3GRVA

Crystal structure of the complex between adenosine and methanocaldococcus jannaschi dim1
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
262
structure length
262
Chain Sequence
QCFLIDKNFVNKAVESANLTKDDVVLEIGLGKGILTEELAKNAKKVYVIEIDKSLEPYANKLKELYNNIEIIWGDALKVDLNKLDFNKVVANLPYQISSPITFKLIKRGFDLAVLMYQYEFAKRMVAAAGTKDYGRLSVAVQSRADVEIVAKVPPSAFYPKPKVYSAIVKIKPNKGKYHIENENFFDDFLRAIFQHRNKSVRKALIDSSKELNYNKDEMKKILEDFLNTNSEIKNLINEKVFKLSVKDIVNLSNEFYRFLQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding of adenosine-based ligands to the MjDim1 rRNA methyltransferase: implications for reaction mechanism and drug design.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
molecule keywords Dimethyladenosine transferase
total genus 89
structure length 262
sequence length 262
ec nomenclature ec 2.1.1.-:
pdb deposition date 2009-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3grvA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3grvA01
3CBGA 1VBFA 3QOWA 4GOMD 2AOTB 3G2MA 3FTDA 3HM2A 4GEKA 2UYOA 1SQFA 3HCAA 2ZWAA 4RVGA 4FSDA 3HCCA 4PNEA 1KYZA 4RTLA 5CVDA 3A26A 3I53A 2OKCA 3OZRA 3WSTA 2V74B 3HCFA 2P7HA 4RVFA 4C04A 5HZMA 3OE5A 2XYQA 3RIEA 5HIIA 2AN5A 4RTJA 3C3YA 5LQCA 3EVZA 2XBMA 3EVBA 1L3BA 3CJTA 3UZUA 1L3IA 3KR2A 5KS2A 2G71A 4CWAA 1KPGA 3CJQA 3AJDA 3P9NA 4HG2A 1JQEA 4QTTB 5HILA 5BW4A 2GAFA 2ZBRA 5HIJA 3PFHA 3KQSA 3TR6A 2Z6AA 3DUWA 2UYCA 3KPWA 5ERGB 4PYNA 2AR0A 3I9FA 5BP7A 3LBFA 1ORIA 3KR1A 1M0EA 1N7IA 1R6AA 2PX2A 2BZGA 1QAOA 5F2NA 3G5LA 3EMDA 5K0JA 2FRXA 2AOTA 2ZSUA 4F84A 2ZBQA 2ZWVA 4RV9A 3RW9A 3RODA 3SSMA 3HEMA 3HCDA 4KRGA 3QV2A 5B1SA 4H0NA 2VS1A 4PGGA 2FK8A 3L8DA 3ME5A 3ORHA 1N2XA 4PYJA 3OE4A 3P9KA 3UA3A 3ER9A 4O29A 5EQJB 3JWIA 1G38A 2DPMA 1EJ0A 1HMYA 5FULA 1JG2A 2OBFA 1HNNA 3EPPA 1O9GA 1XTPA 5DM4A 3T7TA 3TLJA 2VDWA 4LECA 2JH9A 3UJAA 3EGIA 2C7PA 2Z6QA 1N7JA 3HCBA 4JXJA 4OQDA 1JQ3A 3OU7A 4QQNA 3K0BA 1L3CA 5ICCA 2PLWA 1KP9A 3DXYA 4Z2YA 4U7PB 2CL5A 3BWBA 2NNWB 4PYMA 3R6TA 5CM2Z 4OX9Y 1P1CA 3CCFA 2UYQA 3KR0A 4PINA 1YFJA 3DOUA 4CTKA 1RI4A 1PRYA 5EKXA 5E8JA 2QY6A 2IGTA 2Y1WA 2JH8A 3UJ9A 1OR8A 5KQSA 4RTQA 1YUBA 3UBTA 2QE6A 2VDUE 1YB2A 4RSRA 1YZ3A 3PTAA 1DL5A 1UIRA 3NDJA 3MTIA 1JTEA 3KHKA 1U2ZA 1INLA 5FHQA 1X19A 3R24A 5HEKA 5KQRA 3PX3A 2PXAA 1RI5A 7MHTA 3G2OA 3T0IA 3DTNA 3IEIA 2QYOA 3DMGA 3HCEA 5IH3A 2PXCA 5DTQA 3GRYA 1TW2A 3M33A 3SX0A 1X1DA 2H11A 3FRIA 4YUZA 1YF3A 5E1DA 5F2KA 5K0LA 3F4KA 3E8SA 2AOXA 5DTRA 8MHTA 5EHGA 3VC2A 5CCBA 2I62A 4MHTA 4E33A 3FRHA 3FPFA 3M6XA 3LECA 5EZSA 4B17A 5CCXA 2AS0A 2O07A 2PX8A 2NXJA 4RTPA 5GP1A 2OPBA 4FS8A 2F8LA 3HTXA 5GINE 2UYHA 5E8RA 5CD1A 1R00A 3LCCA 2YXDA 4RX1A 3SM3A 5EMJA 2NP7A 3U81A 2XVAA 4M37A 2AN3A 4EMSA 4DA4A 5CVEA 1BKYA 3SSNA 2GB4A 2ORED 2P3LA 3VSEA 4IV8A 3S68A 5EZQA 2I6GA 1AQIA 4IKPA 1D2GA 1RJEA 2GLUA 5EEGA 2FPOA 5EEHA 4E30A 2PXXA 3EMBA 3P2KA 3EVFA 1L1EA 5EPEA 4POOA 4XUDA 4UOEA 5HOQA 3G2QA 3FYDA 1RJFA 1G8SA 3ELDA 2K4MA 3B3FA 2YTZA 5T6BA 4QVGA 2PSSA 4BLVA 2O05A 4RWZA 1Y8CA 5U4XA 3EVAA 3JWGA 3FPGA 4HGYA 4FSXA 5DTMA 5K0GA 1O9HA 3DXXA 2AOVA 2P8JA 2WK1A 3MB5A 4HGZA 3KQQA 3SSOA 2R3SA 3NTVA 1NT2A 2R6ZA 2IH5A 3BGVA 1YFLA 2PKWA 5K0CA 5IKMA 4PCLA 1M6YA 3ELUA 3HNRA 5EMKA 1D2HA 3DR5A 3R3HA 4M7RA 3MAGA 2IPXA 4CKCA 2PJDA 3FTFA 3LKZA 2B3TA 4GUAA 5K8VA 2BM9A 2PT9A 2ZFUA 3C0KA 3HA5A 3IYLW 4P7FA 5EC8A 4PONA 4YMHA 1F3LA 1X1BA 1G6Q1 1BC5A 2ZCJA 4BY9E 2CKDA 5DX1A 5FHRA 2NP6A 3AXSA 5GWXA 4RTKA 3LKDA 3NW9A 1O54A 2PT6A 3CVOA 4C06A 1ORHA 2FHPA 4ATNA 4RTNA 3GIWA 4L7VA 1VPTA 4OBWA 3EVGA 4QTUB 1NV9A 1TW3A 4GBED 4EVIA 2AOUB 3FPEA 2C7RA 1JG4A 3FYCA 5FUBA 3OU2A 1Q0TA 1YZHA 1FPQA 3CJRA 3LSTA 1UFKA 1AF7A 2FCAA 3TOSA 3EGEA 2G72A 5DSTA 4GC5A 3C3PA 3X0DA 3BGDA 4LWPA 4M36A 4DKJA 4EKGA 2GH1A 4HC4A 3G5TA 4DQ0A 2LD4A 1R18A 3DLIA 1PJZA 2HMYB 2OY0A 1JQDA 3A7DA 3KQPA 3GJYA 3AWIA 3PX2A 1D2CA 3CKKA 2H1RA 4GF5A 3UJ7A 4AUKA 4AZTA 3HVJA 1ZKDA 4C07A 1KPHA 1M6EX 5K09A 2QRVB 4A6DA 1JSXA 5D1NA 3GU3A 1XJ5A 5MHTA 3TQSA 4X1OA 4EK9A 3PVCA 5GM1A 4M38A 3ERCA 3NVKI 1VQ1A 3DP7A 1QYRA 4FR0A 2JHCA 4LWOA 5DX0A 2OYRA 3TKYA 4ER7A 5HIMA 3BGIA 5GIPE 2C7QA 2ONZA 3KQVA 3HA7A 4V0QA 1XVAA 3KPJA 5CVJA 1SUIA 2IH4A 1XCLA 3I64A 1X1AA 2BR3A 3A4TA 2JG3A 4RTMA 5T67A 3GNLA 3OU6A 3LGAA 1P1BA 3KPVA 3NMUF 3SGLA 2PWPA 2EFJA 4NECA 2XYVA 4GOLD 1TPYA 1QANA 4WVLA 1B42A 4DCMA 2Y1XA 2GA9A 1DCTA 3DLCA 3P2EA 4QDJA 4XUEA 4PYIA 5EHIA 5K0FA 4E2ZA 4G56A 5K03A 2AZTA 4OA5A 5C0OE 4AZWA 2O06A 5LQUA 3P8ZA 3BZBA 2A14A 1QAQA 3JWHA 5DRYA 5LQRA 2ZULA 1F38A 1NW5A 3FZGA 1XDUA 4ER5A 2YUIA 5K01A 1BOOA 2YX1A 1SG9A 1SUSA 3C6MA 3PFGA 3KQOA 3M4XA 4ISCA 1IXKA 4RVDA 3G88A 1EIZA 3GRZA 3PT9A 5C1IA 3TMAA 2ZZKA 1QZZA 2PX5A 5LQKA 5FWDA 4FGZA 3TRKA 4C03A 3DMFA 3E23A 2YQZA 3T7RA 2G1PA 3KR9A 1JSZA 2QRVA 1XDSA 3BT7A 1JTFA 4CKBA 3E05A 3OZSA 3BKWA 3KPUA 5KVAA 1FJXA 3VYWA 5EG5A 4QVKA 1WG8A 3FUTA 2BR5A 5FA8A 4EQZA 5FWAA 1RJGA 3EVCA 2BM8A 1P91A 4DCGA 2ZIEA 4OA8A 3KQMA 4FZVA 3I58A 4RVHA 2IP2A 3P71T 3MHTA 2VZ9A 1WXXA 3SXJA 1IM8A 2IIPA 1KIAA 1WS6A 1KPIA 3IHTA 4PYKA 5EMMA 2ESRA 4DZRA 4P7GA 5HFJA 3TM5A 4C08A 3BWCA 9MHTA 4ER6A 5K0BA 2ZTHA 3FUWA 2B2CA 2GPYA 3MTEA 3FUVA 