3GRWH

Fgfr3 in complex with a fab
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
230
structure length
230
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTFTSTGISWVRQAPGKGLEWVGRIYPTNGSTNYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARTYGIYDLYVDYTEYVMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibroblast growth factor receptor 3
publication title Antibody-based targeting of FGFR3 in bladder carcinoma and t(4;14)-positive multiple myeloma in mice.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/immune system
total genus 46
structure length 230
sequence length 230
ec nomenclature
pdb deposition date 2009-03-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3grwH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3grwH01
4DTGL 2YA2A 3RWCB 1HSAA 5MI0B 1TZGH 4HDIA 1ITCA 2VMFA 1KCUH 1QRNA 4PRIE 1HDMB 2AW2A 3TT3L 2NX5D 4GW1A 1DVFB 2XQYG 2FR4B 1H8NA 3AMKA 3FQNA 4ZDHA 2OR9H 5EFIB 3FQUB 1X5FA 1Z0MA 4DZ8B 4UDTB 2WBJB 1DBAH 2YPVH 3ILPB 1YN6A 2VDKH 3FRUB 1WBYA 5EZOL 3VDAA 4I18A 1XGQA 4KKLC 5D2NA 1DBJL 2A0LC 4MNGB 2Z0BA 5JHDD 3MV9B 4GMTH 1J87A 4OFYA 1YEHH 3WUWA 5I15L 2C4FT 3X14B 5HYJE 2P5WE 4YBLC 3SGDH 1AI1H 5LGJB 1LD9B 5JORB 2E7LC 2MQCA 5KS9A 3P9LB 4FTVB 4RSVA 5AD0A 4RDQG 3MRQA 3HZKA 3KPSD 3RQ3A 1CFVH 4OLUH 2DJSA 4JFDB 4RFOH 1KXQE 3U79A 3FO1A 1N4XH 2R29L 5LBSL 1U58A 4D3CL 2BY1A 1E4XL 3GSWB 5JDSA 1K8IA 3EO0B 5TPWL 5I75C 2MJWA 4HIXL 3GMPA 3MLZH 4MA1C 3GHEH 1FNHA 1IT9H 1RUML 5FECA 3ZSTA 5F89B 4LVEA 3RVTC 1JCKA 2YR3A 4UTBH 3LKPA 1A14L 3LQAL 4LPCA 1YYLL 3BGMA 2KQNA 1FNGB 4JFEA 4LLDB 3PNWB 2O5YL 4HZLA 5J6HA 3GRWH 1CXFA 3FO2A 4RMQA 5D1XC 4G8GE 1SJEB 3HPJB 4I0KA 5AZEL 1ZHBB 1KJMB 4YNYB 3FZUD 4YHYC 5EA0L 3FB7A 4AEHH 2EDNA 4KMLB 1W72B 1FIGL 1INQB 2I5YH 2R8SH 4MWFB 3NTCH 1NUFA 4G9FB 1ED3A 5KSBA 1TXKA 3QIWC 4JPIA 2KDGA 4NHCH 3LD8B 3VFRB 3BP5A 1JHKL 1JGDA 1QKZL 5D7JD 1I8LC 2X1OA 1J0HA 3HR5B 5LWYH 1QP1A 1P4BL 5E7FA 4CRPA 3MV8A 1ZLVH 2WWKO 4HJJH 4WFEE 3IDNA 4MNQB 4GO6B 2X4QA 2IPKA 2HFGH 2WUBL 5L2JA 1RJLB 5IF0B 2YD1A 3NIFF 4HIHB 2CMRH 3O45B 5AZ2H 3O2DH 5DUMH 1S7UA 4RNRA 3VRJA 3GMRA 4JR9H 1FLRL 3DRQB 3L3DA 4FHBD 4X7TB 2G2RA 3VD9A 5J6GB 4KY1H 2R2CA 4LLWA 5DJZA 1ORSB 1P7HL 1S9YA 3OV6A 1S9WA 3KPTA 3L3OB 1BQUA 1XF4A 2F8OA 1B4JL 5T1KD 5I76A 2FSEA 3RWEA 4P2RD 1MWAH 1CDGA 3HG1E 1KN4L 2XTJC 2PO6B 1HHHB 4NHUA 4I48B 5CIPA 3QAZB 1F45A 3SOBL 1B9ZA 3QDHA 2IBZY 1CQKA 3QDME 3ARGB 1ACZA 4IRJD 4M6MH 5F7DB 3FO9A 4PRNA 4O2CA 1RHFA 3HE6D 4BQCA 3HFML 4LNRB 1T0MB 4YGAB 3CFKA 3NIFE 2EXYC 3KLSA 3X17A 1EDQA 3N9GH 1FZOA 4ODHL 1J9CT 2FX7H 4DKEH 1FFQA 4DEPB 5C3LD 1GGCL 4F37K 1I8IB 2VLRE 1R5VB 3RVXC 1YUHA 2J1KA 3HC3H 3HI6L 3VWKC 1Z0NA 3BT2H 4AJ0A 2W60A 3CXDL 3TO2B 1JRHI 3HZMB 4LSQH 3F5WB 4XP4H 1IVLA 5FYLL 4JO2L 5J1AB 3DXAE 1MLBB 1KELH 1K4DA 5ECJE 1A6AB 1XGTB 4DCQA 4PLJD 3MOAH 3HPLA 3KDMA 2R4SL 1BEYL 2BK8A 1JGEA 2ICEB 3G04A 3E3QC 1X6NA 3I84A 3CFDB 4GUPB 4PG2A 3F6IA 3PJSB 2F54D 3ARFC 4N5ED 1N59A 3I85A 4X9BA 3G6DL 1KB5H 1JL8A 3UPCA 3IF1A 3CDGA 4OSUH 35C8H 5E6IB 4UV7H 1H3WM 4I8DA 2BDNL 3O8XC 4CJ1A 4MJ5B 3RY6C 1MJ8H 2IQAA 4R90L 3RIAF 4WY7L 1MY7A 2VAJA 1J8HA 3PWVA 1MJJA 4PD4K 3BHBB 2PXYA 2UWEF 1I3GL 3O6LL 4BKLA 1MAJA 2H2SD 3VXSA 3RVWC 3C6LC 2YD4A 5CLWA 1BFVH 1VEPA 1ZHNA 3KLHD 3HAEH 5SWSE 5T3XH 3LRHA 4MLSA 4XP6L 3D87B 1TMCB 4ISVB 1N6UA 5J11B 5TJWK 1L0YA 3CZJA 4HGWB 4QHKJ 4QXGL 1VACA 4PRBA 1LO4L 1CFQA 1VEOA 3NVQA 1AQKL 5D93B 1MSPA 5DK3A 2D9QB 3QNZB 4YDIH 1JPGB 3GSXB 3WHE0 5J7CC 4N0CC 4K7FB 4ZAKD 3HNTL 3QWOA 2YPKA 3NPSC 2JB5L 1QSFE 4AIZB 4L8CB 1EAPB 1KT2B 1BX2B 4LLQB 4FXGA 4F7CB 4Z7VB 5C3TA 2X9YA 2W9DH 4ZOAA 5EU3A 4E0RA 4YE4L 5E8EA 2AJ3B 3SEPA 4DVRL 5GS0H 5IROA 1FGVL 1LEKA 4NKDA 3JV4B 1BFOA 5J12C 1DLHB 3LKNB 3I50H 3DVNA 3EYQC 2CIIB 2NY2B 3S37L 2UWEE 4S1DC 4ONOA 4OCRH 4F2MB 4LQ1A 3PDOB 4P2QB 1A3LH 1CN4A 5DJCB 3D39E 4UZGA 3MJ6A 1IC4L 4ELMB 4F15B 1JRHL 2AXJA 1MEXL 1JZ6A 5FM4A 1KC5H 3T77B 3NA9L 4V1DD 2OP4L 4LDEB 4BZ2H 5GRZA 3MO1A 4NN6C 4EVNB 5FYJH 3RIFK 3VXMB 1YEJL 2FBJL 1KIPA 3MGOA 1FV1A 5I1EL 5JZ7C 6CGTA 3LKRB 4WI7A 1P4IL 2BFVH 3ZYOA 5HI4D 4DTGH 1U3YA 3WFDL 5ETUA 4JJHA 3NFSH 3O4LA 3EFFA 4X0KB 2FD6H 3O6FB 2Q76A 1U42A 2Y4SA 1A47A 4TTDC 3CH1A 3O81A 3RGVB 3S35H 2DQDL 5JXEA 5K9OA 1QSVA 1TETH 5IT2L 2LABA 4RWYH 3LEVL 2H32A 3QYCA 1LVEA 1MPAL 2ZSVB 2IADB 4RCAA 4DZBA 1XCQB 3MYJA 4M8VA 3L7FB 4C58B 1OGTB 4LLVA 1ZA6B 4PJ7A 3E8UH 4TVPD 1IGCH 3QDGD 1U92B 4UINL 5DHVB 4M6OL 5HHMB 1KPRB 2R23B 3DURA 1EJOL 4HMEA 3RWCA 5CWSB 1OCWL 4PJHF 2VDMH 4TVPL 4Q97A 4OCYH 3LZFH 4XTRC 1DVFA 4WHYG 5IVXF 2FR4A 1GPOH 1S7WB 2E7MA 1JIBA 5EFIA 4AT6B 4DZ8A 4UDTA 3OHXB 2WBJA 2DBJA 2FGWH 3ILPA 4K3JL 5EOCJ 3U4BH 4JPKL 4LCWD 4KK8C 1JFQH 4MNGA 1BD2B 1X5GA 2RCSL 3BO8A 3FCTA 4MHHI 3LB6D 1HSBB 2WP3O 1LO5B 3MRLA 5L6YL 4XBPB 1F4WL 1I1FB 4JHBA 3WJJA 1D6EB 1WICA 5LGJA 1LD9A 3HKFA 4APQC 3BKJL 4HUKB 3P9LA 4FTVA 4BZ1L 1QBBA 3RA7L 4PJHE 2O61A 1CLYH 3A6OA 5GGTL 3GI8L 2I25N 4JFDA 4D0BB 5IVXE 4BQ8A 3GSWA 3IJSB 5L0QC 2VISB 3EO0A 1M71A 1XZ0B 4QRRE 3ROOB 1NGPH 2NY4D 2VZVA 3PWJB 5E8DL 5FUZL 2YPLE 2I24N 1RK1B 5F89A 3IXTB 5FAAA 1OF2B 3EZ8A 3VD4A 4Z9KB 