3GRVA

Crystal structure of the complex between adenosine and methanocaldococcus jannaschi dim1
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
262
structure length
262
Chain Sequence
QCFLIDKNFVNKAVESANLTKDDVVLEIGLGKGILTEELAKNAKKVYVIEIDKSLEPYANKLKELYNNIEIIWGDALKVDLNKLDFNKVVANLPYQISSPITFKLIKRGFDLAVLMYQYEFAKRMVAAAGTKDYGRLSVAVQSRADVEIVAKVPPSAFYPKPKVYSAIVKIKPNKGKYHIENENFFDDFLRAIFQHRNKSVRKALIDSSKELNYNKDEMKKILEDFLNTNSEIKNLINEKVFKLSVKDIVNLSNEFYRFLQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding of adenosine-based ligands to the MjDim1 rRNA methyltransferase: implications for reaction mechanism and drug design.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
molecule keywords Dimethyladenosine transferase
total genus 89
structure length 262
sequence length 262
ec nomenclature ec 2.1.1.-:
pdb deposition date 2009-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3grvA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3grvA01
4HG2A 2PBFA 4BLVA 3LBFA 3CKKA 2UYHA 1JQDA 4MQ4A 4R05A 4ZTBA 5GIPE 2G1PA 2PX5A 3EVZA 4RTSA 2IH4A 1VP9A 1AV6A 2XYRA 4C03A 2ZWAA 1P1BA 4CTKA 3F4KA 5CVVA 2V74B 2WA1A 3ANXA 3MTEA 5EEGA 1NW6A 1G8SA 3BWMA 4HC4A 3TKAA 2QE6A 4R6WA 3I58A 4OA8A 1XCLA 3MGGA 3AY0A 3B89A 3PS9A 5LQCA 4FGZA 5FA5A 3UWPA 5HIIA 3GWZA 2P3LA 3SX0A 2Y1XA 4RWZA 1DCTA 4HSGA 3HM2A 3B3FA 1VQ1A 4PIMA 5CVJA 4F84A 5HOQA 1YUBA 1ZG3A 1EAMA 2IPXA 3L8DA 2DPMA 4X1OA 2PLWA 3B7PA 4ISCA 3TMAA 3SXJA 5ICEA 1UFKA 3NVKI 2ORED 2V7EA 4NECA 3FTDA 2IFTA 3KQMA 1G6Q1 3FUUA 1INLA 4PYQA 3SSOA 1KR5A 1B42A 3GCZA 4DCGA 3OU7A 2QRVA 4RTRA 4FSDA 2UYCA 1P91A 1NW8A 3R0QA 1JG2A 3EVFA 1JG1A 1X1AA 3KQQA 4EKGA 2YR0A 3LECA 3SSNA 1JQ3A 3KU1A 3UZUA 5DTQA 3FTCA 3E7PA 1SQFA 4F86A 5LQNA 1KPHA 3KQVA 3KPWA 3OE5A 2AN4A 3I5UA 1R00A 2OBFA 2P35A 1HNNA 2ZIFA 3R3HA 2PXXA 4Y2HA 3SVZA 3ELYA 3WSTA 4PYLA 2YXLA 2H00A 3DXYA 3EVDA 1X19A 5ICFA 3X0DA 3EVBA 2IBSA 3R24A 1DL5A 1WY7A 2AOVA 4E2WA 2OO3A 4XUEA 5T64A 1ZGJA 4MHTA 2EFJA 3HCEA 2QY6A 2ZLBA 1BC5A 1WG8A 3EVGA 5EKXA 3UJBA 5EZQA 5DWQA 5FULA 2P40A 2YQZA 3UA3A 1KYWA 4C05A 4ER0A 3ERCA 5HIKA 3PTAA 3FUXA 5C1IA 3GRVA 5DM2A 1JSXA 2GA9A 1I9GA 3A7EA 3NDJA 5K0NA 1JTFA 3JWIA 1NW7A 4DCMA 4DQ0A 1R8XA 3EGEA 5BP7A 4RVHA 1G8AA 1V39A 2VZ9A 4PCLA 4U7TB 3PT9A 3TQSA 5KQSA 2OKCA 2I9KA 1RI4A 2G8NA 3MERA 5IH3A 3IHTA 2G71A 2XYVA 2YTZA 3AWIA 3B3GA 3BKXA 3HVKA 3M6UA 2K4MA 3LKZA 1VBFA 3PFHA 4OBXA 4A6EA 5IKMA 4DA4A 2IBTA 4GC9A 2BR4A 3AJDA 1FP2A 4PINA 5FWDA 1VE3A 4XUCA 5EMLA 2HR1A 1JQEA 1I4WA 1O9HA 2ZBQA 3KQPA 3SM3A 3G8BA 3GDHA 3OU6A 1BOOA 4PYKA 3MHTA 4M36A 2AOUA 3P71T 4HGYA 4XUDA 4GUAA 4YMHA 3DMHA 2OZVA 2YX1A 5F2KA 3RW9A 3FPEA 1N7IA 2O0LA 3FPHA 5EC8A 2P3QA 5HZMA 3KQSA 2OB2A 1L3IA 4PYNA 3DLIA 4BY9E 4QVKA 2IIPA 3KHKA 3LCVB 4E70A 3O4FA 3T7SA 1JG3A 5BW5A 2NXCA 1NW3A 2PX8A 1XVAA 1EQAA 3M6VA 4BLUA 5CIYA 2N47A 2FCAA 3OFKA 5EMKA 4RTMA 4Y30A 2B2CA 2ZZNA 1YFJA 2AOTA 3G7UA 1P1CA 2ZTHA 4EK9A 4DKJA 1ZHFA 5K0FA 2ZBRA 3UA4A 3A25A 4E2YA 2GS9A 2JG3A 1O9GA 1G60A 2NP7A 1XTPA 3BKWA 2ADMA 3BWBA 3NWBA 4KRGA 2F8LA 5DTRA 2FK8A 2OYRA 3NW9A 1NV9A 3TM4A 5K0BA 1Q0TA 2BR5A 3G2QA 3FUTA 2XVAA 1EIZA 3ELWA 2C7PA 4DZRA 3FYDA 3A4TA 3CGGA 5DM1A 4OA5A 3OCJA 2UYOA 5EOVA 2PV0A 5FADA 9MHTA 4CWAA 4R8SA 5BXYA 2CL5A 5C9ZA 3BT7A 1KHHA 1Z3CA 3H2BA 4AZSA 3UJCA 3S68A 1KPIA 4YUXA 3G5LA 3P2KA 2ZVJA 5EIWA 2BM8A 4ER6A 5CVDA 2FHPA 4PCAA 2HV9A 3KR9A 1RI3A 4HH4A 5C0OE 3OZSA 5CD1A 5CCBA 2ZZMA 3LBYA 4GQBA 2JHCA 4HRAA 5GM2A 5E8JA 5D1NA 4RVFA 5FUBA 1D2CA 5EHIA 4KW7A 2IH5A 2NYUA 4YUZA 2FRXA 1XJ5A 4YV0A 3EEYA 1SUSA 3CCFA 5EGSA 3I53A 3GJYA 3SR4A 2JH8A 2PX2A 5E2AA 4PNEA 1OR8A 3AXSA 4R6XA 4WVLA 4OBWA 1R8YA 2AOXA 4KIGA 5FCDA 4RTJA 2AVNA 2O07A 4K6MA 4EVIA 2C7QA 2XBMA 3MTIA 3LKDA 2NXJA 4PYMA 2GB4A 5HEKA 1RI2A 2UZ4A 2ZIEA 2Q41A 3EVEA 2ERCA 4RTOA 4LECA 5F2OA 1Y8CA 2PY6A 5CCXA 1L1EA 5MHTA 2A14A 4PYOA 4EKIA 3E8SA 3R6TA 4PGGA 1JSZA 3UJ7A 3TKYA 1NBIA 5CVUA 2VDVE 3UJ8A 4FT4A 1VP3A 5GWXA 3R9XB 4PONA 3HTXA 2AOWA 2R3SA 3CBGA 2PX4A 3HP7A 3ME5A 5H02A 1BHJA 2P3OA 2OXTA 3HA7A 4OX9Y 4CXMA 3KPJA 2GAFA 2PGXA 4V0RA 3C0KA 5FQNA 1G38A 4CTJA 1X1DA 5K01A 1NKVA 4GBED 4EMSA 3FTFA 5T67A 3PLAE 5E1BA 1XDUA 2HMYB 3E05A 5EG5A 4KDCA 5KVAA 5DTMA 2BM9A 5E9QA 4RTPA 3G5TA 3HCCA 4X63A 3JWGA 2G72A 4QTUB 5P8WA 3FTEA 5DM4A 1WZNA 5D1HA 2YXEA 2GH1A 2B3TA 3G89A 1KIAA 2AOUB 4WXHA 5LQAA 2EX4A 3T7RA 3U81A 3LDUA 3VC2A 2LD4A 4YUWA 1NV8A 3HVIA 5F2NA 5JR3A 1SQGA 2O05A 1IY9A 7MHTA 5HIJA 3OZTA 4GOOD 1QAMA 1RJFA 1SKMA 2CKDA 4QQNA 4PYIA 1YZHA 5EPEA 5LQRA 1QAOA 2JHPA 2ZFUA 1VIDA 1AQJA 5FHRA 3QOXA 3EGVA 4EQZA 2GPYA 3V97A 1AQIA 2C7RA 2PT9A 4IV0A 1IM8A 2HTEA 2ZULA 5E8RA 5LSAA 3TPZA 2PT6A 2ZW9A 5HFJA 4HTFB 5K0GA 1XCJA 3DOUA 3GNLA 1VL5A 4IV8A 8MHTA 3UFBA 5EMJA 4RTKA 3SMQA 3P2IA 3VYWA 4DMGA 3ELDA 3MAGA 3NWEA 3PX2A 3KQYA 3FPFA 5DSTA 3TR6A 4GOMD 3HCDA 5FTWA 2P1DA 2JH9A 5DX1A 3LGAA 1QZZA 3VSEA 4QPPA 3LHDA 3JWJA 2ONZA 5G02A 1JTEA 5GP1A 5KS2A 4P7GA 2AVDA 1M0EA 4BP1A 3TLJA 3AXTA 1YB2A 3SSMA 3I9FA 2I6GA 3KKZA 3ID6C 3Q87B 3B3JA 3BGVA 1QAQA 3DXZA 3EVAA 1EJ6A 2PWPA 4AZWA 4E32A 3UBTA 5EEHA 5T6BA 2Y1WA 2I62A 3G2OA 3IEIA 2EG5A 3CC8A 3LDFA 3P9CA 4KVZA 