4YUXA 4R6WA 3EVDA 2PWYA 3KPYA 2OO3A 5DRTA 4E31A 3CGGA 3NWEA 4FT2A 2JJQA 1L9KA 3C6KA 4KVZA 5DXAA 3UFBA 3G89A 2AVNA 2NXCA 3HP7A 5DWQA 4GOOD 5DM1A 3LDFA 1KYWA 3LL7A 4PGHA 3K6RA 4XCXA 1R8XA 2P3OA 3GCZA 4V0RA 4AZSA 4BLWA 5DLYA 4RTRA 5LQNA 5DXJA 1UWVA 2BR4A 2O0LA 1DUSA 2EG5A 1ZGAA 1I4WA 2V7EA 3PS9A 5FQOA 4F85A 3LCVB 4YV2A 3R9XB 1R74A 3MCTA 4IWNA 4MIKA 4HRAA 4BLUA 2EJTA 1JG3A 2Z6UA 3ID6C 3G2PA 5LR6A 1I1NA 1RI2A 3O4FA 1EJ6A 3MGGA 2WA2A 3TKAA 4KIFA 4PIMA 1KHHA 2CMHA 1XDZA 2OB1A 4PIPA 4PWYA 5EOVA 5E1OA 3MCZA 3P9IA 2NXEA 2G70A 3M6UA 1AV6A 3BXOA 4MWZA 2PBFA 1SVUA 3EVEA 2ZW9A 3V97A 2P40A 2ZZNA 4CXMA 4DM3A 3GDHA 5LSAA 3GRRA 2IFTA 3OFJA 10MHA 1I9GA 3PB3A 1FP2A 3ELYA 2ZIGA 4R05A 3UWPA 3A25A 1KXZA 2ZBPA 5E1BA 3T7SA 3EEYA 4AZVA 1VP9A 1X1CA 4BP3A 5E2AA 4C4AA 3LBYA 2VDVE 3LHDA 4QPPA 5GIOE 2CWWA 3FTEA 4RTOA 3AY0A 4R8SA 4XUCA 4FT4A 2FK7A 2AOUA 2Q41A 5P8WA 3GGDA 2PGXA 5F2OA 3M6WA 3QOXA 1RJDA 3NDIA 4Y30A 5FQNA 1EG2A 5FCDA 5GM2A 3Q7EA 4QDKA 5E2BA 2YVLA 1H1DA 5DM2A 5E9WA 2AOWA 1QAMA 2GS9A 2B9EA 3GXOA 4X63A 1KR5A 3B3JA 3UA4A 1AQJA 4PYQA 3ELWA 4YV0A 3ER8A 5DSXA 2G8NA 4OQEA 5K0NA 4KDCA 4QQKA 3B5IA 5K0EA 4IV0A 2EX4A 2PV0A 3KU1A 3FPHA 2NYUA 5GOZA 3IV6A 3M70A 4KDRA 3BUSA 2NXNA 1VP3A 1JG1A 4YV1A 4U7TB 3P2IA 3B89A 3NJRA 5FA5A 4YUWA 5BW5A 5KYGA 1T43A 5D1HA 4C05A 5LQAA 3GRVA 3HVIA 4ZTBA 1XCJA 4RTSA 4MQ4A 3A27A 4RYLA 2ZIFA 1NKVA 1Z3CA 2WA1A 1WZNA 5EIFA 1JR4A 2IBTA 5DX8A 3E7PA 2YXEA 3THRA 3NVMB 1ZHFA 4EKIA 2P41A 3LPMA 1NW6A 3I5UA 2H00A 3BWYA 5DT2A 3CC8A 1VIDA 2VP3A 2N47A 3THSA 2P1DA 4E2WA 5C9ZA 1EQAA 2I7CA 5EMLA 4PYLA 1BHJA 5FADA 3FPJA 2ZLBA 2I9KA 1G55A 3G7UA 5ICFA 1V39A 3ANXA 1Q0SA 1SQGA 3OCJA 3V8VA 1XXLA 2PY6A 4E2YA 1ZGJA 4GQBA 4ER0A 3B7PA 1G8AA 4HH4A 4KWCA 4E70A 4F86A 4CTJA 4AX8A 5ICEA 3P9CA 3TFWA 3HVHA 4R8RA 2IDKA 4HSGA 5CUQA 3KQWA 5T64A 5EIWA 5HIKA 4E32A 2YR0A 1NBHA 2AVDA 2XYRA 5CVUA 5FTWA 3A7EA 1NW7A 3LDUA 5CVVA 2P7IA 1NBIA 3MERA 2YXLA 1VLMA 3OZTA 1VE3A 2XVMA 3DH0A 3P97A 1NW8A 3VC1A 2OB2A 3H2BA 4GOND 3DMHA 4KIGA 2HWKA 3HA3A 4X61A 5DM0A 5G02A 4BP1A 5LQJA 4PCAA 5ICGA 4PYOA 2E5WA 1ZQ9A 2O57A 4FP9A 1G60A 3G8AA 5JR3A 3LCUA 3DULA 2HTEA 2IDJA 3LDGA 1P39A 1RI3A 4P58A 4X60A 5DPMA 3SMQA 3UJ8A 2AN4A 3AXTA 4YUYA 5M5BA 2ERCA 3FUUA 2EJUA 2QM3A 3BKXA 3LX6A 3GO4A 3REOA 2DULA 4HTFB 3EEOA 3D2LA 4P7JA 1VL5A 4ER3A 3B3GA 4X41A 2ONYA 3BWMA 4DMGA 1NV8A 1ZG3A 4DF3A 2JHAA 5CIYA 5E9QA 3HVKA 3FUXA 5EGSA 3NWBA 3O7WA 4R6XA 5K05A 3JWJA 3PLAE 2UZ4A 3KQYA 3O31A 3FTCA 5H02A 4E2XA 4QPNA 4LG1A 3G8BA 5E1MA 2ZVJA 2B78A 4Y2HA 5EVJA 3SVZA 3UJDA 2IH2A 2BH2A 3R0QA 4MTLA 2C7OA 4A6EA 2HR1A 4HTFA 2HV9A 1EAMA 2ZZMA 1SKMA 2PX4A 2P35A 4WXHA 3MQ2A 4OBXA 5BXYA 1FP1D 3DXZA 5EKUA 5JUWA 3TPZA 2CMGA 4GC9A 4P7KA 2P3QA 3GRUA 3UJCA 1MHTA 3OPNA 2IBSA 1FBNA 3KKZA 3EGVA 2OZVA 1MJFA 2HNKA 1NE2A 2B25A 1WXWA 2JHPA 3SR4A 3UJBA 1RI1A 2KW5A 3KQTA 1NW3A 4KW7A 2OXTA 4CKEA 2ADMA 4K6MA 3TM4A 3M6VA 3GWZA 1WY7A 2FYTA 1R8YA 2PVCA 5E9JA 3Q87B 1IY9A 4YUVA 3UJ6A 4YMGA 3OFKA
chains in the Genus database with same CATH superfamily
1H23A 5E0OA 4JV5B 1CVLA 3GLRA 4YQFA 2HT1A 3QRWA 1DAHA 1Q1GA 2FB9A 3HM2A 3LL4A 4C0BA 1PQYA 1Y7IA 1TVCA 2VUHB 3AFNA 2P6NA 3IA7A 1NN0A 1SQFA 2QOEA 3DQQA 1BNCA 4KH0A 1D1QA 4X95A 4TZ0A 4RTLA 4ON9A 1TF5A 1UPTA 3H4TA 4DA6A 2WQ6A 1TM4E 2GM4A 1IOZA 4CG2A 2BGKA 5EYPA 4CU5A 4DV2B 3DLTA 5CB6A 1TAHA 5G4KA 4BBPA 3H3JA 4L6CA 4NV1A 3PWKA 1U8XX 5B3JA 2A1TS 1GEEA 2DAEA 4F9EA 2I2BA 3G2LA 5K0SA 3QNMA 4R41A 2DE0X 3EDQA 4RJIA 2CGEA 4WLOA 3H5IA 4ALIA 2OTCA 1DKNA 4BNLA 3GPXA 1OX4A 3ED5A 4KLRA 1YT5A 4WOJA 5A06A 2LH0A 3K15A 4RWEA 1DIGA 4X6UA 5GZ1A 3TR6A 2WLTA 4D25A 3TIVA 2ZM5A 2WG1A 3HY4A 1FQWA 2EW1A 2KBFA 4XRGA 2Y21A 4PYNA 1VKZA 4J16C 3AB3A 2O7SA 3W7BA 1RLJA 2JEOA 3KOWA 4XEUA 4CHGA 1FNSA 1RC1A 1N5LA 2WOOA 1AN0A 1QK4A 4BBAA 2X5OA 3JATA 4J9VA 5J1SB 3ESZA 4AG3A 4RV9A 3RTEA 3U9SA 1TJ3A 3TQFA 4B3JA 4M0UA 3NTUA 2VQ6A 4Q12A 3PL1A 4PGGA 2FK8A 5K8TA 3ME5A 4TX1A 2YJNA 3KTDA 5AXDA 4CMAA 4DY6A 1FF9A 1V2GA 3WMWA 3R74A 3O8OB 3RVKA 1L2TA 2WYUA 4AC9A 5DFLA 4P3YA 1M0TA 1JU9A 5B6PA 3AB8A 3N86A 3TLXA 2ZTVA 5L3SA 4RNDB 4AYTA 1O9GA 5KDDA 1N57A 4WKCA 3MUFA 1X42A 3GLHE 2I4LA 4RA9A 3W3AH 2CWBA 1E7WA 1YU6A 1RABA 1C4KA 2B1RA 1GGHA 3HCWA 4TT3A 3VBEA 4B08A 3Q7SA 4RK0A 2OG1A 3SK0A 3RJMA 3AU8A 4QUAA 4AICA 4DMMA 1TUBB 3PNYA 2C5FA 1I94M 3I23A 2NO6A 3WLTA 1CQJA 3N2KA 4OVKA 5ALIA 3RH0A 1XAGA 4BLOA 3JD4A 4GKKM 1Z2NX 4FX5A 2PYZA 4CCYA 3RJZA 5CAEA 4E6PA 3KZNA 1YB2A 1ND5A 2XH8A 2A3NA 3H3XA 1A27A 3FSEA 1DL5A 4JP2A 3U7RA 2F43B 3HKBA 3ROKA 3FUCA 1C7ZA 1F0PA 3JAMS 2HJHA 3LYLA 4H1TA 5FLEX 2IEIA 4DQUA 1INLA 1NIPA 5J4VA 3WDLA 3M1AA 2JAWA 1IFXA 2PZ8A 3CX6A 2PXAA 3HFJA 3M9LA 3P2MA 3TW8B 4E4RA 3KOZA 1IYZA 3KKQA 3NIFB 4WUVA 5EJ8A 3GLUA 4GWKA 1WUYA 3JQQA 3IBFA 5L6LB 1CR4A 2B83A 4OATA 1O0CA 4XD7A 3HCEA 4KR9A 5KJ6A 1YF3A 1V8BA 2RBKA 3FDZB 5HMMA 1HQDA 4DA7A 2P67A 1P75A 4B7HA 2CFSA 1FX1A 2W4MA 2YC4C 2P30A 2J6IA 2AOXA 3E7FA 2Y76A 3ENWA 1Z6XA 3IPRA 3GLFB 3H65A 4GXTA 4JEHA 3BX1A 3C97A 2HLPA 4DQKA 4EG4A 1OCEA 1HSOA 2JBAB 3DE7X 3Q10A 1A5BB 1UJMA 2GZDA 1R50A 4FS8A 5G1OA 1JXQA 5L4LA 3DAGA 4YO8A 1O5IA 4XUGB 2MROB 1W9MA 1HFWA 2YXDA 2ZSFA 5A4MS 