3GS2A

Ring1b c-terminal domain/cbx7 cbox complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
111
structure length
109
Chain Sequence
b'ASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTEKQYTIYIATASGQFTVLDGSFSLELVSEKYWKVNKPMELYYAPTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase RING2
publication title Polycomb Group Targeting through Different Binding Partners of RING1B C-Terminal Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 29
structure length 109
sequence length 111
chains with identical sequence C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2009-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16207 RAWUL RAWUL domain RING finger- and WD40-associated ubiquitin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.430 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3gs2A00
3H8HA 3GS2A 3IXSA
chains in the Genus database with same CATH superfamily
3AE4B 2INCC 2KXJA 1XLQA 3MC9A 3H7PB 1WYWB 4KGRA 2IO1B 2K25A 1RFKA 2DZKA 3BK1A 2QILA 3VTWA 3PT2B 5LNK1 4ZYSA 4TUUA 2ZPNA 1NI2A 4P7IA 1CJEA 1IP9A 2N1WA 4ZRJA 1YOVB 2M8SA 4DBGA 4PYUA 2GLSA 3KQ4A 2M1MA 4HCNB 2MEKA 4BBNC 2MHJA 1UGMA 4W9FA 2UU7A 3GE8C 3VH4B 2AWTA 2NPTA 3ZVVA 1I4PA 1TZ1A 4YT0B 4CQNA 1T3QA 2KC2A 3RT3B 3AB5A 1SJHD 4C00A 3PZ7A 3MC0B 2CHZA 1N62A 3B9JA 4G11A 2I1JA 4W9IA 3A9JA 5D3DA 4UDUC 3AEBB 2DNFA 1WM2A 2N4FA 4KV2A 2ZEQA 2D3GA 3E9SA 2IPKD 1SE4A 4AOFA 1UNSA 2WXFA 4YTPB 3PHWB 1ZXIA 2Z0EB 2K6QA 4J6IA 5BYQA 2QHOA 2DYOA 3B2GA 2N7EA 3PS6A 1P1AA 2C5LC 2WX0A 2C7HA 4R3DA 4JX1C 4W9LA 1L0XB 5GXGB 4NY0A 1JWMD 2JWZA 4LNOA 3RNBC 1TY0A 1V2YA 1IPGA 2EKEC 4WWOA 1STEA 1J7CA 2JQRB 1OQRA 2KDFB 1WSPA 4B6WA 5C23A 4D2KA 1WWTA 2LZ6A 4HCPB 3DVGY 4WH4A 4WAFA 5JHAA 4Q2JA 3DWMA 2K8HA 1TY2A 3W9CB 4MSQB 4ZRQA 1KF6B 3IFWB 3VTUA 4HK2A 1WGYA 2J52A 4KZCA 1M94A 3RD2A 2WDRB 1XLPA 4DK5A 2BTEA 1K51A 1MHHE 1PQSA 4IWQA 2M56B 3Q69A 2PJHA 3RZWC 2L3ZA 4GXBA 1MVKA 5BMIA 1JWSD 3ZNID 1YQ3B 4LDTD 2KMMA 3ZO5B 2JVCA 2V1YA 2RMMA 2WXGA 2G3QB 2WXRA 4OHJA 4MM3A 1NVID 2CHXA 3VH3B 2KJHB 3U7ZA 4A55A 3OJ3A 3KVFB 3RNFC 2RR9A 3P42A 4BBNF 2KHWB 3DBSA 5G5GA 4MGYE 2KFKA 2HJ8A 3A4SC 3ZDMC 3RNAC 3IHPC 4YTNB 2ZW0A 1B1ZA 2LRWA 3QK0A 2WXMA 3I63C 4KGTA 1UBQA 3VVWB 1WMHA 4KGSA 4RF0A 5CTRC 1CK1A 2XBBC 3DDCB 1FXAA 1ZE3D 2NBWB 1HZ5A 2GBJA 3ZNHB 1FD6A 5LXHA 3AE6B 2GBRA 3TEYA 1E8XA 2MSED 3VFKA 2KC1A 2LHEA 1KFYB 1L0VB 4C4VB 2D2QA 4A3PA 3ZYYX 3HVZA 4I6NB 2O6VA 2Z8LA 5H92C 3VXWA 2NR2A 1CZPA 3K9PB 3ZGZA 3ZJVA 2V9HA 1XCQL 1MG4A 2CKHB 4N6EB 2XEWA 2WLBA 4N59A 4LNKA 4YSXB 4IM0A 4US9A 4FA6A 1Q10A 3LJ3A 1ZXHA 2AYOB 2C7NB 2ZVOA 3H8HA 4LK0M 2AQ2B 2FAZA 2BS3B 4TQ0A 4FN2A 3R3MA 2HTHA 1EWCA 1ZDVA 4LDTB 3KYDD 3CSFA 2ACZB 2BBCA 3V6CB 2RDGA 1TIFA 2C7MB 4E3CA 1V81A 1JRUA 2W3SA 4RM9A 2KQ7A 2N7JA 2W3RA 2PTLA 3W1SC 4XWWA 3BIID 4WJNA 2YLMA 1JCKB 1WM3A 3P2BA 3RN9C 3O65B 4XDCA 4HRSA 2KK8A 2MBHA 2YVCA 2N9PC 3QWZB 3VUYA 4DDID 3JSVA 4EE2A 1I42A 5AZHA 3H6NA 5D7GA 3TIXA 5IKCM 2FIFA 2XN9C 5DPRA 4DHJD 3V62A 2WWZA 1WX9A 4GLSC 4PS8A 3QIJA 3L4PA 2JPHA 2M0AA 3V3XA 1C77A 5FR6A 4ARCA 4G50A 3I5JC 3Q3MC 1V49A 1JWAD 3NZ3A 2WXKA 2MBOA 1LFDA 1D5ZC 2PIAA 3ZRFA 4DWFA 1R4MB 2JZPA 1FPYA 2JZ3B 3A1QA 1U4AA 2D07B 1MI0A 4XZ4A 2FCQA 3RNGC 3EA6A 3PV1A 3L54A 2BVCA 3UQBA 2Y3AA 3MC8A 4KKJA 1S3SG 1V1PA 4JGHB 2ZCBA 4XX5A 5FKAC 1NDDA 5CHVC 1EO6A 2BYEA 4RFBA 2BB6A 1OEYA 1J7BA 1WJ4A 2AEHA 2BS2B 2DAJA 3HK0A 3NS8A 3NZSA 3V61A 2I1KA 5BYSA 4A3OA 1WZ0A 2NPTB 1C78A 2RPQA 1YX5B 2I2YA 1QZEA 4RM8A 2WXIA 2BGFA 3X0WA 4YL8A 4FHJA 3RNCC 1KOTA 3VRBB 3MJ5A 1IBXA 4W9KA 3L10B 1F1HA 1TJEA 3FILA 3LDZE 2AL6A 4BOZB 1FXIA 4ANUA 3EFCA 2DZIA 4YXDB 1L5PA 1C4CA 3E56A 4GOCA 2PVGC 3IAS1 4URKA 2KYWA 3RI7C 1FMAD 1UBIA 2RDBC 3TL5A 3DBLI 4NJCA 1T5XD 2JWUA 2G4DB 1E5WA 4USAA 4FADA 1IUEA 3N1YC 2BS4B 4WJOA 3ZKJC 4RGNA 1WR6E 1WXVA 1GG3A 4RGMA 5G55A 2KKCA 4O1NA 2O6VD 1BUIC 1VDVA 4XGAB 1DOIA 4ZOHC 4FJVB 4FULA 3ZXRA 3NY5A 2PPHA 1FNWA 2LRUA 3ZLZA 1ROEA 4M8NA 3H7SA 1AARA 4A20A 1GC7A 1R4NB 2L76A 2M19A 2KTRA 1VR9A 2VH2A 3QHTA 4JE3B 1I4GA 2OEDA 4AUQC 2IY1B 2QCZA 2FBWB 2EMTA 3Q3FA 3HVDA 1TKEA 3DBRI 5LLIA 3DBLB 1ZKHA 2HD5B 1WRDB 4GMVA 1TTNA 3PRZA 3WAPA 2JX5A 3L08A 5J17A 4C7ZA 3U7DA 1ZOYB 1KH0A 3RNEC 3P4SB 1ACCA 3WALA 2KLCA 2NCNA 3SFEB 1SIJA 3V05A 1A5RA 4L2YA 4JPSA 4OVUA 2GOWA 4F1SA 2NBVB 1WX7A 4NQKE 3QAQA 2Z0DB 1Q5WB 4EUTA 2L7RA 4XWTA 2KFKB 2R2OA 3ZQ4A 1I4HA 4KIKA 1WE6A 1FRRA 2DYMA 4K7UA 2CS4A 1TS3A 5D94A 3R7QA 1WMHB 1DYQA 5D6JB 2LUEA 3NVVA 4K7WA 4IOIE 2AL3A 2V3SA 1V9JA 3DBRB 4DXAB 3VR9B 3HRDD 1WR1A 2MX2A 3C19A 1XF5L 2PVOD 1C76A 2O6VB 3W5UB 1E0ZA 2K1FA 3ECIA 4KX6B 1ET9A 2WU5B 2KWDA 2NVUI 3WCQA 4KKIA 3MFGA 4F8CB 4C56C 3WIMA 3UGBB 1N61A 4GB9A 4EZJA 2KWCA 3RULA 2WYQA 3ALBA 3MJWA 3A9KA 3V60A 3MHZA 2KDBA 3TUOA 2BT6A 2K0PA 3IG3A 4XE0A 1FFUA 2FUG1 1J19A 4ZYNA 1F2RC 3NRZA 1D4BA 4B95A 1YMHE 1Z2MA 3IT6B 4NAMA 3X23A 3U4EG 4HPPA 3QJZA 3AEGB 4L1BA 4WQOB 1YIWA 3FAHA 3HHMA 5JXVA 4I6PA 1ENFA 2MLBA 2Q5WD 4JWUC 1PGAA 1FO4A 2KDIA 3PZDA 2KN4A 2ASQA 1P98A 1WXAA 3SDLC 1R7SA 4HKZE 2CJNA 1QILA 2ZVNA 3T3OA 3JSVB 2DBYA 4BKTA 4MACA 1HE8A 2QMTA 