 1LLDA 2C83A 2JIRA 1G5QA 1OY1A 2V54A 2X77A 1K0UA 4TSRA 1RYDA 5FA6A 2EDCA 3S2GA 3SHOA 1Z5UA 4UM9D 3A36A 3DAPA 1A9XB 3A4VA 3TIFA 1PFKA 3DVAA 3IC5A 3NHRA 4LRQA 3VTKA 4CFYA 3PR2B 1KVSA 2R86A 2P75A 5LP1A 4RD2A 1CY4A 1AKMA 1NONA 4I1VA 1YE5A 4DOMA 1ULAA 4MVXA 2ETVA 2VDBB 1MB0A 4BZZA 3B6MA 4KJZA 1ORYB 4XIYA 4EYEA 3I09A 1XKXA 1PR3A 3TM5A 1PO7A 1UJMA 4QDUA 2CVHA 4YT4A 5FUXA 4MYSA 3E3AA 2UXCM 3BTVA 3CEHA 3V2GA 4CCWA 1XIVA 3MIZA 4M9SA 4KYTA 1F1BA 2HM7A 2QL7A 3G6WA 3OKPA 2WSMA 3EA4A 4LJLA 3TLBA 3YASA 3HLTA 4LYFA 2HQ1A 3DUWA 5TARA 3NHJA 2BMVA 4PSKA 1FVXA 3F1KA 2DWZB 4J0DA 4RVUA 2CL7X 2QX4A 2RI0A 4EPXA 1RBZA 3LK7A 1ZWLA 2ZIXB 3S28A 1FIUA 4JAVC 4G5GA 3DBHA 2CNLA 5JXGA 2MU1A 1L3IA 1M2WA 3EVCA 3SQMA 5BOVA 3L7DA 4UBKA 3UGTA 4EX6A 1TR8A 4DMHA 2EIXA 4ZN6A 4OSEA 4RHYA 2Z2KA 3QOWA 3U56A 2E9SA 2ZRDA 3K2LA 5IS2A 1OTRA 1NQAO 4GG1A 1N6RA 1M74A 1ISSA 3H6KA 4BO1A 3GVCA 4CW7A 2GM9A 4FUTA 4M0KA 4IOJA 3LV8A 3DAHA 4FGLA 2FZ5A 3BAZA 1T8RA 4DMRA 2A9VA 1OH7A 1Q1AA 3MYRA 3PB3A 5U1PA 4LXXA 1J23A 3R3UA 3SK0A 4BWYA 1EK2A 1O95A 2Q46A 3A10A 2FCAA 2QX7A 3LRXA 3M5WA 3TLZA 3TZEA 1TUEA 4MR7B 1GQYA 1Q3KA 3C7CB 3DHEA 4M0DA 4QXQA 2JJMA 5EZSA 2PYZA 2QN1A 4RKEA 2KHHA 4A5SA 3JY6A 2PFSA 2CJYA 3K2BA 1LLUA 5EP2A 1N6HA 1F8FA 4ACBA 1ISIA 1CY8A 3WWDA 1RE0A 4HEA6 4TWBA 1HNWB 4HYQA 3RAPR 2PUDA 4QU9A 3WLTA 5AK5A 1LK5A 1TKRA 5FHQA 3UTCA 4RF2A 4N9QA 5IHPA 2HW8A 1DBVO 1JHPA 4RDCA 5FOSA 2JXNA 1PGNA 3C85A 3KD3A 1ESMA 1M8PA 4WZBE 3BXZA 3KU1A 3O2NA 4ZKDA 4YY3B 5JWHA 4R0NA 4MW6A 5EJ9A 3WK8A 2KZSA 3T15A 3AO0B 3I01M 1HZZA 4TMVA 1A7AA 4G89A 3NVDA 3R5KA 4JA0A 1TMKA 1OILA 2JS7A 5BQ3A 2YWCA 5GP1A 2WT8A 2ZVDA 3FDZB 2W4QA 1Q11A 1X7HA 3OO0A 4Y1GA 3BH7A 