4P53A 2QGZA 4EB6A 1LF5A 2OHXA 4M1TA 2HX1A 1CRWG 1FYXA 2A6PA 1A77A 1L5VA 3KYBA 3RFFA 4G2NA 2YJGA 3EWSA 4UU0A 1EBFA 2HU2A 2HC9A 3AUKA 2D8AA 3WA7A 2ORED 3HJHA 4URFA 3RC3A 1CCWA 4AM8A 5AXBA 2P91A 2FW8A 2WJ3A 5BSHA 2I6GA 1QOPB 1CG6A 3C7KA 4AG6A 2MR5A 4A15A 4OX9M 2FPOA 2GD6A 1MB3A 4UPEA 2PXXA 4XA8A 1AQUA 3JYNA 4JX8A 4AYWA 4Q9AA 4LUCA 1VIMA 4F46A 4KG7A 1VDMA 3SD7A 3WGQA 1QZ3A 2QMZA 3OH8A 4GSKA 2H3EA 3ZWXA 3AR4A 3T06B 2IP1A 4ESEA 3CRNA 4UQPA 4I1VA 2OYSA 3WWYA 3LY9A 3PEEA 1F2UA 3UH1A 4CEHA 2O05A 2J5RA 3TSWA 4AURA 1NZFA 1MAVA 1XZPA 4HZGA 1NO1A 1GAXA 3UCEA 2P4UA 2QN1A 5K0GA 5BQOA 1N2GA 3IP6A 2WK1A 4O2AA 4YQYA 1I0ZA 1Y48E 2L09A 2J41A 3H9QA 4RF0A 1NT2A 1QH8A 1XB2A 1RT9A 3LXMA 2H1OA 4COKA 4DQLA 3T9CA 4KQ6A 4Y2QA 3TRFA 4E1BA 1WETA 4RA6A 1TLLA 2J3MA 2H9YA 2PRSA 4HGRA 2IWHA 4C7KA 1X13A 3AGQA 5DEIA 3RS3A 1QKKA 2O2GA 4RC9A 3JPWA 5FBZA 3ZG6A 1BC5A 2Q5HA 1QVRA 4MSUA 3FCCA 3VHLB 3GQ5A 3DG9A 2Z8YM 4Y18A 3RFUA 2ZUDA 3ABRB 4R2JA 4I8OA 1I7DA 3F9IA 5TQ2A 4MYCA 2VJAA 3TINA 3KRTA 1SUCA 4R3UC 3PSAA 4JP3A 2O7NA 2A0XA 3Q3CA 3AYXB 4JYAM 1Z39A 2HSGA 1H2BA 2CVHA 3AKDA 3DVRX 2R46A 3GJ6A 5KTOA 3VKUA 2O59A 3FYCA 1SFRA 2V03A 4RETA 2BCEA 1Z47A 2IV7A 3I8SA 4ZYXA 3CSSA 2VQFB 3F2IA 3X0DA 1J56A 1RLUA 2EWMA 4Q15A 4HC4A 1ZVQA 3G5TA 3VOAA 4DQ0A 2J1LA 2ALJA 2O8BA 1PJZA 1YB6A 3A7DA 3ILVA 3V76A 5FV7A 3AWIA 5JE8A 1SA0A 3JZIA 1S3SA 2VJQA 3A14A 3EXFB 1BVSA 3CLSC 3I30X 3VNSA 4QJ5A 1BO6A 2QLMA 3DYIA 2VZ0A 1GXSB 2EIXA 4R1LA 3UGKA 2JJ8A 3W1EA 3WYNA 2HRCA 2P9ZA 3GRFA 3T9EA 2ECFA 2MYPA 2QTRA 3FOEC 1OIZA 3ANNA 2ZRQA 3VR1A 1YBMA 3DMDA 4ZALA 1KAOA 2BKUA 3PHCA 3OLQA 1TA9A 1Z33A 4XIGS 2BM1A 4WFKA 2AF3C 3HUDA 5BNWA 1SKBA 2QJRA 4J4HA 3GFBA 3NH9A 1Z16A 3LUGA 1L7BA 2C88A 3BFKA 4MGIE 3RLIA 2D0OB 3IEUA 4D2IA 1XMOM 3B2QA 3GNLA 1RPZA 5TQ0A 1QPZA 1MAHA 3C6QA 1PYOA 5F76A 2UVDA 5KINB 1QE3A 4LIPD 5T8KC 4F91B 3IXLA 4LBVA 4QUKA 2ZJ8A 4BVEA 1V41E 4F1WA 2X8AA 4QYXA 2FWBA 1NXWA 3ZX5A 2C57A 1U1DA 1DCTA 5H1YA 2VF4X 1GN8A 3AJIB 4QU9A 4C3UA 3U2QA 4MI3A 1JX6A 4IG4A 2JBHA 4FE3A 3VTKA 4LC9A 3RE1A 4E46A 1ZINA 4LRSA 3GVHA 2FZWA 2X2OA 3C2QA 3L06A 2X42A 4BO0A 1BU8A 3HADA 4JJZA 3MELA 3TTVA 4J7XA 1SB8A 4ISCA 4Y9DA 2H5LA 521PA 3SBDA 721PA 2Q3HA 4QGBA 3GRZA 1WZ2A 1Z8NA 4EEKA 1K8YB 1NVUQ 4HDNB 1P80A 4U7WA 1E2UA 3QHAA 1X70A 1UKAA 1UANA 4ZI3A 2Z3WA 4B45A 4F6LA 1NNUC 4CV3A 1P9WA 2PSFA 3JQ8B 3OPYI 3OZSA 4KQIA 4IJQA 4NJMB 5KVAA 3C5HA 3EIQA 4PPFA 3W8FA 3PNKA 3DHEA 3EZXA 4FNMA 2IOFA 2F9LA 2DZLA 2VJKA 4N3NA 1IN7A 1E3EA 1UBFA 2FZVA 5AM1A 1JRLA 4M1EA 5ED4A 2WTXA 4QYTA 3G5AA 3Q8WA 4K26A 1R4MA 4QUJA 4KREA 1G8MA 1AS2A 2Q5JA 3H2ZA 1QX4A 5FB3A 2XLBA 1Q2UA 4PNHA 4QGGA 3GCDA 5F5NA 2LXEA 1QH9A 4FHEA 2HCJB 1K86A 4ILEA 2QE7A 5TPZD 5LYJA 3BCUA 4XGKA 4R9SA 1WPQA 3ELBA 2G08A 1QE0A 1XPJA 1VXOA 2FUCA 1UBLS 1RHQA 3H97A 2GK3A 4UDXX 1ONNA 1CUZA 5IVDA 1SULA 4ND8B 3VMFA 2F55A 4H4DA 4KSYA 3UMBA 2WF8A 2ZSJA 2WMOB 5DRTA 1K88A 1KJNA 4OK6A 3R20A 2WJVA 1RAIA 1QHXA 4JP5A 3IQEA 1QUSA 5JD4A 3ZWDA 1FW8A 2NIPA 1R8XA 2P3OA 1IZYA 1QQ5A 3NANA 1WZCA 2GN1A 4U7GA 5IBPA 3R76A 3A1CA 4P16A 1EBBA 4KQMA 2X0JA 3PJFA 1QGDA 3ZV3A 2PM8A 1I4OA 4O4HA 1YC5A 1WXEA 1PZXA 5I8PA 3VK8A 3FNEA 3EQ7A 3R8XA 3IE1A 3PSHA 1Q2XA 4B6SA 1W75A 4RHCA 2R84A 4OMCA 1Z0FA 4Q9JA 1JDBC 1N33M 2ZWPA 1RI2A 1DKMA 1II8B 3INNA 4HYYA 3II6X 4PAQA 3W6PA 1IZ8A 3KAQA 4ZMBA 2Q7DA 3PGLA 1LDYA 2UVPA 4CIAA 3RU2A 4PIPA 2RHRA 2GF0A 1MPXA 3GRPA 5ALMA 1G6OA 1RLOA 3K92A 1RAHA 1SUBA 2YW9A 3MJ5A 2CDRA 4MGIR 4TKZA 2DQZA 1FSZA 3FETA 3L7DA 4PSUA 4E14A 2IHTA 1P31A 1QQTA 2XF3A 1J9GA 3GEMA 1X9HA 3RCBA 3KQHA 3ROXA 1CQIB 2IFTA 10MHA 2HHCA 1BCSB 2AJBA 3JTEA 2BWBA 5EFZA 1XCGB 1DADA 2GBLC 1Q3CA 5AKIA 5IAEA 1CR2A 1VFPA 2ZBPA 2FFHA 1TDHA 2C59A 3EEYA 4Y98A 3GYBA 1FC0A 4WZBE 2VDVE 5ELXA 2QL6A 3H5TA 3RRZA 3FD9A 1E9DA 3KYCA 1RR6A 3O9ZA 2JGKA 3ZCXA 2JW5A 4JKYA 3OIYA 2D62A 1U02A 4CCWA 1CUEA 1K4YA 4Y1EA 2CP8A 5F2OA 4EHLA 3DCJA 4W7HA 3RBVA 1FUIA 4PAGA 2IL1A 1BX1A 1N2CB 3OEYA 4KLZA 2R97A 4MGEA 4QDKA 5TS2A 4HS4A 3M4YA 1QTNA 5EUMA 1UFZA 5I8ZA 2W43A 2R11A 4WTOA 4UOZA 4LSZA 1UBHS 5BN5A 3M5DA 1Y4SA 3VQTA 2R44A 1H65A 2G8NA 5ECWA 3KQNA 3K3PA 1PDWA 2DVMA 1PBTA 4U5QA 3GAZA 4GG1A 4HATA 1V5EA 4F8EA 1OV4A 1XXHA 3AI1A 4AZ0B 1TCCA 4OY3A 4B3RM 1LBIA 2W6JD 3DLAA 5IYZB 1CKEA 1E5VA 5JJBA 4K0RA 3RT7A 4B3SB 3MNFA 1M6VA 2OVBA 4YJKA 5AJTA 3EZ2A 1U5BA 4J29A 1WZNA 1TOAA 2ERYA 1PLJA 1RKVA 2RC6A 4LYFA 5FNZA 2QPTA 3FOCA 3HSYA 4DILA 4D3FA 1BG6A 1O95D 1UKBA 1H3EA 1QG2A 2OMKA 4YLYA 3S29A 5LKAA 1XYVA 2Y0BA 1FK8A 4ZVNA 3S2FA 5K3SA 2RGYA 1VIDA 4DGSA 4U63A 5EA2A 4B82A 2FWIA 4LF7M 5EMLA 3EN0A 1NR5A 1B1CA 3E22B 3FPJA 3OC0A 4QG7A 3EASA 5EZYF 1YHNA 2J0EA 3FBWA 4ZPXA 3P0FA 3GCXA 1IAVA 2EHJA 3RYTC 4YPFA 1Z75A 3I0MA 2CC2A 2XZUA 3SBEA 2JBAA 4RUKA 3B5JA 3Q2OA 1SR8A 4BAUA 3EXG2 2ORIA 3CRZA 3S6JA 5FI3A 1GFIA 1SU8A 2W2KB 4J94A 5T64A 1GRVA 2HPZA 5HIKA 2BEKA 2A5FA 4TLDA 1R10A 1TIPA 2QX8A 4BJ1A 4WRRA 3U56A 4IH9A 5K5EA 1L5SA 3QPBA 1WMBA 2YINC 2XRFA 5E3JA 5KVQA 3WA6A 3W6ZA 5KU7A 2OB2A 3I6QA 4IQ8A 3PPWA 1GZVA 1AB5A 3VMMA 1GARA 4LXGA 2SECE 2AMLA 1A2QA 5EXXA 5B64A 5ICMA 4URYR 2PNFA 2IHNA 4PCAA 1MDFA 4FP9A 2YWGA 1AUPA 1RWOA 3X1MA 3SF8B 1T4CA 5B6IA 