3W1YA 4NJ7A 1K50A 1I35A 1E8ZA 3NOBA 2LJIA 1WXMA 4L23A 2JXTA 4YSZB 1NBFC 4S17A 3AULA 3A1QB 1A70A 2H88B 2WXNA 3Q8BA 1GB4A 2Z59B 5DPTA 1EU4A 4MEMA 4IW0A 3CSTA 2GBNA 1SEBD 2OOBB 3GS2A 1GC6A 1V1PB 2JT4B 3MP9A 2NBUA 5AUKA 2M4NA 2ZNVB 2IY0B 4RMAA 5CHFA 2JRIB 1HTOA 2EMSA 1H8CA 1SB3C 4HPMB 3RPFC 1E8YA 1XLOA 2GI9A 2ONQA 4HDQA 5J2RA 3WANA 3RCZA 1SGHA 1IBXB 5J18A 1EWYC 4LJOB 3FILB 3IT4B 3Q8FA 3GOEA 1E8WA 2KQ4X 2BF8B 2GMIC 4OZCA 2WS3B 1ISNA 1AW7A 1TBEA 1YN3A 2L1AA 2PKOA 1SSNA 2PE9A 1QOAA 1WRIA 3I3TB 3N9YC 1F0ZA 1NYQA 2WGSA 3AE7B 3MTNB 4G3XB 3RFZB 3PLVA 3ETRA 4IM2A 3VR8B 2K5PA 2K8CA 2V3PA 3L17A 2MRPA 2W9NA 3L13A 5LXIB 3Q3JA 2W54A 1SIFA 1GB1A 1I4XA 3BZDB 1P7EA 2JRHA 2FCNA 4HDOA 2WDVB 4N9F4 2QIEB 3DHGC 5HI1A 2QSDA 2J42A 1GJZA 1BT0A 4MH8A 2IO0B 3AXCA 1WGHA 2CHWA 2DYBA 2LUMA 2KTRB 3QC8B 3AECB 2DZJA 3DOWA 2MJEA 3AN1A 4HXDA 3HM6X 4W9GA 3TJPA 4IC7B 3AEEB 2WDTB 4US8A 3O13A 2X38A 3APFA 3FC4A 5HKHA 3NJTA 4NQLB 2IDYA 5D3IB 5FR3A 4FLHA 1UD7A 2MWSB 1YJ1A 4ZHOA 3PTFC 2WXQA 2MH7A 3TEXA 2REXA 3R7RA 2KZRA 5IN7A 2RSUA 3B0AA 4ASWC 2K9XA 4MGIE 2RPVA 5G2NA 4J3OD 4GDKA 3VRAB 3ZTCA 1VJKA 1CQVA 3L16A 4B9KA 4KIKB 4BVUC 3EUB2 2G9HD 2HJ1A 5I4DA 1OFFA 1IGDA 2GBKA 3RUIB 4GGQA 1Q1OA 1YN4A 2ICIA 3A33B 2GBMA 5IAAC 3AE1B 2PW9A 2K22A 2NTSA 3PVLA 2JY6A 4PS7A 2IGGA 3APCA 2L8JA 1Q0WB 4HKQA 3HM3A 1JRPA 4G0NB 2K6DB 3HIZA 3ZNGC 1XD3B 1GNUA 2MJ3A 4TQ1A 4II2B 2KD0A 3IVFA 1SE9A 4ICVA 1LGRA 1WI0A 1UELA 5H8YE 4NNJB 4MJSA 2KAJA 1L2NA 3A9KB 3VDZA 3UIPB 1Y56A 2EELA 1G6JA 2KWVB 1P9DU 2OJRA 2LFIA 1ZPSA 3ZUNA 1N63A 1T0YA 3Q3OC 3AE8B 2HTME 4ITKA 1MHXA 3ZNZB 1C4AA 3RMKC 1WIAA 1N60A 1NEKB 2N1VA 2LJ5A 3B1LX 3WAMA 3DWGC 5TR5A 1RAXA 1T0RC 1VRAB 1LO5D 4K3CA 4K3BA 3ML8A 3U8ZA 2WHIA 4MSMB 1DOYA 3AE9B 1KTKA 1WFYA 1GOZA 3SU8X 4E74A 1L4ZB 2BWES 3P4RB 2DHZA 3KW5B 2Y5BB 2XK5A 3OG5A 1YNTE 3QCAA 5BMHA 3NHEB 1F2RI 1XXGA 3H9DA 2LXAA 3N20C 3U2SC 1GAQB 5T8IA 4OW0A 4ANXA 1IGCA 2BKRB 2AX5A 4W9DA 2BPSA 5BMGA 1OQQA 2WNMA 3KUZA 4RNAA 1V6EA 1YX6B 4CO7A 3URYA 2LGSA 2C9WB 3DCGA 2IGHA 1VZ8A 4II3B 3W1SA 4EZKA 4P6VF 4TKNA 4TMAB 5BYRA 4M01A 3AEFB 5C3JB 5C1ZA 3QX1A 3DVNU 4DXFA 3ML9A 2FNJB 1F52A 3MHSD 3PRMB 4ZRKA 2OHFA 3CWIA 1FNVA 3M95A 4RF1A 2QC8A 3W5VB 1JROA 1K52A 1ZW7A 4K1RB 3JYUA 3NS1A 2KDMA 4BKSD 4DHJB 3UQAA 2CJOA 4IG7B 2BKFA 1VZ6A 2KDEB 1WF9A 3AM9A 4MELA 1AWDA 3D32A 4DHZB 5JZEB 1QKZA 1FCCC 3H1UA 2J4XA 4XC2A 1L4DB 1WJUA 4RH6A 4ARIA 2D5GA 4HJKA 2KANA 4NZLB 5JH5C 2J0JA 1M4VA 3AMZA 3IBEA 3KWVA 3W2DA 4WAAA 1LQBA 3GZNI 2D10A 4HJGE 2PE6B 3ZTDA 2BW2A 1SF0A 2V4LA 4IWPA 5D2MB 4A90A 2KWUB 1FCLA 3GB1A 3T3NA 3ZIMA 1FM0D 3PSEB 3PRPB 1WE7A 3OJ4B 1MPEA 3NZUA 1TYGB 2LHDA 5AEKB 3IXSA 1NYRA 3DPDA 2D3CA 1I7HA 1C79A 2A4ZA 3NVWA 4YWGG 1V86A 2DZMA 5EDSA 3VQIA 2IBIB 4GDLA 3BYTB 1WY8A 1EU3A 1TS2A 4WWMA 1RWSA 1XO3A 5E6NA 2SEBD 4JQWC 3P1MA 2KMCA 1HXYD 4LLGM 2K8BA 2LASA 4WWPA 3AE3B 1WGGA 4KSLC 2BYFA 2JYEA 2UWQA 3R66C 3HUIA 2K3UA 2MW5A 3DQVA 3APDA 2KTFA 4YTMB 2DWQA 4A9AA 2AQ3B 2WX1A 2G4SA 1ESFA 1HA5A 1JMLA 2RD0A 3AV8A 1QLBB 3UINB 2PEAA 2L00B 3SR6A 4MT5A 1ET6A 4JLCA 3CF6E 2V4IB 1I4QA 3R2TA 2JXXA 4DHZE 3KLSX 4ZRPA 1JWBD 1EM7A 4I6LB 2QJLA 4YSYB 4AQ7A 3PLUA 1YQ4B 4NJ6A 5IP4D 1K8RB 3I9V1 3LB8C 3LXFA 3Q2AC 1ZUD2 2ZZPB 4GDKB 4M8MA 1UWMA 2PMVA 3QQ8B 3M62B 3N30A 5E6JA 1QT9A 3U30A 2WQYB 4P1BC 2X8XX 4K7SA 2OJWA 2L0FA 2ZW1A 2HE7A 2BYTA 2MP2A 3N1XC 2Y5CA 4W9CA 4HVBA 1JWUD 1ZP0B 3DHHC 4A6QA 1V5OA 2IO3B 2KQSA 3LYYA 1K53A 2MJDA 4LJPB 2LD9A 2WDQB 4WJPA 1FFVA 1WGDA 2WXHA 2N0SB 2FUHB 1QOGA 3JVZX 1VZ7A 3Q6BA 1P7FA 2J53A 2YEPF 1TS5A 2WXJA 3SD5A 4MJSB 2LGYA 3N1ZC 4E71A 4W9HA 4NPNA 3AU4A 2O2VA 2MCNB 5TSSA 1MFWA 1LM8B 4AWJA 2R61A 3WAOA 4LNIA 3EFUA 3VTVA 4F7ZA 1V80A 1WH3A 1DOXA 1Z5SB 1TS4A 1SXTA 1AN8A 3C0RB 3P63A 4FBJB 3SHQA 2VRRB 2L05A 4HLEA 1PGXA 2NS5A 1GPXA 2XK5B 2KT7A 2MQJA 4FJYA 2IO2B 3BYYB 5AZFA 3BVZA 1EF1A 4EEWA 1E7VA 1WYGA 4GN1A 4ZHPA 2G45B 2ZPYA 4WURA 1TT5B 1UUPA 3EGRA 1L7YA 3Q14C 4ZRIA 1XEEA 5EE0A 4S0RA 5C2TB 1OGWA 1ZDXA 3AI5A 1MJDA 3CIRB 3N32A 1Y8RC 2K39A 3BY4B 1E90A 5EE1A 3KWLA 4N58A 2H89B 3KUDB 3TSSA 1RLFA 4WQMA 2LVQA 2D3AA 1UZXB 3DBHI 4KZ0A 2LI5A 3L0WB 1C1YB 5G5HA 2LGXA 4PK1A 2E3TA 3AEDB 3Q3NC 2PLPA 1L0YB 2KOXA 3TMPB 2BB5A 4GSWA 5KHOA 4W9JA 4DDGD 3SEBA 5L95C 2INPE 4KDIC 1AYFA 2D11A 1RFAA 1T6BX 3AE5B 4A8XC 4CHKA 1VLBA 3Q8AA 4X57B 1FXTB 2E6XA 2Y5PA 1FRDA 2L52A 1WXSA 2ZCCA 1KJTA 4CYEA 1J8CA 3U52E 2R2QA 3EECA 1HEZE 4JIOU 4KVGB 3SFDB 2LMCA 1WGKA 4MDKE 3DBHB 3VUXA 1QF6A 1XT9B 2WP9B 4BKSA 1I4RA 2A5UA 4BKGA 1XCTL 2N9EB 2RGFA 2N7DA 5L83A 1TZOA 1TKYA 4JL9A 1B9RA 3ZJUA 2KFJA 2KO3A 2LEKA 1SBBB 1MG8A 4NAWA 2ZJDA 3P4QB 5GMVA 4LCDE 4RGOS 4REZA 3BVMA 4GDLB 2B3AA 4FHKA 3PPAA 2KX0A 1OTRB 1QOFA 4HWIB 3BVGA 4M0WA 1HTQA 4MH0E 4DXGA 1VD2A 1J7AA 1E10A 1P3QU 3AEAB 1KLVA 4IKGA 2LGDA 3IAM1 3ZXVA 4BOSC 1N5XA 3NVYA 3OAWA 1H4RA 4HPLB 2M17A 2J0MA 3GE3C 3ZJTA 1N5WA 3NG0A 2D3BA 1HQRD 2BYVE 2DENB 2NMQA 1RYJA 2ZNVC 1JQ4A 3ABVB 2HDEA 3KUCB 4HEA1 1PGBA 1T0QC 1R4MI 3PZ8A 4ICUA 5IO9A 3AE2B 4LNFA 2JF5A 1UH6A 3H7PA 1YJIA 2KJRA 1V97A 2JSVX 1CMXB 2MBBB 3WA0A 1S1QB 5MPOA 3P4PB 5AZGA 1E7UA 2QDFA 5CX3A 