4FMCB 3FCOA 1XZPA 3SC2B 1JU3A 4K6MA 4MEBA 3U17A 1NMSA 2NT4A 3L6DA 4TQGA 1J2TA 3J7BA 5CDSA 1P7CA 1RPAA 4TN5A 2NAFA 2Q2NA 3OUUA 4J49A 5C4MA 5HTOA 1US8A 5GJCA 3PLRA 2O2YA 3CJTA 4XTRA 4RDHA 4HFMA 3UH1A 4EUHA 1QHIA 4KXVA 3JR5A 2CFCA 2FH0A 1DKLA 3IQFA 3RE1A 1UBEA 5DNYA 3CCBA 3L7YA 3C8HA 2JD0A 1SIOA 2WUEA 4I9HA 4OLJA 1C3OA 1SKAA 4V3CA 4DV5M 4Z5XA 2CFOA 1JEOA 1QHHB 1XUOA 1YRAA 2ZKLA 4MYRA 3S44A 2PJUA 4EIWA 5C8YF 5LMNB 2E85A 2P7HA 1MX3A 1JPVA 1NI3A 4K9PA 4MYCA 1ZQ9A 2D1SA 4D8XA 3PNBA 3H3JA 3N2NA 4H1VA 2J3IA 3T1TA 1Q7RA 2N0SA 3HGIA 1NVXQ 2IUYA 3DKPA 3DUFA 4J43A 1F2UB 3OLCX 3UMJA 1BE6A 1M9NA 4FR0A 3EB9A 4KXWA 2PX2A 3L43A 4NI5A 1GRNA 1PS0A 3UHJA 1HNZM 3GBPA 4C3OB 4ZDJA 2IH4A 4B3TM 4MZXA 5AVXA 4HVTA 3NETA 1M2GA 2OXCA 4YJ3A 3DZCA 3DL4A 4PCUA 3F1LA 3M9WA 4BL5A 4DL9A 1G42A 4PSDA 13PKA 4LV8B 2NZVG 5EC8A 4PIVA 3N58A 3NGMA 5EERA 4CCSA 4LJ7A 3NW9A 3KQHA 3MTDA 3KSDO 1S8NA 4BAUA 1P0QA 3QKWA 1MEOA 5D1HA 1I3NA 1XL1A 4HQNA 2GM5A 3BTSA 2JAUA 5EWJA 1WCIB 5KOYA 1LV7A 3WNVA 4O0MA 1CDZA 1P1JA 2E4AA 1PEAA 2V7WA 1JEEA 1NSFA 3OZ7A 1OX4B 1CLUA 3RYFB 2C8JA 4MEAA 1ARZA 3V4RA 5G1NA 4R01A 4DB4A 1HG1A 5ANRB 2VUIB 3RK4A 1S89A 2IODA 1JAXA 1T9HA 3HYTA 1G5TA 2XHZA 2GCIA 3P32A 1GPBA 3KYDA 3AJ8A 1B3BA 3A4NA 4K6HA 4KPYA 2IIQA 3F0TA 3A32A 3AF0A 3A11A 3I2YX 5FLEX 3T7KA 1MTZA 3PL1A 2P1DA 2WWYA 5F4ZA 2PXCA 4O59O 4HLQA 1AA6A 1FF9A 4L5BA 5KNBH 4RNDB 1T4CB 2RDMA 3UHFA 1HKHA 4KQ6A 1WXWA 2TSYB 1H3FA 3RYFA 3RADC 1Q1NA 4R68A 4UZFA 1CVIA 2G77B 3L27A 4IRUB 3QF4A 3T35A 1N5LA 4REQA 2L7IA 3DZDA 4KUGA 1DAIA 1I80A 4XYGA 4CKWA 3ESAA 3TKYA 2ZROA 3UM9A 1L8AA 3JZDA 5IKOA 3EIXA 4RTSA 1ZEJA 5AJVB 2QB5A 4AMGA 3V9PA 1UXHA 5JH7F 3TWKA 4Q66C 