1YQDA 2HN9A 2Z30A 3DULA 3GGJA 1MHPA 3N7TA 2I71A 1ML3A 1XTKA 4QE3A 4A8JB 1DXOA 5CNKA 1O95C 2JFPA 1TGYA 3UM9A 4BMPB 2NTVA 1MJ5A 4N47A 1GKUB 3D6HA 4R1OA 1HE2A 1T1RA 4EZEA 3N6VA 5IJXA 3WV5A 3EXIA 5JC8A 1G18A 3ONEA 2UXBB 4JKOA 1EWVA 4NVRA 4CJXA 2LVPC 2IYLD 3ET4A 4FINA 3O8RA 1NV8A 2IYRA 3TOZA 4BUJA 3SFZA 3MOGA 3QM1A 4MVYA 3T8YA 4AMZA 1P2FA 3QXGA 4P5PA 1J07A 4E5PA 3H87A 2XSZA 4XM1A 3N2LA 2O1SA 5GV8A 5CH5A 3L4BA 2QN3A 4HXYA 1G3UA 3SY8A 4LG1A 3ITNA 4OJMX 4QRDA 2NZWA 2V6ZM 2NVUA 2RB5A 3KFXA 3DAOA 3MS4A 4N48A 4PX9A 4EY8A 4JVSB 2HLDA 4JI0B 2ARKA 4B3IA 3IR5A 4R3NA 1J8YF 2R7LA 2NACA 1L2CA 5C7OO 1I1HA 3H1FA 5K4HA 4BE9A 5DHTA 1G1AA 1H6DA 1HDXA 1MXFA 3ACCA 4RFSB 1B8NA 1L7NA 1BKSB 3A9CA 1T8UA 3R7FA 1OTYA 3LHSA 1XA3A 4XD7D 4A1OA 1ZMWA 1Z59A 3DAPA 3OQJA 4HUJA 4V24A 2QD3A 5HFNA 1PNQA 3AQIA 1RCFA 4M49A 1Y3HA 2B1QA 3CZRA 3M1YA 4P3PA 1W2WB 4PPGA 1LZLA 1K6MA 2RCYA 3GH1A 1G63A 4JI4B 4X45A 4FFOA 3MWFA 5D3MA 4J7CA 3TZHA 1UAGA 2E18A 4OYRA 2JHPA 4TV9B 2CLSA 3AIKA 4OK3A 1RI1A 3ABZA 5BWLA 3QVVA 4V3CA 1QWOA 2O3RA 2QRZA 2VH5R 4JS0A 4LYJA 5E9JA 3U13A 5LP6F 2JFOA 2WYIA 1T5TA 4IVNA 3SXUA 4L5AA 2I66A 3D0QA 2E37A 4R2LA 5C1PA 2G5GX 1CP2A 4X44A 3DF7A 2GFHA 4FJ1A 1L2DA 1QIFA 4C0QC 1GU1A 1TJYA 4CM6A 4RVGA 1OKKD 2QL9A 3C5VA 4LDJA 1LNSA 1BEEA 3OZRA 2H54A 1G5HA 1G5IA 5IYZA 1I7SB 3ESXA 4B3CA 4JYAB 4DLBA 3IO3A 1U0BB 4QBKA 4YJFA 4C4XA 1V11A 2I65A 3LFHA 1R5LA 4CL0A 2G71A 5LMNM 3GT7A 1CR6A 3BBLA 1I2DA 1ZKMA 4C0SA 2IS4A 3E46A 3EEQA 4IGIA 4QTTB 4TLEA 4K9OA 5FFMA 3VVLA 4C5CA 1GLGA 5ERXA 1K3WA 1E1QA 4F5WA 1R3UA 2Z9CA 4DAOA 4YT8A 1I2BA 2O48X 2HA7A 4HUQB 4O5OA 4DUPA 1FFXA 3A37A 4ARCA 4X8OA 2HA5A 4M9ZA 5DLDA 2QR2A 4LXYA 4M99A 4BNJA 3ZXIA 2BSAA 4MQBA 3RSQA 2BBTA 1P1RA 3G5LA 1YMUA 5BYAA 5F2NA 1IWOA 1I1OA 1Y5NA 4ZI7A 4L75A 2ZSUA 3OQIB 1LXCA 1WEKA 3HXMA 4LV8B 4XTCS 4P84A 5CMLA 1BOFA 2GEUA 3BF8A 4KJZA 3SCZA 3UHJA 5JCOA 1P1JA 2Z5LA 1A8HA 4QDXA 4O29A 1TD1A 3I28A 3UMSA 4D46A 5A4IS 4TN5A 3KEGA 3M5CA 4E3WA 3SN6A 1SCUA 1YTLA 2FPPA 2YMLA 3F5QA 4OUKX 2OBFA 5DM4A 1LLQA 1EXDA 4GUDA 4ZP1A 1NRXA 1OYWA 1M10A 2VDWA 5LYJF 3GAFA 3OI7A 4M76B 1UWCA 5DASA 9ABPA 1OX6A 3N0XA 1FEZA 1ONBA 1Y6QA 2CNKA 3C8DA 5BWBA 4AULA 4PFSA 2ZI4A 4UN2B 1M66A 1NVVQ 1E89A 3R6TA 5KYWB 4GPD1 1UXJA 1LJ8A 2IOFK 3GK3A 3QJ5A 5SZIA 3Q72A 4Y2SA 2JGJA 4M0WA 1LEHA 1OLXA 4BMCA 4QDZA 3U1TA 1BA3A 3E2MA 3FTQA 3ES9A 3HJTA 5G3YA 4LI3X 2NTNA 4GYWA 1FFDA 1G21B 3RREA 3CISA 3KT3A 1GGMA 5FHQA 4QG3A 4K6CA 3FMOB 3OX2A 2QVYX 2NSYA 1D3AA 1ORVA 2NU9A 1FSSA 3OOJA 4W7IA 5GPBA 4C0JA 3MHPA 4A8TA 1G3QA 2V58A 4OP1A 2JLUA 3PR3A 3DMGA 1P1FA 4PLZA 3EQ2A 1QKJA 1TM1E 3A3NA 2HADA 3QG1A 4MQFA 4A3VB 3BA1A 4RF5A 1T5LA 4FHZA 2FPMA 2JK0A 2IU6A 2K87A 2ZCVA 4IIHA 5FL3A 3L77A 4IDNA 4CZ2A 2QMUA 4J8PA 2I3AA 2W2LD 1RWNA 2XGNA 5CCBA 5AD1A 4Z3OA 1CJBA 4I6JA 1W581 3FRHA 4HQ0A 2YWDA 3LECA 3WICA 4LOHA 1KJQA 3AVUA 4KQFA 3W68A 1GPNA 1DC5A 3BK1A 5B36A 5GINE 2UYHA 2BFCA 1LW6E 4KPUB 2BN4A 1MKYA 2DHEA 1IXSA 2XT9A 3EIFA 1YQEA 4QYSA 3QW4B 3I2IA 4UZFA 3V3KA 3EJWA 1YZUA 4CNQA 4W5WA 3GLGE 1HE8B 4LE1A 4B8YA 1R7RA 4I81A 3L1VA 1NAHA 1DAIA 3HWWA 4ESVA 1ZIPA 2CUTA 3LQFA 1V45E 4XARA 4GHLA 3C39A 3NHFA 2JZ0A 3P2KA 3HJQA 3WHPA 3Q8MA 4FYWA 4U8HA 3KXDA 3C98A 3Q3IA 5G0VA 4PEVA 1K9VF 2W58A 4GOXA 5LD2B 5K0ZA 2FN3A 4WINA 3Q5EA 2ZE6A 1NDQA 2ODWA 1TCBA 3EBPA 5CDFA 3HKPA 2BUBA 4RHFA 2WJ6A 5I4IA 2LCIA 2PSSA 3CLUC 3GEEA 4A73A 3EPLA 1KO4A 5I48A 3E9EA 4MO9A 1TO6A 2PGDA 3BXGA 1QP4A 2O5CA 5H4HA 1F1BA 4F3YA 1Z5NA 3K4QA 4MVJI 3FYUC 3WJ7A 2I33A 1SUFA 1IH8A 1YFLA 4NRDA 4RZIA 4EY7A 2XB4A 2GWRA 3FCEA 5LIPA 2WJ4A 4B6QA 1J23A 2H5XA 5KQSA 3NV9A 3CKMA 5GOTA 1D1TA 1M72A 1LPMA 2ZYRA 3V2UA 1DCMA 1VHTA 2PZFA 1GAQA 1E2MA 5C8DA 5IXSA 1C3OB 4RM3A 2ODTX 2CKDA 3EBOA 3R6DA 2BH9A 4JGBA 1A8PA 1C8VB 2HRBA 4HYTA 1ZM9A 3HBMA 4A03A 2CDNA 1EFCA 4C06A 1I10A 4CJ6A 1R0WA 1KE2A 4U39A 4KODA 3DHYA 3WO1A 4DMUB 4CT5A 4HV4A 4B8WA 1DS6A 2AOUB 4DWJA 2GPJA 4ID9A 4D42A 2IOYA 4IDBA 4MMXB 2FMUA 4FB4A 3CJRA 1YBVA 3CNLA 3QE4A 5CT4A 1I2ZA 4OD0A 3MBOA 4MIEA 3TOSA 1XTBA 3GELA 4Y1FA 5FBRB 2RJNA 3V1NA 5IXYA 5DGCA 2I91A 1WNTA 2ZRDA 5FP0A 2GK6A 4KTVE 2CZCA 4OBXA 4BMXA 4LGMA 1A82A 4HQLA 4JV5M 2C58A 2CLOB 4RDCA 4MS4B 4D9EA 4ZYLA 1W30A 4EECA 1PJ3A 4YREA 5COQA 5JJCA 2E3JA 4A6DA 1FJHA 5HA5A 4TM8A 3E3NA 5JJLA 4REZA 2W2MA 3TQSA 4IVRA 3RVNA 1M83A 5AW3A 2GXAA 3WDMA 1SBHA 5CD9A 2Y8EA 3EFEA 4IWYA 1SCBA 3E9YA 4J0CA 4DR3M 2NM0A 4TYQA 5U1PA 1CF2O 4ER7A 3OD1A 2OZPA 1A97A 1UM9A 1SBIA 4B87A 4CTMA 2ONZA 1IBKB 2IT1A 5BSWA 4B4WA 1OFUA 4C4YA 4Z54A 2HCRA 4RTMA 1N4DA 3F5MA 4RQAA 3K05A 1XQVA 3LGAA 3V2GA 3VNAA 3MEQA 4JA2A 1PZHA 3QEOA 4R1SA 4HDRB 5KU1A 3E2IA 4ALMA 4C7BA 2QI9F 4MP3A 4HEJA 1QMPA 3D81A 3UOGA 2LBCA 2ZT5A 4XTRA 2BPOA 3NC0C 3WQRA 1LI7A 1G2QA 3DLCA 2M6SA 4DGQA 4B48A 2JRLA 3LF1A 3QXJA 4PX2A 2C8VA 4DIEA 1KH1A 3UHOA 2VHVA 3D4PA 4K8OA 5F77A 2AG5A 3ZK7A 1V4NA 1FU7A 3DMPA 5K01A 3SI7A 3L7JA 3AZOA 4C7XA 5IZCA 1QVZA 3Q6MA 4WZBA 2HOQA 3EK2A 5IDYA 1IVNA 2P69A 1YSYA 2JFZA 3BQMB 4PLFA 2GERA 2Y77A 1HF3A 4JXKA 5IAKA 4X1IB 2GCEA 4L0QA 1FLNA 4AUMA 1WULS 2AC4A 2EERA 1NNEA 3UKJA 2YCLA 5TARA 3OFND 2GZ2A 2PN1A 2ZSIA 3QVMA 4IICA 1PDOA 2VT2A 4IILA 2P6MA 