1PRYA 5DX0A 3NDIA 5ICCA 4IKPA 1ZGAA 3ORHA 3P8ZA 1KPGA 5K0JA 2Z6AA 3LL7A 3D2LA 4CKBA 1WS6A 5EQJB 4RTQA 2E5WA 2NXEA 4KWCA 1KYZA 4ER3A 1D2GA 3HNRA 4H0NA 2WK1A 5DSXA 1TPYA 1XDZA 3HEMA 4P7JA 3KR1A 3M6WA 2PKWA 4PGHA 1RJEA 3LX6A 4E31A 2AN5A 3FPGA 4P7KA 2WA2A 2IGTA 5GM1A 4QDKA 3THSA 3THRA 2H11A 4JXJA 2PSSA 3FRHA 2VP3A 5LR6A 1FPQA 2QRVB 3DUWA 3K6RA 4X41A 4C04A 5GOZA 5EHGA 3EEOA 3C6KA 3GO4A 3ER8A 1PJZA 2DULA 3GRZA 3HA5A 3M70A 3MQ2A 4MTLA 4E2XA 3OZRA 3KR0A 4ATNA 4YV2A 3OPNA 4C08A 3REOA 3BGIA 3EGIA 4M38A 2AR0A 4GF5A 4IWNA 1H1DA 2XVMA 2OY0A 2PXCA 5K09A 4RTNA 3OFJA 10MHA 5LQKA 1MJFA 3CJQA 3BXOA 4QPNA 5DLYA 2QM3A 5K0CA 4G56A 2IH2A 3G88A 1NE2A 1L3BA 3O31A 2BZGA 5EZSA 3VC1A 1U2ZA 4ER7A 5BW4A 3ER9A 4F85A 4FR0A 3SGLA 2Z6QA 2JJQA 1RJDA 2KW5A 3A26A 4GOND 1NT2A 3DXXA 3T0IA 3P97A 1N7JA 3KQWA 4E33A 2VDWA 4MIKA 3OU2A 5CUQA 4DM3A 2R6ZA 2IDJA 1F38A 3G2PA 1L9KA 5FHQA 1FP1D 4RYLA 3DLCA 1T43A 2H1RA 1VPTA 2P7HA 3DMGA 3JWHA 3PFGA 1TW3A 3P2EA 3GGDA 4FT2A 3Q7EA 4KDRA 3P9KA 3CVOA 5ERGB 5K0EA 4RVGA 3DMFA 4BP3A 1ORHA 2FPOA 2P8JA 1IXKA 3HA3A 3O7WA 2NNWB 3C3YA 1DUSA 3DR5A 5KQRA 2P41A 2ESRA 4QVGA 4LWPA 1KP9A 4B17A 4C4AA 2Z6UA 4RSRA 5M5BA 2UYQA 5CM2Z 2B78A 3IYLW 3KQTA 5K03A 4P7FA 1ZKDA 3FUVA 3M33A 4U7PB 3UJ9A 5E1DA 3UJ6A 4UOEA 2G70A 4FS8A 1RI5A 4PYJA 4C07A 5HILA 3MB5A 4XCXA 1UIRA 2XYQA 5HIMA 3BWYA 4P58A 5EMMA 2CMGA 4POOA 1X1BA 4HTFA 1KXZA 3UJDA 3A27A 3GU3A 4DF3A 3TFWA 3C3PA 3KPYA 4AZTA 1Q0SA 1ZQ9A 1P39A 2IDKA 3PX3A 4FP9A 3LSTA 2EJUA 3TOSA 3DULA 2P7IA 2HNKA 4A6DA 2ZZKA 2ZWVA 4FSXA 3GRRA 4C06A 2ZCJA 1XXLA 3DH0A 1FBNA 1NW5A 1R74A 1X1CA 3RODA 5LQJA 1D2HA 2JHAA 2O06A 4R8RA 2OPBA 2NXNA 5K0LA 3RIEA 1NBHA 5E1MA 4GEKA 5K8VA 2B25A 3P9NA 1SG9A 3FYCA 5EIFA 2OB1A 5EKUA 2YVLA 4AZVA 3EVCA 2EJTA 4M37A 1BKYA 2AN3A 3QV2A 1WXWA 1FJXA 2PVCA 1F3LA 3KPUA 3FUWA 5DXJA 5CVEA 3BZBA 2FK7A 3GRYA 1O54A 2VS1A 3KQOA 3P9IA 2ONYA 3E23A 5DPMA 5FQOA 4CKEA 5DRTA 4AX8A 4E2ZA 3LPMA 1SVUA 3FPJA 5EVJA 2FYTA 1ORIA 5GIOE 5U4XA 3M4XA 4M7RA 3DP7A 4RTLA 3NJRA 3GRUA 5GINE 2B9EA 1VLMA 3LCUA 3KPVA 2CWWA 3K0BA 5JUWA 1I1NA 3FZGA 4AUKA 5ICGA 1JG4A 4ER5A 4X60A 5K05A 1RJGA 2O57A 3NTVA 4PIPA 1RI1A 1XDSA 3NVMB 2BH2A 4FZVA 4LWOA 3BWCA 1EJ0A 5FA8A 3GIWA 4CKCA 4QQKA 2ZSUA 3DTNA 5LQUA 3MCTA 3PB3A 3TM5A 3EMBA 4MWZA 4OQEA 4V0QA 3NMUF 4GOLD 4PWYA 5DM0A 5DT2A 1UWVA 2QYOA 1M6EX 3B5IA 3TRKA 2AS0A 5E1OA 2ZBPA 1AF7A 2C7OA 2ZIGA 1N2XA 2GLUA 3V8VA 5E2BA 1R18A 2I7CA 3A7DA 3ELUA 4QTTB 3IV6A 3MCZA 3LDGA 4L7VA 1WXXA 1G55A 3OE4A 1EG2A 3CJRA 4YMGA 3C6MA 2PJDA 4O29A 2BR3A 3HCBA 4Z2YA 1MHTA 3M6XA 2NP6A 2YXDA 4YUYA 1M6YA 5DXAA 2HWKA 3HCAA 3BGDA 1YFLA 4X61A 1YZ3A 1JR4A 5DX8A 1TW2A 3EMDA 4RV9A 5E9JA 1YF3A 3FRIA 3KR2A 4YUVA 3PVCA 4KIFA 3G8AA 1L3CA 4RVDA 2AZTA 3EPPA 5E9WA 3T7TA 5KYGA 1QANA 3UJAA 5B1SA 3I64A 2YUIA 3HCFA 3CJTA 3HVHA 4GC5A 1HMYA 1R6AA 4HGZA 1SUIA 3G2MA 3HVJA 4QDJA 2VDUE 4RX1A 4OQDA 2PXAA 2CMHA 2PWYA 3GXOA 3BUSA 5FWAA 4BLWA 4YV1A 2AOTB 5DRYA 1QYRA 2IP2A 3LCCA 4LG1A 3QOWA 4E30A
chains in the Genus database with same CATH superfamily
5EJCA 1KU6A 5ECDA 5TR9A 1MAUA 3DNFA 1MTZA 3G0CA 4R01A 2OQ4A 4MVJG 2AMFA 4DCNA 1TA0A 1DIOB 1G42A 3I2JA 4MP8A 5DK4A 1QX3A 4KN8A 4WLUA 2Q29A 4FI3C 1LPOA 2IYFA 3EEIA 3ZC3A 1K7CA 1X8LA 2GBIA 4B2IA 3EDYA 2X8BA 4FFLA 4E15A 3AUXA 3UXEA 2E1PA 4P92A 4OA8A 2IVZA 2OP1A 2CNWA 2WFLA 5AUPB 5JCOC 2LRHA 4D8YA 2R1VB 3B53X 5JSHA 3LJKA 5F77A 5A1TA 3KAKA 1NOKA 2JZOA 2VXYA 2W48A 3DZIA 4FCWA 3B9BA 4GI7A 1Z4LA 4IF4A 1SMKA 2AH5A 4DG5A 4ZD6A 1ZG3A 2SECE 2IPXA 2O4CA 2RGCA 5JNRA 1JDJA 1IQUA 1QYWA 1ZXBA 4H6XA 4DEYA 3CVVA 3CMCO 2P5TA 1THTA 3E4CA 4MKIA 3O4HA 4NECA 5DN6A 3BIWA 4AUMA 4Z4CA 5JW6A 1DEAA 1X38A 1AQYA 2B4KA 4LJKA 1KR5A 3F46A 1IXRC 1HT0A 1JG2A 1XYYA 2X1LA 3CF2A 1ADFA 2GVZC 2DB3A 2GD2A 2W6JA 1CU1A 3SSNA 4I4TF 2B98A 3L49A 2VDBB 4Z3OA 4UEKA 1RRFA 1SQFA 5BUZA 5KTKA 4LI0A 3HHYA 3V42A 2D2FA 3DMRA 3I5UA 3PUKA 4I66A 4GEGA 4I4NA 2OBFA 4TLCA 2G9NA 1I7SB 4QYIB 3LBHA 5JHGB 4UCQA 5ICFA 1DXHA 4PZPA 2GCNA 1I7NA 3KHTA 2FEXA 1ZGJA 3HJSA 3VKFA 1CHDA 2FE4A 1SU6A 2Q3CA 3EVGA 1Z5OA 5DBFA 2XD4A 1GAWA 1XD9A 3MCVA 1JR3A 3U6SA 2FEPA 4MKGA 3OPYI 3DTTA 1WZIA 3EPRA 3IXQA 4KXMA 4C6RA 8ABPA 2BCJQ 1WHSB 5AWFC 5BNFA 2P75A 2FPIB 2I2XB 4KFCA 4QM6A 4IX9A 1QB7A 2KJQA 4GXNA 5JE8A 1V39A 5DT9A 4PHTA 3TQSA 3AI2A 1WDTA 2RG7A 3OICA 4ACBA 3ZHSA 4JI4B 3CLHA 1NJ1A 1VHDA 2XX3A 2WUFA 4WGFA 5LYYA 3TM5A 1R4GA 3A1NA 4Q34A 4EHFA 5IKMA 2VRCA 2X23A 2VHZA 4KHPM 3CZMA 3IT1A 3LE8A 3U9LA 4DCPA 4KBYA 4DR6B 2VBFA 4BQSA 3B7QA 3OTIA 2XEDA 1ABFA 2MSLA 2PQ2A 3GFTA 4M8LA 1SKBA 3BGSA 2R8EA 1JIUA 4ZWNA 1B2RA 2QRLA 1DS6A 3OWHA 4HGYA 3T3DA 3BMCA 1I0LA 2H1IA 5IUNC 1Q14A 1M34B 5CJJA 2HADA 1ANKA 2C97A 3MTDA 1K3UB 1J8VA 3TLEA 2IA5A 4B3CA 2O0LA 5HM6A 2P3QA 4L78A 2G1UA 4E7OA 5AESA 3GPLA 1Z3IX 4J94A 2HREA 3WS7A 1XK7A 3KHKA 4QPCA 2B99A 1SH7A 4RKUF 1ZOPA 2Z2ZA 4TXJA 5HE9A 1EQAA 2DYKA 3EZYA 1QTQA 1VL0A 4N76A 3H84A 2QRMA 1M33A 3AI1A 3KZNA 1YFJA 1L5WA 2OFPA 4EW1A 2AW3A 3BXEA 4X8LA 3PK0A 5AVTA 3C1OA 5DHTA 4XLZA 4R1NA 4XJVA 4P4GA 3DL2A 3MGKA 4NPHA 4OG2A 3R7FA 4B71A 1LQ2A 5C1DA 2FPUA 4W5RA 3RC8A 3JS5A 4ZCSA 1E2UA 3W6NA 1Q0TA 2I33A 5CW2A 4C01A 4EW6A 2I4TA 4AXBA 