2XQGA 2FRDC 1E4VA 2AOWA 3LW8A 5F2OA 3ZVRA 1L5OA 4LWOA 1N0HA 4DA0A 4PC3A 2PS9A 4N0DA 3RUFA 1FS4A 2ATIA 2GZHA 1Z6AA 4OYRA 1MH9A 2DWLA 1IATA 1ZISA 2I8AA 5H16A 3VPBA 2DOKA 3HBFA 3B13B 3AVPA 5LZ8A 2EYUA 3IMFA 4XOUA 3UATA 4G5FA 4U6NA 1CUUA 2ZT6A 1UEIA 3OF3A 4WKNA 5DW3A 5LKRA 5LD2B 4N4AA 4EI8A 1NQ5A 2QSUA 1N5DA 4DV2M 4P86A 1L7VC 5E4JA 3PWKA 4UFPA 4DR7M 2EBHX 2YJTD 1W0JD 4OFZA 5L7YA 3JQFA 2WD7A 3CW9A 4C08A 4DDUA 4BZXA 4BUJA 3L04A 3ESCA 2DFPA 1ORHA 2XT6A 1WXHA 2TECE 2VNKA 2IZ7A 3BWXA 2GEKA 2XMSA 1CDOA 2JJ2D 4HDKA 4B46A 5BNWA 1G38A 3DBIA 5DKFA 4ARIA 4AZ3A 3E5HA 1N5KA 3HU1A 1DBQA 4QGFA 3HGQA 4HO1X 2QZZA 2IP4A 4U5XA 4DIKA 4JU8A 4J0QA 4UPDA 3G1TA 1OT5A 1Q20A 3ICQB 4L57A 1YL5A 2CZGA 5B64A 3EEOA 5ECWA 3FOCA 3GX1A 4YQFA 4GMHA 4IDCA 3UAYA 3HSKA 3W90A 3N2YA 4ZREA 2UZ3A 5K3DA 4NMMA 1WB9A 3AHCA 4F71A 2DZNB 5JC1A 4MRSA 5FBVB 2UYOA 3WJ2A 2H2HA 4NJEA 2VTVA 5A7GA 1G5RA 2O3RA 5J9FA 2PXAA 5C8YA 1Z2PX 3HN7A 3OU6A 4N3BA 5J43A 3RUAA 2C7QA 4DR1M 3T5BA 1BHO1 4YREA 1H3NA 1VM6A 3FVQA 2O2IA 2RK4A 4GEGA 1SBIA 4KPEC 1EDEA 2ZCVA 3QTTA 1NXWA 2A2ZA 3L46A 1XRQA 3UW1A 4CMAA 4Q4HA 1NULA 5JEEA 3R9WA 1RXSA 1W25A 2QN9A 3AERB 3F71A 3LJKA 3PC4A 1AB6A 4P4SA 1X7DA 5FAKA 3LW5F 1FMTA 1G6OA 1SD5A 3QKRA 4U2FA 5CXUA 1Y1SA 1GPH1 1P4JA 3G0IA 3MJ5A 3EGEA 3VDUA 1IBMM 4RMIA 4E11A 7MDHA 4ISCA 2Y05A 5LFAA 3IEUA 4L9SA 1IM2A 2YV4A 1ZNXA 3QWFA 4M1EA 3RO7A 3SJ7A 3AOGA 4BFUA 3M81A 1M7HA 4IQ0A 4PLPA 1OLXA 1DO2A 1ZC4A 3DFFA 3L7MA 4CMEA 2NG1A 4DLBA 5LBTA 4XVRA 4A2PA 4JI7B 4WLOA 3DHNA 4TTRA 3E27A 1ONSA 3DAYA 1AKYA 1ZDMA 2H1VA 1Z0ZA 4YAJA 5E4TA 3SMQA 1KEKA 3K8QA 5ENDA 2OAQ1 1H1TA 3GJTA 3QE0A 4G1VA 4GMDA 3TPCA 4BEJA 1BVYF 3DAFA 3UK2A 1UANA 4GXTA 