2DD8H 1QSEB 3BGFB 4CL7A 1H15B 4RMTA 2W91A 1FNGA 2ATKB 1Q9WB 1AXIB 4LLDA 4NQEB 3PNWA 3QHZL 4R3SA 1U8LB 3PXJA 1UCBH 4WWKB 4DK6A 3AGVA 1CZ8H 1ZHBA 1KJMA 3ZKXB 4GG6F 3ZTNL 4YNYA 2M1KA 4Y5XC 1CVRA 1W72A 1INQA 3LHPL 5DC0A 3KPMA 4LRIC 4U1SB 2QBWA 3MV7E 5CJQH 4NOBA 4QTIH 3VFRA 1NCNA 4NBXB 1XEDA 2VC2L 1F4XL 3HR5A 4HUUB 4YFLF 4KROD 3MACL 4PJ5E 3THMH 1UACH 4QOKA 1NL0L 4Y16D 1YEEL 5IF0A 4HIHA 2BVQA 4MA1B 2OZ4A 4G6AC 3AC0A 3DRQA 4HIJB 3NCFB 1JYVA 5J6GA 2ZG2A 1B90A 1CGXA 1ORSA 3Q48A 3UBXB 4GG6E 1IM9B 1MJUL 4PRID 1S7RB 1AFVL 3L3OA 2L0DA 5C0DA 3U7YH 2CJUH 3S6CA 2P5EB 4GJTB 5D1XB 4PLKD 4OLZL 3V4UL 3UCRA 2VXSL 1K4CB 1ZV5A 4YHYB 2NY6D 3CFIC 3TZVC 1HHHA 5DJ8A 4CAGA 4I48A 1F4YL 1J5OL 5E2VL 4G7VL 5EWIH 1FAIH 3ARGA 3MOBL 5F7DA 1JF6A 3QPXL 5DMKB 3ULVC 3P30H 4AH2A 1C7TA 3VH8B 1T3FA 1OSPH 2EDQA 3O3DB 4OLYH 4K3EL 5EU6E 5HYJD 1T0MA 5SX4I 2HMIC 3LKQB 2P5WD 2RQ8A 1CDIA 3B9KC 4Y4KC 3GKZA 5IHUH 4G8FB 1RJCA 4KHXH 3SBWA 5IFJB 4YXLH 4FMKA 1QOKA 3A6BL 4TQEL 3PG2A 2XQBL 4NNPL 1BGXL 4PV9B 1I8IA 2NY7L 2WLZA 3W82A 4HMDA 1FL3B 1F6FB 3S37X 2P45B 1MFCH 4NFCA 4RAHA 3F5WA 3HLAB 2C1OB 1MIEL 1VEMA 3OSKA 2P8LB 1ADQL 5J1AA 1MLBA 1A6AA 1XGTA 1KJ2L 3IDIB 4NNYB 4TULL 3P4OB 5FGCE 3JSSA 3WFEH 1EO7A 2ICEA 2O5ZL 2AK1L 2YRLA 2UZXB 3HUJF 1SY6L 3CFDA 4GUPA 4XB7A 4G8GD 3PJSA 3OAZH 1NKRA 4NCC2 1GIGH 1EEQA 2FGZA 5E6IA 4OKVB 3VWJC 4DGIL 4MJ5A 5KVEL 3GSVA 4NFDA 4XP5L 2ITDB 3AU1A 1HHKB 4K3DL 5D1QA 3BHBA 1JN6B 1YEIL 1U8JB 2DLFH 5DRWB 1S9XA 4OGZA 1NGYB 2J3SA 3IRPX 1UVQB 2ZCKL 4EEEA 4FZ8L 2MHAB 3O4OC 4HC1H 4HGWA 5TF1H 3QEQB 1J0IA 3VG0L 4WFED 3QEGH 4Q9QL 2KPNA 3QNZA 4QTHB 1JPGA 3GSXA 2DKSA 2XICA 4PRAB 1NMCC 4K7FA 3VG9C 5GXBB 2ORBH 3HMXA 1AXTH 3MYZA 1R3LB 3FB5A 4GT7A 4AIZA 3HUJE 4L8CA 1EAPA 1KT2A 1BX2A 1HHGB 1N7ML 4LLQA 5CINH 5IFHH 4F7CA 4Z7VA 4HWEL 1DQDH 1HCVA 1CICA 4MD4B 2AJ3A 4FQJH 3L5WB 4FQ2L 3QO1B 3BFOA 5KVFH 3JV4A 1WAAA 1DLHA 2XOTA 3HG1D 3LKNA 2C3GA 2CIIA 2VDRH 1FVCB 1GJIA 1X3DA 3O8XB 2IALA 3PDOA 1SJHB 1V3MA 4P2QA 5DJCA 4ELMA 3QDMD 2EYRB 1PY4A 1FVEA 4YBQC 2VERN 2ZUQC 3T77A 3MA9L 1KNOB 4OLEA 5CEXB 4UB0H 4BFIB 2YEZA 3ET9F 5SWZA 3VXMA 3GSQB 2X4OB 5CHNB 1IAOB 2ICWI 1KLFA 3BZEB 4OUUB 4HK3N 12E8L 5F7LB 4FQPA 4WW2C 4G5ZL 5EIVA 3L5XL 3IU3B 1DBML 1WEJH 4XAWL 3O6FA 2VLRD 3GO1H 4PTTB 3RGVA 2DYPD 2OMBA 5SX5H 5HPMA 4OGYH 4J2XA 3NPSB 5LAXA 4HZAA 1NLBL 2HAZA 3MUY1 5C09A 5EZJA 2DQHL 5C0IA 2ZSVA 2IADA 2DTML 4O4YH 1XCQA 3EIFA 3SY0B 4NO5B 2FJGA 3L7FA 3DXAD 1OGTA 4ZFOL 1ZA6A 5C70A 2Z91B 2EDXA 5ICXB 1OSZB 1FORL 1U92A 4P5TA 2DJUA 5DHVA 5BMFL 3DTXB 3CMGA 5FM5M 1KPRA 2IEPA 3LVEA 1O0VA 4P4KB 4D8PB 4YHPB 3RX8A 4XNMB 4MQXC 1PG7X 4OZHF 3RZCD 2I27N 4U1NA 4MA8L 3OKYA 4UIKL 3DETC 4U7MA 5IIEB 3WFHB 1S7WA 1DQLH 4NN6B 3MLWH 3MRJA 4AT6A 1LILA 3QI9C 3OHXA 2YRZA 3WD5H 5EO0B 5CP7B 2BVUA 3U7WH 3RDTC 1BD2A 4LF3B 4O02H 4HUVB 5SWSD 1HINL 1LO5A 5ACMA 4OZGF 1XFPA 3P2TA 5IWLA 4PJCF 1I4FB 1NCUA 2VKWA 3JV5A 1N5AA 4MDJB 3MXVH 1D6EA 4ZODA 3TN0B 4NQDE 4NUJB 4DAGL 1CGSL 1IAMA 5EUOB 5DT1L 5DVMA 5GGVH 1U8QB 4LLUA 1EH9A 1QSFD 5J4MA 4OZHE 5J0BA 4JRXB 1G7JB 1GL4B 2J88L 4D0BA 5L9DH 1UCTA 3IGAB 3MJ7B 3IJSA 4X9IA 2VISA 1C5CH 1XZ0A 4ERSH 3CX2A 2J8OA 4H8WL 5E9DA 3PWJA 5GSVB 2JIXB 1FO0B 4YHLH 1XR8A 1DSFH 1R5WA 3ULUH 3MUHL 1ZSDB 1QSEA 3RJQB 3QG7L 4F57L 1H15A 5CBAB 4JFXB 3WFCH 1Q9WA 3NFPB 2XKSA 3D39D 4NQEA 4WHYH 1U8LA 2WWKT 5T1LB 2F53E 2YBRB 1QHPA 1BVKB 2R56L 1E4KA 4OZGE 1YEDB 2HT4C 4PJCE 3V4PH 4X9HA 5ELIA 4XBEH 1LO3H 1N8ZA 1NUGA 4KUCF 4MD5A 1A6WL 4W70A 2YK1H 1T2XA 1XR9B 3BIKB 4ODSH 5IBLD 4KI5C 1Z9LA 1QO3B 3OZ9H 5I73B 1AQDB 3QH3B 3U7AA 4U1SA 5IVOA 5TF0A 4XCCL 4FFYH 1ROWA 3UYRL 2PKDA 1HKFA 2J4WH 2BRQA 3EYSH 2HJKB 5DFVC 2E7LA 5ENWB 2Y72A 4OD2B 4ZTOH 5C7XL 4HUUA 4KXZI 4RMSA 3GMMA 3BE1L 2PUQT 3RI5K 2VJXA 5TDPB 3U0WL 2C3HA 1NGXB 4HPYH 1V7ML 1A1NA 1HKLL 1L0XA 5F96L 1L0QA 2EH7L 5GJTL 2MCG1 5IGXH 3UTSE 4J3OC 2ZG3A 4U1KB 1U8OB 2HTKD 3QQ9D 4HIJA 2UZIH 3UBXA 2DQCH 3CXHK 4C4KO 2MWCA 1IM9A 3WS6A 1S7RA 1RURH 4OF8A 1A9BB 1N5YH 4F9PA 1MOEA 3BXNA 2P5EA 5D1XA 3D3VB 3QUZD 3B3IB 1FZJA 3ALXA 4LCYA 1B2WL 1ULVA 4L1HA 1FQ9C 3VMPA 3CZFB 5EN2B 1OW0A 2R0WL 1G6RB 4HUXB 3T0DA 2VDOH 3UTTE 5DMKA 5TE4H 3VH8A 1I8LA 3NCJL 4HCRA 2LAAA 1IGFL 1IAIL 4G8FA 2VIRB 4EN3C 5IFJA 5T1DL 1MLCB 4HQQH 4TOYH 4PV9A 5J9PB 1KIRA 3ESVF 1T22B 1RUPH 1LNUB 4HV8B 1NAMB 3E0GA 1FL3A 2BX5A 4QT5B 4PJAB 3UC0L 2DI8A 3EDKA 3FKUS 3HLAA 2C1OA 2XY1A 2HTLC 3ILQC 1D5ZB 2ZOKB 4E42B 4E9LA 4P4RB 4QRRD 5E03A 1RJZB 5J13B 5GSRB 4W4OA 4WO4D 2YPLD 1A3RL 3CLFH 3IDIA 3O3BB 2BNUB 2ICES 3HC4L 4M5YH 2OX5A 3QR2A 4LSUH 1L6XA 3VD3A 4Z18A 2GT9B 1I75A 4YFLI 5C0CE 4H20L 4ZUUB 5IW3A 2ARWA 1KSRA 4HUMB 4X80L 1MUJB 5ESAB 1IL1A 4NWUL 2BMKB 2WINB 5IBTL 5K9QG 2W0LA 3QUXB 1MFAL 1Y6KR 4BQ6A 2NY1C 4LLYA 1NEZB 4J1UA 1YQVL 4FFZH 3D25B 4S1SL 1Q72H 3KYMB 2OS7A 3ARTA 3DI3B 3MV7D 2ITDA 1HHKA 1CD8A 3B9KB 2AXGB 3SDDD 1JN6A 2DQFB 1U8JA 3P0YH 3I3EA 4GBXC 1NGYA 2E8ZA 4JFHE 3TO4B 4OZ4B 1J8KA 5FOJA 1LDPL 3VWKA 1YY9D 2BJML 3MX0A 4PJ5D 4ZQKA 3QEQA 4PV8A 2BNQE 4QTHA 2GJ6E 1MI5E 5CBEB 3CFEA 2FATL 1TTUA 4FP8L 1MHHB 3VXQB 4XVTH 4MAUL 1R3LA 2AS5M 1UADC 4N90E 4N0FB 4PP1D 5I8OL 1J86A 4ZTPL 3U9UB 