3GS2A

Ring1b c-terminal domain/cbx7 cbox complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
111
structure length
109
Chain Sequence
ASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTEKQYTIYIATASGQFTVLDGSFSLELVSEKYWKVNKPMELYYAPTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase RING2
publication title Polycomb Group Targeting through Different Binding Partners of RING1B C-Terminal Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 29
structure length 109
sequence length 111
chains with identical sequence C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2009-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16207 RAWUL RAWUL domain RING finger- and WD40-associated ubiquitin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.430 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3gs2A00
3H8HA 3GS2A 3IXSA
chains in the Genus database with same CATH superfamily
4FXCA 4MDKE 3KW5B 1J7CA 3W1SC 1FNWA 1CK1A 2DAJA 4YTNB 1C76A 1E10A 2PPHA 4JLCA 2JF5A 1FXIA 1K51A 4IC7B 3LXFA 4KIKA 4CHKA 3H8HA 1N5XA 3L13A 1YMHE 1PDXA 1UNSA 4N6EB 1FCLA 3ZTCA 4WJQA 2IGDA 2UU7A 1XQQA 4HJKA 2NPTA 4JE3B 1Y8RC 2AYOB 2E6XA 4OZCA 2G4DB 2IPKD 1WGDA 2LWPA 3FAHA 3DVNU 1KLGD 3R7RA 2D3GA 1TY0A 1VZ7A 4QAYA 4OVVA 3RYTA 3APFA 3NY5A 2J0KA 2W3RA 4OW0A 2JZPA 4NJ6A 1DOXA 2BYTA 4G3XB 1MG4A 2KN5A 4FHKA 2XNAC 3K9PB 4M8MA 3VRBB 1WFYA 2WNMA 2LGDA 3BWUD 2K8HA 4K7UA 1EUVB 2KVRA 1YX5B 4XYCA 3B2FA 1WH3A 3VAWA 4K7SA 4MJSA 2REXA 1YQ3B 3TUOA 2J53A 5EE0A 1VR9A 2RSUA 2IY1B 3H7PA 2O6VD 4W9FA 3APDA 4NJCA 1SJHD 1SE3A 4PYZA 2LEKA 3UGBB 1WGRA 2K9XA 1F0ZA 1MPEA 1NYQA 1WJNA 3V05A 1WXQA 1VD2A 2WXHA 3AV8A 4NJ7A 5JHBA 3W5UB 3PLVA 4B95A 3TJPA 2LGIA 2HJ1A 1V6EA 3OJ3A 1Q0WB 5J17A 4RM9A 3WALA 2WXQA 3T9LA 5DPSA 3PGEA 1LGRA 1KJTA 3KLSX 5AZFA 4B9KA 4ZYSA 5H8YE 4OHJA 3DBRI 4XWWA 4LDTB 1FM0D 3L54A 4F8CB 2NR2A 2B76B 2WHIA 2V4LA 3H6NA 3TMPB 3SHQA 2B3AA 1T0YA 1F52A 4EZKA 1AW7A 1NDDA 1WX7A 2Y3AA 2DBYA 2FIDA 2KXJA 3PREA 4KKIA 2BF8B 1QZEA 4S0RA 1P9DU 1L7YA 1D4BA 2KO3A 4WAFA 4I6PA 1AYFA 2KZRA 5BMIA 3L0WB 1EO6A 5LXIB 1WYGA 2BYEA 3TSSA 3IBEA 1QT9A 3NVVA 3BVZA 3ZNGC 1E8WA 4I6LB 1FCCC 3QCAA 1FFUA 2A5UA 2ZJDA 3RMKC 1KTKA 1AARA 3HUIA 3A1QA 1JMLA 4HWIB 4FJZA 1WJUA 2LGYA 1TS3A 1QOAA 4NQLB 4WWPA 4HEA1 1SE4A 4HKZE 2KTRA 1KF6B 4KZCA 2PVOD 2KVZA 5E6PA 1V2YA 3Q8BA 4PS7A 1YJJA 3D32A 2VH1A 2ZVOA 1NYRA 2WXKA 4G11A 3DBHI 1CQVA 4LK0M 1TZ1A 5JZEB 1KFYB 1OGWA 1TZOA 2QILA 1FO4A 1UH6A 1YJ1A 4JPSA 2RDHA 3R66C 3H9DA 1GG3A 2ZW1A 3PRZA 3HK0A 2H89B 4WWOA 2BWFA 3ZNID 4J3OD 2NBUA 2LXAA 2KJHB 3A9JA 3SR6A 2YLMA 2NMQA 3W9CB 3P4SB 1SXTA 1SEBD 2G45B 2D3AA 2EMTA 2LVPA 3JSVB 3KWLA 2K6QA 1C4PA 2PTLA 4YSZB 3QWZB 2Z59B 3RN9C 4LDTD 5D7GA 3KQ4A 3EHVA 4TKNA 4EZLA 2CU3A 3RNGC 1X1MA 4ZOHC 3B08A 5AEKB 3V61A 1PUTA 2AQ1B 4ZRJA 2FCNA 4O1NA 4WH4A 1PYWD 3CSTA 1E8YA 3WA0A 4A20A 4OZAA 4L2YA 2QEJC 4XE0A 3AEAB 1E7PB 3AB5A 3X23A 1P98A 4RMAA 1V5OA 5CX3A 1EU3A 1C78A 3MP9A 3HIZA 2RDGA 2CU1A 4IW0A 4W9EA 3P4PB 3I57A 1LQBA 3ETRA 1IP9A 3NHEB 3S2AA 4BVUC 3VFKA 4GLSC 3DHHC 3WIMA 1DYQA 1TYGB 3Q3NC 1UGMA 2GBKA 1HXYD 3AE2B 2N0SB 4YWGG 3Q8AA 2JQRB 1E7VA 2MA9B 2PJHA 4PS3A 3ZVVA 3PRPB 4PS8A 3HM3A 1GNUA 2KWCA 1L0VB 1I42A 2KMAA 4AP4C 2Z8LA 3QHTA 1SE9A 2M4NA 2NTSA 2L76A 4H2AA 2K3UA 2GRIA 1JROA 3NZ3A 3H7SA 2FUHB 3Q3OC 1E7UA 2HE7A 2HTME 4IWQA 1I4RA 1HZ6A 5H92C 4NAWA 4ITKA 1V1PB 1Z5SB 2KQ7A 2KQSA 2ZW0A 3R2TA 3DOWA 1WIAA 2D10A 3MJ5A 4KDIC 1E90A 1QILA 4ICVA 1ZW7A 2LVOA 1WXVA 1YNTE 3PVLA 1WI0A 1SSNA 2RPVA 1TTNA 3GZNI 2CJOA 3I3TB 4XC2A 3C0RB 2GB1A 4K81A 2YEPB 5G5GA 2KC1A 2INDC 3M95A 2MRPA 1TGZB 4KVGB 3N3KB 2ZCBA 1K52A 1LM8B 2N9PC 4FHJA 5BYRA 3RD2A 3V3XA 4C00A 4CYEA 2Z0EB 5GMVA 3AU4A 4KIKB 3TEWA 4AS1A 1ENFA 3OWEB 1ET9A 2KDBA 2BS2B 3KUZA 1WGGA 4ANXA 4KGSA 2N1WA 2WXMA 1L4ZB 4GSWA 2WDVB 3P4RB 2I1JA 1HA5A 3Q8FA 1J8CA 5E6NA 1FNVA 2AWTA 2V4IB 1Z2MA 2ZVNA 1V86A 3BYTB 1N60A 2V3PA 2BPSA 5D3DA 4WAAA 1XF5L 3R2IA 3LDZE 2QC8A 5G55A 2K0PA 3IT6B 2KDMA 1P3QU 4A9AA 2MP2A 3AI5A 4DK5A 5C2TB 3PT2B 2WS3B 1ZXIA 2WXJA 1UWMA 4FA6A 1E8XA 3MC0B 2LVQA 2KKCA 4XWTA 1KM7A 1HTOA 3QQ8B 2L05A 3ZRCA 1NI2A 4US9A 1I4PA 1MI0A 5D2MB 1ET6A 3ZKJC 1JWSD 1V9JA 4XX5A 2FIFA 2NCNA 3VR8B 4MJSB 5KHQA 3W5VB 1RFKA 2N7JA 3AE9B 1JRPA 4R3DA 4HKQA 3GB1A 5GXGB 3H7PB 1BXTA 4II2B 3P42A 3WAPA 1KOTA 4BBNF 1I4XA 4C4VA 1L4DB 2PIAA 4WQOB 1AN8A 1JRUA 2KWUB 2LHDA 3KH0A 3MC9A 3ZXRA 2JSVX 2RGFA 1K50A 3VTVA 3ZYYX 5HI1A 2X8XX 1UWXA 4W9JA 2KDFB 2L7RA 1T0RC 1VZ8A 2IGGA 4Q2JA 1C79A 4ZHOA 4A55A 2OEDA 2INNE 1EF1A 2RMMA 2WQYB 1FXAA 5CHFA 2KLCA 1D5ZC 4IDIA 4MGYE 3ZDTA 2JYTA 4M02A 3RPFC 4FLHA 3W2DA 2K25A 2QMTA 3VUWA 1LXDA 2JY6A 3PLUA 3IAS1 3QARA 2FCQA 4I6NB 3RT3B 3E9SA 5IOIA 3U7ZA 5IN7A 3T3NA 1R4NI 1PQSA 3O13A 4FN2A 5C23A 4HRSA 4ANUA 4M0WA 2GBJA 3V6EB 4II3B 5DPWA 2EELA 2I38A 3J9CA 2JYEA 3MJWA 1IUEA 3Q3JA 4NZLB 4BOSC 2WGSA 3NRZA 3QA8A 2IZVB 4ARCA 3A1QB 3ABVB 2XN9C 5L95C 2J42A 4MEMA 2W54A 1HTQA 1UBQA 3PPAA 1UUPA 4US8A 3HVZA 2KTRB 3QC8B 4D2KA 5C1ZA 2LUEA 2R2QA 4EFOA 5HHDG 1ACCA 1H8CA 2KYWA 1WRDB 3EFCA 2ZCCA 2K1FA 2BW2A 1QOBA 2OHFA 4EOYA 1XO3A 