2L0TA 4WWNA 2J0KA 2YEPB 3CMMB 1WJNA 3M3JA 4ANWA 4EZLA 3Q8EA 1XQQA 1XLNA 1WGRA 4AP4C 1BXTA 2KX3A 2JUOA 3GP7A 1WJ6A 1EUVB 2IGDA 1L6UA 2MP2B 2KVZA 1PYWD 1V5TA 3TCAA 2I38A 5JHBA 4MGZE 3EHVA 4P16A 1FEHA 1RRBA 2L32A 1GUAB 3B2FA 5EE9A 2INNE 5EE3A 4BFRA 2WXLA 1UWXA 2KLGA 3RYTA 4IDIA 1UF0A 1D5MC 2AQ1B 4IWOA 5HHDG 3PHXB 1NENB 3NUHB 3EC8A 3B08A 3OLMD 4P1CC 2MBEA 2FCMA 5AUIA 2O2VB 2KJ6A 4XYCA 1VCBA 2TSSA 2JYTA 1HZ6A 2DAFA 4TSSA 2FCSA 5BO4B 2IYDB 4RCOA 2UYZB 3DVNV 3R2IA 3UI3A 1C4PA 4LNNA 2N9KA 1YQBA 1E6EB 5IA7A 3RZFA 1C3TA 4AS1A 4AJWA 2KMAA 4ANVA 3ENEA 3PGEA 3BWUD 2V3NA 4IM3A 1FNUA 2QEJC 1YN5A 3K9OB 1SE3A 3J9CA 2KACA 1WXQA 1KLGD 2VZKD 3ONSA 3TEWA 2FIDA 4DQOC 3PO0A 1R4NI 3A9JB 2BQQA 3JW0X 1WZ3A 2EKIA 2W82A 1SJED 2MA9B 1QQRA 3ZW3A 1D3ZA 4M02A 2GRIA 3ZRCA 1F77A 4K81A 1JW9D 2WXPA 1L6VA 3N3KB 3DHIC 5DPSA 4WIPA 2CU1A 3BK2A 1V1OA 2KNBA 4PT5A 1WX8A 3AU5A 1TKGA 2ON8A 5DPWA 3VUWA 1E9MA 4KDLB 4EOYA 3UF8A 5E6OA 4OZAA 4B0EA 3T9LA 4EKUA 4W9EA 2IZVB 2LVOA 3R8BA 5HFYA 2DLBA 1F9JA 4PS3A 4FXCA 4MGKE 2V0GA 2W55A 4EFOA 1ZGUB 4QAYA 3C8YA 3BINA 1X1MA 2DX5B 3NVZA 3PREA 4GIVA 2LGIA 2M0XA 2KVRA 1KRHA 4TV3A 2G1EA 5KHQA 2CU3A 1IYFA 2VH1A 2LVPA 1E7PB 1BMLC 3S2AA 3VHTC 4KSKC 2IJ0A 1YD8U 1PUTA 4JWSC 4LTUA 1TGZB 2N9LA 2XNAC 4C4VA 2INDC 4FJZA 3ZDTA 5E6PA 4MM3B 3UIOB 4OVVA 2VZKB 2JU6X 3GZNB 3TBLD 1JALA 5FK9C 2KN5A 4M00A 3QARA 1OQYA 2RDHA 1NI3A 1T0SC 4H2AA 4GU2A 3TEZA 1YJJA 4OZBA 1RM6C 1KLUD 1OEYJ 4RGTA 3OWEB 4ACFA 2L83A 4NAWB 5IOIA 3KYCD 2LXCA 5DCNA 1P0RA 3A4RA 1D5XC 2WU2B 1EF5A 4XDDA 2J7QB 4B0MA 2B76B 4M0WB 1PFDA 2JZZA 1N6ZA 3QA8A 1V8CA 3Q8CA 2WXOA 4AJYB 4HROA 2SAKA 1KM7A 3I57A 4BZAA 5HG2A 3M63B 4C7YA 3DVGX 3KH0A 4OVZA 4PYZA 1PDXA 1LXDA 1D6EC 4BAXA 3T8MA 2MBQA 4ZDVA 2FE8A 3VAWA 2N9XA 5CHWA 1DGJA 2GB1A 1UGJA 1J0GA 1QOBA 2C60A 1FIQA 1C9FA 2NTTA 3AH7A 4C80A 2BWFA 3V6EB 2LWPA 4WJQA 2CR5A 1SE2A 3FKYA 4IUMB
chains in the Genus database with same CATH topology
2INPE 1Y56A 2EELA 1ROEA 3AE4B 1AYFA 1T6BX 1XLQA 2LFIA 1ZPSA 1N63A 3AE8B 4KGRA 3AE5B 4A8XC 2HTME 4ITKA 1RFKA 1VLBA 1MHXA 2M19A 1C4AA 3Q8AA 3BK1A 2QILA 1N60A 1VR9A 1NEKB 4JE3B 1I4GA 2E6XA 2Y5PA 2OEDA 4ZYSA 5LNK1 1FRDA 2L52A 3DWGC 1VRAB 1LO5D 2FBWB 1CJEA 3U52E 3HVDA 1TKEA 1DOYA 1HEZE 3SFDB 3AE9B 1KTKA 1GOZA 2LMCA 1L4ZB 1WGKA 3KQ4A 2MEKA 1QF6A 2JX5A 4C7ZA 2WP9B 1ZOYB 1KH0A 3P4RB 1I4RA 3P4SB 1XCTL 1ACCA 3SFEB 1SIJA 3V05A 1YNTE 1TZOA 5BMHA 4L2YA 1TKYA 4JPSA 1I4PA 1F2RI 1XXGA 1B9RA 4YT0B 3ZJUA 4CQNA 1T3QA 2LEKA 1SBBB 3AB5A 1SJHD 3U2SC 1GAQB 3P4QB 3PZ7A 3MC0B 4RGOS 4XWTA 5T8IA 4REZA 1N62A 3B9JA 3BVMA 4OW0A 3ZQ4A 1I4HA 1IGCA 4GDLB 2AX5A 1FRRA 2DYMA 5BMGA 1OQQA 2WNMA 5D3DA 4UDUC 3AEBB 4RNAA 1TS3A 1QOFA 3URYA 3BVGA 4M0WA 1DYQA 2IGHA 1VZ8A 3W1SA 4DXGA 3E9SA 2IPKD 4P6VF 1SE4A 3NVVA 1J7AA 4TMAB 1UNSA 2WXFA 4YTPB 1E10A 5BYRA 3AEAB 1ZXIA 4IOIE 5C3JB 3AEFB 4IKGA 5BYQA 3VR9B 3HRDD 2DYOA 3B2GA 3IAM1 1N5XA 3NVYA 4DXFA 4R3DA 1XF5L 2PVOD 1C76A 3W5UB 1E0ZA 4JX1C 2OHFA 3CWIA 1FNVA 4RF1A 3ZJTA 1L0XB 3W5VB 4KX6B 1ET9A 5GXGB 1N5WA 2WU5B 1JROA 1JWMD 1K52A 2NMQA 1HQRD 3NS1A 2KDMA 2KWDA 1RYJA 1TY0A 3WCQA 4KKIA 1STEA 1JQ4A 3MFGA 1J7CA 2JQRB 1OQRA 1WSPA 3ABVB 2HDEA 4C56C 2CJOA 4D2KA 1WWTA 4HEA1 1PGBA 1N61A 4WH4A 1VZ6A 4WAFA 3AM9A 1AWDA 3PZ8A 1QKZA 3MHZA 4Q2JA 1FCCC 3DWMA 2J4XA 3AE2B 3TUOA 1TY2A 2BT6A 3W9CB 1L4DB 2K0PA 1YJIA 4ZRQA 1V97A 2JSVX 4RH6A 1KF6B 4ARIA 2D5GA 4XE0A 2J52A 1FFUA 2FUG1 5MPOA 1F2RC 3NRZA 2WDRB 1XLPA 4NZLB 2BTEA 3P4PB 1K51A 1M4VA 1D4BA 1MHHE 3AMZA 1YMHE 3KWVA 3IT6B 2YEPB 4NAMA 3W2DA 2M56B 3Q69A 3Q8EA 4HJGE 1MVKA 5BMIA 3U4EG 1XLNA 2BW2A 3AEGB 1SF0A 4L1BA 1JWSD 1BXTA 1YQ3B 3FAHA 3GP7A 2KMMA 4A90A 2IGDA 1L6UA 5JXVA 1ENFA 1FCLA 2RMMA 2WXGA 3GB1A 3T3NA 1PYWD 2Q5WD 2I38A 1PGAA 1FM0D 4JWUC 2WXRA 4OHJA 1FO4A 1NVID 2KN4A 4P16A 1FEHA 2L32A 1R7SA 3B2FA 1MPEA 4HKZE 5EE9A 1TYGB 1QILA 2CJNA 2INNE 2LHDA 5EE3A 3T3OA 3U7ZA 3IXSA 2DBYA 2WXLA 1UWXA 1NYRA 4A55A 1I7HA 3P42A 4MACA 4IDIA 5G5GA 2QMTA 1C79A 3NVWA 1D5MC 2AQ1B 1K50A 4YWGG 3VQIA 4YTNB 3BYTB 2ZW0A 1EU3A 1B1ZA 2LJIA 1TS2A 2WXMA 4KGTA 5HHDG 4KGSA 4WWMA 1RWSA 4RF0A 1CK1A 1XO3A 1FXAA 4L23A 2JXTA 1NENB 1ZE3D 3NUHB 1HZ5A 2SEBD 4YSZB 5AUIA 3P1MA 1FD6A 1A70A 2H88B 2WXNA 3Q8BA 1GB4A 3AE6B 2TSSA 2JYTA 3TEYA 1EU4A 1HZ6A 4TSSA 1HXYD 4LLGM 4RCOA 1SEBD 2LHEA 1KFYB 3AE3B 1L0VB 3GS2A 3R2IA 3UI3A 3ZYYX 1C4PA 2JYEA 2N9KA 3HVZA 1E6EB 3HUIA 4AS1A 2K3UA 1V1PB 2Z8LA 5H92C 4YTMB 2DWQA 3MP9A 3BWUD 5AUKA 2AQ3B 4A9AA 2V3NA 1CZPA 3ZGZA 1ESFA 3ZJVA 1FNUA 2QEJC 1XCQL 1YN5A 1HA5A 1JMLA 3AV8A 1QLBB 1SE3A 2KACA 3J9CA 1WXQA 3SR6A 4MT5A 1ET6A 1KLGD 2VZKD 1SB3C 3TEWA 2V4IB 4N6EB 2WLBA 4N59A 4YSXB 1I4QA 3R2TA 4DQOC 3PO0A 3KLSX 4US9A 3RPFC 4ZRPA 1JWBD 1Q10A 1EM7A 1ZXHA 1XLOA 2GI9A 2QJLA 4YSYB 4AQ7A 2EKIA 1YQ4B 2ONQA 2W82A 1SJED 3H8HA 3I9V1 4LK0M 1QQRA 2AQ2B 1IBXB 3LB8C 2BS3B 3LXFA 4TQ0A 1ZUD2 1EWYC 4GDKB 2GRIA 1UWMA 2PMVA 1F77A 1EWCA 1ZDVA 3FILB 1JW9D 2WXPA 3IT4B 1L6VA 5E6JA 3Q8FA 1QT9A 2ACZB 4WIPA 3BK2A 2BBCA 2WQYB 2KQ4X 2RDGA 1V1OA 4OZCA 4PT5A 2ZW1A 2WS3B 1TKGA 2ON8A 2W3SA 1AW7A 2N7JA 1E9MA 2BYTA 1YN3A 2PTLA 2W3RA 2L1AA 2PKOA 4OZAA 4XWWA 