4YDJB 1RUAL 3BWAB 4POZC 3MRKB 4MD4A 2GK0A 1P7QB 3L5WA 3WXVH 2XZAH 1DE4B 3QO1A 3VXUE 3ARFA 2EDKA 4LGSB 2B4CL 4NCDA 4QKXB 4R97C 1FVCA 5MEPB 5TGBB 1JVKA 3O8XA 1SJHA 2V17H 2EYRA 3ULSA 3BUYB 5DZLA 5DRXA 2DOCA 5CEXA 4GQ9H 4F7MB 3JTTB 3UBXG 2X4OA 5EU6D 3FHQA 5CHNA 4I5BB 1BZ7B 1IAOA 1OP9A 3S4SA 5LQBL 1UA6L 5B4MC 3O4OB 2BVYA 3T65A 4LHUD 4OUUA 4FQXD 1EO8L 3IYLW 5CSGA 3IU3A 4R4FL 4R4ND 1OGAE 1DJSA 3DUUB 1RK0B 3DECA 5CSZB 2HT3D 1MCPL 4LPVA 4QLRA 1K3IA 3FT3B 5BS0B 2ZUXA 3P0GB 2ED9A 4GLRH 3SY0A 1W72H 3VH8G 2AEQL 4JN1H 3TEUA 2WUCL 2Z91A 5GJSL 5ANME 4ALAL 2AQ3A 5ICXA 3BDYL 5BJTB 3RRQA 3T2PA 5MEQA 1MCOH 4UOW1 2WW8A 2WP3T 4D8PA 4JO3L 4TPRH 4TSAH 4XNMA 1VFUA 2LU7A 2NNAB 3KJ6L 2EEDA 1NFIB 3LS5H 4ZFGH 3QWRD 1MHEB 2D0GA 5F7EH 5CZVL 3GB7B 2ZUQB 1SYVB 3WFHA 1E0OB 2AABL 3TJEH 5JQ6L 3DWTA 5H35B 3G08B 3V5HB 2OZ4H 1G7IA 3N06B 4MZ2A 1U3HD 2Q6WA 4TSBH 3VFUB 5EO0A 1INEH 5MENB 5CP7A 3MRPB 4WW2B 2OL3B 4M62H 1JNHB 5BVPH 5DGQA 4LF3A 5JHLH 3T1FB 1AHWC 3E2HC 1AIFB 1RI8A 5HDOA 1I4FA 4GXUN 4F7EA 3JBG7 1OAXL 1A0QH 1CD1B 4MDJA 3V0VB 3FFCB 2IPTL 3V79C 4J3XA 3WNPA 4Z7QF 5DRZB 3TN0A 1A7BA 5DGRA 1WCBB 1HYRC 3ARBC 1FIEA 4PJEB 1U8QA 4KHTL 2GCYA 1RVFL 3IFOA 1G7JA 4JRXA 1EHXA 1EV2E 3ARQA 4P48A 4L8SC 1ZKAA 4PIRF 3MJ7A 1B88A 2A74B 3DSNA 3G9AB 4QXUL 1CI5A 5GSVA 2JIXA 1AE6L 1FO0A 5T5NG 1UM4L 4HBCL 1WCQA 1G0DA 2BSTB 2EEBA 1SYSB 3MXWL 1KEGH 1ZSDA 1EFXB 4X4XB 2QJDA 4POYA 5D5MB 1EEZB 5C92A 5CBAA 4JFXA 1I3RB 1A6UL 3NFPA 1TJGH 1OAZH 5T1LA 4BSJA 3RFZC 2YBRA 3MMEB 1BVKA 1ZS8B 1JZ3A 1YEDA 3EOTL 4YHZL 4TNWK 1UM5H 3RDTB 1N6QH 4JVWA 4O9HL 1ZT7B 4Z7QE 1XR9A 3BIKA 4KJWD 1QO3A 1OTUD 3T0WA 3QH3A 3TBTB 1D9KB 4K8RH 1B0RB 1UGNA 5FUCC 5GHWH 2D0HA 4HIIA 5C0BA 1RZKH 2HJKA 3LSOB 5ENWA 1J10A 4OD2A 2NCMA 3ZZ1A 5I1KH 2X7LB 2YKLL 5TDPA 1NGXA 2VLKB 1G7QB 1IMHC 3VJ6B 2DQTH 5AG8A 4U1KA 4MA3B 4I3SL 1U8OA 3S4SG 1FVDB 2B1AH 3O2WL 1U9KA 1PQZB 2XPGB 1NH6A 3TYFB 2OSLB 3GSOB 3QXWA 4HT1H 5EORL 5DXWA 1SBBA 1AJ7H 4XPGH 1KEMH 1RZ8B 3T08A 4EQ2A 2XZQL 3B3IA 1UWGH 3O3EB 3ECBB 3DMMC 3GBML 1TTGA 3HMXH 2NQCA 3QXAB 5EOQL 4JDZB 3CZFA 3EUUA 5EN2A 3RP1A 1G6RA 2NW3B 4HUXA 5I1HH 4X4YB 1D5XB 3EHBC 1T2QL 5DD1H 1BVZA 5DJ2B 4JB9L 5LXGH 5TDNB 2LAGB 3MRMB 2W38A 1NCDH 2VIRA 4NQDD 3O6MH 4OGXH 4G7YL 5J9PA 1T22A 2Z4QB 1LNUA 3ARDC 4HV8A 4ZO6A 1NAMA 3KXFB 5JW4N 1B0GB 2D31B 4PJAA 4KTEH 2Q86A 1D5ZA 3H42H 1CXKA 2OTPA 4E42A 2AXFA 3L3GB 4P4RA 1RJZA 5I16B 4ZUVB 5GSRA 4PREB 3N1QC 3QUYC 3O3BA 4NO2B 2BNUA 1U95B 4YDLB 3OX8A 1QVOA 4H0IA 3VGFA 4IDJL 4PGEB 5EBLB 1AR1D 2XRAL 3M1BA 5D96C 4H88H 4YH6A 1MUJA 1EMTH 5ESAA 3TZVA 3TFKD 2BMKA 2WINA 1W0WB 1RUQL 2NX5B 2F53D 4KQ4L 4Z95L 3QUXA 4ODTH 1B0WA 1JP5A 4CU7A 1NEZA 5I74B 3MGAA 3D25A 1UM6H 2H2PC 3QJHA 2X4NB 3S8WA 3KYMA 5K59F 5IW1A 1G0XA 3LCYA 2P4AB 2ZG1A 3B9KA 4Y4KA 1H3TA 2DQFA 2VDPL 4EN3B 5T3XE 5I8KH 5JHDB 3WIHA 1MQ8A 3AB0C 1T04B 3TO4A 5ICZB 3MRIA 5JW3H 1FL5A 1WTLA 4IMKA 4I0PC 5CP3A 2VAAB 2YC1B 3C08H 5CBEA 4NC1E 3UTSD 3PWPB 1JK8A 3PP3H 2WM0A 1MHHA 1II4E 2AJXL 3W81A 3T4AB 3WL9B 4WTZA 4N0FA 3EYUH 3D5OF 4IRSD 1D5MB 1SJVA 4LU5L 1JZ2A 1T83C 3DVGB 3U9UA 4YDJA 3BWAA 3DUSB 4KUCD 1P7QA 5K59E 1DE4A 1YZZA 4KK5D 4QRPE 3FHAA 3VXPB 3TVMC 1EA9C 3JXAA 4F80A 4OZIF 3KJ4C 2JELL 2NY5L 5I1IL 2FJFB 5MEPA 3VWJA 5T3ZH 5B38B 5TGBA 1M6OB 4LSVL 3LV3B 3TNNB 2V9RA 1JF1B 3VXOB 5FYJE 3BUYA 3QFJE 3UTTD 3BAEL 4AEEA 4JY4A 3R0NA 3FQWB 3PV7A 4M1DH 4UIMB 4F7MA 2GTZB 1IGIL 4U6YB 1CU4H 3JTTA 3FFDA 2Y6SD 3U83A 4I5BA 1BZ7A 2V2XB 1CCZA 4IOSD 1GGIL 2W9LA 3CSYB 3SO3C 5DSCB 2ZKHL 5T33L 3GMOB 3PGDB 2QQKH 1ZANL 1RK0A 3DUUA 1NCTA 1E27B 3P4LA 3FT3A 5BS0A 4OF5A 3X3FL 4S11A 2F9BT 1P4LB 5CZKA 3SGEH 5BZDA 4OZIE 1G9ML 3O11B 3C5JB 3PE9A 5SV4A 1S5IH 1BBDL 4M03A 3CDYA 1C16B 4B0MM 4U6VH 3TBVB 5BJTA 5JW4Q 5C0CD 3MLXH 1IBGL 1MHPL 1OVZA 2X1PA 2VDLL 3D6GA 2VLLB 5T1KB 2ZJSH 2WWMC 2NNAA 1NFIA 4OCSL 4DWHA 4P2RB 5A2IH 2ARJQ 1NCBH 1MHEA 2VDQL 4A2LA 4ZNEA 2J2ZA 5FO9A 3WNNA 1SYVA 4NN5C 2E27L 3CPLB 1JNNL 3D1MC 2HRPH 3G08A 3WIIL 15C8H 4L3AA 1A22B 4DOHB 1PKOA 2MSPA 1E6OH 2HT2D 5GGSY 4IRJB 3VFUA 4I3RL 4FABH 3RAJH 5MENA 3T4YB 3MRPA 4WW2A 5GPRA 2OL3A 1JNHA 3HE6B 4LGRB 4QHKI 3T1FA 4JFHD 1MFDH 2W0PA 1AIFA 3BEVB 3T0AA 3AAZA 3BKYH 1D5BB 2FX8L 2BNQD 2H41A 3V0VA 3FFCA 2CKBH 3MREB 5DRZA 2GJ6D 1MI5D 1NEZG 2A9NH 2C3XA 1QYGL 1WCBA 4XC1L 3MLYL 1LP9B 2LVCA 4PJEA 3QDJB 1M7IA 3OKLB 2R2HB 4N90D 3RUGB 3CSGA 1WZLA 1WK0A 4H0GA 4DVBB 4YXHL 2A74A 3SN6N 5HBBA 2MNUA 3VXUD 1RZ7H 4OZFB 1BJ1J 4OFKA 1IE5A 2AAVA 5DMGC 3CAFA 5FEBA 4JGJA 1G7HA 4MGXA 2BSTA 3RX7A 1SM3L 3BESR 5TE6H 1EFXA 5D5MA 3M17B 5FUOL 1NJ9A 2R4RH 3QA3B 1I3RA 3SGDI 3QI9A 2C7UB 1QA9A 5DHYA 4HS6B 2NY3C 4JREC 5GRJL 3MMEA 4U49A 5I71B 1F6AB 1ZS8A 3WKML 5F9WC 3K4DA 4LHJB 4O00A 3RDTA 1T1XA 4HPOL 4PJFB 4XPTL 1AHWB 1ZT7A 4B5EA 4K71C 4U1GC 1I85C 1D9KA 1MH5A 3RWIB 2EDFA 1B0RA 1QFWM 3LAFA 1EGJL 5HI5D 3BSZL 4C4KT 3ARED 1OGAD 1IGYB 5I8EA 3IDXH 2QSQA 4YHMH 3V6OE 1AH1A 1Y6NR 5TFSL 2BY2A 2WSKA 1N2RB 1FPTL 4LMQI 2X7LA 1GHFH 4Z78B 4ORZC 3EJZC 1T7WA 3CLEH 2R0ZH 2VLKA 3WMSA 4ZAKB 2W1NA 2DLGA 2LTQC 3VJ6A 4MA3A 3HI5L 3VD5A 3TBWB 1FVDA 1BQLL 3FQXB 4QWWC 1PQZA 2XPGA 4A6YB 4J23A 1H8OA 2OSLA 2F74B 