2ZPNA 1SB3C 3OLMD 1E9MA 5D6JB 2GOWA 3M3JA 4HPPA 2HJ8A 2WU2B 2M19A 3RNBC 2G4SA 3I63C 3K9OB 2IJ0A 3SFEB 4XZ4A 1WJ4A 1OQQA 1OFFA 2MBHA 2MEKA 4OVUA 1VRAB 3DWMA 1R4MB 3DHGC 2IGHA 1FD6A 3BYYB 3BK2A 2JX5A 3A9JB 5BO4B 2V1YA 2L32A 1VJKA 1TS4A 4LNIA 4ACFA 3M63B 2NBVB 2J0MA 4AUQC 2GLSA 2PW9A 2MX2A 2L0TA 3DVGX 2E3TA 3ONSA 2IBIB 3PHXB 1V80A 2Z0DB 5AZGA 1WY8A 4WIPA 2BB5A 2WXFA 4HDQA 3DDCB 2FCSA 3JYUA 1F1HA 5AUIA 4TQ0A 5FK9C 1WM2A 3BIID 2VZKB 2KTFA 1YN3A 2LXCA 2BQQA 4MGKE 2ZEQA 3DPDA 3VUYA 3W1YA 3U2SC 4LJPB 2AL6A 2EMSA 3KWVA 4DDID 1RAXA 1L0XB 3CSFA 5C3JB 2PVGC 1UF0A 4B0EA 4G50A 3KUCB 3PS6A 3AE8B 1XLNA 2IYDB 4PYUA 2W9NA 5BMHA 2WXGA 3ML8A 1IPGA 1YD8U 2RPQA 4BKGA 3CIRB 2ICIA 3GE8C 1WJ6A 3ZJVA 1M94A 1J19A 1OEYA 1MFWA 3U7DA 1NENB 2IY0B 3HVDA 2LGSA 1A5RA 1C77A 5L83A 1WYWB 2MQJA 4P1CC 3VRAB 1L2NA 1RRBA 2CHZA 2GI9A 2DYMA 4NPNA 2D07B 2XK5A 4M00A 2KNBA 2J4XA 1FRRA 4EUTA 1LO5D 2BWES 2SAKA 2L0FA 1XLQA 1IGDA 1TS5A 1QOGA 1JWMD 3AE6B 3BY4B 1PGAA 4YSXB 4NAWB 1C4CA 2NBWB 2L8JA 2KFJA 2HTHA 2JWUA 4EZJA 2O2VA 4MH8A 3DCGA 4URKA 4WWNA 1ZDXA 3N32A 2WXOA 3EGRA 2JRIB 1J0GA 3PV1A 2JZ3B 5T8IA 3HM6X 1N6ZA 2INCC 4OVZA 2INPE 4RCOA 1TBEA 1T3QA 3SD5A 1UBIA 3N20C 3VVWB 2XBBC 1OEYJ 5JH5C 4L23A 4GDLA 4IM3A 3NG0A 3N30A 2KC2A 2VZKD 2WDQB 3ZTDA 3ZNHB 3AEFB 4TQ1A 2ASQA 2N7DA 3APCA 4W9DA 2W3SA 2WXLA 3Q2AC 1WGKA 5CHWA 3LJ3A 3T8MA 1U4AA 3DBSA 4C80A 2CKHB 1M4VA 3AE1B 5EDSA 5G2NA 1IBXA 3H1UA 1GOZA 1WM3A 3ZUNA 3DHIC 2V3SA 3L17A 4DHJB 1C9FA 4KSKC 2MW5A 4ZRKA 1T0QC 4CO7A 4IKGA 3VHTC 4W9HA 4HXDA 1GC7A 1EF5A 3TIXA 2MP2B 3RNEC 3WANA 3ZQ4A 1DGJA 1OQYA 2M0AA 2QCZA 3UINB 4HCPB 2M1MA 1R4MI 2VRRB 4PT5A 2MSED 2K6DB 2JXXA 2Q5WD 2AEHA 2Y5BB 1FEHA 1T0SC 3GE3C 1K8RB 3P1MA 4YL8A 2DZIA 4F1SA 3L08A 2K8CA 1I35A 5D3IB 4ANVA 2MH7A 4M01A 2DWQA 5IP4D 2JWZA 4LCDE 1C1YB 3Q8CA 2N9LA 2J7QB 2BGFA 3VTUA 3PZDA 1WXSA 1DOYA 3NVYA 4J6IA 1G6JA 4JL9A 1T6BX 4YT0B 3EFUA 3RULA 4ANWA 2BB6A 1SJED 4C4VB 1DOIA 1GB1A 1GPXA 5E6JA 3AEEB 4P1BC 3IVFA 2G1EA 4KGTA 4AJWA 5FKAC 3PRMB 2D2QA 3EECA 2C60A 4BFRA 3V62A 4KV2A 2C7MB 3GS2A 1TKYA 3MTNB 2XEWA 4A6QA 4HDOA 4C7ZA 1XCTL 2FAZA 1WXMA 2CHWA 2DX5B 4ZYNA 1YQBA 4NQKE 2PMVA 3PZ8A 1N61A 4HCNB 4DXFA 1NI3A 5LXHA 4HJGE 1A70A 2LJ5A 3IFWB 3U52E 2UWQA 4JWSC 2PEAA 4FJYA 2L00B 5KHOA 2BBCA 2FE8A 3VXWA 5BMGA 1VLBA 3ALBA 2LRWA 1S3SG 3JVZX 2C7NB 1ZDVA 1S1QB 4MACA 4IM0A 1BMLC 4W9IA 5DCNA 2CS4A 4M0WB 4A3OA 4UDUC 4FBJB 1I4QA 5JXVA 2G3QB 4PK1A 4ARIA 1IGCA 3ZO5B 4MH0E 4AOFA 2WXIA 4ZRQA 1TKGA 2KX0A 3UI3A 2KLGA 3VUXA 2LZ6A 4MSQB 2QDFA 2AX5A 3NJTA 2Y5CA 2DZJA 1GB4A 4LJOB 1F2RC 3X0WA 2MLBA 5IA7A 1Q10A 4FADA 2KWVB 3AXCA 2RDBC 1E6EB 3QIJA 4MGIE 2GBNA 1ISNA 4DXGA 2KN4A 3RCZA 1QLBB 4YXDB 3BK1A 3BZDB 3VH4B 4GDKA 3Q3MC 1RWSA 1OTRB 2KJRA 3R3MA 4K3CA 4BKSD 3B9JA 3AH7A 3R8BA 3QAQA 1YQ4B 3QJZA 1WRIA 3PSEB 3TCAA 3NUHB 2X38A 2LI5A 1IYFA 4JWUC 4GOCA 2N7EA 3P2BA 3TBLD 1ROEA 3C19A 2WLBA 2DZMA 1Y56A 2SEBD 2K5PA 5DPTA 5TR5A 1XLOA 4TV3A 3OG5A 1FIQA 1UZXB 3U8ZA 1WR6E 1H4RA 2YEPF 2GBMA 3OAWA 1BT0A 3UIPB 1STEA 1HE8A 5BYSA 1GAQB 2JU6X 2KMMA 1MVKA 2AQ3B 2L83A 2DYBA 4LNOA 4HPLB 3PZ7A 4HROA 3VH3B 3NZSA 4P6VF 5FR6A 3NVWA 3AULA 3ZXVA 3ZJTA 2WDRB 1FXTB 2WXNA 2R2OA 4NNJB 2AL3A 1SGHA 1QF6A 2PE9A 2LHEA 1UD7A 1WX9A 3BVGA 1UGJA 3B0AA 1TKEA 3O65B 3AEDB 2JT4B 4KSLC 3N9YC 1JALA 1K53A 2HDEA 5DPRA 1HZ5A 2C9WB 3SDLC 3I9V1 3TEZA 4RGTA 1L6VA 1WR1A 1ZGUB 3MC8A 2NTTA 2K22A 4IOIE 1CMXB 3JW0X 3IXSA 1XD3B 2C5LC 2WDTB 5J18A 2WX1A 3FILB 2XK5B 2LUMA 4P16A 1MJDA 5EE3A 4E3CA 1F77A 4ICUA 3RI7C 3NOBA 1ZE3D 3PO0A 4L1BA 3DBLB 1YOVB 1R7SA 3RNCC 1F2RI 2JUOA 2V3NA 3VQIA 2D3BA 2MBQA 3BINA 1KLVA 3OJ4B 2KMCA 2M8SA 2MHJA 4JGHB 4RM8A 3CMMB 1P1AA 2QSDA 3TEXA 1JWUD 1WZ3A 2KWDA 2WX0A 2IO1B 3V6CB 3FKYA 4DDGD 3ZLZA 4RGNA 2O2VB 5CHVC 3RNFC 5I4DA 3W1SA 1CJEA 4RF0A 2MCNB 2DHZA 4ZDVA 2J0JA 4AWJA 2H88B 2O6VA 1EU4A 4G0NB 2KAJA 2WYQA 3LYYA 4S17A 3E56A 3ML9A 4REZA 1GUAB 2D3CA 2OJWA 4N58A 3N1ZC 4GDLB 1WGHA 4B6WA 1RM6C 1TIFA 3DVGY 2DLBA 4WJOA 5MPOA 2G9HD 3Q3FA 4M8NA 2RD0A 1CZPA 2ZZPB 1NEKB 3AU5A 4A90A 3Q6BA 1YN5A 2FBWB 2BKRB 3B1LX 1WSPA 4TMAB 2KD0A 2A4ZA 3RNAC 1EWCA 1IBXB 1NBFC 2IO3B 4MSMB 3TL5A 3ZGZA 1WMHA 1JW9D 3Q69A 1RLFA 2IO2B 1WGYA 4ASWC 2KACA 4F7ZA 2N9KA 5AUKA 2QHOA 2DENB 3TEYA 2N4FA 1B1ZA 4DXAB 1QKZA 1MG8A 3SEBA 3ZRFA 2PE6B 1V49A 2FUG1 3NZUA 3AE5B 1EWYC 1HEZE 4E74A 1P7FA 4W9GA 3GZNB 2KT7A 2MJEA 2JVCA 4EEWA 3AMZA 4LTUA 4YTPB 1FRDA 1V81A 1ZPSA 1P0RA 3QK0A 1J7BA 1D5MC 3FILA 2CR5A 2CHXA 2WXRA 3MHSD 2K8BA 1KLUD 1SE2A 1FFVA 4HPMB 2KDIA 2QJLA 2KFKB 2DZKA 1LFDA 3AEBB 1SF0A 2NVUI 2L52A 4KKJA 1L5PA 4DBGA 3BVMA 4BKTA 1N62A 2WP9B 4USAA 5HFYA 1Q1OA 1D6EC 3PHWB 2PLPA 4LNNA 5LLIA 4RNAA 3HHMA 3A33B 3VTWA 3Q8EA 4FJVB 4GXBA 1ESFA 3A4SC 4GMVA 1AWDA 3T3OA 1WZ0A 3LB8C 3A4RA 2ZPYA 4NY0A 1P7EA 2KHWB 3Q14C 4DWFA 4LLGM 2PKOA 1TS2A 1GC6A 1OQRA 1B9RA 4EE2A 1JCKB 5IAAC 3IT4B 1I4GA 1J7AA 1NVID 4W9LA 4WJPA 2L3ZA 5HKHA 2YVCA 4DQOC 2MJDA 1WF9A 4NAMA 1VDVA 3EA6A 2D5GA 1FNUA 4W9KA 2KK8A 1JWAD 4MM3B 1I4HA 5EE9A 3UQBA 4TSSA 2N9EB 1FMAD 3N1YC 3C8YA 2DAFA 3CF6E 1E5WA 2R61A 2KOXA 2RR9A 4YSYB 2W82A 3IG3A 4GN1A 4BAXA 3DBLI 3MHZA 