3GSNH

Crystal structure of the public ra14 tcr in complex with the hcmv dominant nlv/hla-a2 epitope
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural bases for the affinity-driven selection of a public TCR against a dominant human cytomegalovirus epitope.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
total genus 65
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gsnH02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3gsnH01
3MGTB 2X1QA 1JRHH 3HNTL 1FGVL 1GXEA 2MPAL 3P11L 3BX7C 3SDXE 1EO8H 4XP5H 4LVOC 4WO4D 5DJ0A 3RZCC 5FYKU 3I9GH 2P5EB 1I9EA 5F7UA 2VLKA 3RWCA 2WV3A 5C0IA 1KJVB 4NQTA 1N8ZA 3MXWH 3ULUC 3MV9E 4M03A 3MA7A 4BFBD 6FABL 1EGJL 5I76A 1HOCA 2VLRA 1N8ZB 2Z8WC 4NQVA 1EEZA 2VH5H 4NPYB 2KPNA 4ZTOH 2QQQA 1ZLWH 2F5AH 2GI7A 5IW6B 3V2AR 3KPOB 2ZKHH 4OD1L 3L5XH 4BQ6A 3NFNA 3EYOB 4OF5A 5FYJL 5F6HI 3VFUA 2X5PA 2C3WA 2X4NA 2VXQH 4XXCA 1MCJA 2FBOJ 3MNWA 2X4UA 1DVFD 4Y5XA 4YDJB 4OZFH 2BNRB 3B2VH 4XVSL 2BX5A 3EKCA 2PR4H 3MBEB 3CFDB 4U4BA 3DBXB 4DGIL 4F80A 4N0FA 1GZPA 5HJ3A 5KG9A 5E8EA 4KDTA 1LDPH 3EO0B 3WEXA 2PTTA 5EU6D 3FJTA 3PQYA 4X7FC 3BKMH 4CVUA 4PLNC 1Q0YL 2MQ0A 2DKMA 1JYXA 3UAJD 2DI8A 3TPUE 2AQ1A 4NJAH 5GISL 1PAMA 4JO1H 3R1GL 2QLVB 3RDTD 3IB4A 4NO3A 2BVQA 3T3MF 1B2WL 1AJ7L 5A3ID 1YEIL 1MCQA 3G5XA 3CVHB 1BJMA 1FJ1B 1SYVA 2YUWA 1HILB 2IQ9L 2B5IB 1J1XH 3DUUA 2H3NB 4X6EA 1A6ZA 3WEXB 1NDGA 1JWUA 2HT3C 3DHMA 3RUGA 3EO9H 3BGFC 3P77B 4ZUTB 3IDGB 3HE6A 1BOGA 3TCLB 3OXRA 3BZDA 4R7NA 1MJUL 4QY8B 1NGWB 3WNOA 3CXHJ 1VA9A 4ETYA 5E4IA 5IB2A 3UTQA 5EWIH 5F9JA 1MEXH 1UEMA 4NQDB 5EWIL 2VDKL 3JWOC 3K80A 2IH3B 5D2NE 4MD4B 2YRLA 5FHBH 1T2XA 3G6JF 1AGDB 2VN4A 4NO5A 5J6HB 3L3DB 3W11D 2X9YA 4RGOL 1W0VA 4E42A 3MREB 1YEEL 4RBPK 4XI5D 5E95B 4IIQB 4FQ2H 1JWMB 1CFQA 4HD9A 1XF5A 4IRZL 3BXNB 5D70L 2OI9B 4YPJA 4BUGA 2VLRE 3KPNA 2P5WB 4IRZH 