3GSOA 3KPPB 2IF7A 1KOAA 1E6JH 5CFHA 4Y8DC 5CGYD 5T5FL 2CK0L 1TZGL 2EDOA 2L7UA 3C87A 3BW9A 3C8HA 2VR4A 1B6UA 2E9WA 3O3EA 4ESKA 3ECBA 5GZOD 1KF9B 3IFLL 3CVIL 3QXAA 4JM2F 5E2JA 4B53A 5DMYA 2OR9L 4JDZA 4V1DB 4AQ1B 1OQXA 2NW3A 5IKCB 1MCWM 1D5IH 3C60C 1DBAL 1D5XA 2VXQL 2YPVL 4XMKL 4PJGB 5D7IB 4WUKH 5DJ2A 1DFBH 3SDCD 4GMTL 1IQDB 5JNYA 4PJDF 3RKDD 2EEAA 1YEHL 2XYCA 1PGRB 1IEBB 4JRWA 2KKQA 4IMLB 4WWID 1MRFH 3MLVH 2W65A 5I17B 3F58H 3RHWK 2Z4QA 4M00A 1UH2A 2JKXA 3KXFA 1YDPA 1B0GA 2D31A 1PEWA 3U0PB 5HD8C 4PUBL 1WFUA 3KS0H 2UUDH 2F58L 1N4XL 3L3GA 4H8WC 4HEME 4QY8B 4U0RB 5I16A 4G80B 4ZUVA 4G6KH 4PREA 1U95A 3AFLA 5EG6C 4NJAL 4P9HC 1LK2B 4FZEL 3GHEL 4HLJA 4DGVL 4PGEA 3QHFL 3BQUC 5EBLA 4QYOB 1KENL 3QUKB 1T6WA 4HWUA 1UB5B 2FL5B 1W0WA 4Z77B 5HHQB 3U1SH 3S5LB 4U6TA 4KWUA 2PYFB 3GKWH 5DD6A 4OQ1A 3GRWL 4JPVH 4PJDE 2XWJB 3MLSH 4GXUM 4AMKH 2X4NA 3UJIH 5F8RC 4ZSOB 1H3PH 4XPAL 4AEHL 1QRNE 3MRHB 1ZT4A 5I1GL 4F33B 1BQHB 3EZJB 4EN3A 2GAZB 3NTCL 4YO0B 4F7TB 4MAYD 3TIDB 4JFFE 3W9EB 4NHCL 2J8UB 3PHOB 1T03H 4Y4HD 5F6HJ 3FO0H 3Q5OA 4GG8A 5CJOH 1X5ZA 2VAAA 5HHXH 5LWYL 3S34H 4JN2B 4NQVB 1Q0XH 4HUWB 2VSCA 5FK9B 3PWPA 3VXNB 4BM7A 4NM8L 1RQ5A 4M1GH 4NDMB 4DFHA 3T4AA 4RFEB 4JZOB 3VGBA 2BC4B 3O2DL 4LAJH 1D5MA 5F1SA 4GKNB 4RRPA 5D96B 3DVGA 2NY4B 2NXZD 3B5GA 2G5RA 3H3KA 1DUZB 1DBBH 4PS4H 3BD5A 3VXPA 1FHGA 5KSBF 3UJJH 4NC0B 2A77H 1TDQA 2VZ3A 5FDWB 1MWAL 4F3FB 2FJFA 4C54A 1M6OA 4H26B 3RKPA 3VXOA 2ADJB 3NZHH 4N0UB 4HS8L 3MA7B 3FQWA 4LOUC 3O41B 4UIMA 2LFGA 3KWWB 1K2DB 4U6YA 3DHJA 4M7LL 4NQXB 1KCSH 1FO0H 3R06B 2H1PH 2V2XA 4R7NB 5AEAA 4JFEE 3CSYA 4I0PB 3INUH 5DSCA 1A7NH 4XB8A 3UP1A 1IAKB 3PGDA 4G9DA 2DWDB 4QHLB 4LSPL 4KROB 1E27A 4PYGA 5ADOH 1KTLA 1X7QB 2UVEA 4ZG1A 1S7XB 4M6AA 2VXTL 5KSBE 1CDUA 5JOFB 1NLDH 2RIKA 4LFHG 4XBGB 4LSQL 3WNKA 4QRSB 3C5JA 3BP6B 1C16A 3WNMA 1KELL 3TVMB 2QSVA 2A2QT 5FF6B 1MCIA 4QHNB 4MS8C 4PRIB 5CAYB 2VLLA 1SEQH 1YQ2A 5DMIH 5E0QA 2YXFA 4UQ3B 1ZGLB 3OKOA 5HDLA 4DN4H 4LL9A 3CPLA 1NMBL 1KB5L 1MCCA 2JJUA 3AMLA 3ULUF 3I2CL 35C8L 5HHVL 3QNYB 4HGMA 4YDVB 3T4YA 4EDXB 5T3XD 3NCBB 3HE6A 5EC2B 2YA0A 2LU3A 5HYJB 1U3JA 3BEVA 3GSNL 4K7PX 4LBEA 1OAQH 4B7IA 3LPFA 1D5BA 3KYAA 3OXSB 4OLVL 3MREA 1CT8A 3D69B 3A6CL 3CX5K 4YEFA 1LP9A 4FQCL 3BZFB 3HB3C 3QDJA 4XVSH 5ESVB 2DJ4A 3OKLA 1NCWH 4JFZH 5FFLA 1TVBB 5GS0D 1AXSB 1DL7L 3IAGC 1UJTA 2EE9A 4GSDH 4Z7OF 4ZMAT 5FKAB 4DVBA 1N0XL 4ZO8A 4ZS7L 2Z93A 4QRPD 4OZFA 3ULUE 4P99A 3EYFB 4Y5VC 1JTTA 2B4CC 3R0MA 4G8EB 4NN5B 2Y07H 1L7TH 2EDDA 3BX7C 1AKJD 5LGHH 3HMWH 3M17A 1NGQH 1UB6B 4G8GB 3QA3A 2AI0L 2APXA 3P0VH 1S78C 4KJPD 3ZDZF 2C7UA 4OCRL 5F71A 3QFJD 1F6AA 3QJFB 2FJHA 5K9JH 1EK3A 3QCTH 4M43L 4XZUB 4RRPG 4PJFA 4KMQA 2UYLB 1AHWA 4ZFFB 3UO1L 3SGJC 5C6TL 4J4PC 4BZ2L 4LSDA 3G6JF 1T0PB 1KB9K 2B2XH 2E9IA 5FYJL 3RWIA 1K9TA 1OB1B 4FG6C 4LNVA 4W4NA 3HC0B 4K9EL 5IVZA 3ARBA 4KTDL 3NFSL 4Z7OE 4GMSH 3KS0J 4TRPL 1CF8H 1N2RA 3MLUH 2YZ8A 2X40A 4XXDB 3U4EB 5DO2D 4Z78A 3ULVH 4UT7H 1KPUA 5ADPL 8FABB 1UXSB 1J8HE 3LIZH 3K74B 4ZAKA 2BNRB 1MCQA 1TJIH 1WGOA 3IFPB 3TBWA 4QF1A 2A1WL 2VITB 3JZ7A 4JLRB 3RTQD 3ZDZE 2D7PA 3BH8B 4N0YH 1IFHH 4XVJL 4TUOB 1JNJA 3KVQA 2F74A 3KPPA 2EIBA 4IJ3C 4L9LC 4OF7A 2E7BA 1XIWC 5CP3H 1YEGH 2EXWC 5CJ8A 1MREL 3HG1B 5E5UB 3G6JE 3RIAK 4WRLA 5HI3D 4LKCB 4RAUB 3S88L 3SCMD 1GPOL 1T20A 5EC1B 4RWHA 4JDVA 2VN4A 2DQGL 5IB4B 1QBMH 5IKCA 5IR1A 1GZQB 3M8OH 2V7HB 1JFQL 3SO5A 4PJ7F 3ZT6A 1IQDA 3MBXH 2CUMA 2HN7A 3LKOB 4R2GC 2VO5A 1IEBA 4X8JB 2FEDC 5BO1L 4IMLA 4ZFOB 3VU2A 5I17A 4Q58C 4HG4J 5KSAC 5DQ9B 5IV2B 5IM7B 1RIVH 1MFNA 2PYEB 4EI5D 5D2NC 3U0PA 3GNMH 1DLFH 3DXAB 4YHKH 4LDLB 4QY8A 5FM8A 2DL9A 3L7EB 4G80A 3BPOB 3P9MB 1T1ZB 1J7VR 3UROR 3LS4L 1VESA 1NGPL 4TSCL 4Y19B 2HWZH 3MJ9L 1LK2A 2UY6A 5DA0B 4J3VA 1HH6B 3DMMA 4QYOA 2YN3A 5ILTH 1CDHA 2RR3A 3QUKA 5E4EC 4NO0A 4NSKB 4Z77A 1PG7W 2DDQH 4PJ7E 4XPBL 4ZS6D 4YWGL 4M4RA 2VH5H 3ZDXF 3H2WA 1UCBL 2CRIA 3OTTA 1O5DT 3I6LE 1XGRB 2EIEA 3STZB 4JG0H 3K4ZA 3NFNB 3Q2CA 4ZSOA 4OZFG 4XP9H 4ZXBC 4MSWA 3MRHA 4BA8A 1BQHA 3MNVB 3OWEA 5C2BH 3CFBA 3UTQA 4EUPH 2GAZA 4YO0A 4F7TA 5CEZL 3TNMA 1QR1B 4Z0BH 3W9EA 2J8UA 4PJ8C 3TBYB 5GGTA 1PZUB 3ARDA 1ZAGA 3DI2B 1LMKA 5D6CA 3H8NA 3KR3L 2IBGA 1XF2A 4JN2A 4X99B 2ICWB 4P23D 3WSQH 4HUWA 5FK9A 3KPRA 4MNGE 4Y8AA 1QSFB 1UACL 1CE1H 3QUYA 4NDMA 3QPQC 2Q7YB 4AEIH 1G9EA 4OM0H 4RFEA 2ZCLH 4JZOA 4LCUB 1I9IL 2BC4A 3L5JA 2NY0C 3BQUB 4XAKE 3ZDXE 3PUCA 3MBED 1A5FH 1DUZA 4EDWH 1SHMA 3QIUC 4FTVE 5D2LA 1VGKA 2H9GA 1CGYA 2UWEB 5B22A 5I2IB 3D0VA 4Z7UF 3ZT7A 3ZE1F 5FDWA 4KQ3L 3D39B 2VDNL 4H26A 4MYWB 3T0EE 3L3HB 3UPRB 1F02I 2XKNA 2ADJA 4EXKA 3N0PB 3ZHDA 3O9WD 1FBIL 1JWUB 2JCCB 4KPHH 3MA7A 3QP3A 3O41A 1XH3B 3KWWA 4NKIH 4EIZC 3MRCB 4NQXA 4YDKL 3ALPA 4I13B 2XA3A 3R06A 2B20A 2HFEB 1QBAA 2R1YB 4R7NA 4G6ML 2X4PB 3B5TA 4OLYL 5HHOB 4I0PA 5FYJU 3WJLA 5CUSL 3SPVB 5GGQL 5IHUL 3GMNB 4LPYA 1ZTXH 1C1EL 4KHXL 4C56B 4QHLA 2DWDA 4NZRH 1JZ4A 1ZEAH 5GZND 4S1QL 1A4KB 5MP6H 1A7RL 4MQ7B 2HKHL 1Q38A 3CX5J 3D18B 2BHUA 3NABH 1S7XA 4NWTL 1B4RA 2GY5A 2DWEB 1TPXB 2X05A 4GW4B 5DDHB 5JOFA 4XBGA 4Z7UE 4QRSA 2VUYA 2Y36L 4JM2D 1DR9A 1FRGL 3MODL 4W6WB 3DHMA 2D7TL 1MCBA 