1IULA 3OJCA 3FYDA 4FU0A 2QPAA 2L09A 5HF6A 4ARUA 3UAWA 3GUYA 1L5KA 2M6RA 2X5OA 1YR9A 2EWVA 2H17A 4CWAA 2DHCA 1CUDA 2C3UA 3OLYA 4ZIRB 4CPDA 1CDOA 3CCCA 1SXJD 1DWUA 5M04A 1X94A 4W9RA 3U7JA 1V1JA 2BFEA 3U31A 4N01A 1ADBA 4UTZA 4EG1A 5LA6A 4QPJC 1B43A 1NDQA 1Q77A 4X64B 1GPWB 4E5YA 3I9MA 4EJ2A 3IT2A 5E3JA 2FWMX 1VSVA 1E94E 4GPBA 5EJMA 2Y1LA 3WR5A 4L9WA 1XTSA 2G82A 1W5TA 3KBOA 1OF1A 4IW3B 3SHVA 5GZ1A 4HRAA 4DBZA 2IODA 4TTJA 2RAPA 1KFKB 1SFRA 3LY5A 1X8KA 4OP3A 4RD3A 1YDHA 1A5BB 1RBMA 2IH5A 5LCXA 1G7TA 2C4KA 5JS7A 3IDQA 4HAVA 4JXKA 2VDKB 4S05A 3CU5A 3OOJA 5D5HA 1KNXA 3X1WA 3ZDEA 2CFRA 4WVLA 3WISA 1XZCA 5JISA 2X6TA 2ASEA 2ZQ5A 4RJTA 1MAVA 8ADHA 1IXSB 4ZI7A 2PMDA 2L18A 2IX3A 4UE2A 1ST3A 2Q41A 3B5EA 4WZBB 1CRQA 3FPAA 3MSXA 2C1ZA 1OROA 2EJCA 1H23A 2X3UA 4IVQA 3WRYC 3D3NA 3WLNA 1RZRA 4EFKA 4CISA 1M8PA 3EULA 1JSZA 3GVIA 3UJ7A 2FMUA 4RADA 3T34A 1PK8A 2WU1A 4UPVA 2N35A 2FPKA 3O8OA 5DNDA 2NVBA 2Q7XA 4NULA 5MGNA 5TSDA 3UGJA 1PFYA 3UBMA 1FSGA 2WE8A 3CPJB 1YAHA 2PUAA 4U63A 2EL9A 3B1XA 2P3OA 5B3JA 5JASA 2V9ZA 4AQYM 1DRUA 3AHFA 3SSAA 1C3EA 1LNQA 2W6MA 1QH9A 2PIAA 3DAHA 3RC9A 1MB0A 3WIOA 2ZAYA 4BFSA 7ADHA 2ZBEA 3OH8A 2YC4C 4OHFA 3II6X 4DGQA 1NWCA 4GBED 3FE2A 4Q93A 2BI8A 1EUQA 3WAGA 1Y42X 2PH3A 3AIIA 3ZDZB 1U0FA 5A3RA 1R66A 3FYUB 4UM7A 4U7FA 3QXXA 3PR1A 1Q12A 1MG0A 3WWYA 3T41A 3QV1A 2B4TO 5LQAA 1PGPA 2ZU0C 3O4RA 3QELA 4JVNA 1H2AS 1EWQA 2LD4A 5D6OA 1NV8A 5IP5A 3LIIA 3IC5A 1WMFA 3QYFA 2NU8B 5CX1B 1AZSC 3HCWA 2XQIA 1GARA 2CSUA 3GFRA 1USGA 3HB0A 1E20A 1YB6A 1FX0A 3PKIA 4M86A 5EJIA 1U7XA 2FP3A 4LDRA 4RJIA 4RIFA 4RW0A 3UWDA 1BKSB 4CMJA 3IAXA 1GNPA 3RLFA 1D8TA 2H9AA 2Z5VA 5I9NA 4BGVA 2R85A 2CHGA 4CFYA 5K0TA 4YCSA 1ADCA 1E3DA 2QD1A 4M0EA 2GTPA 2P62A 1DBSA 2BD0A 3DO8A 5IYZB 1YCGA 4DCCA 3E03A 2Z1MA 4BNUA 2IYSA 3K3PA 3RGWS 4F85A 3DWGA 1JF8A 4I9HA 1GGVA 2AFHB 3A04A 3CVXA 3IDZA 2GM5A 4JROA 1H1TA 4Z4QA 5AQ1A 3ZGOA 3D4IA 5GP1A 2NO1A 1NLMA 3PSAA 4JLKA 4J3JA 1E6EA 4BP1A 5E4YA 2DBRA 1M0EA 2HZ7A 3MWDA 5FO0A 2OYCA 2I03A 1CUVA 4BO7A 3S1SA 4GX2A 4GS5A 4UHFA 1PFVA 1SKQA 1SOWA 4HPXB 1JFFA 3WE7A 5A4IS 2F5SA 1EJ6A 3ND5A 5D3ZA 2Y1WA 3ND9A 3WO1A 4A0FA 2EG5A 3F6PA 5TPWB 3CZ4A 4EPWA 4QBGB 3NH9A 5DHAA 3RC1A 2AI1A 2GEUA 1MAWA 4UHHA 4YBRA 1PJSA 2GJAA 3LNCA 3LL7A 2W2NA 3O4IA 4HDOB 2BVNA 4LPKA 4QXOA 3PD1A 1OWMA 2EAUA 3HE3A 3K5IA 4H16A 5EXDA 5ULLA 4AQDA 5AVRA 2XLCA 4ZRMA 3SX0A 3K71B 4LQ4A 1U7TA 4M2LA 2VTDA 3ZV3A 3N5CA 3QBDA 1MXFA 3OIVA 3DAOA 4Q7KA 1K08A 3G2HA 3Q2IA 2C2GA 2C99A 5FPTA 4FVMA 3HBAA 4I50F 1EYZA 2CXTA 3N53A 1OAOA 4A8PA 4B33A 1ZAEA 5K0FA 1O0CA 1ABEA 4TLMB 4MDYA 3TLXA 3TTSA 3ZXXA 4CF6A 1XDBA 3GELA 5IUKC 3K9FC 2B0JA 5AM1A 3L1UA 4P38A 2V7BA 2O2XA 5EHGA 2IZOA 2ZPTX 1HFKA 3U5ZA 5AVSA 2QUIA 1PJZA 3EXHB 4YH1A 3UXMA 2JAPA 3BRCA 3FN4A 3KUUA 1YC2A 4H1TA 1FX0B 2FOIC 3FPSA 3LXXA 2VHEA 5F98A 5CK4A 5G1NA 1LNSA 4RHFA 1NP6A 1DJOA 3I12A 1PGQA 2IV7A 3N8IA 3WL4A 4V3BA 3AY3A 1THZA 3RFVA 2XDQA 4ZVVA 1X15A 1A1VA 4OB8A 1ZGBA 1UZAA 4KXUA 4QPNA 4DWOA 1U0RA 2A1UB 3H19A 2H85A 3LT5A 3O1HB 3PDWA 5EE3A 3TAUA 3F5DA 3GJZA 2IH2A 1A1SA 1U2ZA 3CF0A 1HDXA 1XUOA 1ZK3A 2LE0A 5GV8A 1OBHA 1T5SA 2GTHA 1D2EA 3R3XA 3M1AA 5FPHA 3HJAA 3ZNNA 2VDWA 5CUQA 3DVRX 5TV2A 4WK2B 3RR2A 1F38A 3IV7A 3WQRA 3I0NA 3ZU4A 1VDDA 1Z8FA 2O2IA 1Z5CA 1ZJ4A 3R4CA 1H69A 1XEFA 5HDBB 3MAAC 1PGYA 5DGIA 1TW3A 5BSVA 3P2EA 3GGDA 1ZMUA 5EIAA 5C80A 5I3CA 2X0IA 1UWKA 2XTZA 1N8TA 3L1KA 4BNWA 3HJHA 4P84A 4KXLA 1F4IA 2O8BB 1G4UR 3EC2A 3A42A 1RWPA 1D0SA 3O7WA 3HU3A 1DUSA 1B3RA 1JJVA 4H7IA 3IVCA 5DULA 2NYVA 1Z0KA 3D2CA 3V1NA 1IZYA 1SIOA 2DWOA 1EBUA 4GYYA 1SHTX 5ALHA 2ZDHA 4R84A 5LBUA 3QIVA 4IZIA 4O4LB 3W8NA 1OH6A 1FE8A 5H82A 2BLNA 2MINA 3FVWA 2Z7JA 4KO2S 1NVTA 5A0TA 3IUNA 3QVSA 3JW8A 1OFVA 3HSYA 2GEJA 1Z07A 1RM4A 4N0EA 3LOQA 2DT8A 3RREA 1I0IA 1IBRA 5EP1A 1L8LA 3JARB 4FC7A 3KJFA 1P39A 2C00A 3K70D 2REOA 4AECA 3X1KA 3UWMA 2AHMA 3GPPA 3HVUA 3IUJA 4HAYA 4GH9A 5L3RA 1ZH2A 4FM9A 4DCTA 1A7UA 1OFTA 1OOEA 1DCMA 2EGHA 2DF8A 3H86A 5C3UA 3RVLA 2IHNA 4F4JA 5CM9C 1TM2A 3RIEA 4ALLA 1E8MA 1LI4A 2YHIA 3NDPA 4RY0A 5PGMA 1CUJA 2G28A 1NJGA 4DR1M 2VPZA 2AFHE 4R68A 2VZLA 3DZBA 2F9LA 3PXXA 4G9GA 4MUIA 1JYEA 1NG1A 4UD2A 3RG8A 5DCWA 4FDLA 5B64A 2FN3A 4H59A 1VI5A 2C84A 4JITA 1BW9B 1F2UB 2VS1A 1S7CA 4P1ZA 1OB5A 2HT6A 2JC3A 3VAYA 5KQGA 1P4RA 1N32B 1QZMA 4J16C 3A05A 4HNQA 2Q07A 2XSZD 3IUMA 3SATA 1Q0UA 4C30A 4EJ6A 2QY9A 4LE0A 1CJCA 2FZ5A 1T8PA 3AM4A 3BQNB 3L7NA 4ENRA 1JKMA 3ZNOA 1I36A 4JELA 4JLNA 3EXEB 3S7ZA 3K1YA 3I62A 3VKVA 4LRXA 3KPVA 3HFRA 4QQFA 5KQ8A 3ISTA 3K0BA 1DGFA 1YJQA 4Y7DA 4DVGA 2IIQA 4JI5M 2HK7A 4XX1A 3QE0A 1N0UA 1OI7A 1DTWA 2PXHA 4YIHA 1RI1A 1UC9A 2DFVA 3ZE7A 1UBJS 3QE9Y 5FOWA 3OQNA 5FA8A 1J2JA 2ODNA 2OXEA 3IT0A 5F78A 3L8EA 1EX6A 2H9YA 3DBIA 4CIWA 1YNSA 1K8YB 1IIRA 3F4LA 4EGAA 5HKAA 4V0QA 5TXGA 5L3VA 1CYDA 4JQOA 1B16A 4U7HA 4POAA 4WDQA 2DAEA 2XGNA 1NN1A 3NVDA 4QIHA 5ALTA 1AXGA 2ZU6A 5E1OA 4ARBA 4I50B 2O2JA 2CMKA 221PA 4KYUA 1XJQA 5IVHA 4JYMA 3PNVA 4NSOB 3ZBQA 2GM4A 2IQ5A 5FA6A 5BYKA 3U7EB 1T36A 1QH1A 3IV6A 4I55A 5GONB 4E1VA 2VSOA 1V1MB 5BWLA 1X9GA 1GCAA 2HY7A 3GUHA 4PZZA 4DNOA 4Z2YA 1JHDA 3VOTA 4D0GA 3FTQA 2BFAA 2F5QA 2JBHA 