4OZFB 1IQDB 3FO1A 4WI2A 5D70H 4OZGA 2H9GA 3ARUA 3QWRD 4NM4H 1N64L 3SGKC 4GW5B 1FLRH 1P7HL 5FCUL 4I0KA 4OZHA 3S36H 2VITB 3RIAF 3GSNL 4N8VA 3LN5B 3T77B 2VN7A 4ZFOB 5MI0B 4LLQA 1I7RB 3NH7L 2PCPA 5HDLA 3P40A 4JZNA 3HC4L 5DMKA 1IAIH 4QRUA 1WEJH 1FZMB 1KELL 1S9WA 2BNUB 3U6RA 1BIIA 2DLTA 3EYSH 1DQDH 4XC1L 3AS1A 1NCTA 3RDTB 1DBBL 3KPQA 3PWVA 1AKJB 2VLJD 1UQSA 2VZSA 1DVFA 4R90H 4YFDB 2HT2D 2P24B 1QHPA 2G5BB 4RISL 5CZVH 4Y1AE 2E7LA 4ORGA 2A1WH 3VGAC 3BEVB 5EO1B 5B8CB 4ODHH 4WJ5B 5I8EB 1I3GH 2LABA 4TUOB 5HVWA 5IQ9A 5C09A 5L9DH 4CVZB 4GS7B 1MHHB 1U92A 2M2DA 5J11B 5D1XB 3WV0A 1LHZA 3T0EA 2HWZL 3SDAD 2JIXB 5C6TH 2A6DB 4X4XA 2O5ZH 2XWJB 4KVNL 4U1IA 5GRWA 4DEPC 3GMPB 1XGTA 3W0WB 3QI9D 1YZZA 1KLUB 3MRCA 4HULB 2VOTA 4Y4HB 5AD0B 1CI5A 3TYFB 3P0GB 1IM3A 4HQQH 5JW4R 2VQ1B 4LK4A 5IVXE 1ND0A 3ZTJH 2EXYD 3SPVB 4NWTL 5E24E 3VGGA 3W2DH 4ONOA 4MA3B 5KANI 3V6FA 5HHNB 4XCFL 4RZCB 4WWKB 3OJVC 4XNXH 1UCTA 4GBXB 1WUNT 3LN9A 4OLVH 5E5UB 4GQ9L 3PWVB 1E28A 5E6ID 3RWJA 5GGVL 4CU8A 4PJ5E 5C0EB 5BXFB 4Z7VB 2CDGA 3TBSB 1MY7A 1BIIB 5I1KH 5E7FA 3PQYE 2H8PA 1I7RA 3HRPA 5TFSH 1T5XB 5DMKB 1F45A 1QLFB 4JFZL 4P2QB 1KENL 1LK2A 1TLKA 3ROOA 4N8CL 3LKNA 1ZEAL 1HZHL 1WTGT 3QJFB 3B9VA 5ESAB 1MLCA 3HB3D 3LKNB 2ATPB 2GY5A 5D96B 2WIIA 4OD1H 4JGJA 4JVPA 3VU2A 1PKQE 1J0YA 4FS0A 3PWNB 2PYED 4I5BA 3ZKXB 5GQBA 3U0WL 3HMXH 4PTTA 5J1AA 3QIUA 3FN0L 4NRXB 5HYSG 3U0WH 4ZUVA 1OAUH 4PJDE 3FQWA 4J2XA 2GUOA 5DC0A 3QXVA 4Y2DC 2CDGB 3BPNC 2B4CC 2HLAB 1TZIB 3RTQB 1IC4L 3BPLB 2J8UF 3CSYB 3FQNA 4GUPB 4KHXH 1UADC 4D3CH 1Q94A 5I0DA 1WBXA 2MJWA 3K8LA 1KEMH 3D25A 5JQ6L 5DRNA 4ZUTA 2NXZB 4H25B 3WXVL 3E3QA 1RZ8B 4Q74A 3KPSB 1XF4B 1RZKH 4NSKB 1E4WH 1ZA3A 2EC9U 1KIPB 1QSED 3QO0A 5IM7B 3QUZC 4OCXH 1YEDA 5GIRA 3AREA 4OQTH 3F6IA 4F3FA 1KN4H 1I1CA 4CNIA 3BW9A 3PWUA 1GOGA 2AGJH 2X1XR 3I6KA 1F4XL 5EO0A 5JO5B 4OZIF 