1XCQL 2MBEA 5FR3A 3P63A 3AM9A 3ZW3A 2JZZA 4XDDA 4IUMB 2MBBB 1V5TA 2C7HA 1WE7A 3ZIMA 3VDZA 4FULA 1YJIA 3P4QB 1XEEA 2N9XA 3WAMA 4E71A 1MHXA 3KYCD 4CQNA 2ACZB 1N63A 4ZRPA 3B2GA 3DQVA 1VCBA 2BS3B 5J2RA 2N1VA 2ONQA 1JQ4A 4JX1C 2K39A 3GP7A 2OOBB 1ZP0B 4GDKB 2Y5PA 3UIOB 4K3BA 3ZDMC 3QX1A 1PGBA 2KFKA 4WQMA 4WURA 4HLEA 4AJYB 3KVFB 5E6OA 3A9KB 4A8XC 3UF8A 1ZOYB 4C7YA 1ZKHA 1R4NB 4IG7B 1C3TA 2JRHA 4IM2A 1GJZA 4JQWC 1RFAA 4XGAB 2MBOA 4BZAA 4IWPA 2MWSB 3AN1A 3HRDD 2I2YA 3NS1A 2BKFA 4MT5A 2L1AA 1QOFA 2HD5B 4LNFA 5IO9A 3URYA 3N1XC 1Q5WB 3WCQA 4BOZB 1XXGA 4N9F4 4P7IA 4GIVA 3PTFC 1MHHE 1WE6A 1YX6B 1ZUD2 1E8ZA 2JXTA 1I7HA 1XT9B 4RGOS 3GOEA 1KH0A 2IDYA 1E0ZA 3ZNZB 1SBBB 2OJRA 1TJEA 2KANA 3DVNV 4K7WA 1UELA 3JSVA 3KYDD 4JIOU 2LGXA 3IHPC 5TSSA 1N5WA 3AE4B 2BVCA 4KDLB 1BUIC 2WU5B 3ECIA 3I5JC 2KJ6A 3CWIA 1XLPA 2ON8A 3L4PA 3KUDB 4DHZB 1V97A 4MM3A 4HVBA 3V60A 3RUIB 2WXPA 3AE3B 4DHJD 3IAM1 5G5HA 4HK2A 3ZJUA 3SU8X 5LNK1 2DYOA 4GU2A 2KX3A 4WJNA 3AECB 2BYVE 2BTEA 4A3PA 5D94A 3R7QA 4BBNC 4N59A 3MFGA 3L16A 1WWTA 4YTMB 2LD9A 4B0MA 1PGXA 4LNKA 4AQ7A 3FC4A 2LMCA 3ENEA 2LRUA 4MELA 2LASA 2NPTB 4ZRIA 5BYQA 2J52A 1D3ZA 3M62B 1HQRD 4EKUA 4RH6A 2EKEC 2TSSA 4WWMA 4IWOA 1WXAA 1TY2A 4TUUA 1YIWA 4MGZE 2CJNA 4KZ0A 1KRHA 3DBRB 1L6UA 4K1RB 1V1OA 3U4EG 4C56C 2M0XA 1L0YB 3AE7B 2EKIA 3EC8A 3U30A 3L10B 1PFDA 2I1KA 1D5XC 1ZXHA 4X57B 1F9JA 2KQ4X 2M17A 3A9KA 4DHZE 4RFBA 2UYZB 1WX8A 5HG2A 1JWBD 5CTRC 2JPHA 1FPYA 1EM7A 1V8CA 4RGMA 3UQAA 2BT6A 3WAOA 2ZNVB 3RZFA 3SFDB 2FCMA 2LJIA 1QQRA 3RFZB 2LFIA 1SIJA 4RF1A 2V0GA 2D11A 2BS4B 3AEGB 3RZWC 4BKSA 1V1PA 2O6VB 1RYJA 2GMIC 2MJ3A 5IKCM 1TT5B 2BYFA 2NS5A 3EUB2 3DWGC 4ZHPA 2V9HA 2GBRA 4OZBA 1SIFA 3NVZA 2W55A 2KDEB 2QIEB 1YN4A 5JHAA 2M56B 4XDCA 2IO0B 2VH2A 4W9CA 5AZHA 1T5XD 3DBHB 4KX6B 2WWZA 4GB9A 2DNFA 2FNJB 3VR9B 4KGRA 2AQ2B 1C4AA 5EE1A 1VZ6A 2ZNVC 1WMHB 4GGQA 3NS8A
chains in the Genus database with same CATH topology
1M4VA 3AE1B 4FXCA 1J7CA 1FNWA 3ZGZA 1CK1A 1JW9D 4YTNB 1C76A 3TEWA 1IBXA 1GOZA 4AS1A 1ENFA 3OWEB 1E10A 3Q69A 1FXIA 1ET9A 1K51A 3LXFA 2BS2B 3H8HA 1N5XA 2KACA 4KGSA 1C9FA 1YMHE 2WXMA 1L4ZB 2N9KA 5AUKA 1PDXA 2WDVB 1UNSA 3TEYA 3P4RB 4N6EB 4IKGA 1HA5A 1B1ZA 3Q8FA 1FCLA 1QKZA 2IGDA 1FNVA 4JE3B 3SEBA 2FUG1 2E6XA 4OZCA 3AE5B 1EWYC 1HEZE 2V4IB 3BYTB 1N60A 2V3PA 5D3DA 1P7FA 3ZQ4A 2IPKD 1XF5L 3R2IA 2MJEA 1DGJA 2K0PA 2M0AA 3IT6B 2KDMA 3AMZA 4A9AA 3FAHA 4LTUA 4PT5A 1KLGD 4YTPB 1FRDA 1ZPSA 2Q5WD 1FEHA 5C2TB 2WS3B 1ZXIA 1J7BA 2WXJA 1TY0A 1D5MC 1UWMA 1VZ7A 3FILA 3P1MA 2WXRA 1KLUD 3MC0B 5D3IB 1SE2A 2W3RA 2MH7A 4OW0A 4XWTA 1FFVA 2DWQA 2JZPA 1DOXA 2QJLA 2BYTA 3AEBB 4US9A 1SF0A 3Q8CA 2L52A 1I4PA 1MI0A 2N9LA 2XNAC 4KKJA 1L5PA 1ET6A 3BVMA 1JWSD 3VRBB 1DOYA 3NVYA 2WNMA 1N62A 3BWUD 1T6BX 2WP9B 4YT0B 3VR8B 4USAA 5HFYA 3W5VB 1RFKA 2N7JA 3AE9B 1JRPA 3B2FA 4R3DA 1D6EC 4HKQA 2BB6A 3GB1A 5GXGB 1BXTA 1SJED 2PLPA 1YQ3B 3P42A 1DOIA 3TUOA 1GB1A 4RNAA 1GPXA 5E6JA 2J53A 5EE0A 1VR9A 3AEEB 4KGTA 2G1EA 3Q8EA 1I4XA 5FKAC 1ESFA 1L4DB 2PIAA 4NJCA 1SJHD 1AN8A 1AWDA 3T3OA 2LHDA 3GS2A 3LB8C 1SE3A 1TKYA 2LEKA 2K9XA 2JSVX 1F0ZA 1MPEA 1NYQA 1P7EA 1K50A 4LLGM 2PKOA 1TS2A 4A6QA 3V05A 4C7ZA 1XCTL 3ZYYX 5HI1A 1OQRA 1B9RA 1WXQA 4EE2A 2WXHA 3AV8A 1JCKB 1UWXA 3W5UB 3IT4B 1I4GA 1J7AA 1NVID 2PMVA 1VZ8A 2LGIA 2IGGA 4Q2JA 4DQOC 1C79A 3PZ8A 4ZHOA 1N61A 4DXFA 1NI3A 2MJDA 2WXQA 4A55A 2OEDA 2INNE 4HJGE 2RMMA 4NAMA 1A70A 1VDVA 3KLSX 2WQYB 1FXAA 3U52E 3EA6A 4JWSC 2D5GA 4ZYSA 1D5ZC 4OHJA 4IDIA 5H8YE 1FNUA 2BBCA 2FE8A 4XWWA 1JWAD 5BMGA 1FM0D 2B76B 4MM3B 1I4HA 2JYTA 5EE9A 1VLBA 4TSSA 3RPFC 1ZDVA 3W2DA 1FMAD 2QMTA 3C8YA 4MACA 1BMLC 1AW7A 2R61A 3IAS1 4YSYB 2Y3AA 2W82A 2DBYA 4UDUC 4KKIA 3E9SA 3U7ZA 1I4QA 3T3NA 3MHZA 5JXVA 1XCQL 3O13A 1D4BA 4WAFA 4HRSA 4M0WA 4ARIA 1IGCA 5FR3A 1AYFA 2EELA 5BMIA 2WXIA 2I38A 3J9CA 3P63A 4ZRQA 1TKGA 2JYEA 3UI3A 3AM9A 1IUEA 4NZLB 1WYGA 3TSSA 4XDDA 1QT9A 3NRZA 3NVVA 3BVZA 4ARCA 1FCCC 1FFUA 2AX5A 3ABVB 2XN9C 2J42A 1YJIA 2Y5CA 3P4QB 1XEEA 1GB4A 2W54A 1KTKA 1MHXA 4CQNA 3HUIA 1F2RC 2ACZB 1JMLA 1N63A 4ZRPA 3B2GA 1UUPA 2BS3B 4US8A 3HVZA 1Q10A 2ONQA 1JQ4A 1TS3A 4JX1C 1QOAA 4D2KA 4HEA1 1SE4A 1E6EB 5HHDG 1ACCA 3GP7A 4HKZE 1ZP0B 4GDKB 4DXGA 2Y5PA 2KN4A 1KF6B 2PVOD 1QLBB 4YXDB 3BK1A 3BZDB 1PGBA 2BW2A 4WQMA 4WURA 3Q8BA 1QOBA 2OHFA 1XO3A 1YJJA 1RWSA 1SB3C 4A8XC 1ZOYB 4C7YA 1NYRA 1E9MA 2WXKA 3B9JA 3AH7A 3R8BA 2WU2B 2M19A 1YQ4B 1CQVA 4LK0M 2IJ0A 1WRIA 3SFEB 1KFYB 1TZOA 2QILA 3AN1A 3NUHB 1OQQA 2X38A 3HRDD 1OFFA 1FO4A 2I2YA 3NS1A 4JWUC 4JPSA 2RDHA 2MEKA 1VRAB 4MT5A 3DWMA 2L1AA 1QOFA 2ZW1A 2IGHA 1FD6A 3BYYB 3BK2A 3URYA 2JX5A 1ROEA 2WLBA 2H89B 3WCQA 1Y56A 2SEBD 2L32A 1XXGA 1VJKA 1TS4A 4J3OD 2K5PA 1XLOA 1MHHE 3SR6A 2NMQA 3W9CB 3P4SB 1SXTA 2PW9A 1FIQA 1SEBD 1ZUD2 2E3TA 2JXTA 1I7HA 2YEPF 4RGOS 3KWLA 1KH0A 2IDYA 1E0ZA 1C4PA 2PTLA 4YSZB 1SBBB 1STEA 5BYSA 1TJEA 1GAQB 2JU6X 2KMMA 1MVKA 5D7GA 3KQ4A 4WIPA 2AQ3B 2BB5A 2WXFA 1N5WA 5TSSA 3AE4B 2CU3A 2L83A 1BUIC 2WU5B 3CWIA 1XLPA 2ON8A 3PZ7A 3L4PA 4HROA 4ZOHC 5AUIA 1V97A 4TQ0A 5FK9C 4P6VF 3NVWA 3BIID 2WXPA 2VZKB 3AE3B 3IAM1 5G5HA 1YN3A 3ZJTA 1PUTA 3ZJUA 2WDRB 