4B0EA 3BIID 1SSNA 2Y5CA 1QOAA 1WRIA 3R8BA 5HFYA 1JWUD 3N9YC 1F0ZA 1NYQA 1JCKB 1ZP0B 2DLBA 3AE7B 3RFZB 4FXCA 4A6QA 3LYYA 1K53A 3ETRA 2MJDA 3VR8B 2K5PA 4HRSA 2WDQB 2V3PA 4XDCA 2V0GA 1FFVA 2WXHA 4EE2A 2W54A 2N0SB 1QOGA 1GB1A 1I4XA 1VZ7A 5D7GA 2W55A 3BZDB 1P7EA 1P7FA 2J53A 2XN9C 3C8YA 2WDVB 2YEPF 1TS5A 2QIEB 2WXJA 4GLSC 3L4PA 5HI1A 2M0AA 3V3XA 3NVZA 2QSDA 1C77A 2LGIA 2J42A 4ARCA 1JWAD 4MH8A 3NZ3A 1KRHA 2WXKA 2G1EA 1D5ZC 2CU3A 2PIAA 2JZPA 5TSSA 2LUMA 1E7PB 1BMLC 2IJ0A 1MI0A 2R61A 1PUTA 3AECB 2MJEA 4JWSC 3EA6A 3AN1A 4LTUA 2N9LA 2XNAC 1DOXA 2Y3AA 4KKJA 1V1PA 4MM3B 3AEEB 1TS4A 4US8A 1SXTA 3O13A 2X38A 3FC4A 1AN8A 2VZKB 5FKAC 2JU6X 4RFBA 2BB6A 3P63A 1JALA 1J7BA 2BS2B 5FK9C 5D3IB 2IDYA 5FR3A 5BYSA 1PGXA 2RDHA 4ZHOA 2I2YA 1C78A 1NI3A 1GPXA 2WXIA 2WXQA 4H2AA 2MH7A 3TEXA 3TEZA 1YJJA 4OZBA 1RM6C 3BYYB 3BVZA 1KLUD 1WYGA 4ZHPA 4RGTA 2K9XA 3OWEB 2RPVA 2L83A 4NAWB 3VRBB 3MJ5A 4J3OD 1IBXA 4WURA 1UUPA 3EGRA 3VRAB 1VJKA 1D5XC 1CQVA 2WU2B 1XEEA 1TJEA 3FILA 5EE0A 3EUB2 4XDDA 4B0MA 1FXIA 2B76B 1PFDA 2G9HD 5C2TB 4YXDB 1L5PA 1C4CA 1ZDXA 3E56A 1V8CA 3Q8CA 5I4DA 3CIRB 2PVGC 1OFFA 1IGDA 2WXOA 3IAS1 4HROA 2SAKA 1YN4A 2ICIA 3I57A 1FMAD 5HG2A 4C7YA 3AE1B 4OVZA 2PW9A 2K22A 2NTSA 4NJCA 5EE1A 3KWLA 1PDXA 2IGGA 4N58A 2H89B 1T5XD 3TSSA 4HKQA 2JWUA 4WQMA 4USAA 1D6EC 1IUEA 2BS4B 1JRPA 2FE8A 5G5HA 4RGNA 2MJ3A 4TQ1A 2E3TA 1DGJA 3AEDB 2GB1A 4RGMA 2PLPA 1L0YB 1UGJA 1QOBA 1FIQA 1C9FA 2NTTA 3AH7A 2BB5A 4O1NA 4C80A 1BUIC 1VDVA 5H8YE 1DOIA 4ZOHC 3SEBA 1SE2A 2KAJA 1FNWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H8H A;  3GS2 A;  3IXS A; 
#chains in the Genus database with same CATH topology
 3AE4 B;  2INC C;  2KXJ A;  1XLQ A;  3MC9 A;  3H7P B;  1WYW B;  4KGR A;  2IO1 B;  2K25 A;  1RFK A;  2DZK A;  3BK1 A;  2QIL A;  3VTW A;  3PT2 B;  5LNK 1;  4ZYS A;  4TUU A;  2ZPN A;  1NI2 A;  4P7I A;  1CJE A;  1IP9 A;  2N1W A;  4ZRJ A;  1YOV B;  2M8S A;  4DBG A;  4PYU A;  2GLS A;  3KQ4 A;  2M1M A;  4HCN B;  2MEK A;  4BBN C;  2MHJ A;  1UGM A;  4W9F A;  2UU7 A;  3GE8 C;  3VH4 B;  2AWT A;  2NPT A;  3ZVV A;  1I4P A;  1TZ1 A;  4YT0 B;  4CQN A;  1T3Q A;  2KC2 A;  3RT3 B;  3AB5 A;  1SJH D;  4C00 A;  3PZ7 A;  3MC0 B;  2CHZ A;  1N62 A;  3B9J A;  4G11 A;  2I1J A;  4W9I A;  3A9J A;  5D3D A;  4UDU C;  3AEB B;  2DNF A;  1WM2 A;  2N4F A;  4KV2 A;  2ZEQ A;  2D3G A;  3E9S A;  2IPK D;  1SE4 A;  4AOF A;  1UNS A;  2WXF A;  4YTP B;  3PHW B;  1ZXI A;  2Z0E B;  2K6Q A;  4J6I A;  5BYQ A;  2QHO A;  2DYO A;  3B2G A;  2N7E A;  3PS6 A;  1P1A A;  2C5L C;  2WX0 A;  2C7H A;  4R3D A;  4JX1 C;  4W9L A;  1L0X B;  5GXG B;  4NY0 A;  1JWM D;  2JWZ A;  4LNO A;  3RNB C;  1TY0 A;  1V2Y A;  1IPG A;  2EKE C;  4WWO A;  1STE A;  1J7C A;  2JQR B;  1OQR A;  2KDF B;  1WSP A;  4B6W A;  5C23 A;  4D2K A;  1WWT A;  2LZ6 A;  4HCP B;  3DVG Y;  4WH4 A;  4WAF A;  5JHA A;  4Q2J A;  3DWM A;  2K8H A;  1TY2 A;  3W9C B;  4MSQ B;  4ZRQ A;  1KF6 B;  3IFW B;  3VTU A;  4HK2 A;  1WGY A;  2J52 A;  4KZC A;  1M94 A;  3RD2 A;  2WDR B;  1XLP A;  4DK5 A;  2BTE A;  1K51 A;  1MHH E;  1PQS A;  4IWQ A;  2M56 B;  3Q69 A;  2PJH A;  3RZW C;  2L3Z A;  4GXB A;  1MVK A;  5BMI A;  1JWS D;  3ZNI D;  1YQ3 B;  4LDT D;  2KMM A;  3ZO5 B;  2JVC A;  2V1Y A;  2RMM A;  2WXG A;  2G3Q B;  2WXR A;  4OHJ A;  4MM3 A;  1NVI D;  2CHX A;  3VH3 B;  2KJH B;  3U7Z A;  4A55 A;  3OJ3 A;  3KVF B;  3RNF C;  2RR9 A;  3P42 A;  4BBN F;  2KHW B;  3DBS A;  5G5G A;  4MGY E;  2KFK A;  2HJ8 A;  3A4S C;  3ZDM C;  3RNA C;  3IHP C;  4YTN B;  2ZW0 A;  1B1Z A;  2LRW A;  3QK0 A;  2WXM A;  3I63 C;  4KGT A;  1UBQ A;  3VVW B;  1WMH A;  4KGS A;  4RF0 A;  5CTR C;  1CK1 A;  2XBB C;  3DDC B;  1FXA A;  1ZE3 D;  2NBW B;  1HZ5 A;  2GBJ A;  3ZNH B;  1FD6 A;  5LXH A;  3AE6 B;  2GBR A;  3TEY A;  1E8X A;  2MSE D;  3VFK A;  2KC1 A;  2LHE A;  1KFY B;  1L0V B;  4C4V B;  2D2Q A;  4A3P A;  3ZYY X;  3HVZ A;  4I6N B;  2O6V A;  2Z8L A;  5H92 C;  3VXW A;  2NR2 A;  1CZP A;  3K9P B;  3ZGZ A;  3ZJV A;  2V9H A;  1XCQ L;  1MG4 A;  2CKH B;  4N6E B;  2XEW A;  2WLB A;  4N59 A;  4LNK A;  4YSX B;  4IM0 A;  4US9 A;  4FA6 A;  1Q10 A;  3LJ3 A;  1ZXH A;  2AYO B;  2C7N B;  2ZVO A;  3H8H A;  4LK0 M;  2AQ2 B;  2FAZ A;  2BS3 B;  4TQ0 A;  4FN2 A;  3R3M A;  2HTH A;  1EWC A;  1ZDV A;  4LDT B;  3KYD D;  3CSF A;  2ACZ B;  2BBC A;  3V6C B;  2RDG A;  1TIF A;  2C7M B;  4E3C A;  1V81 A;  1JRU A;  2W3S A;  4RM9 A;  2KQ7 A;  2N7J A;  2W3R A;  2PTL A;  3W1S C;  4XWW A;  3BII D;  4WJN A;  2YLM A;  1JCK B;  1WM3 A;  3P2B A;  3RN9 C;  3O65 B;  4XDC A;  4HRS A;  2KK8 A;  2MBH A;  2YVC A;  2N9P C;  3QWZ B;  3VUY A;  4DDI D;  3JSV A;  4EE2 A;  1I42 A;  5AZH A;  3H6N A;  5D7G A;  3TIX A;  5IKC M;  2FIF A;  2XN9 C;  5DPR A;  4DHJ D;  3V62 A;  2WWZ A;  1WX9 A;  4GLS C;  4PS8 A;  3QIJ A;  3L4P A;  2JPH A;  2M0A A;  3V3X A;  1C77 A;  5FR6 A;  4ARC A;  4G50 A;  3I5J C;  3Q3M C;  1V49 A;  1JWA D;  3NZ3 A;  2WXK A;  2MBO A;  1LFD A;  1D5Z C;  2PIA A;  3ZRF A;  4DWF A;  1R4M B;  2JZP A;  1FPY A;  2JZ3 B;  3A1Q A;  1U4A A;  2D07 B;  1MI0 A;  4XZ4 A;  2FCQ A;  3RNG C;  3EA6 