1NCBH 2VXQL 2Z93B 2EKSA 4NQDE 5C0BD 2QQLH 2X6MA 1NFDF 3STZA 4Y5YC 3VFWB 5GS2H 3C08H 2ZG3A 4I0PB 4N5UA 1J0HA 1YYMH 4C59B 5LWYH 3V0AC 4JFZH 3KPSA 1FAIL 5LWYL 2ADJB 4L3CB 2F54E 4JCLA 3EO9L 4PRHB 3GSUB 1IRAY 3QJHA 1PZ5A 4IS6A 5IMOA 3ULSA 1HYSD 1NPUA 1R24B 3OL2A 4KC3B 1JGEA 3T0WA 3JXAA 4CBPA 3BIAX 4KZEL 1F6FB 1TCMA 5CBAB 4FZEH 4PRPE 5DJXA 1MI5D 4P5TD 4UT7H 1ED3A 3H3KA 3QIUD 4ZAKB 3HG1B 2QSVA 3P30H 4PG2C 3PL6C 5CEZL 4NCDA 1EBAA 3O45B 3Q5TA 3TBVB 4PJ5A 4L8SA 1CFTB 2NY1C 5FYJU 5KVGH 1KN4L 1UJTA 3RWEB 3NCJL 4TTDD 3QDJE 3TT3L 2C26A 5IFHL 3FFCB 1U8HA 2VDLH 1XZ0B 3H6JA 3TT3H 5MEND 5D8JL 4ZXBC 4E42B 5F1OB 4PJCA 1FBIH 2ZUSA 4OF0A 1DBBH 1C1EL 1UZ6F 2CXGA 1I9RL 1QFPA 2GJ6B 1RK1A 2A9NH 5C0ND 2XA8L 4V1DE 5I1EL 5HYJE 3LHPL 1JPST 4ZNEE 1HOCB 3HG1A 2G60H 1PSKL 2Y36H 3SDXB 4NOFA 2XA3A 2Q6WA 1ADQA 3CGTA 4LNRB 4GRLC 2J12B 3Q3GA 1SY6A 4I3RL 4Q6IB 3V6OC 1D5BB 1UH3A 1SEQH 4TQEL 2EYTB 4KK6D 2HFEA 1V7NH 3TFKD 3SCMA 3KR3L 3WL9B 4NRZA 1WBZA 1L0XA 3C5ZD 5C0RL 2MWCA 2VL5B 3LEXA 4QNPE 5D1XC 2VDKH 4OV5A 2BOCA 1GHFL 1N2RA 3V4VH 2HJFA 2IANB 3PIQB 2QSTA 4P2RA 1K4CB 3OQ3B 4FQ1H 4I0PA 2F53D 4O4YH 2H26B 3WDJA 2XTJB 2AJYH 3CFBB 2IAMC 3CUPA 5D7SL 3STZB 1G0YR 3RWHB 1DJSA 4LVHB 1S5HB 4UDUB 1R3IH 2YUXA 2IPTL 5JORB 3AAZB 3LKPA 1MCSA 1OY3B 3FL7A 5I30L 1UA6H 3TPUA 2QL1A 3NZHH 4LFHG 1FNSL 4NC1E 5I1KL 3OB8A 2DQFB 3RPIA 1BVKA 2CDEB 1EHLH 1IFHL 1D5IL 1S7RA 2JE8A 5FM5O 1CBVH 5INCB 5TFSL 2DKSA 3AC0A 1NC2D 5DHYA 3QQ9D 4E41B 5D1XA 4YHPB 3ULUF 4P2RD 2B0SL 2DS4A 1KACB 3PQYB 4Q7DA 4N1CA 5DHYB 3HC4H 1P6FA 1E27B 1BREA 4S1RL 3SBWC 3DUSB 4OJFL 3HAEH 3QO1B 3O6LL 2F19H 3C5JB 5CIPH 1QBMH 3TPKA 1HHHB 4QXGH 4JKPH 1KEGL 3C09C 1CZ8H 3BGMA 1HI6A 1EERB 1VFAB 4AH2A 3G9VA 3TESA 2ARJQ 4Q9CA 3QUXA 4PLKC 4J6RL 2KUTA 5E56A 1JPFA 1JV5A 3BAEL 4YK4C 2YUVA 2VDMH 3MNWB 1GZQB 1KOAA 2CDFB 5FAAA 4TNWK 4Y88A 1OGAA 4LPUA 