4HDMB 3VR3D 4PNHA 3SZLA 2MR5A 3CB2A 2DJIA 2QJOA 4PZYA 2ENUA 2LTAA 4I5FA 1OFUA 3X3HA 3ZOZA 1M6NA 5ENZA 1PJRA 4HQOA 4AP6A 1KY2A 5LD2C 1FU7A 3GZNB 4FHEA 5DSZA 1W49A 2L82A 5EN4A 2O5EA 1C1YA 1L7BA 3FPAA 1JFFB 3BTUA 1X92A 1E9SA 2WWRA 3AF1A 3QUTA 5IREB 4TXMA 2ZITA 2RD2A 3KVWA 1GN9A 4LF4M 2X19A 4O6VA 1R0SA 1RHRA 3IS3A 1SCDA 3CF6E 1TZJA 3DG9A 1JV2B 4QXPA 4RHEA 4TV8A 1A2QA 4FT4A 4ZVOA 4C1NA 4DRXB 5J3JA 4YA6A 2DWOA 1ODFA 2ZYAA 2WVJA 3K94A 1H6AA 1T4BA 1AO3A 2FEOA 5IBPA 1VG8A 3GMIA 1I9GA 4E5PA 1E7RA 2IYOA 3RYCB 4CEHA 4UM5A 4JJZA 3T6KA 1HDRA 1Y6ZA 2W7TA 5M2QA 2VATA 3ORFA 1VA5A 1PDWA 1VXRA 1Y8RB 4NYMQ 1T9AA 3G6KA 4UNSA 5A4IS 2W0SA 3C6YA 1PT7A 1RFGE 1W6RA 3CF2A 3FX2A 3LNTA 5FI5A 1Y8ZA 2ODAA 1ZINA 4E5VA 3IP3A 3ZY4A 3FR8A 2VZ0A 2OFOA 1XE3A 4KN8A 4QEZA 3S5UA 1ZJ5A 3F7OA 3ZKAA 1PK8A 1J9GA 1NRJB 3ZWAA 4EH1A 1DKQA 1GUZA 3DMRA 5HUQA 1ODCA 3HJCA 3ME5A 4PD2A 1YIOA 3KNZA 2FSIA 5LOVF 1N2GA 5I7AA 4AP5A 4B35A 3OUTA 3I51A 3CINA 1QYDA 4O4HA 4K46A 3R75A 2V98A 4BRZA 3HBAA 2VDJA 3FCEA 2XB9A 2ORYA 4GYKA 2QRVA 3T3NA 4NSRA 4KB5A 3KOWA 1IVYA 5DP1A 1XTUA 3RS4A 1P5HA 1Y5LA 1E9BA 2GHTA 4BUZA 3FYCA 5JAQA 4LXHA 1QG2A 2LBCA 2ZJ1A 4OHMA 1NUHA 4AUKA 1N1DA 1NBEA 1WCIA 4CYMA 4G0WA 1SBQA 1DWQA 2JD1A 4Y6OA 1Y1TA 2L42A 1IN4A 3K0CA 3L2AA 1XMXA 5I9TA 4BCCA 1NJFA 1Y63A 3DE0X 3CRNA 2DG2A 1MB3A 1U8FO 4C04A 3U6OA 3JQFC 4ERNA 4D02A 1OAKA 2AUTA 3DW1X 3P0FA 4KYIB 1HR0B 3D59A 2A0UA 3AHFA 2Q6LA 1EHIA 5IT9A 1BYUA 5KNBD 5KS2A 4XWWA 1G6KA 4DUZB 3EPLA 4CLDA 4KKVA 3O2QB 2CHUA 1PRYA 3C7AA 1EHCA 4KGXA 5TXGA 4QYXA 4TOIA 3IE0A 4CDGA 3QFFA 4WN9B 3CR7A 4ZVVA 2BKAA 3DULA 4HDCA 1I1HA 3WOVA 2A1TR 4G1UC 3SGLA 1SOAA 5HW0A 5HHTA 2P3QA 2O2CA 1NA5A 2QR5A 