A;  3PV1 A;  3L54 A;  2BVC A;  3UQB A;  2Y3A A;  3MC8 A;  4KKJ A;  1S3S G;  1V1P A;  4JGH B;  2ZCB A;  4XX5 A;  5FKA C;  1NDD A;  5CHV C;  1EO6 A;  2BYE A;  4RFB A;  2BB6 A;  1OEY A;  1J7B A;  1WJ4 A;  2AEH A;  2BS2 B;  2DAJ A;  3HK0 A;  3NS8 A;  3NZS A;  3V61 A;  2I1K A;  5BYS A;  4A3O A;  1WZ0 A;  2NPT B;  1C78 A;  2RPQ A;  1YX5 B;  2I2Y A;  1QZE A;  4RM8 A;  2WXI A;  2BGF A;  3X0W A;  4YL8 A;  4FHJ A;  3RNC C;  1KOT A;  3VRB B;  3MJ5 A;  1IBX A;  4W9K A;  3L10 B;  1F1H A;  1TJE A;  3FIL A;  3LDZ E;  2AL6 A;  4BOZ B;  1FXI A;  4ANU A;  3EFC A;  2DZI A;  4YXD B;  1L5P A;  1C4C A;  3E56 A;  4GOC A;  2PVG C;  3IAS 1;  4URK A;  2KYW A;  3RI7 C;  1FMA D;  1UBI A;  2RDB C;  3TL5 A;  3DBL I;  4NJC A;  1T5X D;  2JWU A;  2G4D B;  1E5W A;  4USA A;  4FAD A;  1IUE A;  3N1Y C;  2BS4 B;  4WJO A;  3ZKJ C;  4RGN A;  1WR6 E;  1WXV A;  1GG3 A;  4RGM A;  5G55 A;  2KKC A;  4O1N A;  2O6V D;  1BUI C;  1VDV A;  4XGA B;  1DOI A;  4ZOH C;  4FJV B;  4FUL A;  3ZXR A;  3NY5 A;  2PPH A;  1FNW A;  2LRU A;  3ZLZ A;  1ROE A;  4M8N A;  3H7S A;  1AAR A;  4A20 A;  1GC7 A;  1R4N B;  2L76 A;  2M19 A;  2KTR A;  1VR9 A;  2VH2 A;  3QHT A;  4JE3 B;  1I4G A;  2OED A;  4AUQ C;  2IY1 B;  2QCZ A;  2FBW B;  2EMT A;  3Q3F A;  3HVD A;  1TKE A;  3DBR I;  5LLI A;  3DBL B;  1ZKH A;  2HD5 B;  1WRD B;  4GMV A;  1TTN A;  3PRZ A;  3WAP A;  2JX5 A;  3L08 A;  5J17 A;  4C7Z A;  3U7D A;  1ZOY B;  1KH0 A;  3RNE C;  3P4S B;  1ACC A;  3WAL A;  2KLC A;  2NCN A;  3SFE B;  1SIJ A;  3V05 A;  1A5R A;  4L2Y A;  4JPS A;  4OVU A;  2GOW A;  4F1S A;  2NBV B;  1WX7 A;  4NQK E;  3QAQ A;  2Z0D B;  1Q5W B;  4EUT A;  2L7R A;  4XWT A;  2KFK B;  2R2O A;  3ZQ4 A;  1I4H A;  4KIK A;  1WE6 A;  1FRR A;  2DYM A;  4K7U A;  2CS4 A;  1TS3 A;  5D94 A;  3R7Q A;  1WMH B;  1DYQ A;  5D6J B;  2LUE A;  3NVV A;  4K7W A;  4IOI E;  2AL3 A;  2V3S A;  1V9J A;  3DBR B;  4DXA B;  3VR9 B;  3HRD D;  1WR1 A;  2MX2 A;  3C19 A;  1XF5 L;  2PVO D;  1C76 A;  2O6V B;  3W5U B;  1E0Z A;  2K1F A;  3ECI A;  4KX6 B;  1ET9 A;  2WU5 B;  2KWD A;  2NVU I;  3WCQ A;  4KKI A;  3MFG A;  4F8C B;  4C56 C;  3WIM A;  3UGB B;  1N61 A;  4GB9 A;  4EZJ A;  2KWC A;  3RUL A;  2WYQ A;  3ALB A;  3MJW A;  3A9K A;  3V60 A;  3MHZ A;  2KDB A;  3TUO A;  2BT6 A;  2K0P A;  3IG3 A;  4XE0 A;  1FFU A;  2FUG 1;  1J19 A;  4ZYN A;  1F2R C;  3NRZ A;  1D4B A;  4B95 A;  1YMH E;  1Z2M A;  3IT6 B;  4NAM A;  3X23 A;  3U4E G;  4HPP A;  3QJZ A;  3AEG B;  4L1B A;  4WQO B;  1YIW A;  3FAH A;  3HHM A;  5JXV A;  4I6P A;  1ENF A;  2MLB A;  2Q5W D;  4JWU C;  1PGA A;  1FO4 A;  2KDI A;  3PZD A;  2KN4 A;  2ASQ A;  1P98 A;  1WXA A;  3SDL C;  1R7S A;  4HKZ E;  2CJN A;  1QIL A;  2ZVN A;  3T3O A;  3JSV B;  2DBY A;  4BKT A;  4MAC A;  1HE8 A;  2QMT A;  3W1Y A;  4NJ7 A;  1K50 A;  1I35 A;  1E8Z A;  3NOB A;  2LJI A;  1WXM A;  4L23 A;  2JXT A;  4YSZ B;  1NBF C;  4S17 A;  3AUL A;  3A1Q B;  1A70 A;  2H88 B;  2WXN A;  3Q8B A;  1GB4 A;  2Z59 B;  5DPT A;  1EU4 A;  4MEM A;  4IW0 A;  3CST A;  2GBN A;  1SEB D;  2OOB B;  3GS2 A;  1GC6 A;  1V1P B;  2JT4 B;  3MP9 A;  2NBU A;  5AUK A;  2M4N A;  2ZNV B;  2IY0 B;  4RMA A;  5CHF A;  2JRI B;  1HTO A;  2EMS A;  1H8C A;  1SB3 C;  4HPM B;  3RPF C;  1E8Y A;  1XLO A;  2GI9 A;  2ONQ A;  4HDQ A;  5J2R A;  3WAN A;  3RCZ A;  1SGH A;  1IBX B;  5J18 A;  1EWY C;  4LJO B;  3FIL B;  3IT4 B;  3Q8F A;  3GOE A;  1E8W A;  2KQ4 X;  2BF8 B;  2GMI C;  4OZC A;  2WS3 B;  1ISN A;  1AW7 A;  1TBE A;  1YN3 A;  2L1A A;  2PKO A;  1SSN A;  2PE9 A;  1QOA A;  1WRI A;  3I3T B;  3N9Y C;  1F0Z A;  1NYQ A;  2WGS A;  3AE7 B;  3MTN B;  4G3X B;  3RFZ B;  3PLV A;  3ETR A;  4IM2 A;  3VR8 B;  2K5P A;  2K8C A;  2V3P A;  3L17 A;  2MRP A;  2W9N A;  3L13 A;  5LXI B;  3Q3J A;  2W54 A;  1SIF A;  1GB1 A;  1I4X A;  3BZD B;  1P7E A;  2JRH A;  2FCN A;  4HDO A;  2WDV B;  4N9F 4;  2QIE B;  3DHG C;  5HI1 A;  2QSD A;  2J42 A;  1GJZ A;  1BT0 A;  4MH8 A;  2IO0 B;  3AXC A;  1WGH A;  2CHW A;  2DYB A;  2LUM A;  2KTR B;  3QC8 B;  3AEC B;  2DZJ A;  3DOW A;  2MJE A;  3AN1 A;  4HXD A;  3HM6 X;  4W9G A;  3TJP A;  4IC7 B;  3AEE B;  2WDT B;  4US8 A;  3O13 A;  2X38 A;  3APF A;  3FC4 A;  5HKH A;  3NJT A;  4NQL B;  2IDY A;  5D3I B;  5FR3 A;  4FLH A;  1UD7 A;  2MWS B;  1YJ1 A;  4ZHO A;  3PTF C;  2WXQ A;  2MH7 A;  3TEX A;  2REX A;  3R7R A;  2KZR A;  5IN7 A;  2RSU A;  3B0A A;  4ASW C;  2K9X A;  4MGI E;  2RPV A;  5G2N A;  4J3O D;  4GDK A;  3VRA B;  3ZTC A;  1VJK A;  1CQV A;  3L16 A;  4B9K A;  4KIK B;  4BVU C;  3EUB 2;  2G9H D;  2HJ1 A;  5I4D A;  1OFF A;  1IGD A;  2GBK A;  3RUI B;  4GGQ A;  1Q1O A;  1YN4 A;  2ICI A;  3A33 B;  2GBM A;  5IAA C;  3AE1 B;  2PW9 A;  2K22 A;  2NTS A;  3PVL A;  2JY6 A;  4PS7 A;  2IGG A;  3APC A;  2L8J A;  1Q0W B;  4HKQ A;  3HM3 A;  1JRP A;  4G0N B;  2K6D B;  3HIZ A;  3ZNG C;  1XD3 B;  1GNU A;  2MJ3 A;  4TQ1 A;  4II2 B;  2KD0 A;  3IVF A;  1SE9 A;  4ICV A;  1LGR A;  1WI0 A;  1UEL A;  5H8Y E;  4NNJ B;  4MJS A;  2KAJ A;  1L2N A;  3A9K B;  3VDZ A;  3UIP B;  1Y56 A;  2EEL A;  1G6J A;  2KWV B;  1P9D U;  2OJR A;  2LFI A;  1ZPS