3UO1L 2O5XH 4XBPA 3HZVA 1J12A 2VXSH 5GPRA 5FKAA 3TJEL 2SEBA 2UYLB 4GG8A 4MDJB 1XGYH 2NTFA 4XCCL 3C08L 4I3RH 1HZHH 1G6VK 3B6SA 1MELA 4XCCH 5IVZA 4NPYA 1VACB 1AO7E 1ADQL 3DURB 1KIQA 4N90D 4Z6AT 1FYTE 1YN7B 1WISA 5F1NA 1DLFH 4BFEA 4FQPA 3SDAB 1XF2B 1X7QB 5AWNL 4PJ8D 3WN5A 1YUHA 1AGDA 4OGYL 3LKRA 3RIAK 3M17A 4QHMA 3V95A 1F6LL 1J11A 2YSSB 1XGPB 2D7TL 1TJHL 4M62L 5FKAB 4WW2C 1RZ7H 5ALBH 3LDBB 4TSAL 4Y2DD 4XPFH 5KVGL 4PJFA 5DR5L 1LD9A 2FRGP 4X80L 1BHGA 1NCAH 5E6IB 3MLRL 2GTWB 2FJHA 1A9BA 1WFUA 1WLHA 5CHNB 5KSBA 2NY2B 4RSVA 1I85A 4F7PB 5MHSD 5E8DL 2DLEA 2YPLE 4RAHA 5DO2C 5DMYA 1A3RH 5F3BB 1RZKL 3CFCH 3PHSA 2CD0A 3FO2B 1BEYL 2XKNA 1RUAH 3P4MA 4NUGL 2YPKB 3TBYB 1NAML 3PDDA 4PG9B 3HUJE 1T03H 1TQCC 3F7VA 3QUZA 4BKLB 2V9TA 3SKNA 1Q1JH 5F1SA 4HJ0D 3GUTA 3JTSA 1X5FA 3O3BA 4OLWH 4QRRE 3KLDA 4JPWL 4XBGB 2VIRA 5DD1L 4G9FD 1RJLB 3F8UB 5GS0C 1WIPA 5GGUA 1VERA 2FCBA 5MHSE 1TCRB 5BW7C 3KWWB 5I8EA 1L7IL 1EFXB 1RHHA 3C8DA 4L5FL 2X1PA 4LHUD 2VYRE 1DLHB 3QEHB 5FUOH 3PL6D 2X4OB 3MJ9A 1NQBA 3VFSA 5C0AA 2HAZA 3BJLA 4A2MA 1MY5A 1SEBB 3B4NA 3HLAA 4Z0XA 5F96L 1UWEH 32C2B 4IDLA 4PG9A 3F12A 5EBWA 3V6ZB 3MRBA 3QXAB 4X80H 3ZT5A 1U3HA 1UKTA 5MEOA 4QRRD 3GSVA 1DQJB 2CRIA 3O3EA 5T33L 1XR9B 5EU6B 2KDGA 4LPVA 5LCVH 5FCUH 3N85L 1CE1L 3D18B 2B1HL 3OTTA 4EDWL 3B8YA 3MUHL 4GMTH 3VMNA 3MUZ1 2DQIH 3AU1B 3I50L 5E03A 3BD5A 1KYOK 1NCWH 4X8JB 5HGDB 1QR1B 2JB5H 1T6VN 5TDPB 2BVPA 3QXUA 2R2BA 4YZFF 3RZCB 3D0LB 1ZOXA 4M62H 3ARDB 3T0AA 3IFPA 2AK1L 25C8H 2H1PL 1SJXA 4L3AA 1JHTA 1UJ3C 5L0QC 3VXMA 4DTGL 2EDQA 3DROB 5D5MA 4K7PH 1IC5H 3MLZL 2EEBA 1W0VB 4AT6B 3OKEB 3X3GH 5HHVL 2JCCF 3PGDA 5A2JH 5FA3A 3B9AA 4HS3A 4YDKH 4PJCB 4AT6A 1Q9WB 5D7JB 5HVFB 1NBVH 1IBGH 1LK3L 4KRPB 2EKJA 2X4RB 2H9GB 4HFUH 5CEZD 3T3PF 1GC1H 2WBJD 2YOCA 3RZCA 1EDQA 1A7BA 4NQDD 1RVFL 1TZHB 3TCLA 4I48B 4OI9A 3MA9H 1FYTD 