2WBLC 5EYPA 1OQAA 4B83A 2BJVA 3WIOA 2QLNA 4UM8B 2H1FA 1VFNA 1WP4A 2FHPA 4HGRA 3BE6A 1GXSB 1RCTE 3F6YA 4EP1A 1UC9A 5NULA 5AW0A 1FNNA 2O8BB 5JSHA 2VQ3A 1VKJA 5AOAA 4D9EA 1EB9A 3BE5A 3WQBA 3C8MA 3DEZA 1ZMVA 3DFZA 2GBIA 2LNHC 3W7BA 3MOSA 3JV7A 1X38A 4GPD1 1YTLA 4X7BA 2M6KA 1CG6A 2Y1FA 1XMSA 3BGVA 4OGKA 2YBEA 2QN3A 1LSUA 5EA2A 5BYAA 4BPRA 5KYTA 3B7QA 1Z34A 3UOGA 2Q6OA 1T4DA 2RG7A 2AG5A 4NMHA 4O3FA 4Q9DA 3IVRA 3LLUA 4LZLA 4RZHA 4URWR 3EY9A 3G9TA 3ZHTA 1FP4A 5AI0A 1R0BA 3ZDEA 1PBTA 2JIMA 3KLOA 4HLUC 3VTFA 2G5TA 3PUJA 1KZHA 2ZJ6A 1Y5MA 3EJWA 1BVUA 4TS4A 1RHMA 4W6QA 3RRMA 4G1MB 1Z8DA 1L3CA 2W2VA 4HAOA 4AJ1A 4AW4A 4V39A 3ICEA 4BNMA 3B3AA 3NGLA 4IMPA 1YZKA 1NTRA 1VDDA 2SICE 4ODIA 3OC6A 1BKDR 4L72A 4NE7A 5F73A 3K72B 3LUCA 1IHPA 5TPZA 5JMWA 5TF0A 2FPGA 5T3YA 3B70A 3MBIA 3DZBA 2WEKA 1IPFA 3JATB 3F92A 1YKSA 4G0NA 3SXUA 2WFLB 2FS1A 2XLBA 3GFSA 5B12A 2OCYC 1G18A 2IZ5A 3ET4A 2H4FA 2A1IA 3HKCB 1TMGE 1LQTA 3IILA 1JBQA 1KQ3A 4MCJA 5JVDF 4DQ0A 4MDFA 1YE3A 1QCZA 2DWCA 1Q3TA 4RKRA 4TL9A 4Y2YA 3MC1A 4LZAA 4G0UA 2QLJA 3FKQA 4XAQA 2R8PA 3LDAA 1U2GC 2OZLB 1FYDA 1AIPA 2ANCA 1IRIA 1QH8A 3KP1E 4GI7A 4L8WB 1NBME 2QMHA 4D9CA 2YHSA 4TM8A 3I9JA 4MS1A 1ZH8A 4C6HA 3ISVA 2CNOA 2HN9A 1V45E 3D8LA 4LDPA 1MC8A 3SICE 4L76A 4FWTA 1W7AA 1CNMA 1H8EA 3TSWA 3UMBA 4YUYA 1YL6A 2LVNC 1AOXA 2MWMA 3FJYA 4F5EA 5LVAA 2OORA 3DOFA 3OF5A 4R7GA 1FS5A 2WD8A 1AURA 2QHOB 4QOFA 1FNSA 2AQHA 2VJNA 4MA4A 1HNNA 4YJ3F 4F86A 2I67A 2FEWB 3CF6R 5J47A 4ZQCB 4HVAA 4EPWA 1L4UA 3A31A 5EIEA 4HS4A 1JPUA 1GQRA 4UXJA 1SWWA 1C3OB 3KZ1E 1YLAA 3GPCA 4JVOA 5DX1A 1NVGA 4IGAA 4PHTA 4ZEMA 4Z4FA 1FNCA 1PSDA 2BZ1A 3SAUA 2VSOA 1ZA1A 3PFHA 4MHSA 5FBQB 1AO0A 3FWYA 