3MZGB 3TVMA 4Y4FC 2D7MA 4CN4A 1DQQB 1JUFB 3K0WA 2VZSA 1XIWD 4QHNA 4HFUL 2DKUA 1QTYT 4QHMB 2Q3AA 1JYNA 4QOKE 4WCYL 5KW9L 4JHWH 2SEBB 3QUZB 1ZGLA 3IRZA 2BVOB 1WTGT 4ZO7A 4Y2DD 5CILH 4JG1L 1A6VH 4NCC1 4ONHB 4LSRH 7FABL 3C5ZC 2R0LL 1QRND 4Y2OA 1NAKH 1OTSD 3C5SB 1J0YA 3QNYA 3ZYJA 4BK4A 5L88L 2GTWB 4YDVA 5CKAA 4EDXA 3G5YB 4FQLH 5EC2A 4JFFD 3CIQA 4MXQD 1IEAB 3RPKA 5KSUB 1KTRL 1ONQB 4IIQC 1RUKH 2DLFL 2EE6A 1P84K 4JKMA 2F5BH 4AG4H 4ELKB 5JXAH 3OXSA 1MCHA 2VZTA 4YUEH 3NOIA 4HC1L 1ADQA 4P2OC 5I6XC 3D69A 3DVFA 4P3WA 4M7ZC 1KJ2A 3BZFA 4OFYD 4M9PA 5ESVA 4FFVC 5MEOB 3ARZA 5IVXB 4NGHL 5D71L 1TVBA 1KPVB 1KYOK 1UKTA 3HZYA 1KG0B 1NBVH 1R5IB 4QRRB 4PB9L 3JV6B 4KK9C 1W0VB 3GMQB 4MQTB 5HGDB 3OF6D 2YPLB 1U8MA 1SY6A 1Q1JL 1R3KA 1DQMH 2R9HD 4D0CB 1JPSH 4RBPH 3I9GL 1X5LA 4L4JA 1K8DB 2NY5C 4PRPB 4G8EA 7CGTA 5DJ6A 5GS3A 1UB6A 1WZ1H 4G8GA 1L9MA 2IG2H 4LP5A 2NYYD 1ZT1A 2DRUA 2VL5B 1HIMH 4Q6IB 1FYTA 2UYLA 3ETBF 4ZFFA 3BH9A 5IROC 3OG4B 3MV7B 5F1NA 3MCG1 4JFED 4XWGH 5B39B 3A0OA 4AEFA 4HH9B 1M7XA 1A7OL 1OB1A 3BZ4B 5F1KC 3QQ4A 3HC0A 4NT6A 4LVNC 4RGNC 2EDYA 5F9JB 1CGWA 5EZOH 2GITB 1DBJH 4UU9B 2MQ0A 1WAAF 4XXDA 3U4EA 3P73B 1BF8A 4D2NA 4TNVF 4KZDH 3QDAA 1UWXK 3RWJB 8FABA 1OTTD 1G9MC 1XAUA 5F6IB 2BNRA 1MFEL 2F8VA 2C26A 3IFPA 4W68A 5BV7L 5JA8B 1QRKA 5ID1B 5IMOB 4ELMF 4Q7DA 4Y5VB 2VITA 2CLVB 4JLRA 3K80A 4TUOA 4KKAC 5JXEC 4KRPC 4I77L 1RHHA 4AQOA 2R29H 3LEYH 5LBSH 3WCYA 4D3CH 1E4XH 4BH8B 3HG1A 5TPWH 4MHHG 4F37F 5E08L 3H9ZA 1XGYL 4HIXH 5I1LB 1N0LA 4LKCA 4RAUA 2ICCA 1RUMH 2LV4A 4R0LB 1AGFB 3EO9H 1DQLL 3MLWL 1A21A 2VN7A 1I85A 4WGWB 2VLJB 2QADC 3HNSL 1A14H 5IB4A 3LMJH 5MI0C 1WAAE 3F7PC 4J8RB 2R2BB 1HHJA 1GZQA 4HS3A 2O5YH 5IEKA 5KN5B 4GS7B 2GHWB 2X09A 2CSPA 1C5BL 5AZEH 4LHUB 4FQXB 1DVFC 2Q8BL 2YSSA 3DGCR 3LKOA 4P2QE 4ELME 1WFTA 1FIGH 4X8JA 1QBLL 4ZFOA 3BJ91 1NQBA 4R96B 2X5PA 3PQYE 3MXVL 2WBJC 1FYHB 5DQ9A 5IV2A 1CLZL 4LRNL 5IM7A 2XWTB 5SWZE 5DI8B 2PYEA 1ZLWH 1C08A 1JHKH 5F9OH 4OM1H 1PD6A 3PABB 1QKZH 4HHAB 1WBXB 5DQDL 1P4BH 5HHPB 5L9DL 4Z7WA 5DK2B 2NPLX 3ULUD 1FZMB 5I66B 1TIUA 5FGCB 1HYSD 1T1ZA 3WJJC 4Y19A 2X10A 1CK0H 1JI2A 5IG7B 5HY9B 1GGTA 1HH6A 1TZHA 4XI5D 5C09E 5A3ID 3DROB 1FLRH 3OL2A 3ULUL 1NAML 4NSKA 3AS1A 3F7VB 5EBWA 3WFCL 2GK2A 1FJ1B 5EU7C 2HFTA 3C60A 1R0AL 1B4JH 5BOPA 5HHME 3DO7A 1OHQA 1U3HB 4JVPA 3NFNA 4O58H 2A6JB 4UTAL 2PTVA 1KN4H 3BN9D 3V7AG 3BIBX 3MNVA 4CADB 5C07B 3EW3B 2JF1A 1MVUB 5CZXD 3SOBH 2V9QA 1QR1A 3C8DA 1LGVA 3Q1SL 5KSAB 5ICYB 2XZCL 3TBYA 2Y1VA 2CO6B 4Y89A 4JKWA 4BH7A 3HFMH 1J8HD 5DFTA 4X99A 2PXYD 2ICWA 3VFGH 4P59H 5TDOB 3RL1B 1BD2E 1SMOA 3HUJB 3FN9A 3QRGL 2AGJH 4ODHH 5E2UH 5IGXL 3RWFB 2EZ0C 3OAYK 1GGCH 3LD8C 4LCUA 4IRZH 4WTWA 3RIFF 1KJVB 3BQUA 1A1MB 3HI6H 4W81A 2GYSA 3CXDH 4D9QE 4HKBB 2OI9C 1AY1H 3I6GA 2CPCA 4JZNB 3VFOB 1PW3A 5FYLH 5T3ZE 2UWEA 4JO2H 5TE7H 1N5YL 5GS1C 2ED8A 2DKMA 4WNQA 1WV7T 2AK4B 1S8DB 1AC6A 4L4VB 3FT2B 2R4SH 1BEYH 5CS7A 3L3HA 5EULV 3UPRA 4ZXBB 3W11C 3U30B 5E9DE 4F7PB 4O2EB 2H8PB 3OGCB 2JCCA 1U3ZA 5B3JF 3FOMB 2L4OA 3MRCA 4OZFH 5DEZA 4PJ8B 5TE4L 1QSEE 3O3AB 3QZWB 3G6DH 1JWSB 1R24B 2HFEA 2R1YA 4RGMB 3FMGL 2X4PA 4GOSA 5HHOA 4NQEE 3QIBD 1JNLH 2BDNH 3D2UD 2PO6C 1JPFB 4M1CC 3QAZC 3GMNA 1TJHL 4C56A 4WY7H 4B50A 1I3GH 3ARGC 3O6LH 4F58L 5ALBH 1A4KA 1PLGL 5ACZB 4MQ7A 2N7BA 4RZCB 4OFPA 4NQUA 5L8LB 2LE9A 2ERJC 4AIOA 3OKNB 1HCFX 3SJVB 3TJHC 2DWEA 4XP6H 4L9DA 4U1HA 5DDHA 4WHTB 3KYOB 5C2UB 2E6JA 4JAMB 4QXGH 1KYOJ 1LO4H 5DR5L 1CXLA 1AQKH 3QIUB 2CQVA 1DQQA 4N8VA 4DEPC 3GBNL 1T2JA 4LSUL 5CD3B 5B3JE 1Q0YL 2P8MB 3X3GL 1VFOA 3OKEB 2SEBA 1DANT 4OT1L 4Z8FH 1F3DH 2BVOA 4YE4H 3I6LD 2V5RA 3R1GL 3EOBB 3WHE1 4DVRH 1FGVH 4PY7A 4OD3L 5C0JB 3EOYG 4ONHA 4XNXL 3W0WE 1MRCL 1AR2A 1Q72L 3IJYB 4GLRI 4X6EB 5D7SH 3C5SA 3RVVD 5EH1A 3S37H 3TYGL 2GTWA 4OCMC 3G5YA 2PTTB 1V5JA 4YFEA 1JRHH 5KSUA 1MEXH 1DN2A 1ONQA 1RZFL 1ZGLM 3DX6A 1OM3L 3NA9H 2OP4H 2BSSB 4X6CF 4CDHA 4BQ9A 4ELKA 4NQDB 3UTPE 3CNKA 5E6IC 2AP2A 5C08B 3TV3H 5I1EH 1H0DB 1MCLA 5F7YC 1MIML 4H25B 4OZHB 1P4IH 5HXMA 3B2UD 3WFDH 5MEOA 2Q8AL 3VDCA 4Y4FB 1KPVA 4X6DA 4CVZB 4JJ5A 1KG0A 2DQDH 4XAKD 4ZPTA 4QRRA 3UYPA 3VFTB 3GMQA 1D6VL 5HGDA 4L3CB 1IM3B 3LEVH 4FRWA 4XHJC 4KDVA 3ZKNC 4YLQT 4MXWH 4FTVD 3HI1A 1MPAH 2NR6C 5D93C 4PRPA 3G5XB 4UINH 2F53B 3T0ED 4IHOB 3L5HA 4M6OH 3KYKH 4MJ6B 2BY0A 3C5ZB 4PJCB 4L8DB 1EJOH 5D7LE 5DVNA 3UZQA 1B6DA 5C0AE 4X6CE 5D9SB 5T5NF 2P8PB 3UEZA 2A6KB 2VL5A 4LP4A 3T2NH 4Q6IA 4HJGA 2XTJE 2DAVA 5B39A 2BSRB 1RV6X 5IFAH 2ZSWB 3DUHA 3BD4A 3O2VL 5DS8B 2NY2C 3BZ4A 5JR1L 3ARSA 2EO1A 4P2OB 5CEYB 3TCXA 3ZL4L 5F9JA 4L3EE 4K3JH 4M7ZB 4JPKH 4UBDC 2GITA 4J6RH 1CE6B 4UU9A 4CN1A 3V0AC 5A2FA 3V52H 1F8TL 3P73A 1NC2B 1MRDL 5GGSB 1T4KB 1MCJA 4NBZB 3RWJA 3UTSB 4NQTA 1F4WH 3SDXF 5IMOA 5ID1A 3BKJH 4Y5VA 2CLVA 4LCIL 1BJ8A 3O6FC 4BZ1H 1H9VA 1SQ2N 1R3IL 3QEQE 5GGTH 3GI8H 4M3KB 4QOKD 3SDYL 3NIDF 1PKQB 1LE9B 4MA7L 3V4VL 4X98B 1EAJA 4ZFGL 4O51B 4P3CH 3P9WB 4KKCD 5F7EL 5E8DH 5I1LA 4CBPA 3SGJA 1AGFA 2AEIT 3NACL 1H5BB 4LQFL 1EUTA 3UTTB 3E3QE 2ATPA 2VLJA 4H1LB 3M45A 4N8VG 4J8RA 1I3UA 4RGNB 3QHZH 3T3MF 5KN5A 5J3HD 5BVPL 1VB9A 3X12B 3H7LA 3QXDB 5IUSA 4P46C 1SBSH 1F90L 