3GSNH

Crystal structure of the public ra14 tcr in complex with the hcmv dominant nlv/hla-a2 epitope
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Structural bases for the affinity-driven selection of a public TCR against a dominant human cytomegalovirus epitope.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 65
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gsnH02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3gsnH01
4JO1H 3MC0A 3V79C 3OJDB 4XBGA 5L7XH 1HQ4B 4HDIB 4UOJA 2ADJA 4U6YB 4Q9RL 5EH1A 4XCFH 4HS8H 1GC1L 2V5SA 2VDOL 3QJHB 1FQ9C 4HK0A 1AKJA 5IOPB 3P0YL 3RNKA 3HTLX 5ESAB 3TBSB 5E94B 1KT2A 5EOCH 3T4AB 2QR0A 3BN9D 2GJ6E 3LEXB 5C6TL 1KJVB 5D7JA 3L3IB 2V7NB 2W38A 5F7MC 4JHWH 1IGYB 3NZHH 2KKQA 3QJFA 4XX1G 1NFDE 1OGAD 1CXKA 4NM8H 4XBPB 3S36X 5JHLL 2IAND 1CFVH 2W60B 4NKOB 5F7HA 8FABB 5IBUB 3UROR 5EU4B 3EYVA 5LCVL 1RK0A 2OJEA 1FRGH 2KL6A 1MCOL 1UZ8B 4G7VL 2QADC 4Y4KA 3HC3L 1YEJH 4JPIA 3FQTB 5EZLA 4C4KT 1G9EA 4NGHL 3DUUB 3T0ED 1F90L 4DOHE 5HI3D 3DXAD 4JZJA 1YY8A 2FZ3A 3D6GA 3W81A 4PJEE 5ECJE 5DVNA 2BHUA 3QCVL 3IFNH 2ZP0T 1UB6A 5FOJA 5IW3A 2COQA 2Q8BH 4WW2B 3OB8A 1JGUH 1S7QA 1VDGA 1B9ZA 5TPWL 1PG7L 5C71A 2NQCA 3QRGL 2FJFB 5J8OA 5FYLE 3O4LB 3SBWA 3QDJD 4XPFH 1HSBB 3OL2A 3LN4A 4OZFH 2X4RB 1GH7A 2NY3B 5DSCA 2HFFA 4Z7VE 1ZT1A 3HPLB 4B0MM 4OV5B 3WSQL 3JTCA 1S7SA 4WFGD 4ODXB 3H42H 1RD6A 4AM0A 1HDMA 4IRZH 2AK4D 1ZLWK 4M1CC 3C5SB 4PRBB 3TF7A 1TZHB 2MQ0A 1G6RH 3GJFA 3MV9A 3QDMD 3RY5A 4XP4L 2VL5A 1OP3H 3G6JA 1ZHKB 2DQJL 2JCCF 5ANMA 5C09B 3WJLC 1JZ7A 3HNTH 5IWLC 5KVMC 4FABH 3V4VL 4PJ7E 5I8OH 3MRDB 1FO0A 4MNQE 1D7FA 2QBWA 4PB9L 5GRVL 5LGHH 3U7WH 4OM0H 4RBPH 3VGBA 5TQ0L 3STZB 1QG3A 4LLQA 3KXFA 4L3ED 4NRXA 1NAMH 4NNXB 1A6UL 1BVLA 3D39A 2P8MA 5INCB 4O5LL 2VDNH 4IHOA 3U6RA 3W5MA 4OKDA 4XBEH 2EIZA 3WN5A 2YSSA 2FATH 3VA2C 3U4BL 4AG4H 2Q76A 5MEPB 4HG4J 1O7VA 2Q20A 4LBEA 5JIIA 1FGVH 3TJHC 4FQIL 2EDBA 4ODHH 3VXRD 3NTCH 4HWUA 5AEAA 5E8NA 4FTVA 4S10A 5JOEA 1J0JA 1JNLL 4QOKD 2N7BA 2GY5A 4MLSA 4D0BB 1R3IL 2BNQE 3TBVA 1QO3A 1LD9A 3MLTB 4U1HB 2IGFL 5FO8A 3QXWA 1QNZH 1FAIL 3N1FC 1CLOH 4LHUG 3GMOA 5ITBL 3IETB 3X3FL 4OLWL 3WKMH 1CK0H 1R5WB 5LBSH 3V0VB 1TLKA 3BX7C 3FOMA 1BAFH 3LOWA 2WBJD 2PETA 4NZTL 2NZ9D 3V5KA 2O5ZH 2SEBA 3AUVA 3L3HB 1M1SA 4L5FL 2R23A 1DL7H 4HW6A 1HZHH 3BGFC 4TRPL 4U1JB 4OI8A 5D2LB 1R6VA 3C9NA 2JJUA 1KGCD 1F3DJ 5IMOB 2E27H 5CGYC 4ZO8A 4Q6IA 5ESQB 2DTML 3TO4D 5D7LE 2X4OA 3ZMRA 2EDXA 5JHDB 4LHQB 3CCHA 1BX2B 4JFEB 1XGYL 1RIVH 3QQ9D 4KKBD 4LLYB 2DMCA 2M26A 1LVEA 2BJMH 3O3EA 4JZNB 4MNGB 1JMZA 2CRYA 3HE6C 1LEIA 3PP3H 4NO2A 3DO3A 4Z6AT 1KG0A 1EXUB 2RJMA 3OHXA 5H35A 1CQYA 3QRFM 2UY6A 2G2RB 2NXYB 4JAMB 4PLKD 1KC5H 4Y4FA 2W0PA 3QHFH 4UI2A 4XBGB 4JG1L 4G8EA 1BFTA 2HMID 4NQCE 4YK4B 1IGIL 3QCUH 4YNYA 2ADJB 2Y25A 2HT3C 2X42A 5JIKA 1PFCA 4F2MA 4U1NA 4HK0B 2L4OA 4P46C 4Y7MA 3VGGA 4DUWA 1AKJB 2ZG2A 3RNKB 3KLHD 1FC1A 1BQUA 1KT2B 4WEBL 3B5TA 1D5MA 2OP4H 4H8WL 2D7OA 2QR0B 3QYCA 3R8BB 4OGYL 5D1QA 5D7JB 5ADOH 5KS9A 5HY9A 3Q6GL 3QJFB 1MJ7H 1TZIA 2DBJA 2V9TA 3I50H 1EJOH 1MWAA 3D2UD 2B5IB 2APTA 2HP4A 3L3KA 1NEUA 2E7HA 1U3HC 4UBDC 1XCTA 4LSUL 3FQWA 3T0XA 5EU7C 1T6WA 5EWIH 3BP4A 3FB7A 1HH6A 2HTLC 3EYVB 1RK0B 1UWXH 4J3TA 2DJ4A 2OJEB 3N06B 1HYSC 5GHWH 4AYFA 4WFFE 4Z9KB 3QULA 3NFSH 4NO3A 1OSPH 4Y4KB 1SMAA 2HVJA 1L7TL 3T77A 4JPIB 3THMH 2IQ9H 5EZLB 4R4BA 5CEXA 2P5ED 3T09A 1F2XK 3FB6A 3FT4A 5FEBA 4JZJB 1YY8B 2FZ3B 2VZTA 3TZVC 2XNAA 4W4OC 3S37X 3DPBA 3HN3A 3IDMA 2VXVH 4JY5H 5F3BA 1NCUA 3MRPA 4K7PH 5TE6H 2C4XA 2FGWH 1UB6B 4YDKL 3KPSE 4XC3H 2QTEA 1DQDL 1S7QB 5BMFL 4HFWA 2X09A 3EDKA 5FHAH 4Z77A 1CFSA 3EYSH 3FKUS 4GAJH 4LSPL 5KSBF 1HQRA 4YZFE 2DKUA 4BH8A 4ELME 1TMCA 2YRZA 3LN4B 4ZG1A 1XGPA 1YEFL 4H1LA 5DSCB 2HFFB 3D9AL 4MDJA 1ZT1B 1WFUA 4AIOA 4KDWA 2X05A 3W9DA 5EORH 5GS2H 1S7SB 1D9KD 5DK3A 5B4MD 3SE4A 4AM0B 1TQCB 1HDMB 3K8LA 2DQEL 4F37F 5E2WH 3MRFA 3BPNC 1YY9C 2DLFL 1NL0H 1I1CA 4P23C 2D0HA 3GJFB 3P2TA 3MV9B 1T3FA 4KZDH 4GH7B 2VL5B 3QCTL 3G6JB 3Q5OA 4V3DB 5ANMB 3V6OA 2YPKA 3DMMD 1QYGH 1KJ2A 3GDBA 4XMPH 4UT7H 2WY3A 4GRLD 2XQBL 1FO0B 4F58H 4HJGA 4JM2D 4NZJA 1JHLL 4L4TA 4LLQB 3KXFB 3SHSA 2PTUA 4NRXB 5F70A 1G84A 1BVLB 2VYRE 3D39B 1T03H 1IQWL 3MRMA 2P8MB 3RAJL 3ARDC 2V5TA 4IHOB 5E00A 3VFVA 2EECA 3U6RB 3O4OB 5H37H 1X3DA 1U8LA 1ZVSA 3MOAH 2EIZB 2VXUH 3WN5B 2YSSB 5J12B 4RMVA 1AIFA 32C2A 2Q76B 4M6MH 4QHNA 4LBEB 4Y5XC 1J0YA 5J7CC 1RZKH 4OF8A 3I6LE 4PRIE 5E8NB 4FTVB 3K2MC 3ZE0E 5CWSB 2QJDA 4PS4L 2FR4A 2NLJA 3MXVL 1JTTA 3TBVB 4DVBA 1QO3B 1LD9B 1DQQA 4TPRH 5FO8B 4EJ1C 3RVVC 3GMOB 1RV6X 4UZGA 2ERJB 5FIEA 4JPWL 3FOMB 4WTWA 3Q48A 2XI9A 3GHEH 3V5KB 2SEBB 5IVNA 3O2VL 2R23B 1LK2A 4RMQA 1CTOA 4YDIH 4F7MA 2NR6C 3C9NB 3PHOA 4Q0XH 3LZFL 4N1CA 1S9KC 4HIEA 4Q6IB 5T3XE 1NDGA 2IMNA 2R0WH 3D1MC 2APBA 2X4UA 3PUCA 2X4OB 3RDTA 2F8OA 2Z31C 3W82A 2P8LA 3BPOC 2BNRE 3CCHB 5F8QC 2CQVA 3MR9A 5IB5A 4IOSD 3VWJC 5HD8D 3QUZA 4LRNL 1CLYH 2I9TA 2EDLA 3O3EB 2VLJD 3TBYA 4D3CH 1LEIB 2EIDA 4NO2B 3KJ6H 1KG0B 3OHXB 3LQAL 5H35B 3UCRA 2NY0C 2VZSA 3B2UC 4D9LL 5T33L 4UTBH 1PX4A 3VCLA 5D7SL 