3MCTA 2LIVA 3OOHA 3RBVA 3MCVA 3JQBA 4LCEA 1TA0A 4JOBA 2ODWA 1HSOA 1Z6QA 2LDBA 4KNYA 3GFBA 2P11A 4DSNA 4TS1A 3GFQA 4UBOA 4FR5A 4YRPA 1WABA 4P38A 1C4OA 4YROA 5FI0B 1JILA 1HURA 3HCFA 5EZYB 5EHZA 2PCLA 2VP4A 3HRKA 3BKXA 4RACA 5CYOA 5HIIA 2X9GA 3M2TA 2PV7A 3L77A 1M34E 3EG9B 5CG2A 4KI0A 1W35A 5KI6A 4X20A 2IZOA 2R18A 5K6RA 4D4KA 1TE2A 3GRFA 4URZR 3SE0A 4TV9B 1AM4D 1QP4A 1RTTA 4TKMA 3CNQS 1NHGA 2QLMA 2D7DA 1BDIA 2EKBA 1JSRA 4F8EA 3VR4D 2VQFM 1P7VA 4HB0A 2GZSA 4R83A 4Y9TA 2QRHA 2XSZA 1T2FA 4W1PA 1FQKA 5E2BA 4U9HS 2WJPA 5FO1A 4KFCA 1DAKA 2GN6A 2ZOSA 4YXFA 5CTAA 4TSFA 2QTAA 4UCWA 5FPKA 4JT2A 2R2GA 1KMHA 1JG2A 3TW6A 4EVQA 2RB4A 1APBA 2X2EA 1AUAA 3AB8A 2BBTA 1DVRA 2HC9A 5CAEA 5CLLA 4BLTA 3BD6A 4JR0A 3WNQA 4DEVA 2BAGA 3K0AA 4RBNA 4ND3A 4WJLA 1GNTA 2P8SA 4AJHA 3WL4A 1VEKA 4N49A 2OQIA 3HUUA 2Y76A 1A9QA 2A5GA 3H2JA 3PNMA 3KP0E 5EE1A 1D2CA 5GY7A 3OU2A 3SEAA 3T5CA 1V7ZA 1X7ZB 4B8WA 1BMFA 3O47A 4WXHA 5JS8A 4HUJA 1P7WA 5E4FA 2J0VA 3MJSA 9LDTA 1U31A 2WE7A 2R6ZA 3DMPA 5I7EA 1CE8A 3FCXA 3HB1A 5KYYA 4AJKA 3QVMA 3SFVA 1SGWA 3B3FA 5C8YB 1CX9B 3WNCA 1ZRMA 5AJUA 4DADA 2ATEA 1K4MA 1R0LA 3QFRA 1GRVA 3HZJA 4QWWA 2KBEA 4ETWA 5LU8A 4YCAA 4IZIA 1ZZEA 2BFMA 2GJ8A 3R20A 4QOSA 3I52A 4YRFA 1M6HA 1Z62A 1Y6RA 1DDIA 3ML1A 4YCNA 3UPUA 4GOXA 2J9FB 1DEHA 1UJNA 3ESBA 3P2KA 4U7PB 4UQPA 3QYPA 1Z0SA 2D6FA 3GA0A 2EGHA 4NOKA 2C4MA 2O0HA 3TOXA 1GRQA 2VLIA 3W2EA 5FFFA 1ZIYA 3P0RA 5PNTA 5KO2A 1TCBA 5BN4B 3FNHA 4BLVA 3MELA 3HEAA 1SOWA 3DR3A 4XX0B 5IVHA 4KN6A 2CUTA 1CUVA 4P2BA 1CEYA 1M8GA 5EPUA 5HRUA 1MIHA 4ZVSA 3WDLA 3WGNA 2C4KA 2NADA 4R5MA 3CX8A 1SHJA 2IX9A 3C14C 4Z0NA 3D4OA 3FE3A 2KBFA 2Q5HA 4N8EA 3EEIA 4G4RA 1X7XA 2I66A 