A;  3ZUN A;  1N63 A;  1T0Y A;  3Q3O C;  3AE8 B;  2HTM E;  4ITK A;  1MHX A;  3ZNZ B;  1C4A A;  3RMK C;  1WIA A;  1N60 A;  1NEK B;  2N1V A;  2LJ5 A;  3B1L X;  3WAM A;  3DWG C;  5TR5 A;  1RAX A;  1T0R C;  1VRA B;  1LO5 D;  4K3C A;  4K3B A;  3ML8 A;  3U8Z A;  2WHI A;  4MSM B;  1DOY A;  3AE9 B;  1KTK A;  1WFY A;  1GOZ A;  3SU8 X;  4E74 A;  1L4Z B;  2BWE S;  3P4R B;  2DHZ A;  3KW5 B;  2Y5B B;  2XK5 A;  3OG5 A;  1YNT E;  3QCA A;  5BMH A;  3NHE B;  1F2R I;  1XXG A;  3H9D A;  2LXA A;  3N20 C;  3U2S C;  1GAQ B;  5T8I A;  4OW0 A;  4ANX A;  1IGC A;  2BKR B;  2AX5 A;  4W9D A;  2BPS A;  5BMG A;  1OQQ A;  2WNM A;  3KUZ A;  4RNA A;  1V6E A;  1YX6 B;  4CO7 A;  3URY A;  2LGS A;  2C9W B;  3DCG A;  2IGH A;  1VZ8 A;  4II3 B;  3W1S A;  4EZK A;  4P6V F;  4TKN A;  4TMA B;  5BYR A;  4M01 A;  3AEF B;  5C3J B;  5C1Z A;  3QX1 A;  3DVN U;  4DXF A;  3ML9 A;  2FNJ B;  1F52 A;  3MHS D;  3PRM B;  4ZRK A;  2OHF A;  3CWI A;  1FNV A;  3M95 A;  4RF1 A;  2QC8 A;  3W5V B;  1JRO A;  1K52 A;  1ZW7 A;  4K1R B;  3JYU A;  3NS1 A;  2KDM A;  4BKS D;  4DHJ B;  3UQA A;  2CJO A;  4IG7 B;  2BKF A;  1VZ6 A;  2KDE B;  1WF9 A;  3AM9 A;  4MEL A;  1AWD A;  3D32 A;  4DHZ B;  5JZE B;  1QKZ A;  1FCC C;  3H1U A;  2J4X A;  4XC2 A;  1L4D B;  1WJU A;  4RH6 A;  4ARI A;  2D5G A;  4HJK A;  2KAN A;  4NZL B;  5JH5 C;  2J0J A;  1M4V A;  3AMZ A;  3IBE A;  3KWV A;  3W2D A;  4WAA A;  1LQB A;  3GZN I;  2D10 A;  4HJG E;  2PE6 B;  3ZTD A;  2BW2 A;  1SF0 A;  2V4L A;  4IWP A;  5D2M B;  4A90 A;  2KWU B;  1FCL A;  3GB1 A;  3T3N A;  3ZIM A;  1FM0 D;  3PSE B;  3PRP B;  1WE7 A;  3OJ4 B;  1MPE A;  3NZU A;  1TYG B;  2LHD A;  5AEK B;  3IXS A;  1NYR A;  3DPD A;  2D3C A;  1I7H A;  1C79 A;  2A4Z A;  3NVW A;  4YWG G;  1V86 A;  2DZM A;  5EDS A;  3VQI A;  2IBI B;  4GDL A;  3BYT B;  1WY8 A;  1EU3 A;  1TS2 A;  4WWM A;  1RWS A;  1XO3 A;  5E6N A;  2SEB D;  4JQW C;  3P1M A;  2KMC A;  1HXY D;  4LLG M;  2K8B A;  2LAS A;  4WWP A;  3AE3 B;  1WGG A;  4KSL C;  2BYF A;  2JYE A;  2UWQ A;  3R66 C;  3HUI A;  2K3U A;  2MW5 A;  3DQV A;  3APD A;  2KTF A;  4YTM B;  2DWQ A;  4A9A A;  2AQ3 B;  2WX1 A;  2G4S A;  1ESF A;  1HA5 A;  1JML A;  2RD0 A;  3AV8 A;  1QLB B;  3UIN B;  2PEA A;  2L00 B;  3SR6 A;  4MT5 A;  1ET6 A;  4JLC A;  3CF6 E;  2V4I B;  1I4Q A;  3R2T A;  2JXX A;  4DHZ E;  3KLS X;  4ZRP A;  1JWB D;  1EM7 A;  4I6L B;  2QJL A;  4YSY B;  4AQ7 A;  3PLU A;  1YQ4 B;  4NJ6 A;  5IP4 D;  1K8R B;  3I9V 1;  3LB8 C;  3LXF A;  3Q2A C;  1ZUD 2;  2ZZP B;  4GDK B;  4M8M A;  1UWM A;  2PMV A;  3QQ8 B;  3M62 B;  3N30 A;  5E6J A;  1QT9 A;  3U30 A;  2WQY B;  4P1B C;  2X8X X;  4K7S A;  2OJW A;  2L0F A;  2ZW1 A;  2HE7 A;  2BYT A;  2MP2 A;  3N1X C;  2Y5C A;  4W9C A;  4HVB A;  1JWU D;  1ZP0 B;  3DHH C;  4A6Q A;  1V5O A;  2IO3 B;  2KQS A;  3LYY A;  1K53 A;  2MJD A;  4LJP B;  2LD9 A;  2WDQ B;  4WJP A;  1FFV A;  1WGD A;  2WXH A;  2N0S B;  2FUH B;  1QOG A;  3JVZ X;  1VZ7 A;  3Q6B A;  1P7F A;  2J53 A;  2YEP F;  1TS5 A;  2WXJ A;  3SD5 A;  4MJS B;  2LGY A;  3N1Z C;  4E71 A;  4W9H A;  4NPN A;  3AU4 A;  2O2V A;  2MCN B;  5TSS A;  1MFW A;  1LM8 B;  4AWJ A;  2R61 A;  3WAO A;  4LNI A;  3EFU A;  3VTV A;  4F7Z A;  1V80 A;  1WH3 A;  1DOX A;  1Z5S B;  1TS4 A;  1SXT A;  1AN8 A;  3C0R B;  3P63 A;  4FBJ B;  3SHQ A;  2VRR B;  2L05 A;  4HLE A;  1PGX A;  2NS5 A;  1GPX A;  2XK5 B;  2KT7 A;  2MQJ A;  4FJY A;  2IO2 B;  3BYY B;  5AZF A;  3BVZ A;  1EF1 A;  4EEW A;  1E7V A;  1WYG A;  4GN1 A;  4ZHP A;  2G45 B;  2ZPY A;  4WUR A;  1TT5 B;  1UUP A;  3EGR A;  1L7Y A;  3Q14 C;  4ZRI A;  1XEE A;  5EE0 A;  4S0R A;  5C2T B;  1OGW A;  1ZDX A;  3AI5 A;  1MJD A;  3CIR B;  3N32 A;  1Y8R C;  2K39 A;  3BY4 B;  1E90 A;  5EE1 A;  3KWL A;  4N58 A;  2H89 B;  3KUD B;  3TSS A;  1RLF A;  4WQM A;  2LVQ A;  2D3A A;  1UZX B;  3DBH I;  4KZ0 A;  2LI5 A;  3L0W B;  1C1Y B;  5G5H A;  2LGX A;  4PK1 A;  2E3T A;  3AED B;  3Q3N C;  2PLP A;  1L0Y B;  2KOX A;  3TMP B;  2BB5 A;  4GSW A;  5KHO A;  4W9J A;  4DDG D;  3SEB A;  5L95 C;  2INP E;  4KDI C;  1AYF A;  2D11 A;  1RFA A;  1T6B X;  3AE5 B;  4A8X C;  4CHK A;  1VLB A;  3Q8A A;  4X57 B;  1FXT B;  2E6X A;  2Y5P A;  1FRD A;  2L52 A;  1WXS A;  2ZCC A;  1KJT A;  4CYE A;  1J8C A;  3U52 E;  2R2Q A;  3EEC A;  1HEZ E;  4JIO U;  4KVG B;  3SFD B;  2LMC A;  1WGK A;  4MDK E;  3DBH B;  3VUX A;  1QF6 A;  1XT9 B;  2WP9 B;  4BKS A;  1I4R A;  2A5U A;  4BKG A;  1XCT L;  2N9E B;  2RGF A;  2N7D A;  5L83 A;  1TZO A;  1TKY A;  4JL9 A;  1B9R A;  3ZJU A;  2KFJ A;  2KO3 A;  2LEK A;  1SBB B;  1MG8 A;  4NAW A;  2ZJD A;  3P4Q B;  5GMV A;  4LCD E;  4RGO S;  4REZ A;  3BVM A;  4GDL B;  2B3A A;  4FHK A;  3PPA A;  2KX0 A;  1OTR B;  1QOF A;  4HWI B;  3BVG A;  4M0W A;  1HTQ A;  4MH0 E;  4DXG A;  1VD2 A;  1J7A A;  1E10 A;  1P3Q U;  3AEA B;  1KLV A;  4IKG A;  2LGD A;  3IAM 1;  3ZXV A;  4BOS C;  1N5X A;  3NVY A;  3OAW A;  1H4R A;  4HPL B;  2M17 A;  2J0M A;  3GE3 C;  3ZJT A;  1N5W A;  3NG0 A;  2D3B A;  1HQR D;  2BYV E;  2DEN B;  2NMQ A;  1RYJ A;  2ZNV C;  1JQ4 A;  3ABV B;  2HDE A;  3KUC B;  4HEA 1;  1PGB A;  