2AQ1B 5LNK1 2DYOA 2WXNA 3U2SC 3AECB 2BTEA 4O1NA 1QF6A 4WH4A 3KWVA 1PYWD 2LHEA 4N59A 3MFGA 1WWTA 4YTMB 1L0XB 3BVGA 4OZAA 4B0MA 1PGXA 4AQ7A 3FC4A 5C3JB 4L2YA 2PVGC 4B0EA 1UGJA 2LMCA 1TKEA 2QEJC 3AEDB 4XE0A 3AEAB 1E7PB 5BYQA 2J52A 3AB5A 1JALA 3N9YC 3AE8B 1XLNA 1K53A 2HDEA 1HQRD 1HZ5A 1EU3A 3TEZA 3I9V1 1C78A 4RGTA 4RH6A 1L6VA 3MP9A 5BMHA 2WXGA 2RDGA 2TSSA 3CIRB 3P4PB 4WWMA 2ICIA 3I57A 3ETRA 1TY2A 2NTTA 2K22A 3V3XA 4IOIE 2CJNA 3IXSA 1KRHA 1L6UA 3ZJVA 4GLSC 1NENB 1V1OA 3HVDA 1DYQA 1TYGB 1C77A 3FILB 3U4EG 2LUMA 4C56C 4P16A 3VRAB 1HXYD 5EE3A 3AE2B 1L0YB 3AE7B 2N0SB 2GI9A 1F77A 2DYMA 2EKIA 4YWGG 3Q8AA 2J4XA 1PFDA 1ZE3D 1D5XC 3PO0A 4L1BA 2JQRB 1ZXHA 1R7SA 1FRRA 2KQ4X 1LO5D 1F2RI 2SAKA 4RFBA 2V3NA 1XLQA 3VQIA 1L0VB 5HG2A 1JWBD 1IGDA 1TS5A 1QOGA 1EM7A 1V8CA 4RGMA 1JWMD 2Z8LA 2BT6A 2NTSA 4H2AA 3SFDB 2K3UA 2QSDA 3AE6B 2GRIA 2LJIA 1QQRA 1JROA 3TEXA 1JWUD 3NZ3A 2LFIA 3RFZB 2KWDA 1PGAA 4YSXB 4NAWB 1C4CA 1SIJA 4RF1A 2V0GA 2HTME 1I4RA 1HZ6A 5H92C 4RGNA 4ITKA 5I4DA 1V1PB 2BS4B 3W1SA 2JWUA 2ZW0A 3AEGB 1CJEA 4RF0A 3R2TA 3MJ5A 4MH8A 1V1PA 1QILA 1RYJA 1ZDXA 2H88B 2WXOA 3EGRA 2MJ3A 1YNTE 1EU4A 5T8IA 2KAJA 3LYYA 3E56A 3EUB2 4REZA 3DWGC 4ZHPA 1SSNA 2RPVA 4OVZA 2INPE 4OZBA 4RCOA 1T3QA 3NVZA 4N58A 2W55A 2CJOA 4GDLB 2GB1A 1RM6C 2QIEB 1YN4A 2YEPB 2M56B 2DLBA 4XDCA 5MPOA 2G9HD 5G5GA 1CZPA 4L23A 1T5XD 4KX6B 1NEKB 2VZKD 2WDQB 4A90A 1YN5A 3AEFB 4TQ1A 2FBWB 3VR9B 1K52A 1WSPA 4KGRA 2AQ2B 4TMAB 1C4AA 2W3SA 2WXLA 1WGKA 5EE1A 1VZ6A 5BYRA 1EWCA 1IBXB 4C80A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H8H A;  3GS2 A;  3IXS A; 
#chains in the Genus database with same CATH topology
 4FXC A;  4MDK E;  3KW5 B;  1J7C A;  3W1S C;  1FNW A;  1CK1 A;  2DAJ A;  4YTN B;  1C76 A;  1E10 A;  2PPH A;  4JLC A;  2JF5 A;  1FXI A;  1K51 A;  4IC7 B;  3LXF A;  4KIK A;  4CHK A;  3H8H A;  1N5X A;  3L13 A;  1YMH E;  1PDX A;  1UNS A;  4N6E B;  1FCL A;  3ZTC A;  4WJQ A;  2IGD A;  2UU7 A;  1XQQ A;  4HJK A;  2NPT A;  4JE3 B;  1Y8R C;  2AYO B;  2E6X A;  4OZC A;  2G4D B;  2IPK D;  1WGD A;  2LWP A;  3FAH A;  3DVN U;  1KLG D;  3R7R A;  2D3G A;  1TY0 A;  1VZ7 A;  4QAY A;  4OVV A;  3RYT A;  3APF A;  3NY5 A;  2J0K A;  2W3R A;  4OW0 A;  2JZP A;  4NJ6 A;  1DOX A;  2BYT A;  4G3X B;  1MG4 A;  2KN5 A;  4FHK A;  2XNA C;  3K9P B;  4M8M A;  3VRB B;  1WFY A;  2WNM A;  2LGD A;  3BWU D;  2K8H A;  4K7U A;  1EUV B;  2KVR A;  1YX5 B;  4XYC A;  3B2F A;  1WH3 A;  3VAW A;  4K7S A;  4MJS A;  2REX A;  1YQ3 B;  3TUO A;  2J53 A;  5EE0 A;  1VR9 A;  2RSU A;  2IY1 B;  3H7P A;  2O6V D;  4W9F A;  3APD A;  4NJC A;  1SJH D;  1SE3 A;  4PYZ A;  2LEK A;  3UGB B;  1WGR A;  2K9X A;  1F0Z A;  1MPE A;  1NYQ A;  1WJN A;  3V05 A;  1WXQ A;  1VD2 A;  2WXH A;  3AV8 A;  4NJ7 A;  5JHB A;  3W5U B;  3PLV A;  4B95 A;  3TJP A;  2LGI A;  2HJ1 A;  1V6E A;  3OJ3 A;  1Q0W B;  5J17 A;  4RM9 A;  3WAL A;  2WXQ A;  3T9L A;  5DPS A;  3PGE A;  1LGR A;  1KJT A;  3KLS X;  5AZF A;  4B9K A;  4ZYS A;  5H8Y E;  4OHJ A;  3DBR I;  4XWW A;  4LDT B;  1FM0 D;  3L54 A;  4F8C B;  2NR2 A;  2B76 B;  2WHI A;  2V4L A;  3H6N A;  3TMP B;  3SHQ A;  2B3A A;  1T0Y A;  1F52 A;  4EZK A;  1AW7 A;  1NDD A;  1WX7 A;  2Y3A A;  2DBY A;  2FID A;  2KXJ A;  3PRE A;  4KKI A;  2BF8 B;  1QZE A;  4S0R A;  1P9D U;  1L7Y A;  1D4B A;  2KO3 A;  4WAF A;  4I6P A;  1AYF A;  2KZR A;  5BMI A;  3L0W B;  1EO6 A;  5LXI B;  1WYG A;  2BYE A;  3TSS A;  3IBE A;  1QT9 A;  3NVV A;  3BVZ A;  3ZNG C;  1E8W A;  4I6L B;  1FCC C;  3QCA A;  1FFU A;  2A5U A;  2ZJD A;  3RMK C;  1KTK A;  1AAR A;  3HUI A;  3A1Q A;  1JML A;  4HWI B;  4FJZ A;  1WJU A;  2LGY A;  1TS3 A;  1QOA A;  4NQL B;  4WWP A;  4HEA 1;  1SE4 A;  4HKZ E;  2KTR A;  1KF6 B;  4KZC A;  2PVO D;  2KVZ A;  5E6P A;  1V2Y A;  3Q8B A;  4PS7 A;  1YJJ A;  3D32 A;  2VH1 A;  2ZVO A;  1NYR A;  2WXK A;  4G11 A;  3DBH I;  1CQV A;  4LK0 M;  1TZ1 A;  5JZE B;  1KFY B;  1OGW A;  1TZO A;  2QIL A;  1FO4 A;  1UH6 A;  1YJ1 A;  4JPS A;  2RDH A;  3R66 C;  3H9D A;  1GG3 A;  2ZW1 A;  3PRZ A;  3HK0 A;  2H89 B;  4WWO A;  2BWF A;  3ZNI D;  4J3O D;  2NBU A;  2LXA A;  2KJH B;  3A9J A;  3SR6 A;  2YLM A;  2NMQ A;  3W9C B;  3P4S B;  1SXT A;  1SEB D;  2G45 B;  2D3A A;  2EMT A;  2LVP A;  3JSV B;  3KWL A;  2K6Q A;  1C4P A;  2PTL A;  4YSZ B;  3QWZ B;  2Z59 B;  3RN9 C;  4LDT D;  5D7G A;  3KQ4 A;  3EHV A;  4TKN A;  4EZL A;  2CU3 A;  3RNG C;  1X1M A;  4ZOH C;  3B08 A;  5AEK B;  3V61 A;  1PUT A;  2AQ1 B;  4ZRJ A;  2FCN A;  4O1N A;  4WH4 A;  1PYW D;  3CST A;  1E8Y A;  3WA0 A;  4A20 A;  4OZA A;  4L2Y A;  2QEJ C;  4XE0 A;  3AEA B;  1E7P B;  3AB5 A;  3X23 A;  1P98 A;  4RMA A;  1V5O A;  5CX3 A;  1EU3 A;  1C78 A;  3MP9 A;  3HIZ A;  2RDG A;  2CU1 A;  4IW0 A;  4W9E A;  3P4P B;  3I57 A;  1LQB A;  3ETR A;  1IP9 A;  3NHE B;  3S2A A;  4BVU C;  3VFK A;  4GLS C;  3DHH C;  3WIM A;  1DYQ A;  1TYG B;  3Q3N C;  1UGM A;  2GBK A;  1HXY D;  3AE2 B;  2N0S B;  4YWG G;  3Q8A A;  2JQR B;  1E7V A;  2MA9 B;  2PJH A;  4PS3 A;  3ZVV A;  3PRP B;  4PS8 A;  3HM3 A;  1GNU A;  2KWC A;  1L0V B;  1I42 A;  2KMA A;  4AP4 C;  2Z8L