3FLAA 2DE0X 3OJEA 5BSWA 2KXEA 1PX0A 2NZ8A 2CF5A 2MSCB 2XDQB 2YHIA 3SOPA 3ZLBA 2JB9A 5LUAA 1P2SA 3CVYA 2F3TA 4XIIA 2PX8A 3OPNA 5IZ4A 1E18A 2ZGVA 4A3VB 2Y2VA 3G9UA 2QMQA 3K09A 3U4IA 2CLSA 3RU3A 4V1CI 4IF4A 1CB0A 3KPJA 1GD1O 3I9V6 4G5YA 4WTOA 3VZRA 4CF4A 5KU7A 4N9WA 1TAHA 5A71A 3ZLVA 1A50B 3DCYA 4WY2A 1FX0A 1JHXA 2VO1A 1XYVA 3DXFA 4D57A 3L82B 3L7AA 4KL8S 1KBOA 3I5XA 1Z37A 4GBED 2P90A 4EEKA 1DX9A 4IMRA 4G4NA 3UAXA 1VIVA 3HO8A 3DLCA 3RBXA 3ZDZB 2PFGA 2CD7A 5ITTA 2JLXA 3HSSA 5IDXA 3WMGA 2AC2A 2P3SA 3DPSA 1PZMA 2ZZKA 4JHXA 1YHNA 4EQZA 2D1QA 3DQZA 3UN1A 3V3TA 4Z4CA 1JB1A 1Z4KA 4PV7A 5CUQA 5SZKB 3WO1A 3ER8A 1SMKA 3Q2OA 1EGQA 3A9RA 5AI8A 5CT4A 2JKYA 3BK2A 1KSFX 1PQ4A 3B2EA 3INYA 1C7JA 3MTJA 3N53A 4B3RB 3ZWCA 5CPFA 1JZQA 2DU8A 2YFYA 2AFHB 4RZQA 5IN5A 5B37A 4RCZA 3RGPA 3JQ7B 2WSSD 1SZCA 3I8OA 5AP9A 1LTHR 1KP3A 2FMXA 4FMBB 1E69A 4YUAA 4O63O 4GLOA 4Z8YA 1KR5A 2Z56A 2CLIB 3QXSA 4HF7A 4Y2VA 1G3QA 5CHEA 2QQEA 2PUFA 3CUWA 3PS9A 4BTVA 1JKJA 3INGA 5ALMA 2QM3A 3QXXA 2BELA 4IZOA 3B5EA 4OFBA 3EASA 1ZGAA 1AKQA 1MJGM 1KNQA 5LMUB 4TZ6A 4G1BA 4WASA 1N3BA 3GROA 4E6PA 2IGTA 3AEUA 2CDNA 1V43A 2EKLA 5EJ5A 2OO5A 2EO2A 5K0TA 4HLNA 1IBCA 2PZLA 3S0JA 3BE4A 4NBTA 2R5WA 1MPXA 3NP7A 1PSZA 3AY6A 3KZOA 1JTEA 4CRWB 4X62B 4Y6QA 3GC6A 3H9JA 1DKNA 1WTAA 4W7HA 3D43A 1MXHA 4TZ0A 3RG8A 5TS3A 4LYYA 4N48A 5A9TA 1MO3A 4KFUA 4I4CA 4MS1B 1S7GA 3KRTA 1O94D 2COKA 4PBSA 4XTCS 4JYMA 4OGWA 3K70B 1ZQ1A 1XZLA 1BHJA 1L5QA 1ZGZA 2FOXA 3QU4A 4NDZA 5JNTA 3HJGA 4C1BA 5JRDS 5JYDA 1WIVA 1SXGA 1CFZA 4P5PA 2V7PA 4QFBA 4W9MC 4ILKA 3OQMA 4Q1FA 3OT5A 5F78A 3NTUA 2AYZA 3SU8A 3MJEA 3T34A 2WF5A 2F5PA 2WSCF 1PS9A 1QLJA 3V7YA 5K8UA 3S81A 3VYRB 3SATA 