1H3PL 3VXOA 1T2QH 5DD5H 5DUPL 2OL3B 4N90E 4LEXH 3BZFB 2WWKO 5IUSA 5LXGL 3DVNA 4M5ZL 5D72H 5FA4B 4Y19B 2GTZA 5KSBE 3PJSB 1H5BA 4YPGB 3KYAA 4MD4A 4LLYA 5SV4A 1FFOA 3GK8H 2A73B 5F9JB 3IFNH 1QEWB 1X4YA 1ZGLM 3LPGA 4U6VH 3R06A 4HW6A 1U93A 1NGWA 3UZQA 2LQRA 4U6VL 3BYYA 2DLIA 3MJ9H 1GIGL 4YE4H 5SX4I 4OGAC 3FFDB 5IG7B 3ILQC 5FK9A 4BZ2H 1NFDE 4I18B 5C0AD 4LMQI 2Y6SD 4LHUG 2F54B 4GW4A 1UB5A 4ISVA 4YO0A 3A6BH 1KCSL 2ZUYA 3SGDH 1BVKB 2CDEA 5FYKE 3VXRE 4LPYA 4OBRA 4PV8B 1OB1B 3ZE1F 3GGWB 2A6DA 4XHJD 1XGYL 4AEHL 2AXFA 2YD6A 4KV5F 4DWHA 2R0LH 3HA0A 4OIIL 3F5WB 3VWJA 4F7TA 1ZT1B 5C08A 4JRYD 3EDDA 1GHFH 3V4VL 1FAKT 2GSGB 4X9FA 3ZE0E 3ME0A 2FZ3B 1CLZL 4Q97A 5EO1A 1GCFA 5GRJH 2AJ3B 4IDJL 5IJVA 1BOYA 4WENB 2YD8A 5C0JA 3NIFF 5HJ3B 3OKOA 4O02L 4JFHE 1EJ6A 1MRDL 4PJ7B 3QDJA 5HHQA 4GRLA 2JIXD 4UMGA 1N0LA 1U42A 3S97C 1M7DA 1T2QL 5DUPH 4RDQF 3UTSE 1FN4A 1FFNB 3C60D 4PY8I 3VWJB 3MRPA 3RL2A 1XGQA 1I9IL 3S4SB 3GGWA 15C8H 1A6UL 2IQ9H 1F5WA 3NPSC 3HI6H 4PGDB 3BZ4A 2EXYC 1SJVA 4MQ7B 1CGSH 2VH5L 1X5YA 3MBXL 5C0GB 3RI5F 1YY9C 1DBKL 4ZO9A 4M7ZB 1U3HC 3BESR 5BW7A 2D4FA 2QHRH 3QXWA 3MRGA 5CGYC 5IOPB 5GS0D 3GIZH 5C0BE 1KJ2A 2L4OA 3LKOA 1CF8L 5D9SB 1FNLA 2XXMB 2XKSA 2X9WA 1LP9E 5JMRA 3VXQB 5D1QB 4M5YH 2Y25A 3GIVA 1X3DA 3WS6C 1NDGB 1P7KA 3T4YB 4BSJA 4F33A 4YNYA 5C0GA 3O3AA 3BKYL 1S7QB 5H35A 4WHCA 4IHOA 1INEL 3UTZB 2P47B 1UACL 4Y5YA 2AJZA 4HF5H 1JTPA 4GRWB 3MBED 4D9RD 4WIQA 3MRKB 2V2WB 4QXUL 3V7MA 3T8XA 1VFUA 3AAZA 1JK8A 3FHQA 3N1MC 4NIKB 1HHIB 4OCRH 1MPAL 4GRMB 1JPGA 2BMKA 2FIRT 2Q86A 1YECH 3O8XA 5J3HC 2A6JA 1EFXA 3EDEA 2VLRD 3C2AH 3KNBB 1H0DA 1W72A 12E8L 4PGEA 3S37L 3MRNA 1QO3B 1FP5A 2VXUL 1I9IH 4HIJB 3I3BA 5CIPA 3HR5A 2FHCA 5D5ME 1HNFA 4JFFB 5FUZH 3SKUD 3GUTB 2Z4QA 4FMFA 3RDTA 4MA7H 4GBXD 1CVSC 1ZVSA 4BYHA 3CFKB 4HBQA 4Q6IA 4MJIB 4ZODA 4LLMB 4U6XA 2PO6C 2Z8SA 2I5YH 4UB0L 