3COYA 2HO4A 4L1KA 4ZIRB 5EAIA 1LPBB 2V98A 4FFSA 4X1KB 3TQCA 3GNQA 2C04A 3PKJA 5ITZA 2BR5A 1OLUA 1NBMD 3IBCA 3VH3A 4HQKA 4KAFA 1CZLA 2X5JO 4WZZA 2NN3C 4L73A 4K5QA 5CG2A 1L4UA 5LIRA 4H2DA 2BF7A 1M0SA 3DLPX 3J27B 3MHTA 2AH5A 3G2IA 4KTTE 1MZPA 3GJTA 2QSZA 3NOVA 2XNDD 4PYKA 2C96A 3OWXA 1PR0A 5DTJA 3SLGA 2CV0A 2FPIB 4YAEA 3QSGA 2NQ2C 3D1LA 2UZ1A 1WCV1 3NH6A 1MFPA 4G36A 3OT1A 5BQ3A 2HF9A 3ZW7A 1ESZA 1WPRA 2NPIA 3AI2A 3VH1A 4AUNA 1BA2A 1RE0A 4FT2A 4QIHA 1ZN9A 5IANA 3G89A 1RD4A 3PFKA 1CTQA 3GA7A 1ECJA 3IDSA 3RTCA 2QUKA 1XVLA 4QJ3A 4NJOA 1EVZA 1YBFA 2O8EB 2HZ7A 2XTMA 3GLVA 4AIIA 2WHYA 3ZV4A 4MH0E 2P90A 1XQ6A 2XMRA 2AT1A 4JI3B 4PRKA 4M1ZA 5I01A 3ZKWB 4BLUA 1N25A 3A6EA 1W88A 4RF3A 3T1HM 4BZXA 1KETA 4Z2AA 1X92A 4DMKA 1ES9A 1T5OA 1UDAA 1LRLA 1UWLA 2OK8A 2QJFA 1ZN2A 3D8HA 4EITA 4FMBB 5LR6A 1DO0A 4YS6A 4AZ3B 2W2XA 3ZDDA 2Q6TA 2WZBA 3MGGA 2GQFA 1G4HA 1GTG1 1ZESA 4FZRA 2NPFA 1CV2A 4OI2A 4LTMA 1DWQA 5LXTA 3T5BA 5EIAA 2G80A 2JI6A 2P9HA 1H6AA 2VBFA 3GNSA 4Q19A 4ZVKA 2BNKA 4GMQA 3P9RA 4XFDA 3T3MB 2XUQA 3SP1A 2J9YB 2GPAA 3BXXA 5JIBA 1GQRA 3CX7A 2I4OA 1TTPB 2GM5A 5AK0A 5ERYA 1VFNA 4EMUA 2XBLA 3OFJA 1DJMA 3PGVA 5L53A 3OEED 2O23A 1V7CA 1IJFA 1YI8A 1UT5A 1OPXA 1WU8A 1VLQA 2JCXA 2PZAA 2ZS9A 5E1BA 5EWJA 4TLBA 2MTBA 4Y1RA 3NCTA 2VHJA 2OP1A 2OA0A 2I2FA 3MJDA 2XD4A 2HJSA 2PQMA 2VFAA 3VKFA 4U0KA 2OCYC 1D03A 1N6IA 4WZAA 3ADKA 5DN9A 2IEAA 2XMQA 4YJGB 3RK1A 3RK4A 1UK6A 4C7JA 5JPDA 1ZSNA 3IUPA 4H1HA 4KO2S 1HEUA 2RBEA 4YJGA 4YV0A 5JAPA 2AE1A 2O5EA 5DBHX 2QKYA 2ZS7A 3ZEIA 3OWHA 5LB4A 1XTVA 2ID9A 5AH0A 1K97A 2HK6A 3MTJA 3IALA 5JS7A 1JJ7A 5DYIA 4NI5A 3TM5A 4NXMM 2N0SA 4JUBA 2FPWA 4JB0A 3I8OA 2Q21A 4I5DA 3WRXA 4ZZ0A 1W6RA 5F23A 5JY1A 4BJ5A 1IY8A 2BMWA 4OQQA 2ZYAA 4MQ4A 2G1JA 1UBOS 2VEOA 1ADYA 2IXTA 4P3XA 3UGQA 3H6GA 2V4UA 3HDYA 5L4SA 2GRUA 5DX8A 2H1HA 3E7PA 4KJXA 5AOCA 5TPWA 2N3ZA 3V9AA 4ARBA 3W5AA 1OGJA 4MUKA 2ATCA 2BFFA 4NONA 4XGIA 1OZGA 1EKXA 4DR7M 4GPTA 5C5EA 4X5OA 5B2ZA 1PM5A 3I5UA 4U7FA 4WBNB 3LPAA 4F3NA 3W5BA 3DJYA 3L1IA 3HN6A 1C4WA 1G55A 1TMGE 2CLMB 3G7UA 4WCVA 4EHAA 1V39A 2YVKA 4X00A 1Q0SA 1OXVA 3PFFA 1EEHA 1BHQ1 4Z51A 1ZGJA 2Q7OE 2JKZA 3ANLA 2WHXA 5J2TF 2VYNA 3CN9A 7CATA 4ZAWA 3W4JA 5K3FB 4A0QA 1EVQA 4EL0A 2DP4E 1GU7A 3FSRA 2GKSA 4HSGA 4XE5A 1UT8A 5BW6B 2Y66A 4XGQA 1VE7A 4G1VA 4RHUA 4H6XA 1DVRA 4D92A 2AVDA 5I4CA 2JIRA 5FTWA 2RAPA 4MKGA 1QOZA 5ALPA 3HKCB 3WKDA 1QZMA 3NASA 2MU1A 1AIPA 2XVMA 5EN4A 2N46A 1R5NA 3F1KA 6Q21A 4GI3A 1TX4B 4QPJC 5TGDA 1E2JA 1UBGA 3TTXA 4ZKDA 4JZYA 1SVIA 1N2JA 2P6PA 1NMEA 1P81A 2X0KA 5FPQA 4ENWA 1QF9A 4Z9XA 1Z5AA 4E5SA 2XUOA 3OJFA 2ZJAA 2MHCA 1X7GA 1YZFA 1G5FA 1QPBA 3AHEA 3G8DA 3O4JA 5E9QA 1P39A 1GRNA 1RRMA 1XC7A 2Y6UA 4G01B 5DP2A 4Z7QB 1EEXB 3NBAA 4YCNA 4F7DA 2PRJA 1P0FA 3ZWBA 4IDOA 4HH3C 4O1HA 1UOOA 3RUEA 3NHSA 3UWKA 2EQAA 1L4MA 2AJ8A 3E3MA 1B6GA 4G41A 3QENA 5L9AA 2WWFA 5DLQC 3VZCA 2Y05A 4CQMB 1LU9A 3DKIA 3MJ4A 3UMVA 4Q7QA 1TAUA 3HJ8A 2ZP1A 1XE3A 4I9UA 4ZCTA 3I1FA 2R79A 1I5RA 2WSFF 1C1YA 2ETXA 2Q0HA 4PRZA 4XASA 5A3JA 3AM1A 2GBCA 2KEBA 2GR9A 3O31A 1GTRA 5ALZA 4UZEA 2I7NA 3ZD9A 3AV0A 1ONOA 4KXLA 5KSWB 1ST3A 3PE3A 3ZE7A 2BH2A 3QVUA 4Q05A 5CTJA 1NLYA 1Y7PA 2WTMA 3A1TA 4GYYA 3DO8A 4ZYYA 1DCFA 5AJZA 5C8YB 4LYGA 1YR9A 3VSAA 1YBHA 2ISSD 3E84A 1Z17A 3CH5A 3K0HA 3KJFA 2D7EA 2B6NA 4FYIA 3Q8GA 5JVDB 4EUFA 2O2JA 2DRIA 1OGYA 2NO0A 1TQ6A 4OJTA 2YJ4A 3OJOA 3VJMA 2WPNA 3W3AD 4QAJA 1UEIA 3MUEA 2LZ0A 1U98A 3Q88A 3KKZA 4C6RA 1LZKA 1P7PA 4H17A 2HNKA 4HMPA 4R9UC 4BO8A 1WW8A 2FJUA 1WNFA 4RMIA 2VK2A 2A5GA 3OIGA 3QMVA 4MS4A 5EPOA 3BMQB 3QFCA 3M6AA 1KK3A 4HUTA 3RUAA 1A9PA 4XJSA 4OMUA 4U1RA 4UFNA 2C3PA 3CBGA 1KDZA 1GG5A 3ZW9A 3SR3A 5KTTA 2UXBM 3G2MA 3DHVA 2XUKA 1IOLA 3FR8A 3IMEA 3CPEA 3IUNA 3PDIB 3TAUA 2XA2A 2XOEA 3DL2A 4PX5A 1SXGA 5CX1A 5DHQA 1KRWA 2Q2NA 3IQXA 1VL8A 3KZ1E 3O90A 4HXGA 4C04A 3EIOA 4YY3B 1E0JA 3THYB 4LXQA 3X1XA 2ZI7A 2JCYA 2H08A 2R85A 4X1YB 2PH5A 4MOWA 2OK7A 4R2MA 2YZ7A 3SDBA 3UT5A 2DCUA 3AKYA 1C0PA 2BGWA 2VF8A 8MHTA 4UHFA 1T9BA 2X15A 3ZK8A 3DCIA 2QVGA 2R4TA 3ZGYA 4A0HA 2V0GA 3INRA 3A98B 1YOBA 1DX9A 3PFHA 5ES4B 4ZK6A 4BV2A 1UMDB 3G9ZA 4W8GA 4BTVA 1I7NA 4RGBA 4XJVA 1E8MA 2AR0A 1CUIA 1NA5A 1QKIA 1WBDA 3LBFA 5F98A 2GEJA 4R40A 3HABA 4UMEA 4G5QA 4YP7A 2BZGA 3DFZA 1QNFA 3O2NA 3TDNA 1ZUHA 4FTWA 4ECEA 4TMKA 4UATA 1DIHA 5GVRA 5I47A 1AO0A 1Q6YA 1D09A 2IITA 4GGOA 1P6XA 2DY1A 2FW9A 4IIGA 4WY8A 1EUDA 2CFTA 3ZVMA 3N5KA 2X9NA 3SOZA 3TZLA 1AK2A 4Q0MA 4JJ7A 4GZ6A 2WG0A 5BSGA 3GA5A 1IQUA 1OAAA 4CRWB 2Q28A 5BWCA 1OXSC 2JIMA 2PSHA 4O2AF 3PUHA 2AMJA 4G37A 4KH1A 1DBRA 2YRFA 4JBGA 3L2OB 5I7FA 5DM70 3UXYA 2DWZB 2WWXA 3A2MA 4G4JA 3ZU4A 3F4LA 1JAYA 3CZMA 4GRAA 4YXWA 2V8BA 4QQNA 2R5NA 3B1KA 3CEJA 4OQ4A 3DXYA 4U7PB 1T24A 3EY9A 4YVFA 3PPVA 2WWIA 4RIGA 4D8XA 5H3LA 5HQJA 2EDCA 4KB5A 4OKIA 2JGAA 1NLZA 3R7BA 3NWLA 4OQNA 1CRPA 4D4LA 3WGVA 4RHTA 3EAFA 2PMKA 1Z4KA 1DDGA 4MGKR 2DZNB 2JAXA 1P5ZB 3WIOA 3FKEA 2BGIA 2X2PA 4IFIA 2BJHA 3FR7A 3N0VA 4DLTA 3G2KA 1O6GA 2EX1A 3T6PA 1VCOA 3E03A 3PX3A 3PA6A 2HBYA 4E0BA 4X9XA 3IJEB 3OJ0A 4BX2A 1MEOA 1BJTA 3WLNA 1C9EA 3CUKA 4D6PA 1S2MA 1OIPA 4FFRA 5K6TA 1QRUA 1KERA 4I50A 1Z0JA 3AETA 5E6RB 5F2KA 