2I6QA 1M2JA 5LJLA 1AKUA 3QPCA 2CV2A 2WQZA 1GUFA 1NI4B 4G4IA 1NMZA 5BSUA 4P0QB 3FD9A 2RAVA 4QA9A 2K7FA 4BMCA 3DWFA 3S2YA 2JIZA 3LFHA 4HDOB 4IXDA 4KVAA 4PT5A 4QL3A 2GZAA 2XGSA 2JFNA 2H11A 4UE2A 4XQGA 3REGA 1B74A 2V97A 3WKCA 3K1AA 2FUG1 1GAXA 4IV8A 2HLDD 4OJTA 4RF0A 2JY8A 3SJUA 4C6SA 4MYTA 2GN1A 3EPPA 3NC1C 4P7BA 5CDYA 1EE9A 4GX5A 2QTTA 2R7AA 4J75A 2VNHA 4BNWA 4G63A 2JRCA 4OHOA 3D9QX 4MO9A 5CURA 3KXLA 1G4UR 3OLWA 3QE4A 2ZBVA 1DB3A 5GONB 2GCGA 2A5FA 4NXMB 1NC1A 3IP8A 2O8NA 3LDFA 4IICA 1LSSA 4DABA 4E15A 3WKBA 1CZHA 2ODQA 4K9LA 2G5GX 2ODBA 1D9XA 2O3JA 3B5IA 4H3SA 3GJXC 2BFFA 5JH7A 1WSWA 2GD2A 3I2JA 4CMJA 3FPLA 2A6PA 3K7EA 4K40A 4X6XA 1P44A 4RVNA 4DGSA 4PE5B 1BHQ1 1XAIA 3VR0A 4U9IS 3HJTA 2JGLA 3QNUA 3PC2A 5FT9A 4DR7B 3OBIA 2J59A 4FQ8A 3PKJA 1RKQA 1CUXA 1W6UA 2CHEA 4U7TB 5EE0A 5BWCA 3U6EA 2VPZA 4MVJI 4C3VA 4DAEA 4CEJA 2TS1A 3KYJB 4HJRA 1QANA 1J7JA 4H1UA 4Z6KA 3L26A 4IHAA 1KJ8A 2BKEA 1E4OA 1YCFA 4LK2A 1UDBA 1VJRA 2ZI7A 1J06A 1JB0F 3T5TA 3CCFA 2CVQA 1Z2AA 2AFIB 4FR2A 4PM4A 3TKAA 1FJXA 1UBGA 3A42A 2JDIA 2R1VA 1E3EA 3GXBA 3Q4GA 2DETA 3EQZA 3FD8A 3MWGA 4PICA 4UU1A 4BAZA 2XTJA 1BXGB 1USIA 3EIQA 2HHAA 5DYIA 1O54A 2HF9A 1GLGA 4WW0A 4CTNA 1KO1A 2JLRA 5KQLA 3PXUA 1B8OA 1US8B 2J3MA 1UPXA 1ND5A 3D3WB 2H59A 5M3BA 3ROEA 1NY6A 4CVNA 3GLGE 4CTOA 2JZNA 5F76A 1NT4A 5D6NA 4AS3A 2ORVA 3NDBB 3D2BA 1QO0A 2FR0A 3ZH9B 3KSXA 2WPDA 1C7YA 3C97A 3DDZX 4L4SA 4Q1DA 5LN1A 2DFDA 3AEXA 1S8OA 2EP5A 2Q7OE 2X5XA 1JEQB 1SB8A 2RCYA 1UWLA 3G8BA 3QMPA 2GESA 2Q4OA 4JBIA 4TQ9A 4NU0A 3TGPA 1LX7A 4AZWA 1ADGA 3K9HA 4OI0A 1M2OB 5F98A 3CRMA 3TZCA 3IBTA 5C81A 3EN0A 4RELA 1E99A 2NWQA 1NQOA 2A57A 4P4UA 3LRPA 4O2BA 4DRXA 3B1JA 3G9QA