1MCRA 4EBQH 1NSNH 1RUPH 5JUEL 2HLAA 2HKFL 4P57A 4ZO8A 3F62A 5DDHB 3QIWC 1MREH 2CXKA 3ORJA 1N4XH 1NBYB 2YPLA 1KV3A 1G1CA 3NACH 1KFAL 3AB0C 5A2LH 3WKMH 4F9PC 1H15A 1OSPH 2FHBA 5DK0A 1AY1H 4J4PD 1P4LA 1CFQB 4WFFE 1IAOA 2BY3A 4LSPL 3HNVH 3T65B 5E99H 1R3HA 2GJ6E 5F21B 3HC0A 3U9UB 5IW6A 3R8QA 1X5KA 3LB6C 4P9HL 5B8CC 4UIKH 2LU4A 4I18A 5I17A 4PJ5B 4PS4L 3WN5B 3ES6B 1MF2L 1FIGL 4ZG1A 4HKXA 4TSCL 5DMGC 3SKMB 5AZ2L 4M1DH 5IT2H 5KSVB 3MYJB 3M07A 1V7MH 1H8NA 1IZKA 1VFOA 3CDYA 1Q9LB 4EXKA 4BZ2L 4E41D 4NUJB 1WZMA 4U1NA 1DBJL 1UKSA 3G6JA 4YQXL 2GTZB 2VDPH 5M7QA 4WTZG 4HXAH 5EPMA 3VD5A 5J4MA 3NGBC 5JZ7C 3HUJF 5C0NC 1IEAB 1IZJA 3FB5A 3OHXB 4RCAA 2BC4B 2NY6C 1HHKA 3OV6A 4LSQL 4WI4A 3SPVA 3TZVB 5JOPD 3CNKA 2BSTB 4MQXD 3H8NA 3H3BC 4LIQH 2HWZH 3QFDB 2AJXL 1WCBA 3A6CL 4DFIA 1NAKL 2P48B 4HUXB 2J88L 1GGCH 5JIHA 3TVMB 1VPOL 2UWEE 1ZWIB 3DUSA 2VDOL 5T3XE 4KRLB 3QUYB 3BT2L 1MFCL 5DDHA 3MV8B 2IBZX 2R0LL 3BP7B 3WUWG 1B0RA 3QEQA 3OZ9L 4FG6D 1KN2L 5E8EB 4DUWA 4KKBD 2OCFD 2AJUL 1DBAL 1U8MB 3AS0A 1SY6L 5E8PA 2VLJA 5D7KD 4MB3A 1QLEH 1HXMA 4C55A 2XZCH 4LCUB 4YFLF 3TWCL 4KQ4L 4Y5VC 2XZCL 3H9SA 4G3YH 2G5RA 1U8KB 3T1FA 3X12B 3ZKXC 2BNQE 2QQKL 4WTXA 5EOTB 3C5SB 4XHQA 5DZNA 3RNKA 3GRWA 4MVBD 3O2DH 3FZUC 4QXUH 1AD9B 5DGQA 4PRAB 3E8UH 1A4JA 5C09D 4PJAA 2BOCB 3CFJB 5D7LA 1JGDB 4NM8H 1QUNA 4RAVB 2FL5A 4ZXBA 1X4XA 4XX1G 3MLRH 2BK8A 3MBEC 4X4YA 1FNGA 4Y4KC 3PV6A 2DLFL 1A3LL 4X99B 4MNQB 5L88L 1I1AA 2P8PB 1ZXQA 5EBLA 4QHKI 1HKFA 3FHAA 4FQJL 5D6CA 2FLRT 5F7EL 1FFQA 1BFVH 1S7QA 5F7KC 4HUMB 4F57H 4KGLA 5C2BL 4YHLL 2W60A 3IAQA 1BGXL 5JPNB 5C71A 1NDMB 4OF7A 1V05A 1TMCA 1WAAE 4RGNC 4ODBD 3H0TB 5IEKB 2FD6L 3OKOB 2FD6H 1YEGH 1WCBB 1DN0B 2X2YA 3AFLA 3MMEB 1NCBL 5E8OB 3SGEH 2LTQC 4HIXL 1MCIA 5C8JB 4P3WA 1OVZA 1J1OL 4JDZB 3N9GH 1A9BB 1P84J 5IB5A 2XWTA 2JJWA 2FGWH 4K71B 1WAAF 1I3UA 5KSUB 