A;  3QHT A;  1SE9 A;  2M4N A;  2NTS A;  2L76 A;  4H2A A;  2K3U A;  2GRI A;  1JRO A;  3NZ3 A;  3H7S A;  2FUH B;  3Q3O C;  1E7U A;  2HE7 A;  2HTM E;  4IWQ A;  1I4R A;  1HZ6 A;  5H92 C;  4NAW A;  4ITK A;  1V1P B;  1Z5S B;  2KQ7 A;  2KQS A;  2ZW0 A;  3R2T A;  3DOW A;  1WIA A;  2D10 A;  3MJ5 A;  4KDI C;  1E90 A;  1QIL A;  4ICV A;  1ZW7 A;  2LVO A;  1WXV A;  1YNT E;  3PVL A;  1WI0 A;  1SSN A;  2RPV A;  1TTN A;  3GZN I;  2CJO A;  3I3T B;  4XC2 A;  3C0R B;  2GB1 A;  4K81 A;  2YEP B;  5G5G A;  2KC1 A;  2IND C;  3M95 A;  2MRP A;  1TGZ B;  4KVG B;  3N3K B;  2ZCB A;  1K52 A;  1LM8 B;  2N9P C;  4FHJ A;  5BYR A;  3RD2 A;  3V3X A;  4C00 A;  4CYE A;  2Z0E B;  5GMV A;  3AU4 A;  4KIK B;  3TEW A;  4AS1 A;  1ENF A;  3OWE B;  1ET9 A;  2KDB A;  2BS2 B;  3KUZ A;  1WGG A;  4ANX A;  4KGS A;  2N1W A;  2WXM A;  1L4Z B;  4GSW A;  2WDV B;  3P4R B;  2I1J A;  1HA5 A;  3Q8F A;  1J8C A;  5E6N A;  1FNV A;  2AWT A;  2V4I B;  1Z2M A;  2ZVN A;  1V86 A;  3BYT B;  1N60 A;  2V3P A;  2BPS A;  5D3D A;  4WAA A;  1XF5 L;  3R2I A;  3LDZ E;  2QC8 A;  5G55 A;  2K0P A;  3IT6 B;  2KDM A;  1P3Q U;  4A9A A;  2MP2 A;  3AI5 A;  4DK5 A;  5C2T B;  3PT2 B;  2WS3 B;  1ZXI A;  2WXJ A;  1UWM A;  4FA6 A;  1E8X A;  3MC0 B;  2LVQ A;  2KKC A;  4XWT A;  1KM7 A;  1HTO A;  3QQ8 B;  2L05 A;  3ZRC A;  1NI2 A;  4US9 A;  1I4P A;  1MI0 A;  5D2M B;  1ET6 A;  3ZKJ C;  1JWS D;  1V9J A;  4XX5 A;  2FIF A;  2NCN A;  3VR8 B;  4MJS B;  5KHQ A;  3W5V B;  1RFK A;  2N7J A;  3AE9 B;  1JRP A;  4R3D A;  4HKQ A;  3GB1 A;  5GXG B;  3H7P B;  1BXT A;  4II2 B;  3P42 A;  3WAP A;  1KOT A;  4BBN F;  1I4X A;  4C4V A;  1L4D B;  2PIA A;  4WQO B;  1AN8 A;  1JRU A;  2KWU B;  2LHD A;  3KH0 A;  3MC9 A;  3ZXR A;  2JSV X;  2RGF A;  1K50 A;  3VTV A;  3ZYY X;  5HI1 A;  2X8X X;  1UWX A;  4W9J A;  2KDF B;  2L7R A;  1T0R C;  1VZ8 A;  2IGG A;  4Q2J A;  1C79 A;  4ZHO A;  4A55 A;  2OED A;  2INN E;  1EF1 A;  2RMM A;  2WQY B;  1FXA A;  5CHF A;  2KLC A;  1D5Z C;  4IDI A;  4MGY E;  3ZDT A;  2JYT A;  4M02 A;  3RPF C;  4FLH A;  3W2D A;  2K25 A;  2QMT A;  3VUW A;  1LXD A;  2JY6 A;  3PLU A;  3IAS 1;  3QAR A;  2FCQ A;  4I6N B;  3RT3 B;  3E9S A;  5IOI A;  3U7Z A;  5IN7 A;  3T3N A;  1R4N I;  1PQS A;  3O13 A;  4FN2 A;  5C23 A;  4HRS A;  4ANU A;  4M0W A;  2GBJ A;  3V6E B;  4II3 B;  5DPW A;  2EEL A;  2I38 A;  3J9C A;  2JYE A;  3MJW A;  1IUE A;  3Q3J A;  4NZL B;  4BOS C;  2WGS A;  3NRZ A;  3QA8 A;  2IZV B;  4ARC A;  3A1Q B;  3ABV B;  2XN9 C;  5L95 C;  2J42 A;  4MEM A;  2W54 A;  1HTQ A;  1UBQ A;  3PPA A;  1UUP A;  4US8 A;  3HVZ A;  2KTR B;  3QC8 B;  4D2K A;  5C1Z A;  2LUE A;  2R2Q A;  4EFO A;  5HHD G;  1ACC A;  1H8C A;  2KYW A;  1WRD B;  3EFC A;  2ZCC A;  2K1F A;  2BW2 A;  1QOB A;  2OHF A;  4EOY A;  1XO3 A;  2ZPN A;  1SB3 C;  3OLM D;  1E9M A;  5D6J B;  2GOW A;  3M3J A;  4HPP A;  2HJ8 A;  2WU2 B;  2M19 A;  3RNB C;  2G4S A;  3I63 C;  3K9O B;  2IJ0 A;  3SFE B;  4XZ4 A;  1WJ4 A;  1OQQ A;  1OFF A;  2MBH A;  2MEK A;  4OVU A;  1VRA B;  3DWM A;  1R4M B;  3DHG C;  2IGH A;  1FD6 A;  3BYY B;  3BK2 A;  2JX5 A;  3A9J B;  5BO4 B;  2V1Y A;  2L32 A;  1VJK A;  1TS4 A;  4LNI A;  4ACF A;  3M63 B;  2NBV B;  2J0M A;  4AUQ C;  2GLS A;  2PW9 A;  2MX2 A;  2L0T A;  3DVG X;  2E3T A;  3ONS A;  2IBI B;  3PHX B;  1V80 A;  2Z0D B;  5AZG A;  1WY8 A;  4WIP A;  2BB5 A;  2WXF A;  4HDQ A;  3DDC B;  2FCS A;  3JYU A;  1F1H A;  5AUI A;  4TQ0 A;  5FK9 C;  1WM2 A;  3BII D;  2VZK B;  2KTF A;  1YN3 A;  2LXC A;  2BQQ A;  4MGK E;  2ZEQ A;  3DPD A;  3VUY A;  3W1Y A;  3U2S C;  4LJP B;  2AL6 A;  2EMS A;  3KWV A;  4DDI D;  1RAX A;  1L0X B;  3CSF A;  5C3J B;  2PVG C;  1UF0 A;  4B0E A;  4G50 A;  3KUC B;  3PS6 A;  3AE8 B;  1XLN A;  2IYD B;  4PYU A;  2W9N A;  5BMH A;  2WXG A;  3ML8 A;  1IPG A;  1YD8 U;  2RPQ A;  4BKG A;  3CIR B;  2ICI A;  3GE8 C;  1WJ6 A;  3ZJV A;  1M94 A;  1J19 A;  1OEY A;  1MFW A;  3U7D A;  1NEN B;  2IY0 B;  3HVD A;  2LGS A;  1A5R A;  1C77 A;  5L83 A;  1WYW B;  2MQJ A;  4P1C C;  3VRA B;  1L2N A;  1RRB A;  2CHZ A;  2GI9 A;  2DYM A;  4NPN A;  2D07 B;  2XK5 A;  4M00 A;  2KNB A;  2J4X A;  1FRR A;  4EUT A;  1LO5 D;  2BWE S;  2SAK A;  2L0F A;  1XLQ A;  1IGD A;  1TS5 A;  1QOG A;  1JWM D;  3AE6 B;  3BY4 B;  1PGA A;  4YSX B;  4NAW B;  1C4C A;  2NBW B;  2L8J A;  2KFJ A;  2HTH A;  2JWU A;  4EZJ A;  2O2V A;  4MH8 A;  3DCG A;  4URK A;  4WWN A;  1ZDX A;  3N32 A;  2WXO A;  3EGR A;  2JRI B;  1J0G A;  3PV1 A;  2JZ3 B;  5T8I A;  3HM6 X;  1N6Z A;  2INC C;  4OVZ A;  2INP E;  4RCO A;  1TBE A;  1T3Q A;  3SD5 A;  1UBI A;  3N20 C;  3VVW B;  2XBB C;  1OEY J;  5JH5 C;  4L23 A;  4GDL A;  4IM3 A;  3NG0 A;  3N30 A;  2KC2 A;  2VZK D;  2WDQ B;  3ZTD A;  3ZNH B;  3AEF B;  4TQ1 A;  2ASQ A;  2N7D A;  3APC A;  4W9D A;  2W3S A;  2WXL A;  3Q2A C;  1WGK A;  5CHW A;  3LJ3 A;  3T8M A;  1U4A A;  3DBS A;  4C80 A;  2CKH B;  1M4V A;  3AE1 B;  5EDS A;  5G2N A;  1IBX A;  3H1U A;  1GOZ A;  1WM3 A;  3ZUN A;  3DHI C;  2V3S A;  3L17 A;  4DHJ B;  1C9F A;  4KSK C;  2MW5 A;  4ZRK A;  1T0Q C;  4CO7 A;  4IKG A;  3VHT C;  4W9H A;  4HXD A;  1GC7 