4TLBA 2FDRA 2YWRA 3GAZA 4WRRA 4YI5A 1Q74A 2BKLA 2MSNA 3W5UA 5CB4B 2ZJ6A 1TO2E 4IFBA 3H4MA 1NUTA 2EU8A 4ARZA 4LFBM 2B82A 2B5VA 4LDQA 3EK2A 4U6NA 4RK5A 3AF6A 2CV1A 4X62B 2EO2A 1QWOA 2JS7A 4UTOA 4FCVA 1I1QB 1SCAA 4JVOA 5IXYA 1O9BA 2VDMB 3HKPA 4TV8A 1F06A 2QMHA 3NTRA 5AK0A 4R8LA 1Z25A 4RHEA 4K81B 3CJTA 1QKKA 1TD1A 4Q3KA 4B9EA 2BI4A 4F71A 5B3LA 1XZJA 5AXAA 3BX1A 1SBCA 3D54D 5CBPA 3DEJA 1CY4A 5AICA 1VEJA 1W4AA 3EIQA 5D7BA 5DRYA 3QU4A 5LB4A 3QITA 1KK3A 3ILHA 5HJ7A 2C9OA 3CZQA 7ABPA 1AQLA 2JLQA 4EA7A 1BW9A 3DKVA 4XYBA 4R54A 3DZCA 2IYAA 3GEPA 1G8MA 3OZGA 1A8SA 3A0RB 2CK3D 2HA4A 2AV6A 4UOQA 4OHUA 4LYDA 4DV4M 2MMGA 5CW1A 3PIRA 2HA3A 1EX9A 1NMZA 1PDVA 3EXHC 1DMRA 3V8EA 1OJLA 4ERNA 2DERA 3JR3A 4E5DA 1KQPA 1Z12A 2NU7A 5A7FA 3OJEA 3R5SA 3O1LA 2EF1A 3AY0A 3AHIA 3GLGA 1FLDA 2ODAA 1Z15A 3D7KA 1T0HB 4WZAE 1K66A 5K3DA 1Q0PA 2X19A 2X8WA 1VLLA 3PXEA 1RXIA 4OH1A 4ZP1A 1BXZA 2QVCA 1GLGA 1TADA 4G9BA 4MMXB 3LPAA 1UOOA 4X1OA 4YLGA 2FR8A 3C8UA 2IPNA 2R79A 3Q0EA 4XX0A 1BFUA 2WVGA 1UK9A 2QRHA 1QRRA 1GO2A 1BVUA 3BJIC 1QV9A 1H22A 1G6Q1 1JHZA 1X8XA 1B7GO 2J30A 2CVPA 4NZ9A 1IU9A 4PAWA 3ZCSA 1UOPA 3C3MA 4QJ4A 1GILA 2H1WA 3TNDA 3GCZA 5KVCA 4I50A 1Z75A 2QX8A 3VYTB 1P91A 1B6TA 5CYGA 5LYJB 2VNKA 1LU9A 3C87A 3SU8A 5GZ6A 3SHWA 1E3LA 1TGVA 3FDZB 4BMOB 4EKGA 3Q7SA 4B2LA 3PCXA 1D9ZA 3CX7A 1XMQM 2D54A 3FTNA 4A73A 5GMOA 1T5OA 4CV3A 4QYWA 1NI4B 1FSFA 4AJNA 4E4RA 4A0HA 1GKLA 3L02A 1AT1A 4X85A 5CK5A 4YXWD 1R5JA 2BF7A 4DILA 2CJFA 1DRKA 4P86A 3ZWAA 2G67A 3KWJA 4N5HX 4DM4A 2F1JA 1JLRA 3OCWA 4DCUA 1U6JA 3ESYA 3R6LA 1IY1A 3U2QA 1NLUA 1ZY2A 1J5XA 3LRXA 4DQLA 1ISRA 4E4YA 3HNPA 2J4CA 2YN4A 5LB2A 3LGSA 1E18A 2O50A 3LUFA 4OOFA 2IYVA 1SA0B 2A2ZA 3WLQA 2O5VA 5JD5A 3AFIA 3GRVA 1GCIA 2XZUA 2VKTA 3GEEA 3LQ4A 1K06A 1N2CE 4RVHA 1II8A 1TD9A 1TYEB 4PCLA 4Z9BA 5TGDA 2PUJA 3MK31 3QG5A 1XALA 2AD5A 4JBLA 4MCJA 5BSGA 3PXBA 4ZT6A 3O7MA 4E5SA 5LDDC 4EB8A 1D5CA 1OGJA 3Q98A 3MN1A 3BL5A 3VKGA 2RB5A 2FF5A 1XCOA 2XPCA 3OX2A 5ALDA 1EB9A 4EHAA 4LQLA 4P6VF 5T4BA 4PINA 4V03A 3WYAA 1K8ZB 1YGYA 3NANA 3PG5A 4XUCA 4BX3A 4EFMA 3WO0A 2P27A 1HFEL 2I7DA 3FPKA 1EVEA 4ZMBA 2VRBA 4IO1A 3IERA 4RESA 1L4MA 4Y2RA 3ZWCA 4YUAA 3OLZA 1PP4A 1PGNA 3QRWA 4LVOA 1IIBA 3H97A 2Z09A 3ZHRA 1FXWF 1G8GA 5AW5A 1I3OA 4I5FA 1F2TA 1CJKC 1YR1A 3QFFA 5F2KA 2XDWA 5ALIA 2EZTA 2BGTA 4DDHA 2FFBA 3UICA 5JDIA 3T3GA 1KY5A 3TW6A 4NAUA 1D4OA 1Y33E 2QZ4A 4LAFA 5T6MA 4E0BA 1RU3A 3U4MA 4JYAB 3JWIA 1TM4E 1U0HC 1NO1A 1BCSB 1JIKA 3N8NA 2ZAGA 1WX1A 3JZMA 1YRBA 1XVAA 4FQ7A 4KLCA 3VPGA 2AC2A 4PNPA 2BGMA 2HBRA 4DV7B 4E3WA 2O4UX 3BD7A 4PCZA 3A58B 3K6KA 3CZPA 1P0MA 4S1PA 4M0FA 4F5EA 4OLJA 1H8HD 3LC1O 4WIAA 3WFJA 1YQGA 1PSWA 1VKOA 3AF3A 4XEHA 2HT1A 4RZ3A 1NI4A 3H04A 3UAOA 4GZ6A 2IP1A 2PD3A 2Q6OA 3NWBA 4HEJA 4YT8A 1H2WA 1UDRA 2BHLA 3MJHA 2JAWA 5EXTA 4P4TA 8AT1A 3GZNB 3IEXA 1U0TA 1PTJC 1N6LA 3EGWA 5HJ5A 2HQBA 4F9TA 1PF7E 4MLDA 1Y1KE 3PEVA 4L3OA 2AFIA 5TVKA 3EIOA 5A03A 2C4TA 4K6HA 3G68A 3TB6A 5C9ZA 3RUHA 4GR4A 1KMNA 5KMGB 2Z5LA 3HKEB 1V6AA 3H2BA 3W3AD 5DNAA 1UBKS 3H7AA 5F7JA 4UCXA 2FWPA 3GLIE 2AX3A 1YDEA 1S8OA 4M6WA 1UZUA 4HWSA 2HF9A 3KETA 4UATA 3NH6A 3TZQA 4BECA 3MRXA 4JSTA 1G8FA 4LRSA 5CNIA 4AN1A 4Z0NA 5IREB 2AKEA 4DBLE 1IPEA 3UWKA 3W5AA 2ORWA 5CFOA 1B76A 4FUQA 4PHFA 1EB8A 4PZUA 4W1SA 4YRJA 4BKUA 1EVYA 2A35A 2IPLA 2A7QA 4OXRA 2FX2A 1SB9A 2PL9A 5AW3A 1KO1A 2WHPB 4HDMB 1XAHA 2J7PD 5IEBA 3FIUA 3GK3A 5AK5A 1VCIA 2CHEA 4F2PA 4BLTA 1J0EA 4J4TA 2WV7A 4E5NA 3OIDA 5GADl 1OR8A 1VIAA 4GX0A 3KTAA 4EITA 2BKXA 3PUJA 4JWTA 2FPMA 2X2OA 2MSKA 3NM4A 3K20A 4K6KA 2IV2X 5LOVA 2WFAA 1IB0A 5KOYA 2VRWA 2ZJOA 1RYDA 1B14A 2NV0A 4UQLA 2AMJA 4DA6A 1MT0A 2QTNA 3VJRA 4EM6A 4FS3A 1NMEA 2HIHA 1YRHA 4G4RA 3RKUA 1LBEA 1KYVA 4LJ9A 2YW9A 3EFOB 3BG5A 4IEIA 4WJLA 2CHVA 1ULUA 1XF9A 1OI3A 4J0JA 3W9YA 4MS3B 1A8PA 5CH5A 2QLNA 1KYIA 1I2AA 2DVMA 4FCCA 3HS3A 5GWXA 3MHPA 3STTA 4AKTA 3OM8A 1Y6GA 1H4TA 2C58A 1SVKA 3BRQA 1SCKA 4MVJP 4UU0A 4L8FA 2Z95A 3E53A 5FR2A 4L0CA 2V7XA 3R7DA 4I1VA 3X1ZA 1LGYA 4WNYA 4A8HA 2GAAA 2PV7A 2GKSA 1OBFO 1PU2A 1RRGA 4M76B 2DTXA 2CVZA 4B4VA 1Z62A 2DWNA 1UK6A 3JXEA 1NSTA 4NBSA 2VSXA 2O2HA 4UEOA 5FXMA 2BMAA 2Q8QA 5J47A 5A7GA 1ZSNA 4RXMA 3DT9A 4HAZA 2RB4A 1W36D 4WXHA 3HKEA 4EHNA 4FKBA 1SK9A 2I6SA 1FDSA 4WKPA 4OFZA 2M6KA 4AZ3B 4HWPA 4ECAA 4B3MB 1RCFA 2V03A 3BTUA 3OO1A 3VH3A 4B9AA 3V3TA 3WRVA 1L7VC 3A6DA 3IOYA 3I52A 3JD0A 4K86A 1BIFA 3EY4A 1TZCA 4N5MA 3SQWA 2ZFUA 2QJTA 5DISB 2PUBA 3P9QA 1UXHA 2DZOB 3MW8A 4Y2UA 2ZI3A 5CB0A 3G8YA 1R2YA 4DDTA 3UCXA 2H8GA 1Y5MA 3IJ5A 4HNHA 5BNIA 3BHMA 5MFPA 2ZCVA 5LMZA 2AZDA 2Q2VA 4MS1B 1UQRA 2D8MA 3VOAA 4W5NA 1TO6A 2BHRA 2WI8A 3ZR4B 2FW9A 4F9FA 2B8JA 3VZRA 2BN4A 4QXRA 2ON6A 3RRXA 4E3ZA 1UH5A 3FSGA 4NAVA 4HLUC 3TE7A 3VYUB 2JIQA 3NXSA 1G19A 3L7DA 5JVDA 4NIMA 2PO5A 4DAEA 1FDWA 3NHJA 5B3KA 2WF5A 1SHLA 1E3JA 3WBFA 5AOAA 1G8YA 4YDSA 3L8YA 1T8WA 4IGEA 5JZSA 3ZDFA 1ENYA 4PM4A 1A5AB 1JP7A 2MJ5B 1LBIA 1W581 2HRRA 2UZ0A 3HRIA 4RGBA 3J7AC 3TIXB 1K2WA 4CIVA 5CB8A 1G5HA 4LYEA 4ENPA 4PO3X 4OW0A 4ZT4A 2FXIA 3CUWA 4IKEA 1GSOA 3NRCA 3F1KA 1YI0A 2UVDA 4KQXA 2Z6AA 1Z8NA 4LDAA 4R3NA 2QR2A 5IXSA 4ESVA 3KKEA 4M0CA 2DHRA 1GP2A 4RY9A 