4I1UA 5HCNA 5A03A 3E70C 2F1HA 2QU8A 3QQ5A 4WXYB 4E33A 4Z53A 3T3OA 1NBME 2FN4A 3FPFA 3ROFA 5C1BA 3UJPA 3QLVC 5FO1A 3MWYW 5DMHA 5E8RA 4YRPA 1FNBA 4PLVA 4FEAA 3I5YA 3D2BA 1NVEA 3FNGA 4EQ6A 5AM2A 4UZSA 4OP3A 2Y93A 3FCUB 1X0XA 3CF6E 5E7IA 5LZ8A 4BGVA 4RESA 4CQMD 1PGOA 3HMQA 3A8TA 3K4HA 4FMDB 1VL2A 1N2HA 4HXEB 3SSNA 2DWMA 3EA4A 4OYLA 3H1GA 1FJ2A 2BFDA 2Y0QA 1PT7A 4QHSA 2E0IA 3B5EA 3FW1A 4PZAA 4BHTA 2I6XA 3CIOA 1P8AA 2OMEA 1UODA 3QWHA 2Y67A 4YPOA 3AEKB 4UOEA 4HNTA 2J6BA 4GX5A 1ZC3A 4BB6A 1RJ9B 4MVJG 3E4DA 1JJAA 4A36A 4QXAA 4Z1MA 3ZKAA 4C7OB 5FBHA 2HJGA 2YTZA 4LAFA 4L9SA 1USWA 3FPCA 1VPVA 3MG9A 4YJDA 4GXNA 3WNCA 2HCBA 4QPDA 1DX4A 4MRAA 1JHRA 4FN5A 5L3SB 2QT1A 4IIBA 5JMOA 3JWGA 3R0VA 4FC7A 4RDXA 2NU7A 1WXIA 5KPJA 3EIHA 2SKDA 3UAZA 1PCXA 2RDMA 5CAEB 3KQQA 4BB0A 3C3JA 3HRIA 1DJLA 4DXAA 1YJ8A 3N7AA 3JYPA 2VXOA 4YP1A 1XEXB 2VDJA 1MGPA 3HNRA 1QYCA 4PRLA 4CFYA 2F4VB 4EARA 3NJ4A 1N6KA 3AR3A 5IW8A 2RGGA 5M3BA 1RWWA 4HDQB 4WACA 1IWPB 3JQBC 1M2OB 4Y9RA 4DA0A 3OZWA 3WLHA 1CQPA 2ZTSA 4MV3A 3LKDA 1K7XB 4X1YA 4NMLA 1SOUA 4N6OA 1BE8A 1J1ZA 4MICA 2C8KA 1TZKA 1YOVB 4OHPA 4ATNA 3DE4X 4BGEA 3NUZA 1L4HA 4H35A 4PXAA 2H2FA 1PJSA 1TW3A 4U8GA 4C2TA 4EPYA 3OU2A 2B4TO 3FSGA 1WVMA 3RYIB 5FOVA 1Z8FA 4IBFA 1C1HA 3BIFA 4NTZA 1QG4A 2VOJA 1GQOA 4L4ZA 1VJ0A 3WMFA 2EJWA 2P4SA 2VP5A 4GHWA 4NFLA 4OYYA 2CHFA 1IAQA 2NZ8A 3PNSA 3MOSA 3RQSA 2DMRA 4AUKA 3ONWA 3MFQA 4RPJA 4GSLA 1YA8A 3RFTA 2A7XA 2V7BA 1JT2A 2FZGA 3PD1A 1C0EA 5IBRA 5JI2E 2Q5IA 5LP6A 2D0DA 5A0FA 1RJWA 1S2NA 2CVOA 3NHZA 3Q12A 4C4PA 2GAAA 3NVKI 7YASA 5FTMA 2D5LA 1VLLA 5DCUA 1CVIA 4FXPA 5AW2A 4KXWA 2Q4EA 1ND6A 1XRNA 1JQ5A 2L2QA 2BR3A 3RABA 3DZDA 2B37A 3LI2A 5T67A 4MCIA 1K7YA 5JI3E 1SZPA 3G9QA 1PT9A 2WSYB 1OPRA 3MW8A 4NECA 2QMEA 2YV3A 3P26A 5CT5A 1Q1AA 1O89A 1UFQA 2WEKA 7MDHA 3DBRB 2GNOA 1WBJB 4A8JC 1L1TA 2ZI5A 4C21A 4CNBA 1ZNZA 2ODAA 4JC4A 2KDLA 2BHNA 2DJ5A 1E6KA 1I2AA 2DZDA 2WM3A 4XUEA 1R37A 4CEHB 1QU2A 1NNSA 1AF4A 1DAKA 2XB8A 2IW1A 1QAQA 4DBGB 4XQCA 3WRVA 5DRYA 5LQRA 1RYDA 5L45A 2PS0A 2FMHA 2B0CA 2AFIA 1XDUA 5CM8B 2O7RA 5EPUA 4NFSA 3IP7A 4IDFA 5ALFA 2J30A 2JARA 4N39A 5EKTA 1Z2OX 2DBQA 3ZCPA 1O94A 1QZZA 1GGFA 2PX5A 3EXHC 4EABA 2WIAA 4FGZA 5C4MA 5G4KB 4D3SA 3E23A 4OU5A 3QUBA 3T7RA 3WJAA 1POWA 5FWXA 1SC1A 1BQ3A 3OP1A 4AJ2A 3CTMA 3GBVA 3UWDA 1FJXA 1J2EA 4UXHA 1NOJA 2HK7A 5JH7A 1T3LA 2JHFA 2P5YA 4NF2A 1XTRA 1XZEA 1TM2A 2PZGA 2XWBF 1ZXXA 2DECA 1M5TA 4GPEA 4NCIA 4IBOA 4UHEA 4X71A 3TLMA 4GL2A 1GZHB 5LXTB 1N1EA 4CKWA 3CN7A 2FZKA 4LGCA 2QN9A 1E5TA 4P93A 4PZYA 2VDPB 2GFIA 3JATB 4BFTA 5KQMA 2ZB2A 4TSFD 5T4BA 1MJNA 1C7FA 1VL6A 1GFSA 1SUEA 1X7YB 2R5FA 3MS2A 3P71T 4LMRA 2I2WA 1PJLA 3ITEA 3JQRA 4NEHB 3VYUB 4TKVB 1XJQA 1KFEB 1LWOA 3U6MA 1SU4A 1PJ2A 1HFJA 2OENG 2PKCA 4ZU6X 3BMNB 2G5CA 3DAYA 4BRZA 1U2RA 1ZMUA 3HSSA 4WXPA 2ZUVA 4YFVA 5AW7A 2WFLA 1JHPA 4AL4A 4Q7MB 4NHEA 4IKOA 2POCA 2EP8A 5ILOA 2KRUA 3L4JA 3HDGA 1PG0A 3AH8A 4Q5IA 1TYAE 1C7IA 4GIBA 4JR1A 1TDJA 5ALTA 3QITA 3S7TA 2CMKA 1EWKA 4V0RA 2AL7A 3OOSA 1E5LA 1RXIA 2Q8PA 1KDYA 5BUCA 3QF4A 1TUBA 4C14A 4YR7A 1GFZA 5DNVA 4BX8A 3PXUA 3HDVA 1KMIY 3LCVB 4G4QA 1PJCA 2NUAA 2O1EA 4E5MA 1B2RA 3KOXE 4ZICA 3GZ4A 4QXMA 4BO7A 3F1LA 1AA9A 3WWCA 1G20A 5FLXS 3CB2A 3H4VA 2ZIZA 3K16A 3IG8A 2DR2A 3X1KA 4RD4A 4JYBA 4AKEA 4ZYTA 3K70B 2KNVA 1JHMA 1V5IA 2CMHA 4DDTA 1USGA 3W8NA 4V1CA 4JVMA 4H6PA 1QTQA 2C1ZA 4E12A 2R8RA 1VMKA 4ZU1X 1IY1A 1XSEA 4BLTA 3M6UA 3RBZA 1BWSA 2G5PA 2JPDA 2PBFA 4AZFA 4DWWA 2J9FA 4Z4HA 4Z4GA 2CJYA 1KZ4A 1Q7BA 4LPKA 5EUCA 4TTJA 4DM3A 2HGZA 4MYSA 2JFFA 4QWWA 2GJ9A 4EB0A 2H2GA 2LVQD 1NXOA 1PGJA 1QGED 1WQ3A 2XNCA 3LNTA 3WRXC 3DDUA 2KWIA 3N8NA 2IS2A 4MWEA 2RD2A 4EYGA 1FTWA 1K5DA 4OKSA 3DZKA 5GY7A 3SYNA 5E2AA 2O6HA 4AZVA 1U28A 2HDWA 2WT8A 1FUEA 3PJRA 3OE7D 4XUCA 2WJAA 2ZTCA 2EBWA 3B52X 3LY5A 4RU1A 1RWMA 1GZDA 1SZCA 5DLPA 2CUZA 3NRJA 4DV5B 1MN3A 1RW4A 4IMPA 3WNVA 2HWYA 3K0SA 1VJTA 4Q1FA 4HAOA 3W6NA 4D6YA 2LPMA 1QX3A 1XEAA 1D0VA 3H8JA 3IJPA 3Q0IA 3PUVA 3Q8XB 4QGSA 2HMTA 4LV5B 4HCJA 4UTOA 5K0NA 3SXPA 1KDOA 3VTFA 3IPAA 1XRLA 2WE7A 2ZJZA 4MUHA 3LUFA 4L2IB 4UJ3A 3IV6A 3WK4A 1ICEA 1W36C 3SYLA 1AK1A 3TWLA 1JG1A 2QX9A 2VHZA 2I8AA 1GKYA 3COPA 4U7TB 4LZWA 2XDYA 5HRCA 2Q99A 4HSEA 1FVHA 2H8KA 3R77A 1F0YA 4S1OA 1E1RD 1GGKA 1HH4A 3AF6A 3EEIA 3P9PA 4KQJA 1Z3CA 3IDOA 3UOWA 1UDWA 3ZLVA 4NV3A 4BJ6A 4CMJA 2ZDGA 3R3WA 3VSBA 3A4NA 3K8YA 1DLIA 2FEXA 1NW6A 4PV7A 1RYYA 1XBTA 4JBNA 1IUOA 4UTZA 3ZHTA 5HSGA 5HE8A 4AS1A 5FDFA 2JGRA 3THSA 4FSHA 2I7CA 3O75A 1N8TA 2ZXFA 4WFJA 3AIIA 4F4JA 2H1CA 1MG0A 2JFUA 2A9QA 3AETB 3I1YA 2MOKA 3QBJA 3UWMA 4ESOA 2C2ZA 3BH7A 2IHUA 4EY3A 4E2YA 2ZBKB 4PQFA 1DIAA 1OLSA 3ZCSA 1FJGB 2DPGA 5BSTA 3SLRA 3SWWA 1NNJA 1LV8A 2RKBA 4R8RA 4KFUA 1ZH8A 1PIWA 1MA3A 2D7HA 3T35A 2IUUA 4P4SA 5BN4B 4MB0A 2YR0A 1JHUA 2BDEA 2XYRA 1AHHA 5BVGA 4LZZA 3AG6A 2P7IA 4Y6SA 4F0JA 3SS9X 1ZP6A 1V5GA 2R4EA 3OZTA 1BVYF 1VE3A 2QVLA 1YDEA 4TXHA 4X7BA 4D4KA 5BVGB 1E6LA 2VPWA 4KHPM 2HWKA 4X61A 2Q8NA 3HJUA 2D5IA 4HWSA 1Q21A 4IV5A 4NFYA 5ICGA 2WB2A 3SNHA 1ZQ9A 1AZWA 2HU8A 1WB5A 2ZUEA 1D2MA 1R5OA 3VOBA 1I36A 2YN2A 1Y34E 3SEQA 5ALUA 4JI6M 2EU8A 4Q93A 4TSFA 4DPMA 4YUYA 5A5DA 1DFGA 1NSYA 