3ARGA 2B7DT 4B7LA 2J5LC 4U0QB 3LKQA 4Y4FB 1FFPA 4G8EB 1R3KA 4OGXH 3HZMA 3CFKA 3CDGA 1R5VA 2ZPKL 3QIUC 4LASH 1FIEA 4DGVH 5HYJE 5CGMA 3GBML 4YNYB 2D7TH 4KRPD 4MZ3A 1NGWA 5D7IA 4F2MB 2WV3A 2WUBH 4U1NB 1VSCA 3W0WA 3KLDA 1ZANH 2A77H 3B5GA 4P59L 4HPYL 4MLIA 3MLRL 2FX9H 4ZYKA 1D5MB 1U0QA 2NY6C 1Z0MA 4FZEL 2AERT 5D1QB 5KOMC 1P4IH 4JPKH 1BD2E 2R9HC 4JFPA 5KS9B 5HY9B 4HPOL 4OUUA 1HNGA 2D7QA 5I71C 2ZG1A 5F9OL 1TZIB 5MEND 1IGJA 1S5HA 1MWAB 4BM7A 5FAAA 5CILH 1J8HE 1MRCH 4TVSa 5E2JA 3L3KB 3RBSA 3ZSTA 1XCTB 3FQWB 1XIWD 1CCZA 3BP4B 3FB7B 4CJ1A 3RTQA 1HH6B 1GOGA 5C08A 1DQML 3QEQD 4LLMA 4DZBA 3TA3D 1RZ7H 1B0GA 3QULB 4NO3B 1S78C 4U7KA 2HVJB 3T77B 1E4WL 4CADA 4R4BB 5CEXB 1E4XH 4AMKH 2R8SL 1KF9B 1AXTH 3MODL 3FB6B 3FT4B 3U0TA 3VDCA 5FCSH 1B88A 1NSNL 4OIBA 1HIML 15C8H 5C2BH 2Y36L 4U1SA 2XNAB 4PJCA 1YEKH 5A2JH 4XP5L 4MJID 3IDMB 5F3BB 5BXFA 1SVZA 3CH1A 3MRPB 1EFXD 1SEBA 4X6DA 2VXSH 3LEVH 5GS3A 1MAKA 2IMMA 2BOCA 4NO5A 5T1LD 4HFWB 5HYIA 1X7QA 4Z77B 1CFSB 4NQDA 2M8XA 4FFWC 5DJ8A 1HQRB 1WBZA 3LHPH 1A7RH 2EDYA 1FL5A 4JGJA 4U3XA 4BH8B 1VPOL 1RUML 1TMCB 4I0PC 1A2YA 5I8CA 1XGPB 5KVDL 3C08H 5AZ2L 4OZIF 1W0WA 2GQHA 4H1LB 4MDJB 3KGRA 3W9DB 5TFSL 1NBZA 3GK8L 2YZ8A 1BF8A 5IHUL 5JNYA 3W2DH 4QRUA 5E1AA 3MRFB 3P73A 4NZUL 1BF2A 1JHKH 4HS6A 2Y4SA 1CDGA 1L9NA 1LQSR 1T3FB 5E8DL 4MWFA 1JYXA 3RVXC 4NO0A 2DMKA 4HD9A 1OP9A 5E08L 4YHKH 5IUSA 5FUOL 4DVRL 4OZ4A 2YPKB 3QDGD 4XVJH 1KJ2B 5C0BA 2DKMA 2L7UA 3IFLL 1A4JA 1JUFA 2Y6SC 2JIXD 4LU5H 3MBXL 4HJGB 1D6VL 3RWFA 3BKYL 4OT1L 2ZWLT 1I85C 1NLBL 3DI2B 4L4TB 2XY1A 5TE4H 1ZLVH 3MRMB 4P9HC 3WNOA 4UU9A 5E00B 3FAWA 3VFVB 4LHUA 1JZ2A 1U8LB 4JQVA 1ZVSB 1KPUA 1JV5A 1OTTC 4V1DD 1QBMH 1AIFB 32C2B 4QHNB 4L4VD 1NMCB 3ULUF 1RUKH 2JJTC 1CICD 5ADPL 5IKCA 1IMHC 3SGKC 4IMKC 3QNYA 4L4JA 3GGWA 2APXA 1ZSDA 2B4CH 1QA9A 2HVKA 4RAHA 1KIPA 4MAYC 3CMGA 2FR4B 2NLJB 4DVBB 4IRJD 2ID5A 5EOQL 1X6NA 1DQQB 1A7OL 4A6YA 2ZOKA 3WD5L 1H3GA 1YEDA 2R4RL 1KYOJ 4XNYL 1UACH 3L5XH 3EDEA 2HFGL 4NN6B 5HDQH 4JY6A 3JUYA 4M62L 3T2PA 3I2CL 1LK2B 3JBG7 2FWOA 5AWNH 4F7MB 2FBOJ 3PHOB 5IJKC 2AXJA 3SN6N 4O58L 5KJRL 4LP4A 4XVUD 4HIEB 5EC2A 2DICA 1NDGB 3U0PA 1S9YA 2X4UB 3RDTB 2YPLA 2PO6C 2P8LB 4FRWA 3MQIA 5K93A 2WUCL 3MR9B 4M7LH 5IB5B 2D0GA 5L2JA 1MFBL 3QUZB 4P3DA 4HC1A 5DEGA 3SPVA 1A64A 1J5OL 2I9TB 1EHAA 3TBYB 4EIZC 1G7JA 4YPGA 3PDGA 2IJ0C 1OARH 1NANI 4FQJL 3VCLB 4FXGA 1R24A 3ARGB 2IG2H 3S98A 3LKQB 3P11L 1WUNT 1FFPB 2JJSA 2FJHA 4I2XA 4APQA 4S0UC 1R3KB 1TPXC 4KHXL 3HZMB 3CFKB 3CDGB 1R5VB 2OJZH 1IBGH 1U8IA 2NYYC 1FYTA 1NGWB 2BRRH 3UTPE 5D7IB 4ZFOA 35C8H 1G0XA 3BDXA 4IS6A 3W0WB 3RUGE 1W72A 4GAGL 5JPNA 3QPQC 1IC5L 4ZYKB 5L6YL 4U1IA 3ARTA 5E2TL 4JFPB 3BKCL 3VFMA 2AJUL 4AEFA 2WM0A 4HEME 4OUUB 3T1WA 2Y07H 4WIQA 4YDVA 5I1KH 4PJIF 4QTIH 3GMQA 1IGJB 5ALCL 1S5HB 3AROA 2R2CA 5D96B 5B8CA 3AM8C 5BOZG 1J1XL 1OL0A 4GOSA 1LE5A 1A47A 1OCWL 4WUKL 3EYFA 3RTQB 4XMKL 1F11A 1GC1H 5C08B 4LLMB 2VDOH 4DZBB 1EO8L 3P0YH 1B0GB 5DJ2A 4N0FA 1SBBA 4HWNA 5HI4C 2Z8WC 4PJFF 4CADB 3EJJX 3IDIA 5C6TH 4QRPD 3P4OA 1PGRB 3U0TB 1MIEL 4FQXA 1G7MA 1FZOA 5J1AA 4U1SB 1QUNA 4PJCB 1G1YA 4LLUA 5IQ9A 3FO0L 5SX5K 5JHLH 5BXFB 1KXQE 3CH1B 1SEBB 4P3WA 4X6DB 4I9WD 3MFGB 3TN0A 1INDL 2BOCB 3G5VA 4NO5B 2J6EL 1X7QB 1N6VA 1H8SA 4NQDB 2J8UE 5DJ8B 3AGVA 1WBZB 5LCVH 1FL5B 2XXCB 4AK1A 4OBSA 4JY4A 1MCOH 1TITA 4G7VH 1A2YB 2HRPL 5I8CB 1NFDA 2WIMA 4TTDC 3HC3H 4LLAA 4TULH 1V3KA 1W0WB 5GRUL 1NBZB 3SGEH 3VXMD 4V3EB 4NGHH 2BX5A 3GI8L 4P4KA 5IVXA 1IC4L 4GKOA 4W70A 4N68A 5JNYB 4QRUB 2CH8A 4QF1A 5E1AB 3P73B 4HS6B 2A6DA 3O3AA 3QCVH 1JHTA 2YK1L 4MWFB 2MCG1 1GPOL 5EU3A 4NO0B 1WT5C 1BFSA 1ZTXL 5TPWH 5L0QC 1ADQL 4OZ4B 2MQ3A 1PG7H 2AAVA 1BEYL 5C0BB 1NCBH 3QRGH 2P5WD 1A4JB 5F1NA 1JUFB 4ODVL 4WNQA 4B5EA 2CUHA 4RGOH 4PJ9C 3RWFB 4OJFL 3G5ZA 3WL9A 4CMHC 1T6VN 1OQXA 1DUYA 4PJEA 4UU9B 4LHUB 4KU1A 4ZOEA 3WSQH 1X6LA 2E7LE 1KPUB 1JV5B 5DJXA 1IM9D 4F9LC 2UV3A 1IEBA 2ITCA 3NAAL 2H2PC 2IEPA 5A40E 5IKCB 3PE9A 5D2NC 4OLZL 2E6PA 3QNYB 2O93L 3GGWB 3MA7A 4OF6A 4XP4H 1ZSDB 4KJWD 1QA9B 2HVKB 5DVOA 1KIPB 4GT7A 2DQJH 4Z7VA 4ZAKD 4ZUTA 3WNNA 4IRSD 3OKOA 5TDPA 4MVBA 4A6YB 2ZOKB 4CKVX 1A14L 4PB9H 1YEDB 3BZ4A 4HUXA 5TQ0H 4GG6A 3NCFB 4X7EC 2IQAA 5A3IC 1A6UH 5M7QA 3Q3GA 3R1GL 3PL6D 5C0AD 4O5LH 3IFPA 3ULUC 4R90L 2H32H 4JY6B 1OM3L 1X5YA 4OFDA 3QPXL 2E9BA 3U4BH 2FWOB 1IGFH 1H5BC 4NQTA 4FQIH 4IDLA 5I1IL 4PJ5D 5EC2B 1FJ1A 5KSUA 3LS4L 4XZUA 4EDXA 1R3HA 3U0PB 1S9YB 2YPLB 1KXTB 2VAAA 1JNLH 3MUZ1 4LSQL 3IFOA 1R3IH 5L2JB 5CEZL 2CUIA 4P3DB 4JFFD 2IGFH 1XAUA 5DEGB 3SPVB 1XMWA 1FAIH 1G7JB 4YPGB 5ITBH 1CE6A 4N0CD 2A9NL 4C55A 1AGCA 3LKOA 4MJ5A 1IILE 4FXGB 2Z8RA 4L3AA 1S8DA 4Z76A 1R24B 1JFMA 1XEDA 4I2XB 5HYQA 2FJHB 1W72H 2JK5A 4APQB 4L5FH 1PX3A 3SJVA 3SKMA 3P4NA 5DUBA 2XWJA 4I3RL 4TRPH 2BNQA 1U8IB 1FYTB 5HVGB 4HUVA 4QGTA 3WS3A 4ZFOB 1AR1D 4IS6B 2DTMH 3AB0B 5K9QG 5KVFL 1AHWC 4POZC 1AR2A 1W72B 3CX2A 5JPNB 2UYLA 3CLEL 1X4XA 1CGYA 1XGYH 3QXAA 2ATPA 4U1IB 1GGIL 4PJGE 4JKLA 5HGHA 4D9RD 2XZQH 1TQBC 3VFMB 3OXSA 3QWOA 3D48R 4YDVB 2XA8H 3GMQB 1AC6A 3TCXA 4MAUH 5B8CB 1DN0A 2QQNL 5D7LA 2FBJL 4JG1H 