4MKRA 4JLWA 1EX1A 1E6LA 1JQKA 4XIIA 5FT9A 5KYKA 1X6VA 4TLAA 1F1BA 2HCFA 4P08A 2CYCA 2ZJ0A 4GGOA 4QULA 5CXUA 1ZMWA 1TNDA 4G5QA 1E5XA 2D0IA 3F6CA 3FJYA 3WJ1A 5CDYA 2HTFA 4YREA 3OC0A 4MRAA 2Z83A 4ZO7A 3T7JA 1AXRA 5FPSA 4N7MA 3B74A 4E03A 4BBAA 4I6JA 1O96A 4BNGA 4NC6A 3A6LA 4DMKA 5HQ3A 4P80A 1D4ZA 1DWPA 3PEFA 4O3MA 3ADBA 1IL0A 1KVQA 3D0RA 2XV1A 3EHEA 4OJYA 2YY5A 2YN0A 4G01B 3ZD7A 4QGGA 1ECPA 3OPXA 3PT5A 4QLBA 4MW2A 1MJFA 1JQJC 1OGIA 5LC1A 3KV3O 4Y2XA 1ITZA 5BMVB 1VEGA 4CG2A 1GVNB 3D7RA 3B60A 2OFWA 3VZBA 4LOLA 1C0KA 1ORDA 3OKCA 4U7DA 3EEFA 3SHFA 1J2EA 1FQWA 5JG7A 2FSVC 4RF5A 1QO7A 2X7XA 2EWMA 3CLUC 2HCBA 2R4EA 1N9GB 4Q3EA 4XQ9A 4Y6PA 4JZYA 1J24A 2VFAA 4EGSA 2HH9A 2IGBA 2GAIA 2HIGA 4BX0A 3CF4G 2A4MA 1L9KA 1QZTA 3K2EA 1Q1NA 2H1VA 2X4IA 2VAVA 1NVVR 4F56A 5I48A 1IRIA 2P7HA 4YECA 4II7A 3NNNA 2OO5A 3OEEA 3WHIA 2OPFA 2XGOA 3SIRA 4BAGA 1UKYA 1FP4A 2J3KA 2RHRA 2C92A 2MIIA 4F60A 4ZCMA 2UU9B 4AJHA 3W67A 2Q9AA 4HMOA 4TL8A 3C3YA 3GVHA 5B53A 1KAGA 1XCMA 3GPUA 3H5NA 5B4VA 5KC9A 1OB2A 4OVZB 3PXGA 1NR5A 1TDJA 2DUJA 2RSLA 3CT4A 4KQMA 4MUGA 4B3BA 4PR3A 3FNEA 4RSRA 5KQPA 1OQYA 1S8AA 3E8XA 3MT7A 1CJSA 3LT2A 4UHEA 1NF8A 2W5UA 4DSTA 5EP2A 1F6BA 4GM0A 1CUZA 4BN4A 4EI8A 1T4CB 2KI5A 3O8QA 2PKYX 1MGPA 4PYJA 4LX0A 5HILA 4FGUA 4MKHA 2XNKA 4P58A 4BV3A 1XLUA 3I09A 4N41A 2QG6A 4TMZA 1E2QA 3FMPB 4HTFA 2GZDA 4JL8A 2WFLB 3HGQA 2ZRMA 5DYTA 3I61A 2QUKA 2GCPA 4AQ7A 1OMOA 4FOOA 4QRDA 1TUBB 5FI5A 2WINI 3T7AA 3OD5A 3WNCA 4AJEA 4EGFA 2GTIA 3A45A 2C0PA 2OGSA 3ZK9A 4B6SA 3K05A 5DOZA 2Z4SA 3A4LA 1B00A 4XYLA 5KOJB 2JFBA 1O96B 2RK6A 3AEQB 2H2AA 3C70A 3NEPX 3PC3A 1GPH1 1SCJA 2AR7A 4LRQA 1PO7A 1TF0B 2GHQA 1SKUA 1S2MA 2B25A 2HHHM 2C2HA 4GQAA 3KZVA 1QQTA 2GFIA 3BFPA 3V80A 4CGZA 3RSGA 3ZJVA 3D6AA 3CTWB 2PJZA 3QZUA 1FVFA 3MS2A 3OZIA 3WGKA 3BE8A 2VBIA 2VUHB 3ONNA 5MFZA 3UPUA 4I5SA 2CLFB 3H18A 5LUAA 4TKZA 1FLAA 3SD7A 3A1SA 1S6YA 4U2KA 1MZPA 2CDNA 4LXUA 3I4CA 1PNTA 3A46A 3JWEA 5A3QA 4FN4A 2QSZA 1VHJA 3KAJA 5JH7B 3MJ5A 2CGEA 4KQGA 4IWYA 1KQ3A 3TXXA 4DABA 2BGUA 1GZ5A 3TD9A 1WJ7A 1Q44A 2XMPA 3CVYA 4FHZA 4CM9D 2Y0PA 1WZCA 4ESEA 2ZYHA 2DBQA 4J9VA 2B9EA 3KKPA 4HNGA 4MPDA 2OHGA 1T6OA 2CWWA 2QT0A 3IR7A 4OK6A 4AUKA 2RE8A 4Q9AA 3VX4A 2G3YA 3WNVA 1X42A 1U2DA 1JBKA 4FOSA 1MRSA 1A9OA 2C54A 2SICE 2PH7A 3GEDA 1TX4B 1EJ0A 5K3BA 4PNEA 1OI2A 4V3CA 5EXSA 3ZDDA 3JQRA 2WTMA 3MCTA 1Y7TA 1HE5A 1G5PA 3GQ5A 2O20A 2REQB 4Q4DA 3DTYA 1QFZA 4CW7A 4FYIA 3FYUA 1P5RA 2JFHA 3F78A 1K5GA 3REQB 1IBCA 4PXYA 1NUSA 2OCXA 3TI9A 4LJSA 2C7OA 4ZC8A 2XD9A 1N2XA 2QK4A 3RVQA 4LCEA 4BMNA 4EO4A 5A4KA 2YWGA 3QNMA 1R18A 2DFNA 2CDBA 3EQ2A 3EZ6A 1PEYA 3NAGA 4QTTB 2C2KA 4RZXA 1K7FB 4P98A 4R9SA 5DZSA 4UMDA 2X8AA 1XEWY 3WV4A 3U3KA 2K87A 3DW1X 3C6MA 2PYZA 4D3XA 1Y82A 3VRHA 4K8OA 3FYSA 2D7DA 3HBMA 3IUPA 2YV1A 2G09A 1WBJB 3M6XA 2G0TA 2I6QA 4G25A 5BR8B 1T2AA 2ZYIA 3MWFA 4YQFA 1KOGA 2V7QA 4HS9A 5IN5A 3OQBA 3UMJA 1M8KA 5ESWA 2JI7A 2FSHA 2E85A 1TF5A 2Q50A 2XGJA 2XLBA 1NNJA 1BA2A 4Y8VA 3TR0A 1L3CA 1S2IA 1R88A 4MTCA 5KYGA 2WBLC 3GJ6A 5B1SA 2DEUA 2CK3A 4FYVA 1HMYA 4HGZA 4B3DA 3VH2A 5LZ7A 4MM3B 5DNYB 5K4HA 2X8LA 3QKTA 3TSOA 2O25A 3PF8A 4G0QA 3JQ6A 2E4YA 2VDNB 3FNIA 2D62A 3NXKA 4RPJA 4XYEA 3IKTA 2C8KA 4ZEWA 1QE5A 1NM5C 1C4KA 4A8JC 5CMLA 2QMUA 5GIPE 3HWWA 3KE8A 5DB4A 2PDAA 5IC6A 3N5KA 4L5IA 1UQUA 3C74A 3Q0TA 3SDSA 2GYVA 3ZS9A 4UQOA 4CNBA 4YRRA 2QQEA 3F4KA 4DR3M 1IQRA 2J48A 3VZDA 3W5JA 2C3YA 2YNMC 4JGBA 2ID7A 4NMMA 5CAEB 3FCCA 1N1EA 3HXTA 4PXSA 2BKAA 4B6RA 5F4ZA 1JBEA 3WNQA 1KS2A 1K4YA 1HTBA 2YL2A 4U2CA 4XYGA 2P3LA 2EEPA 2PA3A 1VCHA 1N6RA 1B2LA 2VPXA 3TLGB 1P6QA 4KQJA 3HN2A 4PIMA 4YJ2F 3DLHA 3L8DA 2BMVA 5U4QA 2ZPUA 1ISGA 5ICEA 1E6MA 4NDNE 4H6WA 3TJRA 4G2TA 2QTHA 1HR0B 2REQA 3TZ6A 1JEDA 3PGMA 3R8XA 4ZFNA 1TDHA 3KQMA 2R44A 1NVAA 2XW6A 2P3SA 3B85A 3NTXA 3VNRA 1Y3AA 1JVBA 2NAFA 4RH0A 2Q1YA 3ONDA 3LMKA 1RW4A 4LF8B 3RSQA 1WP9A 4J4HA 1M8FA 4NATA 3RVNA 4XWKA 3ASZA 5JXWA 3A6JA 1SBYA 5T8KA 1WEHA 3LVWA 4PT5A 1WPXA 3P5BA 3FTCA 3PYMA 1CZHA 1VYUA 2GCEA 5FNVF 3ZD9A 4DLKA 2O59A 5I7VA 5TJHA 2P30A 4WX2B 2HW8A 1QG2A 5C8YF 4DIKA 4U7WA 2JNHA 1GGHA 3VR1A 2ATXA 2R1TA 2PRSA 4HYTA 4C7OB 3ELYA 1E60A 3OP1A 1L5QA 4KC0A 3A6PC 3DZDA 2FNAA 5JEEA 3GLFE 3GMIA 4ENUA 4RH3A 3I23A 3NCHA 3AM3A 1X37A 3H9EO 5KYUB 2C95A 4MHTA 4EG5A 3GLKA 3VPHA 1OXUA 1QFJA 3C14C 1F8XA 5EKXA 4AQYB 2H1FA 4OHWA 1P1IA 3ZE1B 3ADPA 3O8RA 3CUYA 2YQZA 1JLMA 4L5JA 3UA3A 4Z9XA 5JRJA 1NQ5A 2KM1A 4K6OA 1ES9A 1M1XB 5J4KA 2WAYA 1S89A 2JRCA 2QIOA 1JSXA 1ZH0A 4S3MA 3M1LA 2PK3A 4TWZA 2DJIA 2FDCA 3ILKA 2XCSB 2KLBA 4M7WA 2WKWA 3R0XA 1QSGA 2QVGA 2IYWA 2BELA 1Q6ZA 2E87A 3IHTA 1HLDA 3LUCA 1XC7A 2Q3JA 3QVOA 4MVYA 3EGXB 3VPFA 1K63A 2R96A 5ALSA 4LVCA 1GPUA 1JSLA 1ZSVA 1DIBA 3LBAA 3NCTA 1K89A 1NM5A 2YZ7A 2Z4RA 3LW5F 2CMFA 5AJTA 4MQ6A 3KQPA 4IDQA 3SM3A 1C7FA 1FP6A 2XH9A 2QVYX 4QLAA 2R25B 2HN9A 5KQMA 1Y48E 5TF0A 2DUUA 5EC8A 3DH0A 4B7CA 4EHHA 1PJCA 1DMSA 3SLRA 5K2OA 3EDMA 2ZBUA 1E5DA 4BEWA 4GP9A 3A6ZA 4YALA 4GOJA 4NR0A 3AG6A 2D0OB 1G6OA 1U80A 3KTOA 1KH3A 4KPGA 2BGKA 1FDVA 1Q22A 1Q17A 1UMBA 2FX5A 2SHKA 2BZSA 4KSCA 1X1RA 5EZ5A 3ROTA 4ZYYA 1DAIA 3PWTA 5BW5A 3KIPA 3OLVA 1ZU5A 4CUJA 4L74A 3EAFA 