A;  1EF5 A;  3TIX A;  2MP2 B;  3RNE C;  3WAN A;  3ZQ4 A;  1DGJ A;  1OQY A;  2M0A A;  2QCZ A;  3UIN B;  4HCP B;  2M1M A;  1R4M I;  2VRR B;  4PT5 A;  2MSE D;  2K6D B;  2JXX A;  2Q5W D;  2AEH A;  2Y5B B;  1FEH A;  1T0S C;  3GE3 C;  1K8R B;  3P1M A;  4YL8 A;  2DZI A;  4F1S A;  3L08 A;  2K8C A;  1I35 A;  5D3I B;  4ANV A;  2MH7 A;  4M01 A;  2DWQ A;  5IP4 D;  2JWZ A;  4LCD E;  1C1Y B;  3Q8C A;  2N9L A;  2J7Q B;  2BGF A;  3VTU A;  3PZD A;  1WXS A;  1DOY A;  3NVY A;  4J6I A;  1G6J A;  4JL9 A;  1T6B X;  4YT0 B;  3EFU A;  3RUL A;  4ANW A;  2BB6 A;  1SJE D;  4C4V B;  1DOI A;  1GB1 A;  1GPX A;  5E6J A;  3AEE B;  4P1B C;  3IVF A;  2G1E A;  4KGT A;  4AJW A;  5FKA C;  3PRM B;  2D2Q A;  3EEC A;  2C60 A;  4BFR A;  3V62 A;  4KV2 A;  2C7M B;  3GS2 A;  1TKY A;  3MTN B;  2XEW A;  4A6Q A;  4HDO A;  4C7Z A;  1XCT L;  2FAZ A;  1WXM A;  2CHW A;  2DX5 B;  4ZYN A;  1YQB A;  4NQK E;  2PMV A;  3PZ8 A;  1N61 A;  4HCN B;  4DXF A;  1NI3 A;  5LXH A;  4HJG E;  1A70 A;  2LJ5 A;  3IFW B;  3U52 E;  2UWQ A;  4JWS C;  2PEA A;  4FJY A;  2L00 B;  5KHO A;  2BBC A;  2FE8 A;  3VXW A;  5BMG A;  1VLB A;  3ALB A;  2LRW A;  1S3S G;  3JVZ X;  2C7N B;  1ZDV A;  1S1Q B;  4MAC A;  4IM0 A;  1BML C;  4W9I A;  5DCN A;  2CS4 A;  4M0W B;  4A3O A;  4UDU C;  4FBJ B;  1I4Q A;  5JXV A;  2G3Q B;  4PK1 A;  4ARI A;  1IGC A;  3ZO5 B;  4MH0 E;  4AOF A;  2WXI A;  4ZRQ A;  1TKG A;  2KX0 A;  3UI3 A;  2KLG A;  3VUX A;  2LZ6 A;  4MSQ B;  2QDF A;  2AX5 A;  3NJT A;  2Y5C A;  2DZJ A;  1GB4 A;  4LJO B;  1F2R C;  3X0W A;  2MLB A;  5IA7 A;  1Q10 A;  4FAD A;  2KWV B;  3AXC A;  2RDB C;  1E6E B;  3QIJ A;  4MGI E;  2GBN A;  1ISN A;  4DXG A;  2KN4 A;  3RCZ A;  1QLB B;  4YXD B;  3BK1 A;  3BZD B;  3VH4 B;  4GDK A;  3Q3M C;  1RWS A;  1OTR B;  2KJR A;  3R3M A;  4K3C A;  4BKS D;  3B9J A;  3AH7 A;  3R8B A;  3QAQ A;  1YQ4 B;  3QJZ A;  1WRI A;  3PSE B;  3TCA A;  3NUH B;  2X38 A;  2LI5 A;  1IYF A;  4JWU C;  4GOC A;  2N7E A;  3P2B A;  3TBL D;  1ROE A;  3C19 A;  2WLB A;  2DZM A;  1Y56 A;  2SEB D;  2K5P A;  5DPT A;  5TR5 A;  1XLO A;  4TV3 A;  3OG5 A;  1FIQ A;  1UZX B;  3U8Z A;  1WR6 E;  1H4R A;  2YEP F;  2GBM A;  3OAW A;  1BT0 A;  3UIP B;  1STE A;  1HE8 A;  5BYS A;  1GAQ B;  2JU6 X;  2KMM A;  1MVK A;  2AQ3 B;  2L83 A;  2DYB A;  4LNO A;  4HPL B;  3PZ7 A;  4HRO A;  3VH3 B;  3NZS A;  4P6V F;  5FR6 A;  3NVW A;  3AUL A;  3ZXV A;  3ZJT A;  2WDR B;  1FXT B;  2WXN A;  2R2O A;  4NNJ B;  2AL3 A;  1SGH A;  1QF6 A;  2PE9 A;  2LHE A;  1UD7 A;  1WX9 A;  3BVG A;  1UGJ A;  3B0A A;  1TKE A;  3O65 B;  3AED B;  2JT4 B;  4KSL C;  3N9Y C;  1JAL A;  1K53 A;  2HDE A;  5DPR A;  1HZ5 A;  2C9W B;  3SDL C;  3I9V 1;  3TEZ A;  4RGT A;  1L6V A;  1WR1 A;  1ZGU B;  3MC8 A;  2NTT A;  2K22 A;  4IOI E;  1CMX B;  3JW0 X;  3IXS A;  1XD3 B;  2C5L C;  2WDT B;  5J18 A;  2WX1 A;  3FIL B;  2XK5 B;  2LUM A;  4P16 A;  1MJD A;  5EE3 A;  4E3C A;  1F77 A;  4ICU A;  3RI7 C;  3NOB A;  1ZE3 D;  3PO0 A;  4L1B A;  3DBL B;  1YOV B;  1R7S A;  3RNC C;  1F2R I;  2JUO A;  2V3N A;  3VQI A;  2D3B A;  2MBQ A;  3BIN A;  1KLV A;  3OJ4 B;  2KMC A;  2M8S A;  2MHJ A;  4JGH B;  4RM8 A;  3CMM B;  1P1A A;  2QSD A;  3TEX A;  1JWU D;  1WZ3 A;  2KWD A;  2WX0 A;  2IO1 B;  3V6C B;  3FKY A;  4DDG D;  3ZLZ A;  4RGN A;  2O2V B;  5CHV C;  3RNF C;  5I4D A;  3W1S A;  1CJE A;  4RF0 A;  2MCN B;  2DHZ A;  4ZDV A;  2J0J A;  4AWJ A;  2H88 B;  2O6V A;  1EU4 A;  4G0N B;  2KAJ A;  2WYQ A;  3LYY A;  4S17 A;  3E56 A;  3ML9 A;  4REZ A;  1GUA B;  2D3C A;  2OJW A;  4N58 A;  3N1Z C;  4GDL B;  1WGH A;  4B6W A;  1RM6 C;  1TIF A;  3DVG Y;  2DLB A;  4WJO A;  5MPO A;  2G9H D;  3Q3F A;  4M8N A;  2RD0 A;  1CZP A;  2ZZP B;  1NEK B;  3AU5 A;  4A90 A;  3Q6B A;  1YN5 A;  2FBW B;  2BKR B;  3B1L X;  1WSP A;  4TMA B;  2KD0 A;  2A4Z A;  3RNA C;  1EWC A;  1IBX B;  1NBF C;  2IO3 B;  4MSM B;  3TL5 A;  3ZGZ A;  1WMH A;  1JW9 D;  3Q69 A;  1RLF A;  2IO2 B;  1WGY A;  4ASW C;  2KAC A;  4F7Z A;  2N9K A;  5AUK A;  2QHO A;  2DEN B;  3TEY A;  2N4F A;  1B1Z A;  4DXA B;  1QKZ A;  1MG8 A;  3SEB A;  3ZRF A;  2PE6 B;  1V49 A;  2FUG 1;  3NZU A;  3AE5 B;  1EWY C;  1HEZ E;  4E74 A;  1P7F A;  4W9G A;  3GZN B;  2KT7 A;  2MJE A;  2JVC A;  4EEW A;  3AMZ A;  4LTU A;  4YTP B;  1FRD A;  1V81 A;  1ZPS A;  1P0R A;  3QK0 A;  1J7B A;  1D5M C;  3FIL A;  2CR5 A;  2CHX A;  2WXR A;  3MHS D;  2K8B A;  1KLU D;  1SE2 A;  1FFV A;  4HPM B;  2KDI A;  2QJL A;  2KFK B;  2DZK A;  1LFD A;  3AEB B;  1SF0 A;  2NVU I;  2L52 A;  4KKJ A;  1L5P A;  4DBG A;  3BVM A;  4BKT A;  1N62 A;  2WP9 B;  4USA A;  5HFY A;  1Q1O A;  1D6E C;  3PHW B;  2PLP A;  4LNN A;  5LLI A;  4RNA A;  3HHM A;  3A33 B;  3VTW A;  3Q8E A;  4FJV B;  4GXB A;  1ESF A;  3A4S C;  4GMV A;  1AWD A;  3T3O A;  1WZ0 A;  3LB8 C;  3A4R A;  2ZPY A;  4NY0 A;  1P7E A;  2KHW B;  3Q14 C;  4DWF A;  4LLG M;  2PKO A;  1TS2 A;  1GC6 A;  1OQR A;  1B9R A;  4EE2 A;  1JCK B;  5IAA C;  3IT4 B;  1I4G A;  1J7A A;  1NVI D;  4W9L A;  4WJP A;  2L3Z A;  5HKH A;  2YVC A;  4DQO C;  2MJD A;  1WF9 A;  4NAM A;  1VDV A;  3EA6 A;  2D5G A;  1FNU A;  4W9K