4NT6A 3ALXA 1LE5B 1VFMA 1XH3A 2DAVA 1IGIH 4EN3C 3EYFB 3DGCR 1WWCA 2PF6A 4D8PA 3VU2A 5C0IA 1I1YA 3E2HC 5CD5D 3U36A 1F11B 4OCXL 4H5SA 4RIRA 1WBXA 2NXZC 5DJ2B 4N0FB 1EEZA 4WEBH 3V0AC 4NHUE 4PJXF 4QRRE 3SDDC 4FP8L 3RL2A 5JOPE 4WWKA 4OGYH 4J4PA 3IDIB 3SDCD 4J8RA 1FVEA 3MSPA 3P4OB 1GVIA 1KXVC 3Q6GH 4FQXB 1G7MB 4PR5A 1FZOB 5J1AB 1F4XL 4S0TD 4DN4L 1DBKL 2CK0L 4LLUB 5IQ9B 1HXMA 5HHOE 5GJSH 4GKZA 1DQLL 4WTZA 5TF0A 5GGTA 3N9GL 3TN0B 1KEGL 4J2XA 3WXWL 3BQUC 3FB8A 4LSUH 3G5VB 5F88A 2W92A 1CXHA 4HLZH 1RZ8A 5IV2A 3RL1A 4M61A 1MCJA 3I9GL 1ZA6A 2HLFC 1RMFL 3V95A 3ILQC 4JY4B 1JBJA 5HPMA 1N4XH 1NFDB 4NHCL 2AJZA 2PKDA 3HE7A 4PJHE 1L7TH 1NC2A 3L1OL 1NMAL 1KCUL 2CO7B 4LMQE 5E8EA 4HKXA 3TH2T 4P4KB 2A6KA 3DHMA 5IVXB 3JVGC 2VLRE 4QF1B 5EZIL 1LO3L 4QXGL 2P43B 5BCAA 5D1XD 4WV1C 2A6DB 4GRMA 3O3AB 1JHTB 1EHNA 1CVRA 5EU3B 5FYKU 4YDKH 5A2FA 4R8WL 1DQDH 5BMFH 4EQ2A 1NBYA 4LSPH 4RDQG 5F1NB 2YR3A 4DOHB 4OGAC 4WNQB 3T2OA 2HKHL 5K59E 4X7CC 5EU6E 3LN9A 5D2NE 3G5ZB 1C5BL 4JFHE 3WL9B 1FLTX 1QZ1A 1YEFH 1DUYB 4PJEB 4RA0C 3D9AH 1INEH 2IADA 2ZZUT 1VB9A 5CEZD 3DECA 5GGSA 4PJ8C 5DJXB 3KPSA 2DQEH 2EIEA 3G6AA 2ORBH 3OJVC 3C5ZD 1IEBB 2C5DC 1DCLA 1DLHA 2ITCB 3DX9A 1KIRA 5C0JA 2VAJA 2OR9L 1NLDL 4ELMA 4X8JA 3MA7B 4P4RA 1H9VA 1P6AB 4MS8D 4Z7VB 4ZUTB 4L3CA 3MLSL 3OKOB 4J7RA 5TDPB 4OCWL 5SWZD 2X40A 2XQBH 4KI5E 3WLWC 4N5ED 1X5HA 3BZ4B 2CDGA 4K9EL 4HUXB 4HZAA 4KDTA 4GG6B 2NZ9C 1JHLH 3QB7C 2IQAB 3Q3GB 1IQWH 3RAJH 5IT2L 3IFPB 1BQSA 5DRXA 5E03A 3SDAD 1PY4A 3QHZL 1MAJA 2NTFA 1MAML 1MELA 1NCWL 2DYPD 2EE3A 2UUDH 4OFYD 1UKQA 1FJ1B 1RU9H 4GLRI 5KSUB 1EGJL 3NZ8A 4XZUB 4EDXB 1R3HB 5SX4H 3DWTA 2NY5C 2VAAB 3E1F1 3L3JA 4PS4H 3HRPA 5FFLA 3IFOB 3UBXG 3MXVH 1IRAY 5D5ME 3BKML 1DR9A 1MY7A 3I3EA 1CE6B 3HI5L 6CGTA 1AI1L 1AGCB 1NCDL 2R69L 3LKOB 4MJ5B 1LE9A 1ZLUH 4JPWH 3ZKXC 5HDBF 4ODSL 1S8DB 4Z76B 3U30C 3E3QC 4EUPH 4LQ1A 4PRIA 2BVPA 4HUNB 4F9PC 2HMIC 1W8NA 2DI7A 5HYQB 3HR5A 2JK5B 4XB7A 5DMYA 4HIIA 3SJVB 3NGBB 3SKMB 3NIDF 3P4NB 5DUBB 2BSSA 3L6FA 4GBXC 5GZND 2XWJB 4RX4D 2BNQB 4I1NB 5DHXB 4HUVB 3LZFH 5IVZA 4OCNC 1AO7A 2AEIT 3QP3A 3WS3B 5KSAD 4ZXBD 7FABH 4XPHH 1K8IA 2ICWI 2UYLB 4Y16A 1T7ZA 3QXAB 2ATPB 1RFDL 2HTKD 4N5UA 4U31A 5FA4A 4NUJA 5HGHB 4LRNH 5DQJA 3B9KD 4G80A 2JLLA 3OXRA 3OXSB 3QWOB 5DYOA 2G9HA 1VA9A 3FOLA 1U8QA 3LQAH 4PGZA 5HGDA 1SY6A 2NY1D 5T33H 4D9LH 5D7SH 3CH8A 4XC1L 4ZS6C 1DN0B 3ULVC 5D7LB 3QR2A 4NT6B 3BRDA 3DV6A 1XH3B 4FFZL 2BNRA 5J6HA 2ZPKH 1EV2E 3DUSA 3GBMH 1K9TA 5IR1A 4D8PB 4FXKA 1I1YB 3PWPE 5C0IB 5DURD 3U36B 4H5SB 3FT2A 3O6FA 4RIRB 4NC1E 4O2FA 4P59H 3ARBC 4HPYH 4K71C 4C56D 1WBXB 5JW3L 3BJ91 3MV8D 5C07E 1EEZB 4MB5A 3MLRH 3ZTJH 4MA1B 4RGNC 1OT2A 4FZEH 4HXBL 4WWKB 5DMKA 3RL2B 3GI9H 4J8RB 1FVEB 2K9UA 1CQKA 4PJFE 1N6QL 3RQ3A 4HPOH 5DFWH 4PR5B 1ACYL 5I73B 5CZVL 5F9OH 4MMXC 1HXMB 1M05A 4GKZB 4KRMB 1LEKA 2AJVL 4XPTL 2ICWA 2EDHA 4P2OD 3FB8B 3FQRA 3KYKL 3ZDYE 1IGCL 5F88B 3WIHA 5AAWA 4H0HB 1RZ8B 5IV2B 3RL1B 1BD2A 1U3JA 4M61B 4MXVE 1ZA6B 1DQMH 2Z8SA 3SKOA 5LG1A 5BJTA 5HPMB 4PP8C 2AJZB 3HE7B 3ZKNC 5B4MC 1NC2B 4PRAA 1E4WH 1N5AA 3ARPA 1FL6A 1J8HA 3WEXA 2R8SH 4N0YL 5E8EB 4HKXB 3MODH 2A6KB 5D2LF 4NOBA 2Y9RT 2AQ1A 1REIA 1NSNH 1HIMH 2Y36H 4R3SA 2FIKA 4XP5H 3BI9X 1HKFA 3C87A 4KK9D 4GRMB 4HV8A 1T0MA 4FS0A 3BD4A 1NBYB 1I3VA 5FV2A 3K1DA 5E6ID 3UPAA 2BOBA 1P7QA 1VPOH 1MI5D 1RUMH 2PYED 2M2DA 2ADGA 5KVDH 1N2RA 3QHTC 5AZ2H 2OM5A 3S37L 1QBAA 5TFSH 2IADB 1JJUA 2DQDL 4LSTL 3GK8H 3QQNA 5I2IA 5K9QI 5GGSB 4U49A 3KPSB 4QRSA 1HOCA 3G6AB 3MV7D 3LMJL 3K1KC 4KVNL 2FO4A 4XXDA 5IHUH 5MHSD 3AFLA 4NZUH 1CLZL 1DLHB 4HMDA 5KAQF 4X6CE 3DX9B 4JO2L 1KIRB 3PWLA 5C0JB 3EO0A 4I3GA 4ELMB 4X8JB 4P4RB 4LDEB 4UQ2A 3T3MF 4UNTA 5E08H 3FRUA 2X70A 2D4DA 1TVBA 5FUOH 4DVRH 4L3CB 1NPUA 1X5LA 4LCIL 1AGBA 5FYLL 3IFLH 4JR9L 3MBXH 1D6VH 2MHAA 4M4PA 3BKYH 1WGOA 2CDGB 4OT1H 2OCFD 3CU1A 4P57A 5JQHC 1SYVA 1EIBA 2XTJE 2AGJL 4K2UL 1I3UA 4H8WC 1WZMA 2P48B 5DRXB 3BYTA 3QWRD 4HZLA 2LABA 4JFDD 2DL2A 5FYKE 4TN9A 5J13B 5IESL 3H8NA 2NTFB 2R1WA 1MF2L 3OKLA 5F6HJ 5ADPH 2AJYH 1MPAL 1UJ3A 3NZ8B 3P0VL 3TIEA 4EQ3A 2A0LD 5EFIA 5JQ6L 5CLWA 4LPCA 2ZUXA 3H9ZA 4HGMA 2XZZA 3L3JB 1H3VA 2CMRL 5FYJE 4PV9A 5CJ8A 5EOQH 1A7OH 4WI6A 3RWIA 4RSVA 3U82B 1T4KA 3NPSB 1J18A 4XNYH 1V3LA 2V5RA 2VXTL 3S34L 1LE9B 4IOFD 1LO5A 4JDZA 3QZWG 2HFGH 2C4FU 4ZDHA 2KPNA 4PRIB 2BVPB 3LDBB 3HR5B 3HG1D 4M62H 4HIIB 4WU5A 3HAEH 1F4YH 3EHBD 3I2CH 5FHBL 2BSSB 3L6FB 1TIUA 3T0BA 1SJEA 5HYFA 4HKZA 4U7MA 4XPBH 5IVZB 1IAII 5D7KD 4JPVL 1AO7B 4O58H 2XZAL 5KJRH 1EJ6A 1VCAA 4WFEE 4LARL 3ULVE 1K8IB 2EDOA 3G5YA 4Y16B 3REWA 1T7VA 3EO9L 2WUCH 1CGSL 5GGRY 1O0VA 1W0YT 5FA4B 3QQ4A 1NAKL 4NUJB 2IBZY 2IAMA 3WIFA 1J5OH 3CNKA 5DQJB 4OF3A 4G80B 5L8LB 3V4PH 2J7LA 4WW2C 2P7TA 1VESA 1Q0XL 3OXRB 5DYOB 2G9HB 3FOLB 1U8QB 5HGDB 4X98A 5C0RL 4FQJH 3RY6A 4IDJL 4P2RD 3B6SA 3P11H 2GJ6D 5CCKL 2K7QA 4HUUA 3G6JF 4UB0L 3N1QC 5FV1L 1P5VA 4KHXH 3DV6B 1FN4A 2BNRB 3P77A 5J6HB 3SKJL 3S3PA 2NY3C 3DUSB 1MCWW 1AH1A 5IR1B 3Q0HA 3FZUD 4FXKB 1T1WA 4Q58C 4LCYA 3FT2B 3O6FB 5DQ9A 1VERA 4O2FB 3NCYP 4GAGH 4CUCA 4F37K 1ZLWH 2ITDA 5C0CD 1IC5H 5L6YH 