3H5AA 2V45A 2RGUA 2JVKA 1BEUB 2VQFM 1EG7A 4Y30A 3NAQA 4WHMA 3RJMA 3OIWA 1ECJA 1T0BA 3DC7A 2QCUA 3TBHA 1VJ0A 4H7EA 5FOSA 4O8CA 3E8MA 2PMCA 4MWOA 2GCGA 3PR2B 1E2IA 2IE8A 3IVMA 4B08A 2F8LA 3O21A 4J8PA 1Z0AA 2EOAA 3MM4A 4EBFA 5FTLA 3D3JA 3KVWA 1OC2A 1P4HA 3H3JA 4U9IS 4TQUS 4JC5A 2AQKA 2WZJA 5IT5A 1NAIA 5FADA 2JBWA 3A9SA 4O4LF 3KAQA 1E5LA 3MPOA 4TZ0A 1RWBA 3FFBA 2ZANA 1CZKA 1O2DA 2WMNB 4NZPA 5CT5A 5H70A 1O97C 3ZZMA 1QBKC 1Y98A 3WX0A 3LXRA 4INJA 4P31A 1XAGA 3AHDA 1KPIA 3ZHOA 4ZTZB 1RZRD 2PMKA 1UBHS 5IVKA 1L2DA 3BA1A 3NM5A 3CH7A 1P5FA 2JA2A 1RI3A 1K97A 3F7NA 3VH4A 3C4VA 1LX6A 2VJYA 4JLPA 4QUKA 4CGYA 3ACCA 5CM8B 5MN5A 4I1SA 2XDAA 3QVGB 4GI2A 1GRRA 5ALPA 3WL6A 2BCEA 5EHIA 2JANA 2NYUA 3MTQA 1SK8A 3N7TA 2FRXA 2J9YB 4WDRA 3SKYA 3ML1A 1J7KA 2XRYA 2IXEA 2XUGA 5AMXA 1XLTC 4S0XA 5H9WA 4KP7A 5FBKA 1GFSA 3F47A 1E8NA 3E1KA 4RIIA 3EH1A 3NIBA 1KDYA 4AZ0A 3W5DA 2XWJI 1RPJA 3GROA 3GVPA 3LHSA 1F8UA 5CA0B 3KP0E 3QPWA 2X0FA 4OHOA 3KJHA 2KMLA 4MUYA 3VMFA 1WUTA 3E4DA 3U5ZB 1RMQA 1T2EA 3M9LA 2UZ4A 4AWAA 5C8VA 1JI3A 4RTOA 3HYCA 1SXGA 3HJQA 1R0KA 4YRBA 2F17A 1MMFB 3KT3A 3LW8A 5C5CA 4IBFA 4UJ5A 2V54A 2WOJA 3STWA 1UMBB 2I4IA 3R6TA 4HO1X 4JR0A 4BXOA 2JLBA 3PXUA 5CVUA 3L05A 1MABB 1KZ4A 1SCUA 1K6IA 1XV5A 3IHWA 2A1UA 1FMFA 1A4IA 2NZVG 1BHJA 3I34X 2AN9A 1OY1A 2PKQO 3IJPA 3VU8A 1QC5A 1JDUA 3CKMA 4LJYA 3BXGA 3THOA 3WY9A 1PQPA 2HSDA 4OJTA 2NZJA 4KK4A 5TMDA 4CTJA 3UOWA 4E6PA 3ZHYA 3AUSA 4F1IA 4Y9TA 4FYYA 3UV7A 3VGJA 4XGNA 3V5NA 2H4YA 3HFSA 1U98A 2CF6A 4P33A 5CLGA 1TKBA 4UVIA 3UT6A 4YMUA 5KYWA 3FD9A 4QUAA 4AYTA 1B93A 2C31A 2R4TA 2WAAA 4HDRB 2V96A 1LS1A 2JCSA 3RC3A 3DMDA 3GPYA 2KBEA 1AX9A 3LDUA 2BW0A 3B82A 1WVGA 2ETVA 3E82A 4CNQA 1GY8A 1WTCA 3U3ZA 2MCFA 4B0OA 2J0SA 3IURA 3MELA 3R3ZA 2DE0X 2JFFA 3F6BX 1Z5VA 1PJLA 1VPLA 3K9BA 1F4LA 2H6EA 1QAOA 2IYPA 5DI3B 2YWBA 1LK0A 3JQ8A 2HWYA 1A95A 1ZUWA 2GETA 2GPYA 4ZAFA 5B36A 3X1DA 5AW1A 3NBKA 4R8KA 5KKNB 4ZU1X 1VSBA 3UF0A 2PT6A 3GFFA 5K0GA 3D2AA 5LM3A 1PYGA 2XF3A 3T9EA 3I2KA 2FPXA 1P19A 3H1BA 1TZKA 4WLNA 3VO9A 1XNJA 1ZUD1 1AKNA 4NE7A 1UPUA 3S0JA 4Z4HA 2Q99A 4JIGA 4KXYA 5BSWA 4TKVB 1EGVB 2B1JA 3GMSA 4JEMA 1DO0A 1OLXB 5BOSA 1ZITA 4JI8B 2UXDM 1A2QA 4XPIB 4ZDKA 3WQSB 4HVAA 1R6DA 4FBLA 3RFWA 3DV0B 2KRKA 3HGIA 2QJFA 4YDRA 1VSQA 5JLJA 1ZCAA 2AVDA 3EPJA 4N54A 4K9KA 1YB2A 2FPPA 3RPEA 2NSJA 2XHZA 3U19A 3GFBA 1ZK0A 5CH3A 3HJ8A 1CS0B 1JEJA 3A6KA 4EY7A 4RHYA 5T6BA 3G2OA 1EFCA 1GKYA 1DGGA 1R0BA 3I6YA 4QOHA 5THQA 3ZWDA 4YA6A 1NONA 1ZKMA 2CN1A 4TMYA 1FYDA 3IHLA 1CUYA 1WNFA 3OZCA 4DSZA 5ABPA 1CEEA 1KWGA 1KZ1A 2JIPA 4X1IA 2FPGB 3CUKA 2X14A 4L6AA 4E31A 2YJZA 2ZB2A 1G6KA 1PUIA 4AF7A 2AG5A 5AVOA 4ZI3A 4FNOA 4OL0A 1H0RA 4XJXA 3SICE 1OX5A 2G4VA 2I8AA 3W5BA 3GCWA 3O95A 4ITVA 3JQBC 1FPQA 4R83A 4KNYA 4ZCLA 4GPEA 3IBYA 1O6GA 1V34A 4RE5A 1ISMA 3OZRA 4RZSA 3IIEA 1Z0IA 1V6CA 2VG8A 3D9QX 4JP5A 1RZ3A 3GRFA 2BF4A 1N3YA 2O0MA 4V2UA 3SFTA 1UM8A 3WJ2A 3M81A 5IBPA 4BNDA 4KUHA 2PUWA 1AM4D 4NH4A 4EJFA 2GR9A 4CG0A 3THWA 5A3JA 1L2TA 1CQXA 2A30A 3ZUGA 1DX9A 3BFKA 5A7HA 5LD2C 4AS2A 2ZXUA 1KZ6A 1W87A 3AVUA 1YRWA 3TF5A 4Y6GB 3FMGA 3I0MA 2A57A 3RCBA 3FXAA 5ADUS 1EFKA 2ZIWB 2AMLA 1AHNA 1VLZA 3OIYA 4GOND 1P9NA 1Q6YA 1M54A 4JQCA 5I7HA 4R8MA 2XCRB 1AS3A 2HMWA 3ITEA 2CYAA 1VPEA 4JJKA 3QPVA 4MIKA 2QSJA 5JSYA 2IZ6A 4F92B 2HJ9A 1T9GS 1MDFA 3ZWWA 2BWBA 2JD2A 2QD5A 3DW3X 4K05A 2ZXFA 5ICMA 5JFOA 3W4KA 4EB6B 4GI3A 3T9DA 4CJXA 3ST7A 1DAHA 1KFEB 1P60A 3PFWO 3QKWA 4KI0A 4KDRA 4PPNA 4Q7EA 5FUVA 1BDBA 3TW4A 1BEEA 2OKGA 2FPOA 5M3BA 1XA4A 1FLVA 1ZW6A 3N2GA 4IBJA 2V6FA 3HA3A 1WSAA 3BDIA 3OIFA 1IWBB 3G85A 3G17A 1GU7A 4O2BB 5AJVB 3CX8A 4YHBA 1QS0A 2POQX 4IEFB 2IXFA 3O26A 1P5JA 4JYCA 3X2SA 4AUEA 4Y6OA 2Q6TA 3FHLA 2P8SA 4BVGA 2UYQA 4MCHA 2FPSA 4TV9B 4LBWA 4J2TA 2G88A 3L8GA 1E61A 1G20B 2CZGA 2RMKA 1RLTA 2X40A 1EJBA 3LV8A 4HVTA 1UOQA 2G70A 1DG1G 2OK7A 2PU5A 1A4UA 2Y77A 3BD6A 4PQEA 5JADA 1J39A 4GM4A 1U04A 4RPLA 2XYQA 2XEXA 2CRUA 2FR0A 3HHPA 3LUDA 3TSAA 4RO0A 2CMGA 2C4NA 2W6ID 3DLTA 4IGKA 4IHKA 4RMIA 3T35A 4RQBA 2W0MA 3RSFA 1LA2A 3EJ6A 5G1PA 3SEQA 1YI8A 4HN4B 1PR1A 1HK7A 3OD1A 4BX2A 5KPDA 1EFAA 4UHDA 4MAAA 5HBRA 1QU3A 3KPYA 4AZTA 4TL9A 1Q0SA 2K5UA 1POWA 3B12A 4JUBA 2GBFA 4EZBA 2HI0A 3SE7A 4CM1A 3AP2A 2ZWVA 3GRRA 4P3NA 5CX4A 1J99A 3GFQA 3JZAA 3PJGA 2HAKA 1BTOA 3AILA 3VDUA 3R5KA 4L73A 1NI3A 3EW7A 1V48A 4IJ6A 3SJ7A 2NXNA 2LIPA 3S2SA 1W34A 4HWRA 4HV4A 4GEKA 5GV7A 3P9NA 3ZEIA 1EGMB 3ODGA 4XIYA 2EQ5A 2Z1DA 5LOVB 4L5CA 4LMBA 1Z5WA 2O1XA 3QV2A 4BNDB 4R40A 4KYTA 2YWEA 1PE0A 4PPQA 5ED4A 2PUFA 1YGPA 3IV9A 5DLEA 3T12A 3H2GA 3TEMA 2W2PA 2OZKA 4BNIA 4PZAA 1QOZA 3T5PA 3L6UA 3BICA 3SJUA 4FOTA 1PR6A 4LC0A 4PTLA 4N18A 5A1JA 2PBZA 5HKLA 4AROA 1C4XA 2SNIE 4YJDA 1WV0A 3E1GA 1JFRA 1LLFA 2IQIA 1QTNA 3K6JA 4L8WB 3RU7A 5L7YA 3WWCA 1GXSB 1UUFA 2P2NA 1L4YA 3OEWA 1U3VA 1I1NA 1NYTA 3VSAA 4Q19A 4CMAA 2QTCA 4ZVLA 2FJ0A 4JDUA 2ODWA 1X80A 3EZFA 3FKSD 4B3FX 3HKDA 3P0FA 3NONA 1VG9B 1B1AA 3BIOA 3K5WA 4P2BA 1JILA 4DREA 3FETA 3ESBA 3H9JA 5FH9A 1NBMD 2R97A 2Z43A 4D4GA 2IV3A 2UKDA 4DRYA 3CW2A 2IU6A 4B45A 3SEFA 2YRFA 4CTMA 4MYTA 3DBLB 5DP2A 3NUGA 1D6NA 1GZ6A 3ED5A 1YE9A 3HU1A 1WQ1R 1M6VB 3JVUA 4K2HA 