A;  2KK8 A;  1JWA D;  4MM3 B;  1I4H A;  5EE9 A;  3UQB A;  4TSS A;  2N9E B;  1FMA D;  3N1Y C;  3C8Y A;  2DAF A;  3CF6 E;  1E5W A;  2R61 A;  2KOX A;  2RR9 A;  4YSY B;  2W82 A;  3IG3 A;  4GN1 A;  4BAX A;  3DBL I;  3MHZ A;  1XCQ L;  2MBE A;  5FR3 A;  3P63 A;  3AM9 A;  3ZW3 A;  2JZZ A;  4XDD A;  4IUM B;  2MBB B;  1V5T A;  2C7H A;  1WE7 A;  3ZIM A;  3VDZ A;  4FUL A;  1YJI A;  3P4Q B;  1XEE A;  2N9X A;  3WAM A;  4E71 A;  1MHX A;  3KYC D;  4CQN A;  2ACZ B;  1N63 A;  4ZRP A;  3B2G A;  3DQV A;  1VCB A;  2BS3 B;  5J2R A;  2N1V A;  2ONQ A;  1JQ4 A;  4JX1 C;  2K39 A;  3GP7 A;  2OOB B;  1ZP0 B;  4GDK B;  2Y5P A;  3UIO B;  4K3B A;  3ZDM C;  3QX1 A;  1PGB A;  2KFK A;  4WQM A;  4WUR A;  4HLE A;  4AJY B;  3KVF B;  5E6O A;  3A9K B;  4A8X C;  3UF8 A;  1ZOY B;  4C7Y A;  1ZKH A;  1R4N B;  4IG7 B;  1C3T A;  2JRH A;  4IM2 A;  1GJZ A;  4JQW C;  1RFA A;  4XGA B;  2MBO A;  4BZA A;  4IWP A;  2MWS B;  3AN1 A;  3HRD D;  2I2Y A;  3NS1 A;  2BKF A;  4MT5 A;  2L1A A;  1QOF A;  2HD5 B;  4LNF A;  5IO9 A;  3URY A;  3N1X C;  1Q5W B;  3WCQ A;  4BOZ B;  1XXG A;  4N9F 4;  4P7I A;  4GIV A;  3PTF C;  1MHH E;  1WE6 A;  1YX6 B;  1ZUD 2;  1E8Z A;  2JXT A;  1I7H A;  1XT9 B;  4RGO S;  3GOE A;  1KH0 A;  2IDY A;  1E0Z A;  3ZNZ B;  1SBB B;  2OJR A;  1TJE A;  2KAN A;  3DVN V;  4K7W A;  1UEL A;  3JSV A;  3KYD D;  4JIO U;  2LGX A;  3IHP C;  5TSS A;  1N5W A;  3AE4 B;  2BVC A;  4KDL B;  1BUI C;  2WU5 B;  3ECI A;  3I5J C;  2KJ6 A;  3CWI A;  1XLP A;  2ON8 A;  3L4P A;  3KUD B;  4DHZ B;  1V97 A;  4MM3 A;  4HVB A;  3V60 A;  3RUI B;  2WXP A;  3AE3 B;  4DHJ D;  3IAM 1;  5G5H A;  4HK2 A;  3ZJU A;  3SU8 X;  5LNK 1;  2DYO A;  4GU2 A;  2KX3 A;  4WJN A;  3AEC B;  2BYV E;  2BTE A;  4A3P A;  5D94 A;  3R7Q A;  4BBN C;  4N59 A;  3MFG A;  3L16 A;  1WWT A;  4YTM B;  2LD9 A;  4B0M A;  1PGX A;  4LNK A;  4AQ7 A;  3FC4 A;  2LMC A;  3ENE A;  2LRU A;  4MEL A;  2LAS A;  2NPT B;  4ZRI A;  5BYQ A;  2J52 A;  1D3Z A;  3M62 B;  1HQR D;  4EKU A;  4RH6 A;  2EKE C;  2TSS A;  4WWM A;  4IWO A;  1WXA A;  1TY2 A;  4TUU A;  1YIW A;  4MGZ E;  2CJN A;  4KZ0 A;  1KRH A;  3DBR B;  1L6U A;  4K1R B;  1V1O A;  3U4E G;  4C56 C;  2M0X A;  1L0Y B;  3AE7 B;  2EKI A;  3EC8 A;  3U30 A;  3L10 B;  1PFD A;  2I1K A;  1D5X C;  1ZXH A;  4X57 B;  1F9J A;  2KQ4 X;  2M17 A;  3A9K A;  4DHZ E;  4RFB A;  2UYZ B;  1WX8 A;  5HG2 A;  1JWB D;  5CTR C;  2JPH A;  1FPY A;  1EM7 A;  1V8C A;  4RGM A;  3UQA A;  2BT6 A;  3WAO A;  2ZNV B;  3RZF A;  3SFD B;  2FCM A;  2LJI A;  1QQR A;  3RFZ B;  2LFI A;  1SIJ A;  4RF1 A;  2V0G A;  2D11 A;  2BS4 B;  3AEG B;  3RZW C;  4BKS A;  1V1P A;  2O6V B;  1RYJ A;  2GMI C;  2MJ3 A;  5IKC M;  1TT5 B;  2BYF A;  2NS5 A;  3EUB 2;  3DWG C;  4ZHP A;  2V9H A;  2GBR A;  4OZB A;  1SIF A;  3NVZ A;  2W55 A;  2KDE B;  2QIE B;  1YN4 A;  5JHA A;  2M56 B;  4XDC A;  2IO0 B;  2VH2 A;  4W9C A;  5AZH A;  1T5X D;  3DBH B;  4KX6 B;  2WWZ A;  4GB9 A;  2DNF A;  2FNJ B;  3VR9 B;  4KGR A;  2AQ2 B;  1C4A A;  5EE1 A;  1VZ6 A;  2ZNV C;  1WMH B;  4GGQ A;  3NS8 A; 
#chains in the Genus database with same CATH homology
 1M4V A;  3AE1 B;  4FXC A;  1J7C A;  1FNW A;  3ZGZ A;  1CK1 A;  1JW9 D;  4YTN B;  1C76 A;  3TEW A;  1IBX A;  1GOZ A;  4AS1 A;  1ENF A;  3OWE B;  1E10 A;  3Q69 A;  1FXI A;  1ET9 A;  1K51 A;  3LXF A;  2BS2 B;  3H8H A;  1N5X A;  2KAC A;  4KGS A;  1C9F A;  1YMH E;  2WXM A;  1L4Z B;  2N9K A;  5AUK A;  1PDX A;  2WDV B;  1UNS A;  3TEY A;  3P4R B;  4N6E B;  4IKG A;  1HA5 A;  1B1Z A;  3Q8F A;  1FCL A;  1QKZ A;  2IGD A;  1FNV A;  4JE3 B;  3SEB A;  2FUG 1;  2E6X A;  4OZC A;  3AE5 B;  1EWY C;  1HEZ E;  2V4I B;  3BYT B;  1N60 A;  2V3P A;  5D3D A;  1P7F A;  3ZQ4 A;  2IPK D;  1XF5 L;  3R2I A;  2MJE A;  1DGJ A;  2K0P A;  2M0A A;  3IT6 B;  2KDM A;  3AMZ A;  4A9A A;  3FAH A;  4LTU A;  4PT5 A;  1KLG D;  4YTP B;  1FRD A;  1ZPS A;  2Q5W D;  1FEH A;  5C2T B;  2WS3 B;  1ZXI A;  1J7B A;  2WXJ A;  1TY0 A;  1D5M C;  1UWM A;  1VZ7 A;  3FIL A;  3P1M A;  2WXR A;  1KLU D;  3MC0 B;  5D3I B;  1SE2 A;  2W3R A;  2MH7 A;  4OW0 A;  4XWT A;  1FFV A;  2DWQ A;  2JZP A;  1DOX A;  2QJL A;  2BYT A;  3AEB B;  4US9 A;  1SF0 A;  3Q8C A;  2L52 A;  1I4P A;  1MI0 A;  2N9L A;  2XNA C;  4KKJ A;  1L5P A;  1ET6 A;  3BVM A;  1JWS D;  3VRB B;  1DOY A;  3NVY A;  2WNM A;  1N62 A;  3BWU D;  1T6B X;  2WP9 B;  4YT0 B;  3VR8 B;  4USA A;  5HFY A;  3W5V B;  1RFK A;  2N7J A;  3AE9 B;  1JRP A;  3B2F A;  4R3D A;  1D6E C;  4HKQ A;  2BB6 A;  3GB1 A;  5GXG B;  1BXT A;  1SJE D;  2PLP A;  1YQ3 B;  3P42 A;  1DOI A;  3TUO A;  1GB1 A;  4RNA A;  1GPX A;  5E6J A;  2J53 A;  5EE0 A;  1VR9 A;  3AEE B;  4KGT A;  2G1E A;  3Q8E A;  1I4X A;  5FKA C;  1ESF A;  1L4D B;  2PIA A;  4NJC A;  1SJH D;  1AN8 A;  1AWD A;  3T3O A;  2LHD A;  3GS2 A;  3LB8 C;  1SE3 A;  1TKY A;  2LEK A;  2K9X A;  2JSV X;  1F0Z A;  1MPE A;  1NYQ A;  1P7E A;  1K50 A;  4LLG M;  2PKO A;  1TS2 A;  4A6Q A;  3V05 A;  4C7Z A;  1XCT L;  3ZYY X;  5HI1 A;  1OQR A;  1B9R A;  1WXQ A;  4EE2 A;  2WXH A;  3AV8 A;  1JCK B;  1UWX A;  3W5U B;  3IT4 B;  1I4G A;  1J7A A;  