4UOW1 4KUCD 4KKCC 5DMKB 3QIBA 1YJDC 1NUGA 5E2TH 2AABH 4JVWA 2YUZA 5D9SA 4IMLA 2NW2A 1UVQA 2AJUH 4YDJA 5T5FL 4CU8A 3B5HA 3VRLE 4FQ1L 4QHUA 3Q6FA 1M05B 3A67L 5EOTA 5JZ7D 4WHYH 1LEKB 1OHQA 1J1XH 2ICWB 5EUOE 3RUGA 5FF6A 4JHAH 4YHZH 1OCWH 3FQRB 1O5DT 3MLVL 5D1ZA 4WUKH 3C09B 4Y19A 1SBSL 3CAFA 2X1OA 4XMKH 1F8TL 1BD2B 1B6UA 4R4ND 1EO8H 3SKOB 5E2UL 1MSPA 1HE7A 3NFNA 1MREL 5BJTB 5KVGL 2FL5A 2IPUK 3GBNL 4PRAB 1N5AB 1FL6B 1J8HB 3WEXB 1MCHA 5FYLD 3SGDH 2FD6L 5IEKA 1KCGC 5M95B 4G5ZH 1MIEH 1LMKA 1GZPA 2NY4D 4R3SB 3UBXI 1QSFD 2FIKB 1V7ML 4ZPVA 4PGDA 3FO0H 1XF5A 1X5GA 3DVIA 3ARUA 1CDUA 1Y18A 1T0MB 2KQMA 3ARRA 4HV8B 5A2LH 4M9PA 4V2BA 2XKNA 1INDH 3SCMA 5GISL 4YBQD 5L88L 4DAGL 2J6EH 5IFJA 5DVKA 1I9JL 3LSOA 2BOBB 3CX5J 1MCFA 3RGHA 4KTEL 1P7QB 2VDPL 1N59A 5MEQA 4HCRL 5TJWK 2HRPH 2ADGB 4AEIL 1N2RB 4DUVA 3CFIC 5GRUH 4HGKC 1EO5A 4ACPA 5I2IB 3AS3A 4OZHE 3GIZL 3VI3F 4QRSB 1HOCB 1IC4H 2FO4B 4XXDB 3H9SD 3ERYA 3T8XA 3QFJD 4AJ0A 1BJ1H 2PR4H 2YEZA 3PGDA 3PWLB 2FNBA 2RR3A 2JTDA 3EO0B 2YK1H 3MRLA 3MZTA 1GPOH 3T08A 1ZTXH 4UQ2B 1EEYA 4KGLA 3RI5K 3FRUB 2NXYC 4HT1L 4JE4B 2X70B 3CMOL 1TVBB 2AKRA 2ED9A 1BEYH 1DTUA 1AGBB 5ID1A 5KS9F 4ODVH 2MKLC 1YMMA 3EOAA 5F7NC 2MHAB 4QO1A 4OJFH 1I1AA 4YK4C 3QT2A 3UBXA 1J10A 2NY2D 4P57B 1SYVB 2EYTA 3C6LA 2VH5L 4HZLB 1G0YR 4ZTPL 3K4DA 5HXMA 1J05A 4QXTA 1CXFA 1RZJH 2R1WB 2EICA 3C60D 3NAAH 3OKLB 2FEEI 3DX7A 2DQGL 4M93B 5D7JC 4KROD 2X7LA 1RUQH 1HHGA 4OLZH 1UJ3B 3KG5A 4PP1D 3TIEB 1F2QA 5BV7B 1OD9A 5EFIB 4KGJA 4PRHE 3H0TA 2E7CA 1BVZA 4Q9CA 4PV9B 1BOGA 4K3DL 2B5IC 3TVMA 1T5WA 2E7LA 3BZEA 3RWIB 1FP5A 1A14H 4ZFGL 1VKXA 4KWUA 3V7MA 1T4KB 3PWVA 4GFTB 3O2WL 2E7MA 5IP4A 5E7FA 1FCCA 1FNLA 3JWDC 4JDVA 5DUPL 1LO5B 5GRZA 4JDZB 2PUQT 3R1GH 4OSUL 4ZDHB 4RMRA 4XHQA 4R90H 1OM3H 5F97E 5HDBE 2LVCA 3QPXH 4WU5B 4IIQA 4Y4KC 1I9IL 2PW2A 4KKAC 5GIRA 1SJEB 3MV01 4HKZB 1QLFA 5DHYA 1IKFH 3IDGA 3LS4H 4JFQA 4G8IA 1JWMA 4JZJC 4JCLA 4NQCD 3RVUC 1MFNA 3G5YB 3REWB 4LSQH 5CEZH 1L6ZA 3N1GC 3QQ4B 3GSQA 4YAQA 2IAMB 3CU7A 3WIFB 3IKKA 4R6UA 4G42A 5I1DA 3S97C 2P7TB 2A9NH 3CK0H 4X98B 4FZ8L 5C6PB 3MZGB 4NUGL 1WIPA 2VIRA 3B6SB 3SBWC 2UZIL 2BRQA 2R0LL 4HUUB 4OBRA 1FN4B 4PG2A 2G60L 3P77B 2FHCA 4I3RH 2FSEA 1S5IL 4I0KA 5C09E 2QADD 1MY5A 2Z0BA 2NTSP 1T1WB 2QEJA 4LCYB 1TQCC 5DQ9B 4CL7A 5HHNA 3IF1A 5KVFH 5ACMA 3TT1L 4G6KL 4IM8A 2ITDB 4ZQKA 5AUMA 1F00I 1H3TA 5GS0C 3TF7C 1GGIH 3RPKA 1KFAH 3QIBB 4F7TA 2VUYA 1U41A 4EKXA 5D9SB 4IMLB 2NW2B 3UDWC 1UVQB 4YDJB 4K3HA 2AJSH 2F5BL 4QHUB 1UWGH 3Q6FB 3QUML 2BCKA 4K94L 5JA9A 5JXEA 5EOTB 4DFHA 3UJIL 1QLRA 2IWGA 2H9GA 2QQNH 2FBJH 5FKAA 3RUGB 5FF6B 3IXTA 1IAOA 3ZDZF 5EUKA 4GAYA 3MOQA 5D1ZB 1HCVA 4PJGA 2P42B 1OAXH 3O4OC 4Y19B 3GMNA 3PQYE 4J12A 4OCXH 3WN5C 4UIMA 5J12C 1OVZA 2XA3A 3U2SA 3NFNB 5CBEA 2FL5B 4G7YL 2ADFL 5JR1L 5LGJA 1S7TA 2H8PA 4M1CD 4FP8H 1EPFA 3BUTA 2YD4A 2HFEA 3QQ3A 3MRCA 5IEKB 5F6IC 1NEZA 4LMQI 1I7TA 4HWBA 1WZLA 1MJJA 1B0RA 1GZPB 1F4XH 5D2LE 2HWZL 2YD8A 5ID0A 4DN4H 1DBKH 2Q86A 2CK0H 4ZPVB 4PGDB 1XF5B 3IAQA 1DQLH 2IBZX 3L5HA 1Y18B 2ERJC 1U6AL 3SE9L 3N9GH 1KEGH 3WXWH 1MCKA 2XKNB 4FN0A 5JHDE 3SCMB 5IK3A 5IFJB 4QRRA 1UEMA 3QEGH 4M7ZC 4DTGL 4G59A 3LSOB 1MHHA 1EVTC 3I9GH 4Z7NF 1N59B 5MEQB 5BW7A 2VLKE 1ZT4A 4NHCH 4XP1L 4I3SL 4HH8A 1F97A 5HHOA 3L1OH 1I1FA 3S36H 3G6DH 3GNML 1NMAH 1CD0A 2VL4A 4M8QA 4Q6IC 1KCUH 3TJHD 1PVHA 4P2QD 1FE8L 3UPRA 2EKSA 3DIFA 3T8XB 4RWHA 2OI9A 5EZIH 1I8LA 1LO3H 5D7IF 4QXGH 2Y23A 1RIUH 5FGBA 2YEZB 1WIOA 3PGDB 5IB4A 5E2VL 3PV6A 2GIYA 3MRLB 3SQBA 1JP5A 2GJZA 5I1GL 1EEYB 1FIGL 4R8WH 4F7PA 4PJHA 1DLFL 2AKRB 4CDGC 4Y4FC 5ID1B 2V7HA 4Y2DA 2HKHH 1YMMB 3EOAB 3MBEA 3R4DA 1I1AB 3ZT5A 4OLXH 4EDWL 1C5BH 2VLRA 3UBXB 3RZWA 3HPJA 3FL7A 3WUWA 4LEXL 4F33A 2EYTB 4HG4K 3C6LB 4MX7A 5L2KD 1GL4B 5C0FA 4G8GD 5CGTA 4NDMA 1OLLA 2C3WA 3QZWA 1J05B 4QXTB 5CGYD 5I15L 3TH4T 4U6XA 1A6TA 1LP9E 4XHJC 5D1QC 3DX7B 3ARWA 2D2OA 1NFIA 1FHGA 1H15A 2B1AL 1HHGB 2OR9H 2X7LB 1NLDH 4X9BA 1OTUC 4R0LA 5B39A 1U8PA 3OBAA 2PXYA 3HE6D 1QFWM 1HEZA 3H0TB 2G5BA 3MLSH 1CL7I 1ERNA 1BOGB 4J3VA 2FRGP 4OCWH 1T5WB 3TVMB 3BZEB 2W9DL 3UJTL 1VKXB 4MXWL 4LSRL 3PWVB 3RGVA 3RHWF 4K9EH 5ELIA 2PYFA 4JO3L 4PJCF 4JDVB 4NKDA 2AI0L 4MD5A 4X7SL 5IT2H 4X6DF 1OAKL 4XPAH 3ULSA 4C54A 3F7RA 2HT3D 1Q9OA 4KUZL 3QHZH 4IIQB 4X99A 2PW2B 5GIRB 4P46D 4OLYL 3H9YA 4JZOA 1NCWH 1QLFB 5HHQA 3KAAA 5DHYB 3BFOA 4XCCL 3QIWA 3CDCA 5C0EA 3IDGB 2DLIA 1EGJH 5F7EL 4JFQB 4G8IB 1JWMB 2F54A 3VXSE 2QL1A 3MCLL 1DFBL 5HYJD 1XF2A 3GSQB 4YAQB 4KJPC 3BKMH 4G42B 5CUSL 5I1DB 4KTYA 2YWZA 3HI5H 2YC1A 1QR1A 1AI1H 3GRWA 2R69H 3MJ9A 1G7PA 2VKXA 1U3HD 4UBDD 1RK1A 2VIRB 5DJAA 3OTTA 2F19H 4Y8AA 1UCBL 2Q3ZA 3MV9E 1NH6A 2HTLD 3V6FA 1NUFA 1QBBA 5CINL 1HYSD 4M00A 2FSEB 2BSTA 2IBBA 4AIZA 5HHVH 2W59A 5INDA 3SE4C 3NCEB 4YHLL 5HHNB 3IF1B 1S7WA 3PDOA 3R8QA 4E41E 4ZQKB 5AUMB 4KVCL 3KXFE 2W0FA 4EI5A 1BBJA 3TZVD 4F7TB 3FO1A 4F57L 1U2HA 4RFOL 2AXFA 5E24E 3TH3T 4MHHG 3V6OC 2DQUL 5CKGA 3V4UL 2BCKB 4XC1H 4NBZB 1QLRB 2H9GB 5CZXC 5F3HA 5FKAB 1INQA 4PRNA 3IXTB 1IAOB 2D9QB 4FFZH 5EUKB 4GAYB 3QG6A 5DHVA 4PJGB 2XACC 1YQVL 4WY7L 1A3LL 1CE1L 