3DBIA 4P2GA 1BE6A 1Z6AA 4IHKA 2B1IA 3U6PA 1T1SA 1TL7C 4K9MA 4TRRA 3LX6A 3ZLJA 4NLLA 1K82A 4NIMA 4OQPA 4XVUA 1BMTA 1S8OA 3B3GA 3QMWA 4M8LA 3WWOA 2GHRA 1XPUA 4HB0A 3GJSA 4K9SA 1R64A 2HDNB 2WTBA 1V71A 3N2KB 4H77A 3V4ZA 5CIYA 3WGIA 3CRQA 1H3NA 2AKYA 2X0RA 3OFVA 4JHXA 4RVSA 3NWBA 4K03A 2QTFA 2QS9A 1IM2A 2VCYA 3DMTC 4JDUA 2XUJA 3OZBA 4HMOA 4ZI5A 1LVGA 2UZ4A 3W7AA 3QLUA 4QM6A 2JVJA 4LGYA 4LQ4A 2SICE 3F8SA 3ZI7A 1SHTX 4QTXA 3G8BA 1KK1A 4D0SA 3NDBB 4P81A 3VO1A 1R3DA 4WX2B 1WHSA 4BAGA 5K4GA 4WLFA 3C48A 2YFKA 3OMWA 4U00A 3KVWA 3P52A 3T5CA 2WYOA 3NEJA 5TR9A 1TM7E 2WTAA 5DHRA 2CXHA 3DW3X 4BQIA 2CVQA 1EZZA 1DV0A 1IBRA 3CA8A 1FYFA 4OXRA 4WCFC 3DXZA 4XWYA 1MQAA 2AW5A 4Z0PA 5REQA 4LQCA 3WL3A 3E5RA 1CEEA 3DWFA 3JZFA 1XI2A 3OOHA 3WYEA 4B3FX 4M8NE 2B5WA 4Y2PA 3N8HA 1BRMA 1ECFA 3G85A 4YRLA 3JZAA 3EARA 4I55F 3CB4A 3ETJA 2R62A 3DMYA 4DDWA 4QA9A 5T3YA 1KE1A 4GH9A 2XQVA 4PFQA 3DLHA 2MYUA 4KN8A 2DWPA 1ECGA 1GPKA 1NVKA 2XZTA 3B3QA 1TIBA 4N7MA 2AZ4A 4OGKA 4ZJUA 5LJLA 1FMFA 4MYDA 2OUKA 2W6CX 4BQNA 2FFJA 1VBFA 3FJ1A 3FTPA 3LRTA 4KWIA 2LXNA 4ZQFA 3SMVA 3T7CA 1Q0RA 4JI7B 4L2IA 3A6GA 1KYZA 3WJ2A 5GV7A 3IB6A 4LYYA 3NORA 4IR7A 1AOXA 1U2GC 4LNHA 3RVSA 1Z7BA 2Q2VA 5IMSA 1MX0A 3AMVA 5F9FA 5DMXA 4LF6B 4I6EA 2O7QA 5DB4A 3D8NA 5TVGA 5ESWA 1Z3IX 2BC9A 5GADl 5LD2C 1S96A 1EFLA 1Y1PA 4OLHA 4WZBB 1Z0UA 4FVTA 3IMKA 4XVCA 2C9CA 2C3YA 2OGUA 4BC1A 4HG2A 2JLRA 4MLCA 1E60A 3HS3A 1E2GA 4RHYA 1HYQA 5AOVA 2Z6AA 3E82A 3U44A 3KPWA 1A2OA 1YRWA 5CB8A 5EIBD 3SEZA 2Q45A 2NSLA 3QU5A 3EGDB 1Z06A 3GBSA 4RKYA 4PDGA 1GRQA 1RHMA 3CZAA 3QUAA 4H7KA 4H7IA 3WLJA 5JY6A 3OM9A 2CK3D 2AX4A 1OKSA 2J0UB 5EZ5A 3V9PA 3KP0E 2QT9A 3FYHA 4D9KA 2YJ6A 1QIDA 4UFPA 4UTPA 2ZIXA 4BTEA 4W1QA 2JGDB 1KOLA 5CLHA 3Q15C 4HNGA 3UA3A 5GZ3A 1EFUB 4JI8M 1BFDA 3DEHA 3RS0A 4DV1M 1U3GA 3P9QA 4IZ6A 1FBTA 4H27A 1SKUA 4KMMA 1EK6A 4URUR 1F12A 2RH8A 3EPPA 1T5IA 1N32M 2A2ZA 2I4NA 4HWGA 3ZC3A 1M2WA 4BPRA 1G42A 2LIPA 5ALJA 2W2PA 4Z4IA 3HCBA 3DJFA 3C15C 3OU7A 1WD7A 1ZRNA 1NWHA 1A4XA 5AKLA 3PXAA 5FTKA 4MJ3A 2L0XA 1IL0A 1C81A 1P1CA 2PKRA 2UYQA 3I6YA 3KKMA 3JQGA 4Q18A 5F51A 1XZNA 2I1LA 4F1JA 2J9ZB 1E3SA 4L7QA 4PO9A 3UT6A 5ILGA 5JZBA 4TWAA 3K2QA 5ALKA 6REQB 2ZJ7A 2EYUA 2XA1A 4IL5A 1XNGA 3E9MA 5HDQA 3WKCA 4G24A 3AVYA 4UNPA 3U3DA 2DF8A 3MJVA 1K3TA 4RE5A 3QXXA 4DBLC 1NM5A 3HB5X 1PR6A 4I4LA 1GQSA 3HC7A 3N76A 2NZJA 4IJ5A 4OTZA 5D01A 3VR3D 4D9GA 3LX5A 4B31A 7REQA 1VCIA 5D7NA 3RPEA 1L4BA 1SB9A 1T6XA 2WKPA 3G2OA 3SE0A 5FEUA 4N7RA 1V7ZA 1QDLB 1HSZA 4ADSG 2O0MA 1L5QA 3EVNA 4DRXA 1MV5A 3E0QA 4KE6A 3NI2A 4B2IA 3M33A 2VHQA 4IIDA 1RRCA 1S3IA 3ZCVA 4BNTA 1KY5A 2GUWA 1PFVA 3KOYE 3E58A 3AVQA 1YK1A 4PQRA 2WILA 5DTRA 1RIIA 3L1KA 2D1QA 3BXPA 1DAPA 1KR2A 5I3ZA 1LBHA 4N41A 1U9IA 4MKRA 1CHNA 3RUFA 3USZA 5BORA 5JADA 2JD0A 1ML4A 5AHXA 1Y9JA 3TX6A 3L49A 4UAVA 1S8NA 4AJNA 2P2YA 3IBGA 3PXEA 5ALSA 5EMJA 2R751 3E22A 1XNHA 3DBVO 1LJLA 3D1VA 2XJ4A 2VJLA 2ZRGA 3CVUA 3HV0A 5IUKC 5LWQA 3D8RA 1T2VA 3W1VA 1P33A 2PUVA 3K9BA 4MUIA 3H9CA 3VSCA 2WB4A 3Q7TA 2ZQZA 4L4RA 1JW9B 1NI3A 4M1OA 4LF9M 2HRQA 1ZNYA 3WK5A 4DDUA 4G4GA 5K8IA 1N1DA 4POOA 4MPTA 2JD2A 4M60A 4Q7JB 4Z9BA 3KSBC 1OW3B 2VHUA 3GV0A 2PCJA 2HF2A 3LLSA 5TE9A 3TSCA 2ZT6A 4X6LA 1JR3A 1RXSA 3FDJA 2NYRA 3O3MB 5J4LA 1P9NA 3BPSA 3W0FA 2Y1DA 3LQ4A 1DU4A 4IYRA 3U1BA 3GPUA 1AZSC 1C30A 1SBZA 4M3NA 2IYAA 3LUPA 2K2WA 3IAUA 1NE7A 2GCOB 3NZEA 1W0JA 1YA4A 2NVWA 4H1VA 2DH6A 1ZRMA 3K32A 1VHQA 3B1WA 1EYZA 3AHHA 3P9SA 2MINB 3V1MA 4B7XA 1FPMA 1VJRA 3GQ4A 1D2HA 3IHPA 1N77A 3FVWA 1OXTA 3OM8A 4Y6QA 3LZCA 5BPFA 1HTBA 1Y8RA 2D4HA 1I1QB 3MB8A 1Z6PA 3CZ4A 1LLFA 3M7IA 1HZZA 1N5DA 5KTRA 2D1YA 5A3SA 2XQKA 4EYSA 4GU5A 4QUGA 2HMSA 5JZ9A 5KCMA 1YR8A 1AE1A 1ZNWA 1HR0M 3CPJB 1MH1A 3MWKA 1DAOA 1ZMBA 3QV1A 4HGQA 2O0HA 1B6SA 5TMEA 3TEJA 4D4IA 2E4YA 3RE8A 2XRZA 1SBTA 3UK0A 2ZB7A 1UM8A 3FMGA 1A1VA 4FGLA 3HB1A 4N0QA 1NXQA 2WT4A 4GQIA 3RUPA 4XOUA 4INOA 1ZGBA 3BHMA 3N70A 3GC6A 4C9BA 5DNYA 2CF6A 2NTEA 2DX7A 3A6FA 1QVAA 4DWVA 1NKSA 2Z58A 1AF7A 3BJZA 4WHMA 2JEYA 1PFUA 2Q3DA 5D3KA 2DUUA 3BGDA 3FGPA 4C1BA 4EUSA 4DKJA 1B74A 4EKGA 3LQQA 3DLIA 1TZJA 3DWEX 3ML1A 5CXSA 3WMRA 1JFTA 3L7KA 3I5MA 4P7BA 1EQ2A 3PT5A 1RRGA 1N0UA 2OHIA 3WWEA 1YAHA 3I9OA 2H1WA 1GNVA 5DK4A 3A1EA 3BFPA 3RVBA 4FFLA 2N1BA 5D1NA 5AVUA 3BN3A 2JGDA 3R5JA 3QPWA 5CT8A 1Y6FA 3MT0A 1I5EA 1P29A 2VSXA 1ZNXA 2ZDQA 4EI7A 1X7XA 1TB4A 3PNVA 1PT8A 4WV3A 4LVNA 3TD6A 1B8VA 1P3DA 1L4NA 4QHYA 1KDRA 4GPBA 3TW6A 5IBCA 1ZK4A 1QOQB 4ZZ3A 4EG7A 1MC4A 3VZPA 2Z4TA 2XCLA 3AF1A 3QTBA 4KKXB 4YONB 2WSLA 3W05A 2FPGA 5HRUA 1R9JA 2PWPA 3N75A 2BFEB 4RELA 3DGFC 2ASEA 4M7PA 5LZ2A 4QO8A 4H3VA 3U09A 3BG5A 4GMFA 1P62B 4DSOA 4LXIA 4BQPA 1RYFA 5JQGB 3C16C 1SBNE 4PG7A 5HKBA 4KLAA 3O94A 1QIIA 4R16A 5K6AC 1GL3A 2WT9A 2O8FA 4CV2A 1UXIA 1NBEA 5I9LA 1Z5VA 2P9TA 4UBIA 4QPCA 5BV0A 2ZSEA 4TKMA 1C8BA 5EJ5A 3ZE1B 3M6LA 5IT9S 1DEXA 5HIIA 3VJRA 1R4NA 1E2FA 3I9NA 1NBAA 3SYTA 3QVXA 2I4TA 1VG1A 3FNQA 2CJFA 4DR4B 1ZSVA 2HFJA 2WM9B 1GCOA 3SHVA 4IXWA 1UMBB 2ZJ5A 3TIXB 4GO1A 4C6TA 2GLXA 1D8TA 2JLWA 1E59A 3FE2A 4M87A 5EP2A 1K06A 2YIVX 4TSKA 1CFJA 3CSUA 1Q0PA 4CLDA 3D4OA 4AJPA 2GHIA 3T38A 3KHUA 1OH5A 3OF2A 3GQ3A 