4NBRA 3ZTYA 2NV6A 2ES4A 4RWEA 3V8VA 1QDEA 3EZXA 3SK0A 4QYSA 5L95A 3DVAA 3GJXC 3F6YA 4BB9A 3LWNA 1QUFA 4Q12A 2HK8A 4Q05A 4DPLA 4NJMA 4NAHA 1TAHA 1ECGA 1EG2A 3L82B 4R69A 2PJDA 3ZG6A 1A50B 1JDNA 4PG6A 1TO1E 5KX5B 3WMRA 3R41A 2YXDA 4B47A 3WGOA 3BCRA 1TUIA 3L9XA 2Z5FA 2G04A 4I9UA 3TW8B 5K7SA 1VKJA 4PPFA 3ZZNA 3GGSA 1W2HA 1IXZA 3F7OA 3PUXA 1Y7LA 1S1CA 3LZ6A 1PLLA 4GR9A 2OCLA 4DZTA 4JH0A 4MVCA 2BGNA 2ZT6A 2JFZA 4BO6A 4OXKA 5A4JA 2UUAB 3M4ZA 2UUCB 2L19A 2GO7A 1YASA 2AMYA 2QRPA 1UQTA 4NENB 1DRWA 5JS8A 2IHUA 4EF4A 4FVTA 2VI5A 1E0KA 1GZDA 4MIEA 4RMHA 1J2RA 2XECA 3LCCA 4F7WA 4TS9A 2JJ2D 1IJEA 2F00A 4IGAA 1IZZA 2B4AA 2C59A 2PBFA 2V8OA 4M8IA 1FU7A 4MQ4A 4ND4A 1SCNE 4Q02A 4DS3A 2GWRA 1BMTA 3EVZA 4O2LA 3BJEA 2QRJA 4G5YA 4H6VA 4OP1A 1GPJA 2OXRA 4M88A 5FBQB 4IHAA 4IR7A 2QS9A 4KKVA 4D2IA 2R45A 1STOA 1JZTA 2H48A 2JIMA 2VHCA 3ESCA 4DRXA 3LKBA 3M7GA 5JBQA 1PJ3A 3WWOA 4R6WA 1LZLA 2EA0A 2QQGA 4EG7A 2COEA 3RAEC 5E6UB 1TCVA 3PHIA 3WVNA 2Q6IA 3AQ4A 3DMTA 1O1YA 3D59A 5HKKD 4XFJA 1DCTA 1YTUA 3BGWA 4QUHA 1HSZA 4NCXA 1NVGA 3TZBA 4BRSA 1XZEA 2XKJE 3C7DB 3J7TA 3ECAA 1KIFA 4Q4LA 5TEWA 1EAMA 3UG6A 1S2GA 3B7PA 2N75A 1RD4A 5D5QA 3HXOA 1ZD1A 1GUBA 5LU9A 3R09A 5JCJD 2E4XA 3C3XA 3E3LA 2H4ZA 4RK7A 4ZT3A 5F5NA 2R8OA 4LA4A 2WWVD 3PI6A 1SVSA 2DI0A 1II0A 5C7LO 3NYIA 2J7PA 3GP5A 3OHMA 5KYTA 3KHUA 3GMDA 1E9RA 3UCEA 5G4KA 5TRTA 4B3TB 3RS8A 1VSTA 4OM8A 4D46A 1SUFA 1VM6A 4QX6A 1T1IA 5ER9A 1A7AA 1JKJA 1EM8B 2R46A 1H65A 2IOHA 3WK7A 4B2PA 4PFSA 3KV1A 4TT8A 1LC0A 3SVZA 1PNVA 3AUJB 3A2NA 3I4FA 5LZ2A 1RWQA 2XZDA 2AEEA 2F3SA 1Q57A 1E99A 1QFYA 1QMPA 4CKWA 1YK0A 2ZRQA 4X97A 4CEHB 3NHWA 4TRRA 5KOHB 4XJSA 3MCUA 3UJBA 3R0ZA 1V8BA 2OO5C 4YRIA 3R9WA 3S8YA 3B1ZA 1KYWA 1RKVA 2AG8A 4P54A 4CKBB 4DR4M 2VCEA 2OCBA 2KBFA 4LYFA 5T4FA 3OTOM 1DVRA 3K0CC 4XAQA 3A7EA 5I45A 1GV1A 2WFZA 3L43A 2ZXEA 5A71A 1I30A 3UH1A 1PN3A 2QX9A 1PT5A 3EIWA 4XQCA 1AC5A 4GKKM 4LV5B 1TB4A 5CTJA 2F1RA 2HQ1A 3WKCA 3AM5A 1XA3A 3Q8XA 2JGDB 3EH2A 3CG4A 3QLVA 3VHXB 1JL3A 2J6HA 1XKTA 2KHZA 3CT6A 3EZLA 2WYIA 2WD9A 3AJDA 3FWKA 4P0TA 2X9VA 1VE3A 3NOXA 2PIDA 4XVRA 4IJMA 2HL6A 4DRXB 2GK4A 2TMGA 4DSAA 2H4JA 4IL5A 3TSYA 1GR0A 5A2QS 4EARA 4M1KA 3GRKA 4MPRA 5E6UA 3GLQA 4I1OA 2RHBA 3R7AA 2CLOB 2PZJA 3O8QB 3GQBA 1SD5A 3PTLA 4RACA 2PFGA 4F7DA 4WN9B 4HLNA 1VPVA 4FGSA 3R7NA 5JAPA 1VRVA 1LBHA 4PV7A 3RE8A 1Q1ZA 2WTXA 3BAFA 2VPPA 1FFGA 2YRXA 3ZGNA 4B3GA 1FNCA 4BP9A 3KC2A 4YN3A 5FFNA 4R7TA 4F72A 2O7NA 4FK8A 2YWXA 4Q7QA 4GO1A 5CFZA 5HKBA 2BGWA 4K8RB 1A98A 1AKEA 1FP7A 4JBIA 5M7EA 2O7SA 5EMKA 3IP1A 3AJ8A 1C0EA 3UXHA 2VHXA 1O5TA 2RHGB 2ZZNA 1P1CA 4NLLA 3AERA 3DHNA 2AUNA 5T5QA 3USZA 1IVSA 2BMFA 2IIBA 3OHSX 5EE1A 4E2YA 3ZY2A 1F4PA 1TKRA 4HQLA 4DCJA 4HDNB 4D0RA 5IASA 4Z2AA 2DQYA 4DV0M 3LK6A 3A9RA 1ND5A 2L17A 3NW9A 2OYRA 4F5YA 2D74A 3G79A 4MZXA 5JCPA 1GNQA 4FDVA 3DOIA 4N8EA 1BDIA 2J4FA 2VWPA 2B6NA 2J7KA 5AXBA 2PLAA 4CYMA 4LFCB 2PGDA 5C32A 5FFFA 5K3AA 1QV7A 3EB9A 2OO9A 4IJUA 4AG5A 1J49A 3I6BA 3UGTA 3U5TA 2HL7A 1G3QA 3KDSE 3KXPA 2VJNA 4Z53A 1S01A 2UDPA 5FOXA 5IWCA 4FYMA 3VJLA 3P2KA 1IDOA 5B4UA 3ICWA 5C7OO 1R2QA 4QSHA 2PCLA 4Y2SA 3T5DA 1M2WA 2YASA 2P2GA 1GGMA 3AESA 3HNOA 3KR9A 2XBUA 5LOVF 3TE6A 5CD1A 4BTLA 4YMVA 5JI2E 1XQ6A 4WUVA 5DDIP 2GKGA 2Y1DA 4KQ9A 4BRZA 5C35A 1YL7A 3P9PA 3P96A 5BWCA 2FPWA 2P1ZA 2WYWA 4JP2A 4P3YA 1Z13A 2A59A 1HTWA 4DIEA 3I3OA 4P93A 4PG7A 3VNUA 1Q7BA 4Q3BA 5B1DA 2F7SA 1SUSA 3CX4A 621PA 1PJRA 1QCDA 2ANBA 3AZOA 4GEWA 3C9PA 4PVCA 1ZN7A 5CGZA 3UPDA 3JQPA 1RAIA 2A9OA 3B7WA 1FRNA 1ZM2A 3A11A 4PHGA 5AJXA 2C7QA 3LT1A 2V97A 1ZMOA 2HLDA 4BO9A 1FYXA 3Q2KA 2NXJA 1R50A 5HEKA 2IDZA 2PS0A 5DW3A 4G4JA 4WESB 5DWDA 7MDHA 2PLFA 2BUAA 1J0BA 1M8GA 3CS3A 4LECA 4LRYA 3EQ6A 2QQ0A 4RNDB 3FTPA 4BU1A 2IXTA 1QVAA 1GU1A 4RD1A 4EKIA 5AH0A 4CIXA 2ONJA 1I01A 1XZBA 3GEIA 3CB4A 2ZETA 1H3EA 4CFSA 4JX8A 4HX2A 3PHHA 3Q3CA 4RC9A 5CLFA 3UJ8A 5HSGA 4DT1A 4MWDA 4UDYX 4J1QA 4L4SA 4IS2A 1GR1A 1C30A 2FV8A 3DWEX 4FDTA 3WA7A 5CPBA 4U02A 4JN6B 2ZUEA 3D6NB 3O9ZA 3U61A 4V0RA 1NXPA 1US8B 2E4VA 3KFLA 5JWOA 5DNYA 1G38A 1X1DA 1XD8A 3C3KA 3KOYE 2QVZX 2ZE7A 4TZTA 1ZS9A 3D8UA 4DLLA 1N32M 3TGPA 1RXVA 3RI3A 1EWVA 2YUTA 3ILSA 2CP8A 1BXRA 3H13A 4OKNA 4YPOA 3ZWVA 1N8NA 2NAPA 2ZR0A 3RUEA 5K4AA 2G08A 2DR0A 2EX4A 1MQAA 1G2QA 2P9TA 4J29A 1ZVQA 5AW0A 3WGQA 3E2PA 2GILA 3MJFA 5CAEA 4JYZA 2V65A 5FI3A 4DPKA 5H5JA 3QVTA 1G5IA 3ORRA 1ULAA 1Y89A 1DQRA 4NRVA 4Y0VA 3NTOA 5K8JB 2XF2A 4J9UE 4PAOA 4GWLA 4Y1RA 2R8XA 2LVAA 3DBHB 2J5XA 2HWJA 3T0GA 1A9YA 3ABZA 2BV3A 4J0GA 4LBZA 3T99A 3GG2A 4LZLA 3UJ3X 4F3TA 2QMOA 3H83A 4PWZA 5HFJA 4UNNA 4KACA 1O0BA 1SUEA 1V11A 5ILGA 1EPUA 3D02A 4XWWA 4EFNA 3KU4A 2RC5A 3TNJA 2KWIA 4XD2A 3FSRA 3I6ZA 1XAIA 3DKKA 4XZ3A 5CG2A 3PNLA 5ALMA 3ZY4A 3T7CA 4GGPA 3BSFA 3C6QA 5JJCA 3DOCA 2P5SA 3B48A 3K5PA 2VQEM 4KQCA 1C9DB 3LHDA 4RZ2A 5K8UA 3PFFA 3WK5A 3FNHA 3FLBA 2V7PA 3TRJA 2W82A 4A5OA 3LM8A 5L7TA 4FWHA 4IIEA 1D09A 2JCGA 3MUEA 5HMLA 1VZ3A 1DJMA 3F90A 4QATA 2YMQA 5I4CA 2JD0A 2LCQA 1MXHA 4RFSB 1QVVA 4E5UA 3BGVA 4M0LA 1AO0A 3LLCA 3OUUA 4E32A 2QG4A 4Z9AA 4X95A 4PX3A 4W4TA 4D4LA 2GZ2A 1FTNA 1O6FA 1TT7A 2CJXA 2VZEA 3BXZA 4DQVA 5KVSA 4KRFA 1FMLA 5FLKA 