4FFYL 4OIAA 3GMNB 5I1HL 3OF6A 4UIMB 2CIKA 4Z0XA 4Z7QE 3U2SB 4KRNA 3GFUA 5CBEB 1NMCC 3MV11 5JXAL 4MA3A 4DCQA 5KSVA 5LGJB 4KDVA 1S7TB 2H8PB 4JRYD 5D70L 4HXBH 1P4BL 2HFEB 4X7TA 4LPVA 3QQ3B 3MRCB 1NEZB 3UTTE 4GAFB 4P23D 1NANH 1N6QH 1I7TB 1X4YA 1MJJB 1ACYH 1B0RB 1KJMA 1WBYA 1FL3A 4M48L 2BMKA 3PWPA 5ID0B 2Q86B 3HFMH 3KPRE 2VMFA 3QI9A 2AJVH 4XPTH 5C07A 5DTFA 4LSSL 5HJ3A 2C9AA 3KYKH 2ZUUA 1IGCH 4PB0H 5IK3B 4NN6C 5I9QB 4QRRB 3E6HA 2ICES 2XN9D 2B0SL 1MHHB 4M7JH 5LXGH 4HFUL 4ERSL 1L9MA 3S5LA 5JW4N 1ZT4B 2DTSA 3BGMA 3D3VE 4TQEL 2YMXH 5HHOB 4MQSB 1I1FB 5BVPL 2ICWJ 4M8QB 3WO4B 5F7FA 4N0YH 3RDTC 2RB8A 3UPRB 1QFWI 2EKSB 4NQED 5D4QA 4PGEA 3DIFB 3K2UL 2OI9B 1YPZA 5E4IA 3QUZC 4R2GB 1D5ZA 5IB4B 3PV6B 4OKVA 4WDIA 2GJZB 4F7PB 4PJHB 3RVVD 2QV2A 5ICXA 4XPGL 3ARGC 3ARVA 2MCPL 2V7HB 4Y2DB 3WNMA 3MBEB 1GSMA 2VLRB 3HPJB 2NX5D 4KC3B 3ARYA 3WUWB 3S37H 4F33B 3TPUA 4MX7B 3MLXL 4NWUL 5C0FB 2NR6D 4LSTH 5MI0B 3K46A 3SQOL 5I1AA 1CBVL 4L8SA 4NDMB 1I9EA 2YZ1A 3QZWB 1J9CT 1FCGA 1IC1A 4KVNH 3LMJH 1B4JL 2ESVE 1CLZH 1RZGA 5GRWA 2Z31D 4U6XB 1UZ6E 1A6TB 3KLAA 4P9HL 5GRXG 4JO2H 1NFIB 3UYRL 3VWJD 1H15B 2W07A 4N9OB 3X12A 1BHGA 4R0LB 1U8PB 5B39B 5F96L 4YQXL 3GSNA 2PXYB 2HJFA 3O9WA 1HEZB 2CGRL 2MKWA 2G5BB 5D96C 2NY0D 3B2UD 1G7QA 4LCIH 5FYLH 1OWWA 4YHML 4JR9H 3PP4L 3LKSA 2I07A 4WENB 5F7YC 3RGVB 4R96A 1E4KA 1WZ1H 4JRXD 4AENA 2PYFB 2G5RA 5C3TA 4NKDB 3RTQC 2VDRL 2AGJH 2F8VA 4K2UH 4XMLH 3ARFA 4MD5B 3QIUD 4X6CA 2DDQL 1EA9C 3EFFA 2H1PL 3ULSB 4NQUA 1KCVL 1Q9OB 4JQXA 3U83A 5EO9A 1RUAL 4X99B 3W11C 5IESH 3FCTA 4JZOB 1MF2H 5GGVY 3FFCD 5HVHB 5HHQB 3QIWB 4JRWA 5C0EB 1AGFA 2H2SC 2NY6D 1MPAH 3P0VH 1NFDF 3T3PE 2E8YA 2F54B 3NCYS 1UA6L 3I84A 5JQ6H 2R9HD 2CMRH 3C2SA 3FT3A 1HI6A 5SWSE 1XF2B 5GSRA 5IVXF 4JO4L 5SX5H 5BVJA 4M43L 1YC7A 1KLUA 3FONA 4GXVL 2YC1B 3O3BA 4FFEX 1QR1B 1K2DA 2VXTH 3S34H 1G7PB 3DBXA 2X44D 2VLLA 1NUDA 1RK1B 2HAZA 5DJAB 3MUY1 4NZRL 3B8YA 2CLZA 3V6FB 2D03L 1MHEA 4MJ2A 1U58A 3IYLW 2ZUSA 2FDBP 2FEEL 3QISA 2BSTB 4XTRC 4AIZB 4MQXC 4JPVH 1S78D 1CDCA 1QLEL 2XZAH 1FNFA 5INDB 4XH2A 4GS7B 1S7WB 5ERWA 3PDOB 3F8UB 1TFHA 2AEQL 4PJEF 4LGSB 1CGSH 4WTXA 2W0FB 4YHYB 1YEIH 3TYFA 4EI5B 4WO4A 1BBJB 3VXUD 1NAKH 4HGWA 3FO1B 4TTGA 3NFPA 2AXFB 1UH3A 1Q0XH 4FMFA 2XICA 4R4FL 5GGQL 1T89A 1OGAE 4FQHA 4IDJH 3KPTA 3HCVA 4BSJA 4KY1L 2X1WL 5CCKH 4FFWD 5F3HB 3TLRA 2IANE 1INQB 4Y4HA 4PRNB 4Z7VF 5GS1A 2XG4A 4LCCA 4B53A 4YXLL 4WJ5A 3SKJH 1TXKA 3WFEL 3QG6B 5DHVB 4I0PD 4JQVC 2XWBA 2ZNXA 1NCAL 3SO3B 5DFTA 4GG6F 2CIKB 4Z0XB 5GJTH 3LB6C 3WFBL 4OCLC 5JMOC 3M8OL 4EOWL 1P7HL 3JV6A 4MA3B 3SKNA 4DCQB 5KSVB 5IMMA 4TVPL 1UWEL 3T0DA 4X7TB 1M4KA 4OCRL 2VOTA 4GUPA 1QACA 3JXAA 5T5FH 3DSFL 3DXAE 2C26A 4FQ1H 25C8L 1KJMB 3RVXD 1WBYB 4BUHA 1FL3B 2BMKB 3PWPB 2XY2A 3A67H 4LKCA 5F9JA 3QI9B 2BFVL 1KUMA 2Y6SD 2OL3A 5C07B 5DTFB 1RHHA 5KVEL 5HJ3B 2AQ2A 5FUCE 4UT6L 5T1DH 1KB5A 4Z78A 4RCAA 3E6HB 1XR8A 1YNTA 2AEPL 3QH3A 1SBSH 1F8TH 2GSIA 1UADC 3TBTA 4G9FA 1NC4D 5E2UH 3S5LB 5KVGH 1MREH 3V0WL 1OTTD 3BGMB 3GBNH 4JHZA 1FNHA 3RWEA 2OSLA 4JKKA 5EUOA 2FD6H 4WFGE 1MHPL 4HK3J 1A3QA 4PGEB 2VR9A 3VRJA 2AK4E 3KS0J 3VFRA 2DM7A 1ZHNA 1YPZB 1JFQL 1V7MH 4MAYD 1D5ZB 4KJYA 4FOMA 4OKVB 2DQTL 3LKNA 4WDIB 3QDME 2GUOA 2HA1A 2QHRH 2JB5L 4ZUUA 1KCSL 3HI6L 5GISH 2F53A 4DAGH 1QEWA 3HZKA 5L88H 5ICXB 1A7NH 3GKWL 1I9JH 1IE5A 2JJSC 4LF3A 4APQC 3VG9B 4HF5L 4KTEH 3MRRA 2FLRT 2VDPH 1MRDL 4HCRH 3GB7A 4F3FA 5H37G 4AEIH 4WHTA 2X89D 3VRIA 4L3EE 3TPUB 4JGMA 4XWOC 2YD6A 5I1AB 2Q7YA 3AB0C 3TJEL 4L8SB 1MCNA 1CS6A 3I6KA 1G7HA 4LCWA 3CXHJ 3O0RH 2ZNWA 2OZ4A 4GRWH 1RZGB 3B83A 2PO6D 3KLAB 2BVQA 4HLJA 3VXRE 4POUB 1AXSA 5FDWA 3X12B 2MPAL 4PGBA 2HJLA 3GSNB 2HJFB 3O9WB 3V6BR 1KYOK 4HT1H 4MHHI 1JMXA 1JWUA 3CMOH 4QOKE 1K8DA 3G9VA 5B8CC 1G7QB 4M5ZL 4H25A 5FXCH 2OMNA 4OZHA 3LKSB 2I07B 4IOFC 4R96B 4AENB 5CIPH 3AXLA 4HUMB 4OFPA 2W65A 1MJ8L 4JN2A 4OQTL 1HK6A 3ARFB 4X6CB 2VH5H 4OD3L 1A7BA 1Z2KA 3EHBC 1WWAX 3EFFB 2NYYD 3ZHDA 1Q8MA 4X6DE 5EO9B 5T3ZH 4ZTPH 5J1SC 1P69B 5F72S 3FCTB 2R4SL 1C8PA 3E0GA 3IDNA 2AK1L 3QPQD 4X80L 3OKKA 3ULUL 2DQGH 3H3PL 1AGFB 3B2VL 1T66C 5DXWA 4FQXC 4RBPK 4S1RL 5C70A 2XTJB 3KHQA 3FT3B 5F7WC 4UTAH 1HI6B 3VXOA 4K3DH 5GSRB 2DB8A 4S1DC 5BVJB 1PZUB 4ZFGH 3ARDA 3TN0C 1IT9L 1KLUB 3FONB 3O2WH 4C83A 3O3BB 3JTTA 3B9DA 1K2DB 1A3RL 1SJVA 3DBXB 5DUPH 3MXWL 4OSUH 2VLLB 1CIUA 2MTPA 4K8RC 4PPTA 2A9ML 1YEHL 4DGYL 4TVPD 1PEWA 5HYEA 1RJCA 1D6EA 2CLZB 3QUXA 4XNQA 1MHEB 5CSBA 1U58B 4PRHA 1I9IH 3VMOA 5BRZD 1Z9MA 2PN5A 4RISL 4O2EA 5HI4D 4P4KC 4UQ3A 4XH2B 3MUJA 4EVNA 2VABA 5ERWB 5E8OA 2CD0A 5C9JA 4WUUD 5DI8A 3PWNA 1LO4L 3B9VA 2EC9U 3CFCL 3TYFB 1K4DA 4WO4B 2C4FT 4ZUSA 4HGWB 3NIFE 4M1DL 3NFPB 3WV0A 1A5FL 3UZEA 4MXQA 2F15A 2R29L 4GG8A 3CFEA 4YZFF 2W9EH 3O41A 4FZ8H 4GQ9L 1L7IL 4NUGH 4FQHB 2OR8A 1CVSC 4ELMF 3HCVB 4HWZA 2UZIH 2R0LH 5DMIL 5C8JA 2HT2C 4Y4HB 5GS1B 4LCCB 4YXKL 4WJ5B 2G60H 3AREA 3H6JA 1S5IH 4LAQL 5AG9A 4GLRH 2NPLX 4RQQA 3JWOC 4TTDD 4ZOAA 1M7IA 2IC2A 2XWBB 3QEUA 1QSZA 4G8FA 1QHOA 3O2DA 1AJ7L 3IJSA 4G6KH 1P84J 4BSVA 3JV6B 3SKNB 1F58H 5IMMB 3U48A 4OZFA 4KQ3L 5JPMA 5DO2C 4X5WA 3QUYA 