3SDXE 4XCFH 1LEIB 1X6LA 3EO1B 5FDYA 3LHPH 1C7SA 2E7HA 4L5FH 4NRZB 4R96A 2NLJB 1R6VA 4FNLL 2G75B 3VXRB 2V5YA 2XWTA 3JUZA 3NIDE 1PYWA 4I0CC 3VGAB 2ZUSA 3PABA 5B8CC 2CDGB 1A7PL 4HHAA 2VC2H 1WBXA 1F4XH 1MCDA 2I60L 4L9LA 5HHPA 2EIZB 5IWLC 3MACH 1FZMA 5I66A 3H9YA 5C0CB 1HQRB 1BZ9B 4ZYKB 4YJZL 1NL0H 1JV5B 5IG7A 5GQBA 1RD6A 5DF0A 3BJLA 4WFFE 3CK0H 1W8OA 3DROA 4XCNB 4YIQA 3T3ME 1KEGL 2QKIB 3F7VA 2HKFL 4NIKB 2QADB 4GRLD 3WLBA 5BRZB 5ISZB 3O0RH 5IB5B 3W39B 1AFVH 1KV3A 4K8RD 4NUGL 4YGVB 2QV2A 3BKML 1U3HA 1N6QL 3MFFB 3V4UH 5L7XH 2VXSH 1J05A 5C0ND 1JZ7A 2A6JA 2NZ9D 3KAAA 3KG5A 4GAFB 4DGYL 5DHXB 4CADA 5C07A 4K9EC 3BGFC 3ZKQD 2NXYD 5KVGL 1MVUA 1F4YH 5LGKA 4G7VH 3ZKMC 1RIUL 4PRHA 5KSAA 3U6RB 5ICYA 3L3JB 4WWKC 3MOBH 4LPXA 5DVOA 1E4KC 3DLQR 3ZKXC 1OAYL 2GJ6B 1MI5B 3N1FC 5HJ3B 4KZEH 3B2VH 5D1QD 4IOFD 4MZ3A 4K3EH 1XF1A 1T66D 3LH2H 1RY7B 1DTUA 3DYMA 4CDGC 2V2TB 1GCFA 4KKBD 1T1YB 4NP4L 3UJTL 25C8L 5B39G 4M8QB 2AJVL 2XQBH 4NNPH 1BGXH 4X9GA 3VW3H 1Z5LB 1KJVA 4U0QB 2VRAA 1K6QH 1BPVA 2W0FB 4WEBL 4HT1L 4HKBA 3VFOA 1MIEH 4TYUA 1UKSA 2H45A 1KEML 4JRXE 1GGBL 2ZOLB 5KVDL 1KJ2H 2AK4A 1S8DA 4Q6YA 1UWGL 4TULH 5A16A 4WTXA 4L4VA 3FT2A 3TCLA 3KLAA 5EO9B 1CICD 4XVUD 4ZXBA 5I1JL 2NMSA 5IMKB 2O5ZH 4F7PA 3ARWA 1F6LL 2H8PA 4O2EA 1CDBA 4NYLA 1IKFL 2ESVE 2AK1H 1INDL 3FOMA 1N26A 1SY6H 3WS6C 3SDAC 4F9PC 1A6TB 4PJ8A 3QZWA 1JWSA 1BHGA 4HBQA 3ES6A 1R24A 4RFNB 1BJMA 4P2QD 1N64L 2YD9A 3LPGA 3AREB 3ESUF 5HYFA 1OGAB 4UBDD 4DGIH 3LRGA 4P5MB 5A40E 5KVEH 1JPFA 3PQYD 2FLRT 3C2SA 1QPXA 1KXTB 3REVA 1ZLVK 3KPQB 3RY5A 5SWZD 3O6ML 1OW0C 4HXAL 5KVMC 5ACZA 2BVPB 5JIIA 4RZCA 3CH8A 3JWOL 3JWDC 3VGEA 4FN0A 2ZCKH 4HSQA 3OKNA 3SJVA 5ANMB 4WHTA 4GKZB 1AGCB 1FL6B 3KYOA 4KTEL 3PL6D 3GIVB 5C0BE 4JAMA 4NKOB 1MFBL 3H42L 3MLRL 1DUYB 3RGVD 2OI9B 3VG0H 4Q9QH 1T89C 2AJZB 3QIUA 4YQXL 4J12A 5GS1B 1T1WB 2FB4L 5C09D 1G84A 4DQOL 1AGEB 1RFDH 5CD3A 5FGSA 2FIKB 2ITCB 2P8MA 1N7MH 3QULB 4JO1L 3OKEA 5IJKA 4Q0XH 3IKKA 1BECA 4HWEH 4P5TD 1MELA 3LRSA 1YNKL 1HEZB 4HH8A 5SX4H 4ODTL 5HHMD 3EOBA 1YYML 4W4OC 5F88B 4FQ2H 4M5ZH 3QRFM 1WWWX 5C0JA 4Y1AB 4RIRA 3TA3B 3GBLA 4X6EA 2CLZB 4XMLL 3ARPA 4Y5YB 5F6HI 4OTXH 1KUMA 3UAJC 2PTTA 2BCKB 4FOMA 5I8KL 3NCCB 3GM0A 5DD3L 3SDCB 4N9GB 5AYUL 5C8JA 4LASH 4WU7B 4NZDA 4NQDA 1W0YT 2ZUYA 4KVCH 1BM3L 3SE3C 5C08A 3FT4B 2ERJB 2EH8H 3K81A 2EC8A 2QEJA 3K7UA 1H0DA 4X5XB 4PJ9D 4ORGB 1BD2D 4H25A 4OZHA 1IAIM 12E8H 2VLME 4EI6B 1QLRA 4G5ZH 5D1ZC 3L5XH 3NCEB 4EXPX 1FNLA 4U4BA 4Y4FA 4H5SB 1YJDC 3DBXB 5I18H 1CL7I 3DGGB 3ULVF 3VFTA 1HXYB 3BDXA 4L3CA 2VZ1A 1NLBH 4D9QD 2FWOB 3IDJA 5T3ZD 2DTMH 2Z31C 5IB1B 1BREA 1CR9L 1T5XB 3EJYC 3G5XA 4KGJA 2CGRH 3WUWG 1FORH 3FAXA 2F53A 4U1LB 1NMAL 5BMFH 3I02B 3OAUH 1X5HA 3GJFH 4MJ6A 3C5ZA 4P57B 1NBYB 4PJCA 4L8DA 3WDHA 2Q87A 5E9DD 1QUNA 2P8PA 3CSPA 2A6KA 4CVUA 1YEFL 4KV5F 4HF5H 4MA8H 1PSKH 1QSED 4IIQA 4UIKH 2IQ9H 4M1DL 4P5KB 4O5LH 1CU4L 3H3PL 2BSRA 4NQED 1KCRL 2ZSWA 5DS8A 1JTPA 2P47B 4KKLD 4P2OA 5CEYA 4HX1B 2A0LD 2V5SA 1FH5L 3ULVE 2HA1A 3MRNB 1CE6A 1CFNA 3BPNB 4AENB 3ME0A 1IARB 2APWA 1MCSA 1NC2A 4K55A 1HINH 5GGSA 1T4KA 3UTSA 1ZVHA 2Y23A 2R0KL 2XG4A 3GK8L 2A9ML 3QZWG 3S36L 4ODXA 1FFOB 1S5IL 4DAGH 1CGSH 1VDGA 1MWAB 4U6VL 5F70A 4J3TA 2NXZB 3JWNC 5ABDE 3V6BR 3MLXL 5FCSH 2EYSB 4QO1A 4PGCB 1NCAH 1PKQA 4KV5E 1LE9A 3WDIA 5DEFB 3SE8H 4TUKL 2A6IB 2ZJSL 3VFWB 4S10A 1OAKL 4P3DB 5DURB 5HVWA 4K2UL 1GOHA 2GY7B 3IJHB 4O51A 1UC6A 2ZNXA 4H8WH 4Q2ZB 3RVTD 3F12B 1WSST 4LSTL 3BP4B 5E99L 4WU5B 2B7DT 3WN5C 3W0WD 5F9DC 4P9HH 1FNAA 2HRPL 3UTTA 4H1LA 4P4KC 1KN2H 4F57H 3QG7H 3VGHA 2ENSA 5D1XD 1CL7L 4A6YL 4X4MA 4JO4L 5DTFB 3UTZB 4FABL 4FS0A 3RAJL 4OLWL 2R56H 3QXDA 1Z3GL 5IMMB 3UTPD 3FTGB 3QUMH 1Y0LB 1LEIA 3L6FB 3U9PL 1A6WH 1S7VB 5CJBA 3EO1A 4PJBB 3BKYL 1RZIA 2R1XB 4R8WH 3QIWD 5F7UA 1J18A 3MLPA 1F42A 4DW2L 5AWNH 4EBQL 4NRZA 2CKBL 2NLJA 1FFNB 1FNSL 4XCCH 2G75A 3VXRA 2IANA 2IFFH 1PX4A 4M7LT 1QEWA 1REIA 2JJWA 3WEXB 2XN9B 2DF3A 5E8NA 3AVEA 4JM4L 2CDGA 3HN3A 5C7XH 4WJ5B 3CFJB 3RVUC 3WUZA 4LLMB 2OK0L 3H9SB 5C86A 3MZTA 3PWLB 4U1JA 3KLDA 5C0CA 1FFPB 3U0WH 3LOWA 4S0SD 1HQRA 1I1AC 1V7MH 3Q6GL 1BZ9A 3TN0C 5AAMA 5BS0E 5F1IB 5GJTH 4WW2F 2EH7H 1JV5A 2JLLA 1KB5B 3WE6B 3MLTA 1QD0A 2X89A 2MQ3A 4XCNA 1UWEL 3EDFA 5D7LD 2VABB 1NFDB 2QKIA 1AGDB 5C0AD 5E2TH 2R4RL 5BRZA 5EBMB 5ISZA 2D7NA 5ESQB 4RMRA 1TQBB 4JPWL 5IB5A 3BPLB 3W39A 4U6HB 1JYXA 4YGVA 1QFPA 3GSNB 1HDMA 2XTJD 4PJEF 4P46B 3HAEB 4FQIL 1OLLA 2IMMA 1H3XA 3V5DB 3Q5YA 3MJ8B 4U2YA 4FFWC 1B2WH 5CJXA 3FQUA 4R6UA 4ZNEE 4L3ED 5D70L 2C9AA 4PRDB 3U6RA 4YXKH 2R0WH 3L3JA 4U1IB 3FRUA 2VQTA 3VXTB 4OFVA 5J8OA 4MD0B 1OP5H 4EQ3A 2GJ6A 1MI5A 1P6FA 3OKKB 2EXYD 5B8CB 3MV9A 5MENE 1GHFL 3B9AA 5GGRY 3NCJH 3P11L 5EU5B 3STLB 2V2TA 3X14A 5I73C 5BV7C 3C8KB 1IGFH 3FQRB 1IAIH 3RWHB 2FCBA 3ZSSA 3RVXD 2AEPL 5T1DH 3VWKD 5FA4B 3FN0L 4UNUA 5JORA 1Z5LA 3QEQD 3DV4B 2DQUL 3GMLB 2W0FA 1FC2D 3UC0H 3D48R 3TF7C 4PJEE 3IFNL 2YD2A 2VOTA 1AKJB 1A3RH 2XQYK 2ZOLA 1V3KA 4WI2A 3HC4H 1LO2L 4PLNC 1NCCH 2EDWA 3OB0H 3QFJB 4ODVH 4H20H 5ID0B 1OT2A 1EGJA 4FQ1L 5IMKA 4X80H 5KANI 3ARFD 4KXZH 4NWUH 1NANH 1MFAH 1A6TA 4IDLA 1SJEA 3HPJA 3O8XD 1RJYB 1CGVA 