5DHPA 5E7MA 4EFNA 5LQMA 3GLIE 1U7WA 1XRSB 5AT1A 4US0R 3THWB 2FZ4A 1RQ2A 3ZIUA 1AY0A 1YNOA 2IF2A 1DQZA 3BMCB 2Y2UA 3OPYA 2BMVA 3WC4A 4EGAA 1WUIS 2F59A 1NN5A 2OESA 4REQA 1NRJB 3PNMA 3ZJ5A 4LX8A 3HCNA 4QATA 1WXXA 4QLOA 4AP5A 1KJIA 2CB0A 3S1AA 4N01A 2ZXUA 5L4NA 1WB4A 2NTJA 2WUWE 4EY4A 3CLSD 5K0BA 1T0PA 2I9PA 1NXVA 3GJRA 3QVLA 4R6WA 2R4JA 2H1IA 1XZDA 4PBSA 1D6NA 4D44A 2XYHA 1OB2A 1ENYA 1HTWA 3N3BC 1RFLA 3A36A 3WSVA 1HDYA 4TKUA 2H92A 4HQNA 4KN6A 4TL9A 1VIYA 3NONA 2BRUC 3A3KA 1E3MA 2G17A 1O96B 2J3IA 2JZOA 3FPKA 3L4EA 2QUJA 3E3OA 4JFAA 2ZUSA 1HYGA 2RHOA 4QBTA 1Q02A 1SOWA 4HZIA 5FH9A 1I9CA 3PUIA 4XJXA 3OM1A 3RRYA 1IK6A 2WVAA 1DUSA 3F3MA 1WU7A 1ZGAA 3F3SA 4HDRA 1M5UA 2IBMA 3MINB 4JJFA 5F9MA 1HE5A 1MB2A 2BKVA 2R8XA 2ZU0C 4P0TA 3DDWA 2BMDA 1Q3TA 1EDZA 1W87A 4Q9DA 5DGHA 5B12A 1GQ2A 2C42A 2YOHA 2CLEB 4ZJYA 2YYSA 1Z0SA 1EUCA 5ALHA 2ODQA 5J2UF 1XEFA 3HFSA 2SHKA 3TPFA 4MQFB 2PO5A 4Q3AA 1RQGA 4BCDA 1RPAA 4PWYA 4JI5M 5EOVA 4F6RA 4KXNA 1Z34A 3FJOA 3W2HA 2PHZA 4BTLA 1YZYA 2PIAA 5IZ7D 5KQ8A 2ZW9A 3M1LA 4KCGA 1EUYA 2X1MA 2IDMA 2PK3A 3PUJA 3W5UA 1O9BA 4C0XA 4DIMA 1E9EA 1RC8A 1X8KA 4O8CA 4HDKB 2XMSA 1DQYA 1YONA 3ELYA 3H6KA 1EA7A 3QPUA 1B0UA 1FXWF 4RK7A 1DUVG 4ENVA 1GCUA 1M2VB 1DBWA 3OUTA 3R5KA 2V6BA 3QMPA 4IDEA 4EHJA 1TMKA 1NVGA 4BB9A 3DCYA 4R8SA 1KEEA 3DONA 1WCWA 5EE1A 1E0KA 3AV3A 2PGXA 3BRQA 4OVZB 1VI6A 2GEFA 2P0EA 2RGCA 3M6WA 4L8LA 3FVVA 2WYWA 1EG2A 1T1EA 4MVJH 2TS1A 5KNCH 5GM2A 3GIDA 5AR1A 1H1DA 5EQFA 4MGKE 1YS9A 4O59O 3I4YA 2B9EA 4ZEXA 1K6IA 1K8QA 1K98A 1P0IA 3VNBA 4G9BA 3SBJA 2GRAA 3DBLA 3KTOA 4QU5A 2NU8B 1TVKA 2G77B 3F49S 3T9AA 2AG8A 5BV7A 4QQKA 1WQ1R 2PGJA 2PV0A 1FXUA 2MT9A 5AJYA 5GVSA 3VR6H 2GYUA 1SG0A 3NTQA 5G0SA 3LC2O 1IY0A 1W8DA 2IPAB 2QIPA 2J7OA 5AW1A 5G1PA 5J9FA 5D51S 1QFYA 4M9UA 4FDAA 2QQ0A 2H0QA 4TYYA 2EWVA 2LKDA 3IUMA 4TPKA 1DRJA 3RKRA 1NKVA 3KZXA 1XZQA 3IUYA 2O8CA 4L08A 1P1IA 4WCFA 4TV8F 1SXQA 3NVMB 3TR0A 1BGVA 3ESAA 3PQFA 5JCJD 2B1GA 2B30A 4JVOA 5CW2A 2Y1GA 1BZYA 2XE7A 5EERA 4LOIA 3NBYC 5BYKA 5IM4A 5E95A 3UYKA 3ASYA 1SQSA 4GEGA 4X93A 3BMOB 2XNDA 5LA6B 3C6XA 3IEXA 4EQ6B 5A2QA 2I3DA 5AJVB 2JIQA 3MBKA 3SQDA 3UB4A 1GPUA 1XK7A 2PVSA 1YC2A 5B30A 5DDIP 1TR8A 1PZNA 1RQPA 1QQ6A 5KAMA 2QNJA 4BLPA 2A9OA 4KQ9A 3H9JA 3I9KA 3BXZA 1E63A 5I9BA 1JDNA 1W0JD 2X41A 3D59A 4LNUA 5BT9A 2AEFA 3V1YA 3VSDA 4S24A 4CMBA 4EH1A 1QHGA 2VATA 3HY6A 1O77A 2LCQA 5C8YF 3KQWA 4XWWA 3FHJA 2QP3A 2C5HA 1RKQA 4FI3C 5AXAA 5TEVA 1VDDA 5KSPA 3LDUA 1Z82A 2GDZA 2CK3A 4FJ0A 1J0EA 1CJTC 3PD7A 2PQ6A 1XO1A 4UBMA 1WCYA 3E3AA 4WASA 1ZHOA 3GLFE 3IOYA 4US1R 5LQJA 3PTLA 1J0BA 1ZOIA 1OH8A 3FHOA 2HV8A 1DG1G 1EPUA 2C2MA 3Q41A 4Q82A 4QNMA 4MP6A 4WD3A 1XWFA 3B2EA 2Z1DA 4TXJA 4EF5A 4L5IA 3BXWA 1SAYA 4U02A 3K5HA 2HMVA 1WCIB 3DKKA 3IXQA 4HPWA 5DGIA 3CNHA 4I66A 2QRGA 4MI6A 3ZE0B 2X4GA 1I6LA 2YKGA 4C1NA 2WKWA 1GNSA 3BKXA 4M7OA 3GO4A 1LFAA 4CQLA 1PKEA 4TVKA 4B33A 2VKTA 3UGJA 2DAMA 4ER3A 1VMIA 1CE8B 3L8MA 3SOPA 3TS1A 3BL8A 3QLTA 16PKA 1UBSB 2G4LA 4C4OA 4BV9A 5I45A 2ST1A 2P68A 2OM6A 3SDSA 3NUQA 3EZNA 2FW0A 4MS3B 1X80A 2BGTA 3G1UA 1W35A 3QWLA 2PS3A 4JLKA 3NT5A 2XB9A 3ZYCA 1RYZA 3TH5A 3TIIA 2B78A 3KD2A 5FJIA 3UJDA 3QX8A 2HL7A 1B41A 4NSNA 3AY3A 4Z3DA 3OQ6A 3VR3A 1OA1A 3EXIB 4UEWA 4YAFA 4IBJA 5C7YA 2OSBA 1DMSA 4GKVA 1JJBA 3O4HA 1KC3A 1RZ3A 3OCCA 2WY2D 5JYBA 3CVVA 1B00A 1PJQA 3HZOA 1P60A 3MT9A 1U0SY 1AC5A 3BXHA 1J0DA 5DJ5A 5F52A 5EKDA 3GRUA 1M73E 5LP6B 4B2YA 1A2BA 4P83A 5CHYA 4UREA 3L6DA 2C4NA 4JSTA 1HDRA 4HDKA 4LOKA 4UTNA 1DB3A 1WZEA 3KQTA 4XR4A 4MXDA 1HRDA 3TFOA 2AJDA 4YDRA 3M6IA 1EGVB 3O38A 1I33A 3GPPA 3GJQA 3TE7A 4EKYA 4IGEA 5CBPB 4DQDA 3X3HA 1S8FA 5T57A 2C82A 1Y6GA 2JJMA 4WBXC 3UAVA 4GNKA 4GEKA 4F97A 3WL6A 1CIPA 3OD5A 5EJ9A 3LTNC 2Z5GA 3S5JA 3WB0A 1SCJA 2C2KA 5AO9A 4B32A 2GM9A 3WLOA 2NU8A 2Q4TA 1NNUA 3GZTB 2FMXA 4EWLA 2D2FA 2WHEA 3KXIA 3VX4A 4NYIQ 4F11A 4HKTA 3LQKA 4TWIA 7AT1A 1P45A 4KVGA 1AQYA 3NLLA 3C7CB 4QUHA 4AD8A 1F0KA 5KS2A 4A8HA 3UKOA 1RXVA 5KMGA 1VSQA 2W6QA 1L5NA 4QGAA 1NZJA 4H9GA 5CT9A 4HNUA 5HIJA 1YQXA 1T4GA 3AI7A 3L07A 4DJAA 2QAGA 3GHHA 4MGZE 1N92A 3HEAA 4WOKA 1XGKA 3OJWA 1EX7A 5GKNA 1O94D 2BMJA 3ZDCA 3BD6A 2PUGA 1ORDA 1OD6A 1UP7A 3MCAA 2JAPA 2GNPA 3ENVA 4UTXA 3SZ3A 3VR4D 1Z2CA 4RIEA 2D0PB 4OV6B 2CVFA 5CA1F 4H6WA 5HW0A 3KL4A 5JROA 2OXIA 1A8UA 3RUIA 4LN1A 4RXTA 4CM4A 5F7ZA 5DGXA 2C4KA 3DBOB 4ZVVA 3RDPA 4CF4A 1HE1C 4ITUA 3GO8A 4MPRA 1D6SA 2A9JA 4KHZA 3MPUA 3Q1KA 2H5JA 2EKFA 2VOEA 4YX9A 1FZTA 5E7QA 5FBKA 3IAXA 1N5MA 2CJXA 2I76A 4W5OA 3AHGA 4IIUA 4LJ9A 1LQUA 3E1SA 5KHLB 1HNNA 4JR2A 1O3YA 4MR9A 4PC7A 4IBKA 4NU6A 2EKDA 2MSWA 3NC1C 4PICA 1P5FA 1QUFA 1QO9A 5DOVA 3ODGA 3A9VA 1W47A 2DWOA 4BN4A 1XRQA 3BXFA 2WU1A 4Z2YA 3TTUA 3KFVA 3BWBA 4OSEA 1KO5A 1ONSA 2G7ZA 4PYMA 3V1KA 2FCRA 3GJ4A 4PINA 1MIOB 2HZBA 1P44A 3AP3A 2RI6A 2JK1A 5B4UA 1PRYA 4CF6A 3JSAA 1TJ4A 4KYUA 4RSRA 3NTLA 3L92A 4FGJA 1MJGA 2GJAA 4K2AA 3LXXA 2PRKA 2VWGA 3ABSB 1Y9AA 4BXOA 1SVNA 1U2ZA 4CLRA 4D1YA 4YCLA 4ABYA 1L5LA 1JSCA 2W2TA 4L51A 3TTSA 3ZD8A 2HXYA 3O1HB 1ZBDA 4GP7A 3ZDQA 4RM2A 3F6RA 4MB7A 2FJ0A 2PR2A 3IEIA 4GLOA 4HF7A 1V8ZA 1CJVC 1SBYA 4MI9A 1EZ1A 2VP4A 3E4CA 4FLMA 4DANA 4OHFA 4KQ2A <