1BJMA 2P5EE 4GUPB 2CRZA 1K6QL 1TJIL 3U4EA 1T2JA 2F5BH 5JW4Q 3VWKA 3O11A 3QUMH 4MVBC 1R0AL 4K94H 3GMLA 4LKCB 4H1LG 5F9JB 3UJIH 4YE4L 1G6RA 2QSQA 2OL3B 1RHHB 2YPLE 4PJ9D 1KB5B 4Z78B 1QD0A 1XR8B 1YNTB 2ED8A 3QH3B 2GSIB 3TBTB 2Q6WA 4G9FB 2BY3A 5E9DD 1FSKC 4G7YH 2ADFH 4YDLB 5JR1H 1MIML 1ITCA 1NAMA 4MJ4A 1WTLA 2DLEA 5F7UA 3RWEB 2OSLB 5KANG 5EUOB 5IEHA 5EU6D 3VRJB 1GCFA 3VFRB 1ZHNB 2HWZH 3HMXL 4KJYB 3PQYA 3BRFA 1QSED 3LKNB 5JW4R 1GIGH 1U6AH 2GUOB 3SE9H 4ZUUB 3OG4B 1OPGL 2F53B 1QEWB 4DTGH 5A3ID 4LF3B 3NGBC 3ULUD 3MRRB 3GB7B 4F3FB 2VSDA 4WHTB 2H6PA 3VRIB 5CFHA 4LGPB 2AQ3A 4YX2L 3GNMH 1DVFA 2Q7YB 4WW1A 5I6XB 4RMTA 1KN4L 3I6KB 4I8DA 1G7HB 1E27A 4LCWB 4ELKA 1FE8H 4ZO6A 5J9PA 3GBLA 5J3HC 1JYVA 1HN1A 2BVQB 5DJYA 5E2VH 3CXDL 1AXSB 3DURA 5DS8A 5FDWB 2CXKA 2VLKA 4PGBB 5I1GH 2HJLB 4LFHG 1FIGH 3RZCA 1JWUB 2DM4A 1DLFH 1K8DB 4AY0A 3GJFK 4H25B 4Q7DA 1KLFA 3I6GA 4OZHB 2V17L 4O02L 2HKFH 4UAOB 4UILL 1N64L 1OB1A 1T04A 4EDWH 3AXLB 2W65B 4YPJA 5CJ5A 3MRQA 4LEXH 4JN2B 3CSGA 5J06A 3HZYA 1QFWL 5DA4A 5BZWA 1QRNA 4I4WA 5D93B 2ARJA 5I15H 1ZGLM 1WITA 4POZD 4MA1C 3IDNB 1JI2A 5EBLA 4J4PC 3OKKB 3MOBL 2B1AH 2WP3O 2XOTA 4R26H 5I76A 3MGAA 1DBML 5I73C 2ARWA 1BGXL 3BPLB 4OF7A 5KZCB 1B6DA 3VXOB 1ZWIA 5E5RB 1MEXL 1S7XA 2W9DH 3UJTH 3ARDB 3MLYL 4MXWH 4LSRH 2VLJE 4LEOA 1U8JA 5IVXE 4C83B 3JTTB 4JO3H 3K4AA 1OLZA 2NY5L 4KK6C 1LP9A 4OCSL 1T80A 2AI0H 3V9FA 4EN3D 1KV3A 4X7SH 1OAKH 2CKBL 1D6EB 5I16A 2BSRA 3QUXB 4KUZH 4XNQB 4PRHB 2V5YA 3HE7C 4X4XA 4OLYH 4NJAL 1EZVY 2NXZD 4O2EB 4TSBL 4R7NA 1JZ4A 1LO0L 1JRHI 4XCCH 3QXVA 4UQ3B 3SDDD 3X3GL 2VABB 4EVNB 1LNUA 2Z4QA 5E8OB 5C9JB 3ALPA 3ESUF 4XNZB 5FYJL 3MCLH 5B38A 4LVOB 5DI8B 1DFBH 2OTPA 3PWNB 3K80A 4I5BA 5EZOL 1K4DB 4ZUSB 4YH6A 4G6ML 2R56L 1CFTA 2I9LA 5CUSH 1ORQA 4GG8B 3CFEB 3O41B 4KMTL 3BQUD 5MENE 3T0WA 4HWZB 3O2DH 1UCBH 5LVEA 3VXSA 1MQ8A 3IGAA 5C8JB 1IZJA 5ISZD 4DGIH 1A22B 4PJBE 5CINH 3AREB 2HLFD 2BY0A 3ILQD 1AC0A 4QTHA 3CC5A 4RQQB 2DQIH 1M7IB 3QEUB 4YHLH 5A2KH 1G0DA 4G8FB 3ULVL 3QEQE 1RY7B 3IJSB 2RCSL 4G6FB 1Z0NA 3RRQA 4BSVB 4ZODA 4GG6E 4OUOA 4KHTL 4ODTL 4KVCH 4WRLA 3TFKA 4PY8I 4OZFB 5JPMB 4X5WB 3QUYB 4LPYA 4X0KA 4X9IA 4F57H 1EAJA 1A7PH 4PG9A 5BS0A 3HC0A 1J1PL 3DETC 3U4EB 5IROA 1S9VA 4HIJA 3BN3B 2DQUH 3VWKB 3H9HA 3V4UH 3O11B 1WF5A 1GGBL 3GMLB 4MJIE 3RWHA 1MVUA 1NGQL 3V8OA 1G6RB 4KDTC 4P5TA 1U95A 4E41A 4OGAD 2XKSA 4QWWC 1R3JA 3BH8A 1J0ZA 4YR6A 3JV0A 1YQVH 4WY7H 1A3LH 2MQCA 1GOFA 1CE1H 3EJZC 4FFYH 4UOW0 5I1HH 2X4PA 1UFUA 2Q6WB 5J13C 3F12A 1SJXA 3X17A 4NWTL 4CN1A 1E28A 4PJ8D 5JXAH 1XGRA 3MRNA 1NAMB 4Z7OE 5D70H 2F8XC 2QSCL 1P4BH 1CXEA 4LL9A 3BMWA 4YLQT 3PNWA 5IEHB 3SJVE 3O6KH 3O8XA 4M48H 4TUJA 1WVZA 5JIPA 5HDOA 3PQYB 2P1YA 1F6FB 5C7XH 1N5YL 4QKXB 3NPSC 1KENL 2LV4A 4BQ6A 2X4NA 3HC4H 4NC0B 1VEPA 3WLWD 3LPGA 2IFFL 4JB9L 4NRZA 3LDBC 3QDGE 4U05A 5C92A 2B0SH 1MHCA 2Z9TA 5DLML 2WQRA 4HFUH 3L3OA 3UTTA 4ERSH 2DQCL 5DC4B 1Z5LA 3OAYK 2H6PB 4TQEH 3KPRA 5BVPH 1KTDA 1QPXA 1DVFB 1TCMA 4WW1B 1J1OL 4NJ9H 5I74B 4DQOL 5IHBA 1QQDA 1E27B 3RWJA 4V1DE 4ELKB 4LIQL 5J9PB 1JI1A 4Y16C 3K2UH 2WWKO 1XGUA 2FLBT 4ODUA 5DJYB 1TZGL 4OM1L 3F7PC 2EH7L 2F58L 3DURB 2VERN 5DS8B 1ZS8A 2VLKB 1A6PA 3D3VA 3PWUA 4PRPD 3RZCB 3QG7L 3O3DA 4XNMA 4XPGH 4Q9QL 4YO0A 3BO8A 3C6SA 1KOAA 1NCCL 2MCPH 3I6GB 5GGSY 3H3KA 5IBTL 2PNDA 2Q8AL 1OB1B 1T04B 8CGTA 3MRQB 3EFDL 4CBPA 4GBXD 3MLXH 4NWUH 3HZYB 3RUGF 3SQOH 5CKAA 3O6FC 4YC2C 1ONQA 1WJ3A 1CBVH 1D5XA 1UM6L 5BZWB 1QRNB 4I4WB 2ARJB 2PTVA 1B4JH 1KTRL 1G9NC 2J8HA 2LVEA 5DEFA 4K94C 5EBLB 1H3UA 4P9HH 2X4TA 4Y1AA 3EJYD 4D0CA 3UYRH 5EBWA 1ZGLA 1GAFL 1B0WA 5J11B 2EDKA 3CZJA 5I76B 4RDQF 1QRKA 4YQXH 5F96H 2VQUA 2YD7A 2CGRH 4HXAL 5C0DA 3UXFA 4PFEA 2JE8A 1ZWIB 4YHMH 1S7XB 3F65A 1IGMH 1LWRA 2WAHA 3PP4H 5L9DL 1Z3GL 4G6AC 3GMPA 1U8JB 3GSUA 4LEOB 3F6LA 4ZS6D 2ESVA 2FX8L 3QBTB 1KNOA 3ULVD 3S4SG 3DJ9A 3C09C 4EXKA 1LP9B 2VDRH 4LVNB 2DDQH 3RKDC 1NDMA 2H1PH 3WFZA 3RVTC 1KCVH 1RZFL 5I16B 2BSRB 4RZCA 1ZVHA 3MLWL 1RUAH 1K4CA 3CSYA 4JG0L 1DP0A 5GQBA 4X4XB 2CDFA 3ARBD 2UWEE 4R7NB 3EW3B 5KANI 4RGND 1LNUB 1KBGL 4NKQB 1UA6H 2Z4QB 1L0YA 5B38B 4OF5A 4I5BB 4BSWA 4LDOB 4ZTOL 4JO4H 1PKQE 1CFTB 2I9LB 4M43H 3T0VA 4GXVH 3UTSD 1ORQB 2J8UF 1VGKA 1FLRL 2VR5A 4NZRH 3S35X 3VXSB 1PEZA 3IGAB 2D03H 3N1PC 2A1WL 1C12A 3F5WA 1A6WL 4YGVA 4QTHB 3CC5B 5SWSA 2L0DA 3OPZL 5HTSA 1WISA 3ZKND 1GGTA 3IKCA 3OKEA 1CFBA 4N8CL 2V9QA 3WHXA 5TQ2L 3GIVA 1PW3A 2E7BA 4OZGE 4X0KB 1RUPL 3KYOA 4PG9B 1JPSL 1XF4A 2JJVA 3CDYA 4QRPE 5BS0B 3HC0B 2D0FA 5HHMD 1S9VB 4R4FH 4HIJB 2V2WA 1UEYA 3H9HB 4XCNA 1MFEL 3CVHH 3KDMA 1HKLL 4Z7UE 1YJDL 1MVUB 4KY1H 4UINL 3RWHB 2DLHA 3MO1A 5EZJA 4P5TB 3H42L 1U95B 4E41B 4HLZG 1KTLA 4XWGL 4YXLH 1R3JB 3GHBL 3JTSA 3BH8B 4IRZL 3WFEH 4KPHH 4AEHH 2CXGA 4YR6B 5I30L 3KNBA 4DEPB 1LILA 3FTGA 5T1KD 3T2NL 1NCAH 4PYHA 1FYHB 2X4PB 1EHLL 4L8BA 3F12B 5E1HB 3WFBH 1E28B 3M8OH 4EOWH 1OGAA 3W39A 4O4YL 3CSBA 1XGRB 3MRNB 4TVPH 1EZVX 1UWEH 3HNTL 1IAKA 4M93C 1KCRL 3LD8B 1UJ3C 3PJSA 3U0WL 2IANA 3VXME 1MCPH 4M7LT 5BV7C 4OCRH 4E0RA 3VGAB 3PNWB 3DSFH 3LN5A 5JDJA 3C8HA 4ODBD 5I8EA 3O8XB 4TUJB 2VZOA 