1BECA 4RA3A 2YRPA 5CS7A 5GHWL 1IGTA 1ONQA 3GSWA 1A6AB 1MHPH 2VISB 1FVCB 3LRGA 5AD0A 4HXBL 1FORL 4Z76A 2YXMA 1AJ7H 4OCXL 3S35H 5I1JL 4HIHB 3QHZL 5I74B 3ULSB 5IMOB 4DGVL 1JGLL 3U7WL 2NY4D 3DX8B 4OAWA 1CXEA 3KYNA 4PJXA 4LLWB 2ZUUA 4MAYC 4ISVB 4X4XB 2DMCA 4J3SA 1PG7X 4Z7UE 3QUKB 3ARQA 1JUFB 2Q7YB 3TO4B 2D31B 5J3HD 3DETD 4KDVA 4XMKH 1F3DJ 1ITCA 4XVTL 1X5XA 1IGML 1G7QB 4L8BA 1MEXL 5J1SC 4FTVA 5E2UL 5HHXL 1XZ0A 4Q9RH 5KVDH 2OS7A 4X6CF 4GG6A 3CX5K 3KPPA 1EVUA 5DVMA 1A9EA 4PLJD 4U6TA 2IALB 4NCC2 3DO7B 5DYOA 3SDDA 5CEZE 3ERYA 4GMSH 5HI5D 3BZFA 3OJDB 5EH1A 5DJ2A 3LS4L 1DEDA 4I77H 4KRPC 3U0TB 4P23A 3T8XB 4PB9L 1X5AA 5HDQL 3ZHDA 3CMOL 2JELH 5I1IL 2VTFA 1CCZA 3QDGD 4NQEA 3HE6D 1RIUL 3KLAA 1K8IB 1NGZB 4YHKH 4LHQB 4Z0BL 1OF2A 4JM4L 2CGRH 3WMSA 4XAKD 4R6UA 3KHOA 2M1KA 5DHVA 4WHTB 4WCYH 2FB4L 5IW3A 1NGXA 2YN5A 3NN8B 2XWBA 4G9DA 4XP9H 5T1MB 4ZUVB 1B4JL 2VQTA 3GSOB 4N9GA 5D1ZD 3NCCB 5FDWA 1FG9C 4X7DC 4PGCA 4OKDA 4GW1A 2Q7NA 5KSAD 4JVWA 1C5BL 4P46B 4X5LA 1F4YH 2ORBL 3KYNB 1OLLA 1LEGA 3GB7B 3V4UH 2BRRL 2CJUL 3SDCB 4W4OA 4Y4HD 5C6PB 4UAOB 3CXHK 4KROB 4Z76B 5EUKA 3DVNB 4YHMH 2WINA 3ZDXE 2WLZA 5CAYB 3KPTA 4MVBC 4JG1H 5HBBA 1AD0A 2YD4A 4GAGL 2ZPKH 1OTUD 1BZ9A 4MA1C 3BEWB 3BT2H 3HNSH 3RAJL 1VFAA 1G6RH 4EN3D 2H32A 2H2SC 1G7IB 3RPKA 2R2EB 5CJ5A 3P9MA 1CGWA 2CLZA 2W65B 4M00A 2WZPD 1BFSA 2EIDA 2AV7A 1U3ZA 3H42L 3BD4A 3QPQD 4NN5C 5DEGA 3RHWK 2W0FA 2P8MA 2UZYB 5I1HL 2RFXA 2EDLA 5I15L 4PGJA 5J9PB 1H3GA 1U2CA 2QV2A 4OIBA 5D2LE 4NNPL 1VDGA 1X5LA 4KKBC 4DW2L 4NQCB 4WI9A 5F7YC 3SHSA 4OJFH 1BBJA 3B43A 4HUVB 5IP4A 2WSKA 3HI6L 3SCMD 3WNLA 5DFTA 3GNMH 3M1BA 2WAHA 3GSNA 3NFSH 1WTLA 2P8LB 1YC8A 4HPYL 3BN3B 4TUOA 1ORQB 1CL7I 4RISH 5CZVL 4WWKD 2X4UB 5HHQB 5FEBA 3JV0A 4JPKL 4Z7VA 2RIKA 4LLVA 1T7ZA 5JHDB 3ZE2E 3X12A 1JGUL 4HLZH 2AXHA 4J7RA 3OKDB 5MENB 5KZCD 3ZDZE 3IU3B 1XAUA 2GSGA 