2XXCB 2ZNWA 4M48H 4S1SH 3AREA 1NFKA 1CG9B 1DFBL 1OGAA 5KZCB 4P5MA 5GRUL 1IGJB 1XF5B 5E5RB 2DM2A 4CVWA 3RVWD 2CXKA 3C6LD 4MWFA 5CCKL 1MRFL 3MLVL 2GKIA 4G9FA 3HCVB 1YEKL 3F58L 1PG7L 3QISA 4KVNH 1ZVSB 1I9RL 4H1LG 1A3QA 4OZIB 5I1DB 2YUXA 1GC1L 4S1RL 4GKZA 1FL6A 3IDYC 4NKOA 3T2OA 1DUYA 3SKUD 4KI5F 4N0CD 3RBSA 3V0WH 1IC1A 5KOVC 4ODUB 5IOPB 1X44A 1RU9L 1CYGA 4G6KL 1YMME 5GS1A 5F3BB 2LQRA 4MNQA 1T1WA 1MF2L 1EUUA 1R3JB 4WFFD 4CMMB 1RJLA 5IESL 1OPGH 2I9LB 3O45A 2FIKA 2ITCA 4I2XE 2VLKE 4XWOC 3QULA 1D3CA 3TH2T 4ZTPH 4X7TA 1A2YB 4DN3H 3DX9B 1RUAH 3U1SL 1HEZA 5J13C 3SCMB 4QGTA 2Y9RT 1V3JA 5F88A 4ONGL 3GKWL 3EYQD 4JPVL 1SVZA 3SDAB 4MVBC 4S1DD 4Y1AA 2AERT 3TA3A 3B6SB 2B4CH 2RHEA 4Y5YA 2D9CA 1MNUL 1H3PL 1VGEL 5FYKH 4HULB 3MCLL 2PO6A 3S36X 2VQ1B 2BCKA 4OCWL 1FAKT 4KAQH 3QUXC 1MJ7L 4N9GA 4HWZB 5M7QA 4FQQB 3UDWA 1QFUL 4WU7A 5JZ7D 1T03L 4KI5E 4WFHE 3ARXA 3FT4A 4W6YB 5CJOL 3HE7C 4X5XA 1F11B 1UA6H 4UT9L 4LNRA 5HHXL 4EI6A 4TTDD 4XPHL 3V5KB 1LO0H 4EI5B 1EO8H 4YPGB 1BFTA 4R4FH 4UAOB 4H5SA 4L8BB 3DBXA 3TO4C 1MCPH 1R5VA 1HOCB 1HXYA 3QFDB 2FWOA 1XF3B 4IMKC 3TO2A 5DD0H 3HZMA 3GRWA 5IB1A 4JRXD 4QXWA 4E41E 1T5XA 4PS4L 2WUCH 1OD9A 4N1HB 1HILB 1V05A 3BDYH 2AVGA 3CD4A 5JTWA 4U1LA 3I02A 5TQ0L 2X41A 4RX4D 1I7UB 2YD8A 1NBYA 3QQ3B 1YC8A 4F8QA 3SQBA 2ESVD 2A6DB 4XTRD 3KJ6H 2VSDA 1LK3L 4GRWH 2D03H 2AV7B 5CZVH 4P5KA 3O6KH 1G9NC 4NKMB 2QR0B 3ZE0F 2X4RB 4GAGL 4OCXH 1X5KA 2AABH 1ZK9A 5T1LD 2H1PL 4CNIB 3T8XB 3V8OA 1HH9B 1NGWB 3INUL 4HX1A 4KK8D 2VZUA 32C2B 3EYVB 1OP3K 5D1ZB 3MRNA 3O2DA 1HE7A 2Q1EA 2VB5A 1AD9B 2OTUB 3OKMB 1TTFA 4JKPL 4NZJA 5C0BD 4APQD 1PDKA 4ISVA 1OAXH 4KJQC 4PJXF 2IPTH 3KGRA 4PY8I 4XNUL 2Z31B 4AYFA 3AM8C 1CWVA 1FFOA 2M26A 1JGVL 1MWAA 3GIZL 4KHTH 3MBEB 1QHOA 5LCVL 1RVFH 2EYSA 1FDLL 3BGAA 4PGCA 1QLFB 2NW2B 3LN9A 2F19L 4CU8A 3PWPE 1SEQL 5DEFA 3ZE0E 5DMIL 2A6IA 3VFWA 4JFYB 3IJHA 3CGTA 3RWGB 4Q2ZA 2GFBB 4E5XB 3BP4A 4DN4L 3SQOL 4WU5A 3VD7A 4HFWB 1UM4H 4OJFL 3O9WB 4HBCH 5DUPH 5FO7B 3MXWH 3BWUC 3H9HB 2HJLB 1GGUA 5DTFA 1A6UH 1KXVC 4NQSB 4F2MA 1UJ3C 3IVKB 5DUBB 1J12A 1J1PH 1L6ZA 1NDMB 3EOTH 4WI6A 5IMMA 4PFEA 4GXVL 3FTGA 4PJXE 3U0TB 4O9HH 1Y0LA 1DEEB 5EO1B 3L6FA 1S7VA 5SX5K 4PJBA 4EVNA 5FV2A 2VLMD 3LKRA 1J0JA 4K94L 3RGHA 5CGTA 4M93B 2ZPKL 3HNVH 3V6FB 4X83A 4ETQB 4X0KA 4HWBL 3WEXA 2XN9A 2XT1B 2XY2A 2FH6A 3T04D 4ZD3H 4WJ5A 3CFJA 4LLMA 2PR4L 4JM2B 3H9SA 2X70B 4LCCC 3PWLA 4GSDL 3N85L 1JGLL 5A2KH 1FFPA 4N1EA 1M7DB 3ARRA 4G6AD 5IEHB 1V7NH 2ZCHL 1KB5A 3WE6A 1MQKL 3WN5B 1G7PB 4WEUD 3O2WH 3O3UN 5E1AB 1NFDA 1ZOXA 4I4WB 4PJDB 1AGDA 5LGHL 2R23A 4FA8A 1EXUB 5EORH 4MVBD 5EBMA 5ESQA 4Y2DB 5CWSA 3U48A 4U6HA 4ODWB 4HDIB 5TQ2L 3GSNA 4JY5L 2XZQH 3TZVD 4P46A 5E95B 1GH7A 3IETB 3GBMH 2DI7A 1U91B 4OGAC 4XH2B 3V5DA 2QHLA 3MJ8A 4JFFB 3RU8L 3GSRB 3BYYA 2GJZB 2KQMA 3ULVD 1VA9A 4HJ0C 4U1IA 1KFAL 3VXTA 2HMID 1T2QH 1CF8L 1XGQB 2HVJB 3OKKA 3B9KD 4Y4KD 3WO4B 5B8CA 1HSBA 1OL0A 5EU5A 3WLWC 4UT7L 3STLA 1T7ZA 4XBPA 1D9KC 3LIZL 1I1FA 3IAQA 5FHBL 1I1AB 5FA4A 4G7YH 5CIPH 3DV4A 3PWNB 2B1HH 5FYLE 2V5TA 3MGTB 4X9FA 2IGFL 4PB0L 3QDJE 4XXCA 3B83A 1AKJA 4QCIB 1YEGL 2Y25A 2CUIA 3ROOA 1K8IB 3OAYH 1CD0A 1RK1A 3QFJA 5ID0A 4IDJH 3IXTA 4KRNA 1CLCA 1P7QD 2XRAH 2DI9A 1OF2A 4YHIB 2XKUA 5GRWA 2ATKA 1QBML 2HLFC 4Z95H 3BGMB 3VWJD 4WWKA 4HZLB 5J6HB 3FO2B 4NFBA 3VI4F 3WFBL 5DC4B 1CG9A 3VFPB 5EBGA 1OWRM 1YNLL 4JQIH 1IGJA 2KUTA 1XF5A 2FHBA 3K2UH 5BV7B 1U8NB 3HCVA 5GISH 5T1MB 4WDIB 1ITBB 3L1OH 1ED3B 3ELAT 1ZVSA 5KSBB 5E8OB 4KK6C 3MV11 5KAQG 1Q8MA 5F3HB 4RA3A 1LWRA 3HHRB 3WBDA 3S3PA 3B8SA 1UH3A 3NCYP 4GQPH 4ODUA 5IOPA 5BS0D 2H3NB 3NAAH 2MCPL 5F3BA 3FJTA 2UVFA 4YX2L 2DN7A 2AJXH 4CMMA 2AKRB 2I9LA 4LEOB 4BZYA 5L2JB 3MRDB 1IQWL 5ILTL 1NBZB 4RNRB 3GMRB 1TITA 2DICA 4LU5H 1A2YA 3VI4E 2RJMA 3SKOB 4WI9A 2IAMC 3NPZB 1DQJB 3SDAA 1RAMA 1ZA3B 4YHOL 4YDLC 3D0LB 5I76B 3B6SA 3EDDA 4LARL 3RWEB 5E2WH 3R4DA 1K4CA 1VHPA 2JELH 2NY5H 3ZO0A 4LSVH 4YBQD 4FXLA 4XP9L 2J6EL 4HXBL 3CJJA 2OXGA 2VQ1A 4XP1H 4MJ4A 2YD5A 2WANA 4N1CA 4HWZA 4FQQA 2QQQA 3IDMB 1IGIH 2C3VB 5I74C 4UNVA 5I9QB 4PRNB 5MEND 4O2CB 5LJYH 4JCLA 5FUCE 1F11A 3O3DA 3MCKB 1GGIH 3IDYB 5HVHC 3LKQA 4HEPG 3V5KA 4EI5A 4H1LH 4YPGA 3CFKB 3MJ9A 1T89A 2ZKHH 5DC9B 1MVFA 4OQTL 4D9RE 2ZCLL 5DYOB 2YD7A 1YUHB 3QFDA 3X3FH 1XF3A 1CD9B 4JRYB 3D85B 4ZPVB 1G9MH 2P8LA 4NZUL 1BBDH 4QXTB 1VPOL 5SWQB 2J8UF 4NNYA 4AIXA 1IBGH 1MHPH 4MQXD 3P4OA 1I7UA 1Q9LB 2VDLH 2B5IB 3C6SB 3QQ3A 3LQAC 2IFGA 2A6DA 3S7GA 5DD5L 1JGEB 3DETD 1QFHA 3S98A 4KPHL 2H32H 2VDQH 2AV7A 1EFXD 1N6VA 4NKMA 2QR0A 2X4RA 4PGDB 1FGNL 4GKOA 2DMBA 4NQCB 3QI9D 2E27H 1DCLA 3DVIA 3SE3A 1JNNH 2J5LC 3T8XA 1N3NB 4OKVA 3IF1B 3FB8B 2H6PB 1HH9A 2V6HA 1NGWA 3HE7B 3RDTD 32C2A 4I3RH 3EYVA 2Z8RA 3MC0A 5D1ZA 3FZUC 4K3GA 3JWOC 5D2LF 1I7TB 4NZRL 5LKNA 3BMWA 1OY3B 1ZEAL 2PXYB 5DRWA 5DRNB 4BKLB 1IGMH 1AD9A 2OTUA 1OAUL 3OKMA 1UVQA 1X5AA 2RFXB 2FO4B 1ZHNB 2MHAA 1X5IA 3DYPA 2FX8H 1A1OB 1U6AL 2W9EH 2J8UE 2Z31A 2BVTA 1YMMD 4NM4L 4Q9RL 4OFIA 4N9OB 1JGUL 1CFQB 4XC1H 3N1MC 5D7JC 5JMRA 1RZJL 4PRAA 3MBEA 2DIJA 2VLKD 1QLFA 2NW2A 1G7MB 3G6JB 4J3WA 2YUVA 3KPRE 1HHGA 4C83B 3QEHB 3VI3F 2ILLA 4DKFL 4YXHH 1IC5L 4OIIL 3RWGA 