3D85D 5AYUL 5FOBA 1AO7E 2BFVH 2X4NB 5KVEH 3EKCA 1E6OL 4M6AA 2FATL 3RHWK 4WI7A 4UT6H 2WZPD 2P46B 3PG2A 1J87A 4NRZB 2AEPH 1DUZA 3IDYB 1MHCB 1H3PL 3T0EA 1BWMA 3UTTB 3IJYA 3L3OB 1ROWA 1S3KL 4PJAE 4O9HH 5TDOA 4U6TA 4YXHL 3DXAA 1EEQA 1Z5LB 3V0WH 5DD5H 3KPRB 1FGNL 1AP2A 1KTDB 1EO7A 3H3BC 4U6VL 4ZS7L 4CU7A 1QQDB 1MHPH 3V5HA 1K3IA 1MCEA 3RWJB 4Y5YC 4BZ1H 2H26A 4OCYL 1OAQL 1ZEAL 1XGUB 4Q2ZA 1TENA 4ODUB 2IAMC 2EEDA 1MUJA 1H8OA 2DQTH 3FFDA 3QDJA 4CVUA 1BBDL 3ALWA 2HT4C 1ZS8B 3RI5F 2JB5H 2VJXA 3D3VB 1DL7L 3OKNA 1KCSH 3PWUB 4LQFH 5J56B 3DRTA 3RY6C 3HI6H 3O3DB 3F6IA 4XNMB 4YO0B 3BO8B 3C6SB 3GKWH 2CUMA 4NFDA 3VDAA 4HF5H 2ZSVA 2AK4A 2GKIA 2WBKA 3R06A 4LOUC 4K3JL 2E3VA 5C0AE 2AJXL 1ONQB 3TJEH 1S7UA 1D5XB 3QDMA 4Z0BL 4FFVC 5EBMA 4PLNC 4PJGF 1HHIA 2AVGA 5DEFB 4MJ6A 2DQHL 3QIBC 2X4TB 4JKWA 4Y1AB 4D0CB 4PJ5E 1ZGLB 5EBWB 3VI4F 5FECA 2WK2A 5DD6A 2MPAH 1FNSL 3VFGH 1ODAA 4L3EA 3NA4A 5GRYA 4JKPL 3NIGE 4TNWF 5C0DB 3S9DB 3QCUL 4M5ZH 1YDPA 4JFFE 3O4LD 3GMPB 3B8SA 3GSUB 4EUPG 2ESVB 5D1ZC 1KNOB 1MJ8H 4ZNCD 3VXRA 2NY3D 4OD3H 4W6WB 2OP4L 1NDMB 3MGOA 1FDLL 4RZCB 3MCKA 1UJTA 4DKDC 1K4CB 2DIBA 3CSYB 3SGEI 2NW3A 4QOKA 2R4SH 3JWDL 2CDFB 1BFVL 2AK1H 4M5YL 3VH8G 4X80H 3ULUH 3F7QA 3MYJA 3H3PH 1LEGA 5DVMA 4KKCD 1EJOL 3B2VH 5JORA 1P4LA 5F6HI 1V3JA 4S1RH 2ZKHH 1GOHA 1XCQA 4KTDL 4AL8H 5JTWA 5ALBL 1YN7A 2RIKA 3EOBA 2WBJA 3AMKA 5C09D 4BSWB 1JTPA 2QSTA 1SJHA 3ZYIA 1BPVA 3CPLA 1IT9H 4JANA 1CDBA 3EZJB 5E4EC 4P5KA 5GHWL 1HXYA 5EG6C 3SCMC 1A3RH 1N6UA 5GZOC 1VGKB 4BFEA 4E5XA 3MXWH 3IDXL 2Y7QA 3BIKA 3GJEA 4ONFL 2P24A 4NSKA 1YQ2A 1YEHH 3ZE2E 4DGYH 4MA8H 3OAUL 4N0UA 3TO4A 4PJHF 4MD0A 3VXQA 3F5WB 1C12B 1F45A 2VZVA 4KMLB 5EOCJ 5HPOA 1GJIA 4RISH 4YGVB 5SWSB 5DMGC 1TJGL 5C0ND 1NGYA 3IKCB 3OKEB 2VXVL 3BYYA 2EZ0C 3ZTJG 5TE6L 3WHXB 2FGWL 4WTZG 2I60H 2HN7A 1CD9B 3MROA 3GIVB 1LO4H 3CFCH 1QBLL 1HINL 4M1DH 4UT9L 1DSFL 1KJ3L 3KYOB 3N1MC 1XF4B 1A5FH 2R29H 5TE7L 1MVFA 2V2WB 4PD4J 4R7DA 4GQ9H 1QFOA 1L7IH 5GS0L 5K59F 4XCNB 2JELH 1WV7T 3KDMB 4DZ8A 4R97B 5DMIH 1I1AC 3MO1B 5EZJB 3VD4A 3OX8A 3GSRA 1KTLB 3TT3L 2CK2A 4YXKH 4LSVL 3JTSB 3EIFA 1JRHL 2A38A 3C6LC 1H0DA 4LAQH 1UM4L 3CUPA 3KNBB 4G9DA 4I77L 4M6OH 1FO0L 1PZ5A 4BFIA 3FTGB 4K7FA 2JJWA 4L8BB 1PAMA 1AJ7H 4JFXA 4OF0A 1G9MC 1OGAB 5JHDD 4KK5C 3W39B 3ORJA 4JFED 4KQ3H 1IAKB 2QKIA 2FX7L 3D2UA 3PJSB 2IANB 4E0RB 2VZ1A 3MLZL 3LN5B 1TJIH 5FGCE 5I8EB 4GW1A 4XAWH 4KI5F 1U93A 3OMZA 2E7LC 3TVMC 2NXYD 4ZUVA 1R0AH 4O51A 5FOBB 4EI6A 4YHNA 4OLEA 3CX5K 4XT1C 1CTNA 1G7LA 2EO9A 2WWMC 1DUZB 5J57B 1BP3B 1S9WA 3T0EB 2P5EA 3WXVL 3IJYB 2YD1A 4IIQC 1F3DH 5TDOB 1I3GL 3DXAB 3AY4A 1AKJD 2ZUYA 3TC9A 4Y5VA 4J6RH 5K33A 1AP2B 1URLA 2EO1A 4TUOA 2H32A 5CEZE 3AC0A 3V5HB 5D5MF 5D7JD 1FBIL 1JNNL 2H26B 4PDCE 4OGZA 3T04D 4Q2ZB 5E5UB 3HMXH 4Y89A 1UKTA 4ZUWA 1MUJB 4DWHA 3FFDB 3QDJB 1XZ0A 4MNHA 4QEGA 43CAA 4U7SA 5DZNA 3EOYG 3OKNB 2YA0A 3DRTB 1OPGH 4OV6F 4HK3N 3OWEA 2ADIA 3RU8L 4LPWA 3UC0L 1D9KA 2YD3A 5DRZA 1TCRA 5SWZE 5GXBB 3U7YL 1BM3L 2WIIA 4PG2C 2ZSVB 5CD3A 2AK4B 2C1PA 2BXZA 5GRJL 1OAZL 3R06B 4XX1E 4Y4KD 1ACZA 1JIBA 1WAAE 4KKAD 3BH9A 2PCPA 4RRPG 4Z95L 1S7UB 2DI8A 3QDMB 3SGJA 1KN4H 3S4SA 5TDNA 5EBMB 4NQXA 3NCMA 3ES6A 1T1XA 4KKNA 1JN6A 1HHIB 4X4YA 5DDHA 4HKBA 4MJ6B 3QAZB 3DMMA 3RVUD 5HI5C 1KEML 4GRLA 4Y19E 5GGRA 3F58L 3NABL 3CXDH 5FECB 4JM2A 1ZHLA 5DD6B 4KK8C 4Z7WE 1BIIA 4L3EB 4HHAA 2BERA 5JXEC 4AEEA 3BEWA 4GMSL 1DQTA 1YDPB 2R2BA 4GJTB 3ARZA 2V17H 3QFDA 4O02H 4UILH 1N64H 3CZFA 1NGZA 4IJ3B 3SE8L 3MLUL 5CJXA 2XIDA 1KELL 4Q9RH 3HAEG 4FQCL 3VXRB 1MWAL 3SDYL 3MGOB 1P4IL 3V7AE 2HRLA 3MCKB 4BUGA 5FK9A 1VGEL 2NW3B 3VD3A 4QOKB 4A2MA 5K9JL 4ZO9A 1JGVL 1T0PB 4Q97A 5GS0D 3MOBH 2LAAA 3MYJB 1LEGB 3F62A 5JORB 2WBWB 1P4LB 2QQLL 3MV9D 1DBMH 2BVEA 1QFPA 1XCQB 1BGXH 1K85A 1YN7B 3EOBB 2WBJB 4RNRA 1TNNA 1F4AA 3QO1A 1SJHB 3RA7L 1MEXH 3ZDYF 3MLYH 3CPLB 5HYSG 4JANB 4PTUA 5E7BA 4KXZH 1S7RA 3FN3A 3LAFA 1HXYB 4P5KB 2YUWA 5I9QC 2BVTA 2NY5H 4MXVF 4LLWA 3KXFD 4E5XB 1TETL 4OCSH 3TWCL 2Y7QB 3BIKB 3GJEB 3UTQA 2P24B 2UUDK 3D39D 4NSKB 2KH2B 2CKBH 4XVTL 4C57C 4N0UB 3TO4B 3P0GB 1AXTL 5BW7C 3WJJA 4MD0B 4I18A 3VXQB 2NNAA 2X10A 4EEEA 4NJAH 3JZ7A 1LO0H 3WO4C 4BJLA 4Y8DC 3BDYL 1FNEA 1NGYB 1F90H 2VLJA 4QGYA 1YMME 4ODWA 4P48A 3CDFA 2XT1B 1BQHG 4FTVD 1LDPL 1DQJA 2OI9C 2HN7B 4WFHD 4C56E 3MROB 3MV8E 5DQDL 5FGBC 2X2YA 4NQSA 4R2GC 4GXUN 3MRJA 5EZOH 5HGBA 2KDGA 4G6MH 2R56H 3RY4A 4YEEA 5J4MA 1MLCA 1A0QL 4KMTH 4WHYG 1T0NA 2VWEE 4R7DB 1FVCA 1QFUL 2N1KA 4Y2DC 4DZ8B 3MBEC 5SV4A 2H45A 2C3GA 4G6JL 4JREB 3OX8B 3GSRB 2R15A 3FQUA 3RKPA 2FGZA 1H0DB 1IEHA 1KJ2L 3S3JA 2EC9T 3CUPB 4G9DB 5MI0C 1PZ5B 3ZSSA 4BFIB 2XZCL 4K7FB 1JK8A 3PWJA 4BQBA 3ULVH 4JFXB 1NCNA 2RCSH 3QO0A 4X6CF 4OFKA 4KHTH 4ODTH 1HCFX 5MENA 1G7IA 4C4KO 5F1OB 2QKIB 1CGVA 5SX4I 4L29A 4CVWA 3D2UB 5DWUL 2YKLL 4R0LC 2BHZA 5K9KA 2PXYC 4PJBA 1OT1A 1J1PH 3ZLQC 4DN3L 2D31A 2KUTA 1XIWA 1AQDA 4QNPE 4GW1B 1U93B 3BIBX 3O6LL 4ZUVB 3V4VH 4O51B 1GGBH 4EI6B 4PY7A 1NGQH 4YHNB 3QEQA 3ME0A 3RGVC 2VITA 4Y4FD 3TA3A 4M9OA 4HQQL 4C59B 1KCKA 3REVA 1G7LB 4ZFZA 1JE6A 5GGVL 1T5XA 2WLYA 3KHOA 3T2QA 