1T0Q C;  1R4M I;  3PZ8 A;  4ICU A;  5IO9 A;  3AE2 B;  4LNF A;  2JF5 A;  1UH6 A;  3H7P A;  1YJI A;  2KJR A;  1V97 A;  2JSV X;  1CMX B;  2MBB B;  3WA0 A;  1S1Q B;  5MPO A;  3P4P B;  5AZG A;  1E7U A;  2QDF A;  5CX3 A;  2L0T A;  4WWN A;  2J0K A;  2YEP B;  3CMM B;  1WJN A;  3M3J A;  4ANW A;  4EZL A;  3Q8E A;  1XQQ A;  1XLN A;  1WGR A;  4AP4 C;  1BXT A;  2KX3 A;  2JUO A;  3GP7 A;  1WJ6 A;  1EUV B;  2IGD A;  1L6U A;  2MP2 B;  2KVZ A;  1PYW D;  1V5T A;  3TCA A;  2I38 A;  5JHB A;  4MGZ E;  3EHV A;  4P16 A;  1FEH A;  1RRB A;  2L32 A;  1GUA B;  3B2F A;  5EE9 A;  2INN E;  5EE3 A;  4BFR A;  2WXL A;  1UWX A;  2KLG A;  3RYT A;  4IDI A;  1UF0 A;  1D5M C;  2AQ1 B;  4IWO A;  5HHD G;  3PHX B;  1NEN B;  3NUH B;  3EC8 A;  3B08 A;  3OLM D;  4P1C C;  2MBE A;  2FCM A;  5AUI A;  2O2V B;  2KJ6 A;  4XYC A;  1VCB A;  2TSS A;  2JYT A;  1HZ6 A;  2DAF A;  4TSS A;  2FCS A;  5BO4 B;  2IYD B;  4RCO A;  2UYZ B;  3DVN V;  3R2I A;  3UI3 A;  1C4P A;  4LNN A;  2N9K A;  1YQB A;  1E6E B;  5IA7 A;  3RZF A;  1C3T A;  4AS1 A;  4AJW A;  2KMA A;  4ANV A;  3ENE A;  3PGE A;  3BWU D;  2V3N A;  4IM3 A;  1FNU A;  2QEJ C;  1YN5 A;  3K9O B;  1SE3 A;  3J9C A;  2KAC A;  1WXQ A;  1KLG D;  2VZK D;  3ONS A;  3TEW A;  2FID A;  4DQO C;  3PO0 A;  1R4N I;  3A9J B;  2BQQ A;  3JW0 X;  1WZ3 A;  2EKI A;  2W82 A;  1SJE D;  2MA9 B;  1QQR A;  3ZW3 A;  1D3Z A;  4M02 A;  2GRI A;  3ZRC A;  1F77 A;  4K81 A;  1JW9 D;  2WXP A;  1L6V A;  3N3K B;  3DHI C;  5DPS A;  4WIP A;  2CU1 A;  3BK2 A;  1V1O A;  2KNB A;  4PT5 A;  1WX8 A;  3AU5 A;  1TKG A;  2ON8 A;  5DPW A;  3VUW A;  1E9M A;  4KDL B;  4EOY A;  3UF8 A;  5E6O A;  4OZA A;  4B0E A;  3T9L A;  4EKU A;  4W9E A;  2IZV B;  2LVO A;  3R8B A;  5HFY A;  2DLB A;  1F9J A;  4PS3 A;  4FXC A;  4MGK E;  2V0G A;  2W55 A;  4EFO A;  1ZGU B;  4QAY A;  3C8Y A;  3BIN A;  1X1M A;  2DX5 B;  3NVZ A;  3PRE A;  4GIV A;  2LGI A;  2M0X A;  2KVR A;  1KRH A;  4TV3 A;  2G1E A;  5KHQ A;  2CU3 A;  1IYF A;  2VH1 A;  2LVP A;  1E7P B;  1BML C;  3S2A A;  3VHT C;  4KSK C;  2IJ0 A;  1YD8 U;  1PUT A;  4JWS C;  4LTU A;  1TGZ B;  2N9L A;  2XNA C;  4C4V A;  2IND C;  4FJZ A;  3ZDT A;  5E6P A;  4MM3 B;  3UIO B;  4OVV A;  2VZK B;  2JU6 X;  3GZN B;  3TBL D;  1JAL A;  5FK9 C;  2KN5 A;  4M00 A;  3QAR A;  1OQY A;  2RDH A;  1NI3 A;  1T0S C;  4H2A A;  4GU2 A;  3TEZ A;  1YJJ A;  4OZB A;  1RM6 C;  1KLU D;  1OEY J;  4RGT A;  3OWE B;  4ACF A;  2L83 A;  4NAW B;  5IOI A;  3KYC D;  2LXC A;  5DCN A;  1P0R A;  3A4R A;  1D5X C;  2WU2 B;  1EF5 A;  4XDD A;  2J7Q B;  4B0M A;  2B76 B;  4M0W B;  1PFD A;  2JZZ A;  1N6Z A;  3QA8 A;  1V8C A;  3Q8C A;  2WXO A;  4AJY B;  4HRO A;  2SAK A;  1KM7 A;  3I57 A;  4BZA A;  5HG2 A;  3M63 B;  4C7Y A;  3DVG X;  3KH0 A;  4OVZ A;  4PYZ A;  1PDX A;  1LXD A;  1D6E C;  4BAX A;  3T8M A;  2MBQ A;  4ZDV A;  2FE8 A;  3VAW A;  2N9X A;  5CHW A;  1DGJ A;  2GB1 A;  1UGJ A;  1J0G A;  1QOB A;  2C60 A;  1FIQ A;  1C9F A;  2NTT A;  3AH7 A;  4C80 A;  2BWF A;  3V6E B;  2LWP A;  4WJQ A;  2CR5 A;  1SE2 A;  3FKY A;  4IUM B; 
#chains in the Genus database with same CATH homology
 2INP E;  1Y56 A;  2EEL A;  1ROE A;  3AE4 B;  1AYF A;  1T6B X;  1XLQ A;  2LFI A;  1ZPS A;  1N63 A;  3AE8 B;  4KGR A;  3AE5 B;  4A8X C;  2HTM E;  4ITK A;  1RFK A;  1VLB A;  1MHX A;  2M19 A;  1C4A A;  3Q8A A;  3BK1 A;  2QIL A;  1N60 A;  1VR9 A;  1NEK B;  4JE3 B;  1I4G A;  2E6X A;  2Y5P A;  2OED A;  4ZYS A;  5LNK 1;  1FRD A;  2L52 A;  3DWG C;  1VRA B;  1LO5 D;  2FBW B;  1CJE A;  3U52 E;  3HVD A;  1TKE A;  1DOY A;  1HEZ E;  3SFD B;  3AE9 B;  1KTK A;  1GOZ A;  2LMC A;  1L4Z B;  1WGK A;  3KQ4 A;  2MEK A;  1QF6 A;  2JX5 A;  4C7Z A;  2WP9 B;  1ZOY B;  1KH0 A;  3P4R B;  1I4R A;  3P4S B;  1XCT L;  1ACC A;  3SFE B;  1SIJ A;  3V05 A;  1YNT E;  1TZO A;  5BMH A;  4L2Y A;  1TKY A;  4JPS A;  1I4P A;  1F2R I;  1XXG A;  1B9R A;  4YT0 B;  3ZJU A;  4CQN A;  1T3Q A;  2LEK A;  1SBB B;  3AB5 A;  1SJH D;  3U2S C;  1GAQ B;  3P4Q B;  3PZ7 A;  3MC0 B;  4RGO S;  4XWT A;  5T8I A;  4REZ A;  1N62 A;  3B9J A;  3BVM A;  4OW0 A;  3ZQ4 A;  1I4H A;  1IGC A;  4GDL B;  2AX5 A;  1FRR A;  2DYM A;  5BMG A;  1OQQ A;  2WNM A;  5D3D A;  4UDU C;  3AEB B;  4RNA A;  1TS3 A;  1QOF A;  3URY A;  3BVG A;  4M0W A;  1DYQ A;  2IGH A;  1VZ8 A;  3W1S A;  4DXG A;  3E9S A;  2IPK D;  4P6V F;  1SE4 A;  3NVV A;  1J7A A;  4TMA B;  1UNS A;  2WXF A;  4YTP B;  1E10 A;  5BYR A;  3AEA B;  1ZXI A;  4IOI E;  5C3J B;  3AEF B;  4IKG A;  5BYQ A;  3VR9 B;  3HRD D;  2DYO A;  3B2G A;  3IAM 1;  1N5X A;  3NVY A;  4DXF A;  4R3D A;  1XF5 L;  2PVO D;  1C76 A;  3W5U B;  1E0Z A;  4JX1 C;  2OHF A;  3CWI A;  1FNV A;  4RF1 A;  3ZJT A;  1L0X B;  3W5V B;  4KX6 B;  1ET9 A;  5GXG B;  1N5W A;  2WU5 B;  1JRO A;  1JWM D;  1K52 A;  2NMQ A;  1HQR D;  3NS1 A;  2KDM A;  2KWD A;  1RYJ A;  1TY0 A;  3WCQ A;  4KKI A;  1STE A;  1JQ4 A;  3MFG A;  1J7C A;  2JQR B;  1OQR A;  1WSP A;  3ABV B;  2HDE A;  4C56 C;  2CJO A;  4D2K A;  1WWT A;  4HEA 1;  1PGB A;  1N61 A;  4WH4 A;  1VZ6 A;  4WAF A;  3AM9 A;  1AWD A;  3PZ8 A;  1QKZ A;  3MHZ A;  4Q2J A;  