1NVI D;  2PMV A;  1VZ8 A;  2LGI A;  2IGG A;  4Q2J A;  4DQO C;  1C79 A;  3PZ8 A;  4ZHO A;  1N61 A;  4DXF A;  1NI3 A;  2MJD A;  2WXQ A;  4A55 A;  2OED A;  2INN E;  4HJG E;  2RMM A;  4NAM A;  1A70 A;  1VDV A;  3KLS X;  2WQY B;  1FXA A;  3U52 E;  3EA6 A;  4JWS C;  2D5G A;  4ZYS A;  1D5Z C;  4OHJ A;  4IDI A;  5H8Y E;  1FNU A;  2BBC A;  2FE8 A;  4XWW A;  1JWA D;  5BMG A;  1FM0 D;  2B76 B;  4MM3 B;  1I4H A;  2JYT A;  5EE9 A;  1VLB A;  4TSS A;  3RPF C;  1ZDV A;  3W2D A;  1FMA D;  2QMT A;  3C8Y A;  4MAC A;  1BML C;  1AW7 A;  2R61 A;  3IAS 1;  4YSY B;  2Y3A A;  2W82 A;  2DBY A;  4UDU C;  4KKI A;  3E9S A;  3U7Z A;  1I4Q A;  3T3N A;  3MHZ A;  5JXV A;  1XCQ L;  3O13 A;  1D4B A;  4WAF A;  4HRS A;  4M0W A;  4ARI A;  1IGC A;  5FR3 A;  1AYF A;  2EEL A;  5BMI A;  2WXI A;  2I38 A;  3J9C A;  3P63 A;  4ZRQ A;  1TKG A;  2JYE A;  3UI3 A;  3AM9 A;  1IUE A;  4NZL B;  1WYG A;  3TSS A;  4XDD A;  1QT9 A;  3NRZ A;  3NVV A;  3BVZ A;  4ARC A;  1FCC C;  1FFU A;  2AX5 A;  3ABV B;  2XN9 C;  2J42 A;  1YJI A;  2Y5C A;  3P4Q B;  1XEE A;  1GB4 A;  2W54 A;  1KTK A;  1MHX A;  4CQN A;  3HUI A;  1F2R C;  2ACZ B;  1JML A;  1N63 A;  4ZRP A;  3B2G A;  1UUP A;  2BS3 B;  4US8 A;  3HVZ A;  1Q10 A;  2ONQ A;  1JQ4 A;  1TS3 A;  4JX1 C;  1QOA A;  4D2K A;  4HEA 1;  1SE4 A;  1E6E B;  5HHD G;  1ACC A;  3GP7 A;  4HKZ E;  1ZP0 B;  4GDK B;  4DXG A;  2Y5P A;  2KN4 A;  1KF6 B;  2PVO D;  1QLB B;  4YXD B;  3BK1 A;  3BZD B;  1PGB A;  2BW2 A;  4WQM A;  4WUR A;  3Q8B A;  1QOB A;  2OHF A;  1XO3 A;  1YJJ A;  1RWS A;  1SB3 C;  4A8X C;  1ZOY B;  4C7Y A;  1NYR A;  1E9M A;  2WXK A;  3B9J A;  3AH7 A;  3R8B A;  2WU2 B;  2M19 A;  1YQ4 B;  1CQV A;  4LK0 M;  2IJ0 A;  1WRI A;  3SFE B;  1KFY B;  1TZO A;  2QIL A;  3AN1 A;  3NUH B;  1OQQ A;  2X38 A;  3HRD D;  1OFF A;  1FO4 A;  2I2Y A;  3NS1 A;  4JWU C;  4JPS A;  2RDH A;  2MEK A;  1VRA B;  4MT5 A;  3DWM A;  2L1A A;  1QOF A;  2ZW1 A;  2IGH A;  1FD6 A;  3BYY B;  3BK2 A;  3URY A;  2JX5 A;  1ROE A;  2WLB A;  2H89 B;  3WCQ A;  1Y56 A;  2SEB D;  2L32 A;  1XXG A;  1VJK A;  1TS4 A;  4J3O D;  2K5P A;  1XLO A;  1MHH E;  3SR6 A;  2NMQ A;  3W9C B;  3P4S B;  1SXT A;  2PW9 A;  1FIQ A;  1SEB D;  1ZUD 2;  2E3T A;  2JXT A;  1I7H A;  2YEP F;  4RGO S;  3KWL A;  1KH0 A;  2IDY A;  1E0Z A;  1C4P A;  2PTL A;  4YSZ B;  1SBB B;  1STE A;  5BYS A;  1TJE A;  1GAQ B;  2JU6 X;  2KMM A;  1MVK A;  5D7G A;  3KQ4 A;  4WIP A;  2AQ3 B;  2BB5 A;  2WXF A;  1N5W A;  5TSS A;  3AE4 B;  2CU3 A;  2L83 A;  1BUI C;  2WU5 B;  3CWI A;  1XLP A;  2ON8 A;  3PZ7 A;  3L4P A;  4HRO A;  4ZOH C;  5AUI A;  1V97 A;  4TQ0 A;  5FK9 C;  4P6V F;  3NVW A;  3BII D;  2WXP A;  2VZK B;  3AE3 B;  3IAM 1;  5G5H A;  1YN3 A;  3ZJT A;  1PUT A;  3ZJU A;  2WDR B;  2AQ1 B;  5LNK 1;  2DYO A;  2WXN A;  3U2S C;  3AEC B;  2BTE A;  4O1N A;  1QF6 A;  4WH4 A;  3KWV A;  1PYW D;  2LHE A;  4N59 A;  3MFG A;  1WWT A;  4YTM B;  1L0X B;  3BVG A;  4OZA A;  4B0M A;  1PGX A;  4AQ7 A;  3FC4 A;  5C3J B;  4L2Y A;  2PVG C;  4B0E A;  1UGJ A;  2LMC A;  1TKE A;  2QEJ C;  3AED B;  4XE0 A;  3AEA B;  1E7P B;  5BYQ A;  2J52 A;  3AB5 A;  1JAL A;  3N9Y C;  3AE8 B;  1XLN A;  1K53 A;  2HDE A;  1HQR D;  1HZ5 A;  1EU3 A;  3TEZ A;  3I9V 1;  1C78 A;  4RGT A;  4RH6 A;  1L6V A;  3MP9 A;  5BMH A;  2WXG A;  2RDG A;  2TSS A;  3CIR B;  3P4P B;  4WWM A;  2ICI A;  3I57 A;  3ETR A;  1TY2 A;  2NTT A;  2K22 A;  3V3X A;  4IOI E;  2CJN A;  3IXS A;  1KRH A;  1L6U A;  3ZJV A;  4GLS C;  1NEN B;  1V1O A;  3HVD A;  1DYQ A;  1TYG B;  1C77 A;  3FIL B;  3U4E G;  2LUM A;  4C56 C;  4P16 A;  3VRA B;  1HXY D;  5EE3 A;  3AE2 B;  1L0Y B;  3AE7 B;  2N0S B;  2GI9 A;  1F77 A;  2DYM A;  2EKI A;  4YWG G;  3Q8A A;  2J4X A;  1PFD A;  1ZE3 D;  1D5X C;  3PO0 A;  4L1B A;  2JQR B;  1ZXH A;  1R7S A;  1FRR A;  2KQ4 X;  1LO5 D;  1F2R I;  2SAK A;  4RFB A;  2V3N A;  1XLQ A;  3VQI A;  1L0V B;  5HG2 A;  1JWB D;  1IGD A;  1TS5 A;  1QOG A;  1EM7 A;  1V8C A;  4RGM A;  1JWM D;  2Z8L A;  2BT6 A;  2NTS A;  4H2A A;  3SFD B;  2K3U A;  2QSD A;  3AE6 B;  2GRI A;  2LJI A;  1QQR A;  1JRO A;  3TEX A;  1JWU D;  3NZ3 A;  2LFI A;  3RFZ B;  2KWD A;  1PGA A;  4YSX B;  4NAW B;  1C4C A;  1SIJ A;  4RF1 A;  2V0G A;  2HTM E;  1I4R A;  1HZ6 A;  5H92 C;  4RGN A;  4ITK A;  5I4D A;  1V1P B;  2BS4 B;  3W1S A;  2JWU A;  2ZW0 A;  3AEG B;  1CJE A;  4RF0 A;  3R2T A;  3MJ5 A;  4MH8 A;  1V1P A;  1QIL A;  1RYJ A;  1ZDX A;  2H88 B;  2WXO A;  3EGR A;  2MJ3 A;  1YNT E;  1EU4 A;  5T8I A;  2KAJ A;  3LYY A;  3E56 A;  3EUB 2;  4REZ A;  3DWG C;  4ZHP A;  1SSN A;  2RPV A;  4OVZ A;  2INP E;  4OZB A;  4RCO A;  1T3Q A;  3NVZ A;  4N58 A;  2W55 A;  2CJO A;  4GDL B;  2GB1 A;  1RM6 C;  2QIE B;  1YN4 A;  2YEP B;  2M56 B;  2DLB A;  4XDC A;  5MPO A;  2G9H D;  5G5G A;  1CZP A;  4L23 A;  1T5X D;  4KX6 B;  1NEK B;  2VZK D;  2WDQ B;  4A90 A;  1YN5 A;  3AEF B;  4TQ1 A;  2FBW B;  3VR9 B;  1K52 A;  1WSP A;  4KGR A;  2AQ2 B;  4TMA B;  1C4A A;  2W3S A;  2WXL A;  1WGK A;  5EE1 A;  1VZ6 A;  5BYR A;  1EWC A;  1IBX B;  4C80 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...