1S9WB 2P5EB 2IALA 3MTRA 2EDTA 3RX5A 2E5EA 1IAMA 4K23L 4NWTH 3OJ2C 1MI5E 4WEUD 4Y5VB 3WKNA 3L3DA 3MACL 5HVHC 4MJIA 4WI9A 3TCLA 4KI5C 2QSCH 1MCBA 2EXYD 1EFXA 4TUOB 4XHJD 5D71L 2H32B 3O81A 5D1QD 5DGQA 3K74B 5F1KC 2VR4A 3UJJL 2FEDC 4XP9L 5M94B 5T1LA 1PJ9A 1OTUD 4HMEA 5MHSE 3SDXE 1ZKAA 4ZUWB 1FH5L 5HDQL 2DM2A 4MNHB 1XZ0B 1KENH 3CGTA 43CAB 3X3FH 4OLWH 1CFQA 4A2LA 3M17A 3NMEA 3EGSA 2IFFH 5F9WB 3ZZ1A 4CJ0A 4JB9H 2ADIB 4NZTH 4CW1A 3ZE1E 4U1GB 5F7DA 1D9KB 5DLMH 5DRZB 1TCRB 2DQCH 3RVWC 4LAJH 2WIIB 1AD9A 4OAWA 4MZ2A 5CD3B 3WMSA 2C1PB 4QRQA 1OTSC 2BP3A 4OTXL 3BH9B 5JUEL 2PCPB 3ULVF 4DQOH 1J1OH 4GS7C 4PY8J 4EUPA 4JFDE 3S4SB 3MRBA 5TDNB 1QSVA 4NQXB 3ES6B 1T1XB 4LIQH 1JN6B 4X4YB 5DDHB 4LP5A 4HKBB 4YHYC 3QEHA 4EI5C 2P8PA 3DMMB 3QDGA 5I66A 2XPGA 3N85L 4GRLB 4XCYA 2EIBA 5GGRB 1TZGH 2JIXA 4OM1H 2EH7H 4HIXL 4S1SL 3HB3C 1N0XL 4WI3A 4JM2B 2F58H 4KJPD 1ZHLB 3VDBA 4RFNB 4HIHA 3VH8A 1BIIB 3VI4E 3TYGL 4HHAB 4GQPH 3QG7H 3A6CL 4Q9QH 5A1AA 5FO7A 4UDTA 3BEWB 5F89A 1NCCH 1SM3L 2R2BB 3QFDB 4V1DA 4BK4A 5IBTH 5TF1L 2Q8AH 3CZFB 1NGZB 4ORZC 2J1KA 4L4VA 3EFDH 3GMMA 1CICA 3SO3C 1Q9KA 2FJGA 3MCG1 3A0OA 1U8OA 1UM6H 3HG1E 5FK9B 5CJOL 4D9QD 2O5XL 4HEPG 4IRJA 4H8WH 4QTIL 4J3SA 5D7KE 3VRLF 4KH2A 1GAFH 3ECBA 4J1UA 5CJQL 3BOVA 3HRZA 2EDWA 3X13A 4HXAH 4RNRB 5C0GA 5EUOF 2GTWA 4J3WA 4DJMA 3QO1B 3QI9C 4NC1C 4JQIL 1WZKA 5L9DH 1IL1A 1Z3GH 4PTUB 1JL8A 1S7RB 1P9MA 2FX8H 3MNWA 5CZXD 5JDSA 3WIIL 4L4TD 4LLWB 5BQ7A 3NPZB 3P9LA 3UTQB 3HHRB 1CU4L 6FABL 1J0IA 3PXHA 4P2RE 1RZFH 4S2SA 3MLWH 3GKZA 4I18B 4JG0H 3K0WA 2Z8VC 2NNAB 2ICEA 1FNEB 1RSFA 2VLJB 1KBGH 4ODWB 1D5BA 1UKSA 2CO6B 1DQJB 2J4WL 2X6MA 4LVHB 3WO3B 4NQSB 4DK3A 5C0CE 1NQBA 1VFUA 3HZVA 3MRJB 5HGBB 5KTEL 1I1RA 3BIAX 4ZTOH 1KULA 5HVWA 1JWSA 4N8VA 3ZKMC 5DEZA 3SEPA 3NH7L 1MLCB 3U9PL 4ENEC 4W4NA 4IOIA 1T0NB 2UWEA 1FVCB 1C1EL 4TULL 4KRPB 1FLRH 3VG9C 5ILTL 3VFPA 4Z8FL 2ED7A 4DFIA 1DBAL 4LFHD 2ZUQB 3FQUB 5ITFA 4JLRA 2A1WH 3VD5A 4L9DA 1A6WH 4OZHF 1PKQA 3X11A 3OPZH 3BAEL 5FGSA 4L8SC 3UO1L 1P2CA 1JK8B 4N8CH 3QNXA 3PWJB 5EPMA 3D87B 5TH2A 3V7AG 5I75B 3QO0B 5TQ2H 3RDTD 5MENB 1G7IB 2DLFH 3A6BL 4L29B 1NCBL 3QUZD 1RUPH 1LDSA 2YA2A 1JPSH 5K9KB 4PLJC 3O9WC 3P3YA 3QCTH 4HH9A 4PJBB 4RGOL 1OW0A 2D31B 1XIWB 1AQDB 1FNGA 2X4SA 3KLSA 1I8MA 1QSFE 1MFEH 4FQ2L 5MERA 1HKLH 2EDQA 1YJDH 4PY7B 4UINH 3ARGD 3QEQB 4X83A 1BVKA 2VITB 1E4KC 3TA3B 2F54E 2YOCA 4XWGH 3GHBH 3ARFC 3REVB 4ZFZB 5I30H 2LTQB 4OZGA 1T5XB 1NMBL 5AAMA 4A6YL 1CXLA 2IALB 4W81A 4QRPA 3T2NH 4JQXC 3UZVB 1EHLH 1JVKA 4CN4A 4S0SD 3W0WD 2OK0L 3ILPA 3UDWA 2XTLA 3L3DB 2FIRT 4O4YH 4MJIB 4H0GA 4Z7UA 3TCLB 1KTKE 4DKEL 1VFOA 1KCRH 1EFXB 3U0WH 4HKJA 3RIAK 3BGAA 4QXWA 2XTJC 1BIHA 3LCYA 1OOAA 5T1LB 4RRPA 3H9SE 3QFJE 2DMBA 5DZLA 4NN7B 1F42A 1XF1A 2EKJA 4U0RB 5AYUH 3AVEA 4YFLF 4ALAL 4N9GA 1CFQB 3WHE0 3M17B 1E6OH 4D2NA 3EGSB 1IGFL 4AT6A 4CW1B 1PY9A 3I02A 3HLAA 4HC1L 1JNJA 3RTQD 3VXMA 5F7DB 1H3PH 1Q9LA 3J8F7 2VDML 3O2VH 4WW2F 1S3KH 2CRMA 3DTXA 5C08D 1AD9B 4OAWB 4YXHH 2Y06L 1JYWA 3BP7A 4MB3A 2AW2A 5HSFA 5CWSA 4QRQB 3W11D 1FGNH 4LLDA 4M1GL 2ZCHL 3NOIA 4EUPB 2C3VA 4U6VH 4ZS7H 1BWWA 3MRBB 1I7UA 2H2SD 3TIDA 1MOEA 3HAEA 4OCYH 1OAQH 3EJYC 1QHPA 1ZEAH 1RULL 1ZOXA 3QEHB 4WO4C 2P8PB 3GSVA 3QDGB 5I66B 5IHLB 2XPGB 3R0MA 2QQQA 2P5WA 4XCYB 2JIXB 4ZFOL 4PJAA 4JGUA 2CRIA 1BBDH 1CZ8L 1W72L 3PXJA 3ARQA 4HIHB 3P9MA 1C5DA 3VH8B 1T89C 1WLHA 4GKNA 3BP6A 3IAPA 5FO7B 4UDTB 3FRPA 3H7BA 4NQDD 5F89B 4Y4HC 5GS1C 4V1DB 3ROLA 4LCCC 1EUUA 2G75A 1IM9A 4LNRA 5EC1A 1JZ6A 4HSQA 4L4VB 3GMMB 4YHIA 4K3JH 1CICB 4XTRD 4CDHA 3DX6A 5HYSA 1Q9KB 2AJXH 2FJGB 2EDDA 4MQXD 1U8OB 2DIJA 3PHQA 4HAGA 2XZQL 3IS0X 4Z0BH 5F44A 1CXIA 1K5NA 4MDIA 4TSCL 3GSXA 3SGDI 4ZAKA 2DQHH 1BMGA 2XA8L 4IRJB 4IRSA 1MCQA 1IAIM 4UNVA 4MAUL 2YN3A 5HHPA 1V05A 3ECBB 3UAJC 4J1UB 1FNSH 3HRZB 4NO0D 3X13B 5CAYB 4JKPH 1OY3B 3OKDA 3PL6A 4RAUA 5C0AA 5C0GB 4P3CL 2GTWB 2L7JA 3ISWA 2GTZA 1XGTA 5C0BD 5B3NA 3KPLA 1BQHA 1PQZA 1IL1B 1MLBA 1VHPA 3MNWB 1A6VL 5JDSB 2IBGA 1ND0A 5BQ7B 3P9LB 1YPZE 1UXSA 4PJ5A 4LHUD 4S2SB 2PW1A 7CGTA 1FDLH 3WFCL 5I0ZA 4YDLC 1WFOA 3JWDH 3LB6D 1BFVH 1A8JH 5GPRA 4M5YH 1IQDA 3P4MA 2ICEB 4K8RL 4PJDE 4JFFA 5GJSL 1Y0LA 3VXNA 1BLNA 5L8JB 4N0CA 1D5BB 2R2EA 4KTDH 5ALBH 3U4AA 2HYMA 3BE1L 4M3JA 3HZVB 1QVOA 2C1OA 3TPUE 2Q3AA 2Z93A 4NCC1 3TGXA 1JWSB 1MCDA 4N8VB 3ARXA 4URTB 3BZDA 2FH6A 3CIQA 5I1EL 2DWDA 1X5JA 4X9FA 4IOIB 2UWEB 1N4XL 3IDXH 4ONFH 1KB9J 2F74A 3VFPB 1MCCA 5EB9A 3OAUH 1X5ZA 5ITFB 1Q1JL 1NEZG 2UVEA 1WSST 2DLGA 4JLRB 4HJ0C 3LIZL 1CI5A 1TJGH 1PKQB 2MOVA 2J6EA 3X11B 5I6XC 4GRWE 4NQVA 4X7FC 1P2CB 5EPMB 3QNXB 4X5LA 4F8TA 2VLMD 5TH2B 3W5NA 4XNXL 4XNUL 4H0IA 2YPLD 1MCRA 1QBLH 5IBLC 3PABA 3JWOL 3MLPA 3S35L 1HINH 3HUJE 4UT9H 1DSFH 1KJ3H 5E8DH 3KPQA 3K7UA 4OIIL 3T1FA 4HH9B 5TE7H 1YMHA 3LQZA 2Y5EA 1FNGB 2X4SB 4JM4L 1CDHA 5GS0H 4HBQA 4UUJA 5F8RC 1I8MB 2EDJA 2OQJA 1R5IA 5MERB 3GJFH 1INEL 4BELD 9CGTA 4UAOC 3X14A 1BVKB 4U1LA 5DJ6A 3VGDA 4APQD 3U1SL 1QTYT 1NLBH 3TT3H 4LSVH 1JRHH 5T3ZE 2ORBL 2I27N 3U79A 1UM4H 4OZGB 3ABZA 3V52L 4I77H 3SKUD 1ADQA 1FYTD 1FO0H 3SDCA 5KG9A 4QRPB 3WS6A 2B20A