3VPCA 1YMVA 2FA9A 1NXOA 3D2LA 4ND1A 5F1PA 5JJBA 1UAAA 4D8UA 4B85A 1CF4A 3NBFA 4B82A 5JDCC 2RGYA 2CD9A 4R1MA 1TVKA 2VK1A 3ETDA 3NG1A 4U3JA 1RKQA 4C5CA 4UM9B 2EJWA 2UXDB 2WA2A 3W0FA 4U00A 5LFAA 5C8ZA 1PL7A 3N2ZB 2BEWB 2PRJA 4INZA 4M83A 3I28A 3EX7C 1L7XA 1XTBA 3FRHA 3KLOA 1GSAA 3QX9A 3U0BA 2C1XA 2ISCA 2B2NA 2D2EA 2P4QA 1RABA 3LD9A 5JNWA 1GQSA 3NGXA 4PFQA 4XM1A 4YYZA 5KWSA 1Q7TA 3ESQA 1ZX1A 2LVOC 4J7XA 4RD0A 2CCGA 4FNMA 5BSTA 4K9DA 4ZVSA 3QLVC 2MYTA 5IABA 1LV7A 1K4KA 2WDZA 3DPIA 2WZQA 4OO3A 2PZLA 4YQEA 2QZSA 2AJTA 1J1UA 1ZI8A 1L4FA 3SBJA 1H1DA 1QKJA 1YS7A 3KTFA 4HDSA 4KCGA 4M0KA 3P0IA 1MQ9A 5UKDA 1P17A 3AUUA 4WSOA 2J5BA 1I7LA 3LVFO 5NLLA 4GKJB 4Q24A 2BMJA 4Q01A 4NXMB 2YICA 1QHHA 1I4EB 1T26A 3PQ4A 1CR6A 2D7CA 3VC1A 1WB5A 4DDKA 5BSKA 4AY4A 4DLYA 1QPZA 3SGLA 3THXA 4Q6BA 2DKNA 3KKKA 2QHOB 2DAKA 1QHXA 3OZFA 4DSUA 3O3CA 3KQWA 1U2QA 3DOHA 4QARA 4GSLA 1C7JA 2XH8A 3RYIB 1O97D 4CHTA 3G2PA 1JPNA 1Y3CE 2R6R1 4K3VA 4Y1FA 4HFMA 4ILEA 1V1RB 1BO6A 1V4BA 4EJSA 1GT6A 1IM5A 2VYQA 4O2RA 1HE4A 2YKGA 4O5OA 5EN4A 1SBHA 1NC3A 4FT2A 4JOQA 2H8KA 4GMGA 4MUMA 1Z5PA 1CR1A 2IIVA 2VWGA 3DMFA 4RVGA 4TV8F 4D41A 5IZCA 2OE2A 2QTVB 4UZEA 2OHJA 3UMGA 3ZQ4A 4KAFA 3RASA 5HG0A 4K88A 4RKRA 3FZNA 3Q85A 1EVZA 4B17A 2OD9A 3HR7A 1W59A 4WKNA 4ZDJA 2A9JA 4D6PA 4LWQA 5ALVA 3IYLW 1CJBA 1IJKA 1H2EA 3NRJA 4LPSA 3UY4A 3H8WA 4KR0A 3AR9A 1FMTA 4P7FA 5U9CA 4ICIA 4NFHA 3EFHA 3EG9A 4Q3LA 2WEKA 4FS8A 1NSYA 4X45A 2NO6A 4FDMA 1P8AA 4KWEA 1OLUA 2V9CA 4XWOA 3OF5A 4F06A 4TUYA 4G24A 1KI9A 1SU7A 1WIWA 4QEDA 4IIHA 4QJ3A 2K47A 1MO4A 5FDFA 4JLUA 1OT5A 2FXVA 2B4QA 5I4BA 4Q4AB 1K3FA 4FXOA 5I5EA 4JWKA 5THXA 3VSDA 2HWXA 3DCIA 4J2OA 1LTKA 4XSHA 4FP9A 2X5XA 3F5QA 3LSTA 1TCAA 3VPDA 2P7IA 3MYYA 2Q4DA 1DX4A 5JD4A 2XCLA 1HYQA 1XOIA 2C42A 2OPBA 3PNMA 4CBVA 4KN5A 1H0KA 4D9IA 2I1QA 3N05A 2XGSA 4L9AA 4RGVA 3SIPA 1HT1E 5HE8A 2E5LM 1XHBA 5J23A 3BRWA 3DBOB 5HK8A 2X4DA 3DE3X 3F9RA 1GCGA 3D7SA 3RRJA 4HNUA 3O8CA 3RTCA 1HY3A 5FNZA 1DAOA 1NF3A 3HWSA 1V9CA 1ZH6A 2WHQA 2JIBA 4AU1A 3H99A 1AD2A 2SCUB 4AM8A 4G07A 1VL8A 5DRTA 1QRDA 5L6LB 9ATCA 2H1CA 3E7FA 3DTVD 2B35A 3UHPA 1I1HA 4ARIA 3ZI7A 3OCUA 5TJ9A 5BQXA 1Q3TA 1R9GA 3EGCA 1LDNA 3GGCA 4M7RA 1ZUNB 3K9OA 1PZHA 1JU4A 2VDWB 4IQ8A 5KYUA 3SZMA 5CG1A 4PCUA 4E08A 3LCUA 2JF0A 2C2ZA 3IPAA 2QWXA 5K0ZA 4CEJA 1XIVA 5FEUA 5JLAA 4ER5A 3F73A 1EVJA 2ECPA 2VH5R 1DO2A 2L4FA 3WV5A 1P3QQ 1Z38A 2B5WA 1E79A 4D8XA 1A96A 1GNSA 3W4IA 3HQ4O 2WHRA 4HNAA 2DSNA 5C52B 2QZPA 3GC6A 4JUAA 1UWVA 3YASA 1TEVA 1S9HA 3FJ1A 3TRKA 3PPWA 2AS0A 5HTKA 3R9KA 4IOMA 5BN3A 2EERA 2VAMA 5I01A 3DPUA 2FZGA 2ZIGA 2I4LA 3TOVA 4NSNA 3R3WA 4E5PA 2RHTA 2ZBDA 2WF6A 2DSTA 3OFSA 1D07A 2I7CA 4HTAA 3SBDA 1XVTA 1Q2XA 3OAAD 4O59O 3QJYA 1MB4A 2O3TA 2EYQA 2PAAA 5B7QA 5HP4A 3IPRA 4A2CA 1AUVA 2VHUA 4O29A 3OFVA 3AG5A 1OVGA 3V55A 1RRCA 3A1VA 3PUWA 3HFGA 5AR1A 2QNRA 1RWMA 4GG1A 4JOBA 2BJVA 5LJIA 3HJGA 4DB2A 3LLSA 4KI7A 1Z83A 1HF3A 5IUJC 5DX8A 3ABRB 4EMTA 3EMDA 2WHEA 1NR7A 1IH8A 4R3WA 3VNVA 1T2NA 2K7FA 5TMEA 3HC7A 4Y9RA 1E3SA 2DNAA 3Q1KA 1SVWA 1XWFA 3KUDA 3MLBA 3R74A 1QANA 3INRA 4ADSG 1KSHA 1VYVA 1B26A 1LVGA 2YUIA 3DL0A 1R6AA 1MC4A 1UEIA 1AIPC 2ZI4A 4GLLA 3U3DA 3KOXA 3W1WA 2ZRLA 3BUSA 4BLWA 3KFVA 1V5IA 4HQRA 3ZVLA 1HGXA 2Q2OA 4M89A 1N3IA 4D9CA 4DTCA 3PC8C 4HG2A 4ZYLA 3M5WA 4BLVA 2ZJ7A 1Y3BE 1NVEA 2BMDA 1Y6FA 1OKSA 2XFSA 3PITA 1JFSA 2RHWA 1NW9B 1BVHA 1CS0A 5G0VA 5IBQA 2FFHA 1C0IA 4RA9B 5REQA 2P9HA 2CB0A 2ZJ1A 2WA1A 3T1QA 1U94A 1X0XA 2FB9A 2OBBA 2XIJA 2EW2A 2ZSKA 3GW8A 2VDOB 3A1UA 2V3CC 1NQWA 3GJSA 4IVRA 5AI9A 1SHJA 2J46A 4I4CA 2NTVA 4IJQA 4MWSA 2E6UX 5C8YB 4CEJB 3G9ZA 4B87A 4I81A 3NKVA 2P4UA 1KMQA 1KARA 2CDAA 1GQRA 2FETA 2OYSA 4XLTA 5DHQA 2NNLD 3FOZA 1VQ1A 5ALOA 5C46F 5F35A 4YHHB 2ZVPX 5LDHA 3LDHA 4OAOA 2HU2A 4ZQBA 4NCAA 3SXJA 1C3OB 3NVKI 2V7TA 3S81A 4CCAA 1WKVA 5FI1B 3KP1E 3QU2A 4FB5A 4HVLA 3ABQB 2IY7A 1LCIA 2BEUB 4BUZA 2HJGA 4NK5A 3M1YA 5BQ3A 1M1NA 1PW7A 3MT8A 4JIMA 5KNCA 3BQMB 1U4SA 2V0NA 3VYSB 5JCOA 4YJ2B 1EGQA 4DLWA 1NVDA 3GG9A 4ZDWA 4HADA 5EGNA 2GEFA 3B70A 4G0OA 3SKVA 1J23A 2ODEA 3O84A 3EG5A 1U4OA 3GDFA 4AJOA 1USWA 4MI3A 4C7KA 2P35A 2B1IA 2PXXA 3H5OA 5IBRA 2KX7A 3V4VB 3WSTA 1KTIA 3X0DA 2SBTA 3IUBA 4TN5A 1M5UA 1G7CA 1L5RA 1T9BA 1HRDA 1TTQB 1V16A 1XD2B 2EFEB 2WWIA 2H5LA 3AW8A 1YR7A 3PSHA 4NS4A 1J56A 1YQQA 4MLPA 3R0VA 3ZXSA 2I4OA 3K9WA 1WG8A 2OFFA 4HDQB 4BWGA 4D92A 5EZQA 1ACMA 1JU9A 2P40A 2D1SA 3ANYB 1TA4A 3CNOA 3D1VA 4GAEA 4HEQA 3TWMA 1UBCA 4S35A 3WDLA 4BXOB 4INOA 4CRWB 2VUSA 2OPHA 4ZHSA 2B7BA 1MABA 3CQ9A 3FCOA 1XVLA 1O4WA 1SCUB 4JYAM 3IULA 1GIAA 1FDTA 1IONA 1L4NA 4X66M 5IVDA 2O52A 1N33B 1RRPA 2CXRA 1Q91A 4IX1A 1QC5B 3VBCA 2OKCA 1CZRA 3EUFA 3LF1A 5AHWA 4M9QA 2GQ0A 4CN9A 3M3HA 2FVYA 1KBQA 1JAIA 1IY8A 3KE9A 5HUQA 2FMXA 3GHYA 3ANTA 3HVKA 3PFHA 2LVPC 1IATA 4UD6A 4A6EA 3ZV4A 3ZW8A 5DTEA 2DLNA 1II9A 1Y3FE 2JAQA 2UV8A 4EP1A 5JRDS 3ZHTA 5JY1A 4MMZB 1JQEA 1QGUB 4KR9A 1O9HA 4XDZA 3WFIA 1F1JA 2ZYDA 1WZEA 4IDAA 4M21A 1Z5AA 4RDHA 3P71T 4IJWA 2FP4B 4Y2TA 1I14A 1UEXC 3QF4B 4KN6A 3VV2A 1UP7A 1RSZA 3ORSA 5I9SA 2C29D 3I39X 1GQ2A 2GNAA 3FKQA 3KEQA 4UDNA 5AI4A 3FPHA 5BORA 2VK2A 1R9JA 1O6ZA 1KFBB 2R6HA 4LOAA <