1FCC C;  3DWM A;  2J4X A;  3AE2 B;  3TUO A;  1TY2 A;  2BT6 A;  3W9C B;  1L4D B;  2K0P A;  1YJI A;  4ZRQ A;  1V97 A;  2JSV X;  4RH6 A;  1KF6 B;  4ARI A;  2D5G A;  4XE0 A;  2J52 A;  1FFU A;  2FUG 1;  5MPO A;  1F2R C;  3NRZ A;  2WDR B;  1XLP A;  4NZL B;  2BTE A;  3P4P B;  1K51 A;  1M4V A;  1D4B A;  1MHH E;  3AMZ A;  1YMH E;  3KWV A;  3IT6 B;  2YEP B;  4NAM A;  3W2D A;  2M56 B;  3Q69 A;  3Q8E A;  4HJG E;  1MVK A;  5BMI A;  3U4E G;  1XLN A;  2BW2 A;  3AEG B;  1SF0 A;  4L1B A;  1JWS D;  1BXT A;  1YQ3 B;  3FAH A;  3GP7 A;  2KMM A;  4A90 A;  2IGD A;  1L6U A;  5JXV A;  1ENF A;  1FCL A;  2RMM A;  2WXG A;  3GB1 A;  3T3N A;  1PYW D;  2Q5W D;  2I38 A;  1PGA A;  1FM0 D;  4JWU C;  2WXR A;  4OHJ A;  1FO4 A;  1NVI D;  2KN4 A;  4P16 A;  1FEH A;  2L32 A;  1R7S A;  3B2F A;  1MPE A;  4HKZ E;  5EE9 A;  1TYG B;  1QIL A;  2CJN A;  2INN E;  2LHD A;  5EE3 A;  3T3O A;  3U7Z A;  3IXS A;  2DBY A;  2WXL A;  1UWX A;  1NYR A;  4A55 A;  1I7H A;  3P42 A;  4MAC A;  4IDI A;  5G5G A;  2QMT A;  1C79 A;  3NVW A;  1D5M C;  2AQ1 B;  1K50 A;  4YWG G;  3VQI A;  4YTN B;  3BYT B;  2ZW0 A;  1EU3 A;  1B1Z A;  2LJI A;  1TS2 A;  2WXM A;  4KGT A;  5HHD G;  4KGS A;  4WWM A;  1RWS A;  4RF0 A;  1CK1 A;  1XO3 A;  1FXA A;  4L23 A;  2JXT A;  1NEN B;  1ZE3 D;  3NUH B;  1HZ5 A;  2SEB D;  4YSZ B;  5AUI A;  3P1M A;  1FD6 A;  1A70 A;  2H88 B;  2WXN A;  3Q8B A;  1GB4 A;  3AE6 B;  2TSS A;  2JYT A;  3TEY A;  1EU4 A;  1HZ6 A;  4TSS A;  1HXY D;  4LLG M;  4RCO A;  1SEB D;  2LHE A;  1KFY B;  3AE3 B;  1L0V B;  3GS2 A;  3R2I A;  3UI3 A;  3ZYY X;  1C4P A;  2JYE A;  2N9K A;  3HVZ A;  1E6E B;  3HUI A;  4AS1 A;  2K3U A;  1V1P B;  2Z8L A;  5H92 C;  4YTM B;  2DWQ A;  3MP9 A;  3BWU D;  5AUK A;  2AQ3 B;  4A9A A;  2V3N A;  1CZP A;  3ZGZ A;  1ESF A;  3ZJV A;  1FNU A;  2QEJ C;  1XCQ L;  1YN5 A;  1HA5 A;  1JML A;  3AV8 A;  1QLB B;  1SE3 A;  2KAC A;  3J9C A;  1WXQ A;  3SR6 A;  4MT5 A;  1ET6 A;  1KLG D;  2VZK D;  1SB3 C;  3TEW A;  2V4I B;  4N6E B;  2WLB A;  4N59 A;  4YSX B;  1I4Q A;  3R2T A;  4DQO C;  3PO0 A;  3KLS X;  4US9 A;  3RPF C;  4ZRP A;  1JWB D;  1Q10 A;  1EM7 A;  1ZXH A;  1XLO A;  2GI9 A;  2QJL A;  4YSY B;  4AQ7 A;  2EKI A;  1YQ4 B;  2ONQ A;  2W82 A;  1SJE D;  3H8H A;  3I9V 1;  4LK0 M;  1QQR A;  2AQ2 B;  1IBX B;  3LB8 C;  2BS3 B;  3LXF A;  4TQ0 A;  1ZUD 2;  1EWY C;  4GDK B;  2GRI A;  1UWM A;  2PMV A;  1F77 A;  1EWC A;  1ZDV A;  3FIL B;  1JW9 D;  2WXP A;  3IT4 B;  1L6V A;  5E6J A;  3Q8F A;  1QT9 A;  2ACZ B;  4WIP A;  3BK2 A;  2BBC A;  2WQY B;  2KQ4 X;  2RDG A;  1V1O A;  4OZC A;  4PT5 A;  2ZW1 A;  2WS3 B;  1TKG A;  2ON8 A;  2W3S A;  1AW7 A;  2N7J A;  1E9M A;  2BYT A;  1YN3 A;  2PTL A;  2W3R A;  2L1A A;  2PKO A;  4OZA A;  4XWW A;  4B0E A;  3BII D;  1SSN A;  2Y5C A;  1QOA A;  1WRI A;  3R8B A;  5HFY A;  1JWU D;  3N9Y C;  1F0Z A;  1NYQ A;  1JCK B;  1ZP0 B;  2DLB A;  3AE7 B;  3RFZ B;  4FXC A;  4A6Q A;  3LYY A;  1K53 A;  3ETR A;  2MJD A;  3VR8 B;  2K5P A;  4HRS A;  2WDQ B;  2V3P A;  4XDC A;  2V0G A;  1FFV A;  2WXH A;  4EE2 A;  2W54 A;  2N0S B;  1QOG A;  1GB1 A;  1I4X A;  1VZ7 A;  5D7G A;  2W55 A;  3BZD B;  1P7E A;  1P7F A;  2J53 A;  2XN9 C;  3C8Y A;  2WDV B;  2YEP F;  1TS5 A;  2QIE B;  2WXJ A;  4GLS C;  3L4P A;  5HI1 A;  2M0A A;  3V3X A;  3NVZ A;  2QSD A;  1C77 A;  2LGI A;  2J42 A;  4ARC A;  1JWA D;  4MH8 A;  3NZ3 A;  1KRH A;  2WXK A;  2G1E A;  1D5Z C;  2CU3 A;  2PIA A;  2JZP A;  5TSS A;  2LUM A;  1E7P B;  1BML C;  2IJ0 A;  1MI0 A;  2R61 A;  1PUT A;  3AEC B;  2MJE A;  4JWS C;  3EA6 A;  3AN1 A;  4LTU A;  2N9L A;  2XNA C;  1DOX A;  2Y3A A;  4KKJ A;  1V1P A;  4MM3 B;  3AEE B;  1TS4 A;  4US8 A;  1SXT A;  3O13 A;  2X38 A;  3FC4 A;  1AN8 A;  2VZK B;  5FKA C;  2JU6 X;  4RFB A;  2BB6 A;  3P63 A;  1JAL A;  1J7B A;  2BS2 B;  5FK9 C;  5D3I B;  2IDY A;  5FR3 A;  5BYS A;  1PGX A;  2RDH A;  4ZHO A;  2I2Y A;  1C78 A;  1NI3 A;  1GPX A;  2WXI A;  2WXQ A;  4H2A A;  2MH7 A;  3TEX A;  3TEZ A;  1YJJ A;  4OZB A;  1RM6 C;  3BYY B;  3BVZ A;  1KLU D;  1WYG A;  4ZHP A;  4RGT A;  2K9X A;  3OWE B;  2RPV A;  2L83 A;  4NAW B;  3VRB B;  3MJ5 A;  4J3O D;  1IBX A;  4WUR A;  1UUP A;  3EGR A;  3VRA B;  1VJK A;  1D5X C;  1CQV A;  2WU2 B;  1XEE A;  1TJE A;  3FIL A;  5EE0 A;  3EUB 2;  4XDD A;  4B0M A;  1FXI A;  2B76 B;  1PFD A;  2G9H D;  5C2T B;  4YXD B;  1L5P A;  1C4C A;  1ZDX A;  3E56 A;  1V8C A;  3Q8C A;  5I4D A;  3CIR B;  2PVG C;  1OFF A;  1IGD A;  2WXO A;  3IAS 1;  4HRO A;  2SAK A;  1YN4 A;  2ICI A;  3I57 A;  1FMA D;  5HG2 A;  4C7Y A;  3AE1 B;  4OVZ A;  2PW9 A;  2K22 A;  2NTS A;  4NJC A;  5EE1 A;  3KWL A;  1PDX A;  2IGG A;  4N58 A;  2H89 B;  1T5X D;  3TSS A;  4HKQ A;  2JWU A;  4WQM A;  4USA A;  1D6E C;  1IUE A;  2BS4 B;  1JRP A;  2FE8 A;  5G5H A;  4RGN A;  2MJ3 A;  4TQ1 A;  2E3T A;  1DGJ A;  3AED B;  2GB1 A;  4RGM A;  2PLP A;  1L0Y B;  1UGJ A;  1QOB A;  1FIQ A;  1C9F A;  2NTT A;  3AH7 A;  2BB5 A;  4O1N A;  4C80 A;  1BUI C;  1VDV A;  5H8Y E;  1DOI A;  4ZOH C;  3SEB A;  1SE2 A;  2KAJ A;  1FNW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...