3RHWF 4E0RB 2GFBA 3CSBA 4Q9CA 5L8JB 3DSFL 2HG5B 2DM4A 1BFOB 5FO7A 3CFCH 1A6VL 2GEEA 4LSRL 3H9HA 5FUOH 5D2LE 3BP7B 1NAKL 2HJLA 2HT4D 4NQSA 9CGTA 2G60H 3L3KB 5GRJH 3IVKA 5DUBA 2M8XA 1NDMA 5CMAB 3QIBB 4KI5D 4WFHD 1KNOA 1EPFA 3D2UB 4XPTH 5EO1A 2F5BL 2AJSL 4BFIA 3GSQA 5JUEH 5L2KB 3MO1B 3WHXB 5JXAL 4L29B 4LFHD 3BZEA 4IRJC 5DFVD 1EGJH 2EDJA 3BSZH 3V6FA 3HE6C 4G3YL 4JEGB 5I1AB 2OR8A 3VI3E 5ETUB 3EFDH 3EFFB 5F7WC 4PTTA 2Q76B 3MFGB 3QCVL 3I3BA 1FPTH 5K9OB 2X70A 5KTEL 2JJSA 2VWEC 2HH0L 5CLTA 2CO7B 1L4IA 3MR9B 1M7DA 4E41D 4OB5L 4BELD 2VL4A 5IEHA 4N8CL 4NO5A 1P2CB 3L9RB 3OGOE 3HI5H 5D4QA 3WN5A 1G7PA 2WLYA 1OSZA 1KCVL 3ZHKA 5E1AA 3DTXA 4IOIB 4I4WA 4PJDA 1WZ1L 1J0KA 4P4KA 2IG2L 4YHPA 3N1GC 2BZDA 3DURB 5T5FH 5D72L 4PLJC 3ARVA 2CK0H 1NC4B 4ODWA 3T0VA 1F58L 1UJ3B 2EDEA 1R3HB 1HIML 1FSKB 3MROB 3IETA 5IIEA 1U91A 4XH2A 4HC1A 4JFFA 3IFLH 3CVIH 4XWGL 5IB3B 3GSRA 1H3GA 1A6ZB 1A02N 2GJZA 3NH7L 3C09C 4N5EC 4Z5RB 1CLOL 2DIBA 5I71C 4GRMB 2VXQH 4XMKH 3W9DB 4WUUE 1WT5A 3A67L 2HVJA 3DX7B 4HUVA 3BO8B 3FCTB 3OPZL 1NSNL 4KU1A 4EN3D 4KZDL 1MAKA 3OXRB 4LCCB 5HGHB 2H2SC 3MRLB 4WI4A 5A2LH 2J12B 1I1AA 1MAML 3KLHC 4NUJA 4UT6L 3OF6A 5EUOA 3PWNA 4TVSa 2HTLD 3ILQD 5DWUH 3MGTA 4ONFL 3PWPD 2O61B 2X4UB 4PUBH 2DQJL 3IGAA 1EFQA 1F00I 2F58H 3LEYL 4JFQB 4ZAKC 4PBWD 4QCIA 4OLXL 3LN5B 3T0EB 5E70A 1M71B 2ZUVA 4NJAH 4U7KA 4FZEH 4DGVH 3QHFH 5SV3A 3EO9L 1KENH 1AD0B 4YHIA 3V7AE 2NY1D 3LMJL 4BFEA 1WBZB 1XCTB 1ZGLP 4R3SB 2VE6B 1UYWL 4JDTL 4OKDA 4OD1L 1RULL 4X7DC 2QSCL 1CDCA 1WIPA 3VFPA 4MJIB 1HZHL 4XPAH 1YPZF 4GBXD 1MHCB 1AQDA 5I1GH 4NBYB 1FYTE 1U8NA 4Z0XB 5HPOA 5T1MA 3KPMB 4WDIA 3OJVC 1AGBB 2DQEL 5E8OA 1L9NA 5BQ7B 4Z7UB 1A4JB 5F3HA 1BQSA 1WWAX 5F9OL 4ZFZB 1CBVL 4OM1L 5HI4C 5EOCH 2G5BB 3U2SB 1CFTB 2FX9H 3R8BB 5F8QC 4L4TE 2AV1B 2H3NA 1P1ZB 3KPNB 4NM8H 4QOKB 1CK0L 2AKRA 2QL1A 1GAFL 4LEOA 5ITBL 3AY4C 1DQTA 3MRDA 2BVQB 4POZD 1IC7H 1NBZA 1WITA 2BNRE 5KJRH 5AG9A 3SKOA 2EE2A 2Y06L 4KFZC 4U0RC 1BMGA 1RPQA 4XX1G 3SGKA 5INCB 1DQJA 1A9BA 1ZA3A 5C0DB 1YPZE 3D0LA 2DBLL 2UV3A 3D3VA 2YD6A 1BOYA 4O58L 2B0SL 4TNVK 3KYNB 5DJ8B 4Z7WF 3GM8A 2PW1B 4HS8H 4OAWB 2HP4A 1QNZH 2QHRL 2JB6B 2C3VA 3IDMA 5E94B 5B4MD 1CDYA 4M7LH 1YY8B 3JTSB 4AH2B 1T3FB 2MPAL 3MCKA 3BRFA 3QBTB 3OB8A 3VFGL 4P59L 1JHLL 2PW2B 1FE8H 3IU4L 1RIHH 3LB6C 1MLCA 2AGJL 4LSPH 5E2UL 4UDUB 4XC3L 6FABL 4RGOL 5FYLD 2BRRH 5DYOA 4IRZL 2GI7A 4QT5A 4KI1A 2VXTH 4WGVB 3QDJD 4JRYA 2ED7A 5M95B 2GJJA 3D85A 4M6NL 1AY1L 3QQNA 4G6JL 4ZPVA 2PYEE 2ZOKA 2Z8VC 4LVHB 2IAMB 2PTUA 4QXTA 5TE7L 5SWQA 1CXIA 4M9OA 4GRLB 1Q9LA 3C6SA 2GT9A 4Z7WE 4BSVB 4ZUUA 3H3BC 3TT1L 1FZKB 2NY4C 4EKXA 4Y19E 5HGBB 2BY3A 4OF3A 4XNYL 1X5YA 4HK0B 3BD3A 1IRAY 3OKDB 4PGDA 4U3HA 4NQCA 3PHQB 4MCYB 4UI2A 2NXYB 1NMBH 4C55A 1J1XH 1N3NA 3FB8A 1BF2A 2DM7A 2H6PA 4JFOB 3I2CH 1FG2B 3H7BB 3HE7A 1JNLL 5TH2B 5HHVH 5DJ0B 2R69L 5DHVH 5HVHB 4LAQL 2EC9T 3GSVB 3MUZ1 3IT8D 3B9VA 2AXGA 3AU1B 4NO3B 1I7TA 5D1QB 1ZLUK 3GZKA 4X4ZA 3PP3K 5DRNA 5ALBL 1GC1C 4J7RA 5IB2B 1S9XB 1DP0A 3GSNH 4OZ4A 2RFXA 2FO4A 1S7QB 2FLBT 3ARBD 1A1OA 3BUTA 4OLVH 2MFNA 3WJLC 4EJ1C 1I9JL 3A6CH 3MRRB 2JCCF 2FNBA 2GUOB 4FQCH 1I1YB 3JUYA 3IXAB 4KROC 3KPSB 3VXQA 3UZEA 2ADIB 1G7MA 3G6JA 4HKXB 4PJIF 3FB5B 5GRVL 1DL7H 4C83A 3QEHA 4JVUA 4N0RA 2RAMA 4Y16C 5HGAB 1N0XH 4C59B 4ZS7H 4YEEA 3MRKA 4Z8FL 4GAJL 1CICB 1NUDA 2P24B 2EYTB 2HG5A 3KPLB 2P42B 4NZTL 5JPNB 2MKLC 2E6PA 4OUOA 1TQCB 2J5LB 1BP3B 4L1DA 3BP7A 5D7SL 2AI0H 4WW1B 2V9TA 1QLEH 3U46B 4PLKC 1HWHB 3L3KA 4YAQB 2IALB 1T80A 5CMAA 1Z9OA 3QIBA 4M43H 1F97A 1FVEB 3D2UA 4NJ9H 2NY6C 2ID5A 3UO1H 1BIHA 5C6TH 3PQYB 2NTSP 4U2ZA 2D7QA 5HHNB 2YWYA 3CCHB 4HKZB 5L2KA 3WHXA 2JCCE 2YEZB 4OCLC 5SWZB 1RMFL 4K23L 3TV3L 4L29A 3BRDA 4K9EH 3AM8A 4X7SL 4PJIE 2IBZX 5I1AA 2DMKA 4KTDH 4U31A 5D7JB 4D9RD 5LG1A 5HHOE 5CSZA 4ZUWB 3PL6B 2J8HA 4TRPH 5C0FB 2K9UA 2KZWA 5D8JL 5HPMB 3RBGA 5LAXB 4C56E 5ADPH 2YMXL 3MR9A 2V5MA 5C09B 1JPTL 4RA0C 5EZJB 1ERNA 4KUZL 2EE3A 4MXWL 5C0IB 1P2CA 3WXWL 3L9RA 2PETA 1DANU 2FJGB 4LEXL 3QEUB 2A1WH 3CVHL 3BKCL 2CRMA 4IOIA 4XVJH 3OG6B 4P5TB 5J57B 1O7VA 3KYKL 2CR6A 4D9LL 1NC4A 3DMMD 1WF5A 2O5XL 1UJ3A 1MREH 4N68A 2W59A 5MERB 1R3HA 3T2NL 3GB7A 4U1NB 4NO0D 4JQVC 3MROA 2UY7A 3S88H 4X6DF 3EDJA 5IB3A 5H35A 5IFAL 4OFDA 1A6ZA 3B4NA 3V5HA 3VFSB 5C6PB 2DQGH 1DBKH 4Z5RA 3RNKB 3MRJB 4FQHB 3EHBD 3KHQA 5FCUL 4GRMA 1Q9KB 3W9DA 1IKNC 3RJDA 3GHBH 4PJ9B 4J6RL 3DX7A 3V52L 3B9EA 3OXRA 4LCCA 3HTLX 5HGHA 1CD1A 2DS4A 1AO7E 4JHAL 3RPIB 3ARDD 5BO1H 1N5AB 1BAFL 1KJ3L 5DLMH 3CMOL 1E4WL 3QSKB 4LLUB 3KPRD 2X4UA 3B8YA 4HD9A 3TM6A 4R26L 3JWDH 3QUYD 5C71A 2BERA 2CR3A 3TPUB 4JFQA 2VXUL 3OJDB 3C2AL 4X6DE 1YECL 3LN5A 3WO3B 4HCRH 3WV0A 3S96B 3T0EA 4UILH 4RDQF 4KMTL 3LS4H 4TSCH 4P3CL 5E9DB 3MJ9H 3ARUA 1SYSA 1AD0A 2Z8WC 3SE4C 5B21A 1XR8B 1R5WB 3OJ2C 4X4XA 1EEZA 1PAMA 2ADFL 3C09B 1WBZA 4UV4H 1XCTA 2F54B 2H2PD 4PRPE 1X4ZA 4XPBH 1I1CA 2VE6A 4K3HA 4YWGH 3SKJH 5D6DC 2OTWB 5EZIL 2OLDA 4WTZG 1SBSL 5I1CL 2FZ3B 4MJIA 3HZVB 1N8ZB 4XCFL 5H37G 4K94C 4MD5B 1MHCA 4X6BB 3TBTA 4NNXB 4Z0XA 5CKGA 4L5FL 3QXTA 5CEZH 1AGBA 2DLIA 3QG6B 4YBLB 4I0PD 5BQ7A 1UZ8B 1A4JA 2IC2A 4Z7UA 3LSOA 4CGTA 2VKXA