1GGUA 4Y7MA 2IG2H 1DZBA 3GKWL 1RJLA 1QZ1A 4UT6H 1G0XA 2VMFA 1RQ5A 5FYLH 5SX5H 1UM6H 1CWVA 4E0RA 5JPMB 1FL6A 3PGCB 4HUKB 4PRBB 5L6YH 5CJXA 3T0XA 5TJWK 4B41A 3S5LG 4ZFOL 5K93A 2BFVL 1K2DA 4CL7A 5E5RB 3RWEA 1TNMA 1S7SB 3ARGB 2AK1H 3L7FB 2EDKA 4ZFFB 1FG2A 5ESQA 5IHBA 5E70A 3RKPA 2J2ZA 1BX2B 2D03H 2R4RL 5CSZA 1S7WB 1YPZF 2Y07H 1X5ZA 2CKNA 2DTSA 4ESKA 3DXAB 4W68A 1HHGB 2V17L 1QRKA 5F9OL 5LCVL 1HE7A 4CW1A 1N3NB 5DEFA 1LK3H 5FM5M 3QIUB 1P4BL 4CVWA 5IROC 2P5WD 4FQIH 1F3RB 1NEZG 3OJMB 5D7IA 3VG0L 3MNZA 3CU1A 5T1DH 1H3PH 3ARDA 4JFQB 2OMBA 2PNDA 4PJHF 4A6YL 1RZJC 2BVPB 2J3SA 4E0RB 2HKHL 3ZKSD 2W1NA 1GGIL 4QYOA 3N06B 4W70A 3FB8B 4J8RA 4PB9H 1S5HA 2YPVL 3PP3H 4GXVH 4FNLH 2CIIA 4HWUA 4OSUH 3Q2CA 1MFEL 5K9JH 1W8OA 5L7XH 5IBUG 2R9HC 4JLRA 5KVFL 1B6DA 3OB0K 4TOYL 1FZJA 1IC5L 2VZ3A 2GSIA 3C2AL 2R23A 1BQLL 3BVNA 4IBLT 4LCUA 4NGHL 4OI7A 1LE5A 4MXQD 3H9SB 2R2BB 1GPOL 3GSQA 2VLJB 1YPZA 1HXMB 4KI5E 4WU7A 3GJEA 1I7TA 3GSQB 4G6AD 4P2QD 5E8PB 5D96C 1CE6A 1NC4A 4K3DH 4JDTH 3SKJH 2DQIL 4FQXD 1VCAA 2ZUQB 5EZIH 4H5SB 4M7LH 4G6JH 3VWJC 4JFDB 5I66A 2HA1A 2FHFA 4X6CA 3REWB 2NTSP 3WLBA 2OSLB 1AXSA 1ES0B 2EZ0D 4OCYH 4BKLA 4ZOBA 5BMFL 5ICYB 1AQDB 3V6OE 4OT1H 1JPGB 4R8WH 1H3TA 1RIVH 3QFDA 4L1DA 2DL9A 3QYCA 5ALCL 1MHHA 1FC2D 1U92B 4MMXC 4EOWH 1A7NH 1J0JA 3ALPA 3WIFB 4F7PA 4WTWA 4BFGA 2GYSA 2ZNWA 4PJBF 3SOBL 3HR6A 4JR9H 2NW2A 1Z0NA 3DSNA 1A5FH 3ARXA 1YMMB 1LD9B 2CLZB 4HBCH 2ESVD 1RZFH 4EI5C 4MNHB 4PY8J 2Q20A 3G6JB 2VXTL 1JZ8A 2A73A 1OCWH 3DI3B 2X4SA 4B7LA 4JFED 4Y4FC 2HTKC 5T1KB 1EEUA 5IEKA 5LBSH 4QHMB 1BZ9B 1R0AL 3UZEA 1NCDL 4AIZA 3QQ4B 4CDGC 3NFSL 4CN4A 4N9OB 1AD0B 4HWBA 5ABDE 3ARDD 2GT9A 1AGCA 1J05A 1RK0B 2ADFL 4FQCH 3C8KB 5DD0L 1X4ZA 3WJLC 3QHTC 4HC1H 2XTJE 3O4OC 2FH8A 4JPKH 5JOPE 4MX7B 1N26A 4TVPL 2BY2A 4YXHL 4G7VH 5C0CB 5IWLC 4PJ9C 2G9HA 1AH1A 1QLRB 4PD4K 2V2XA 5EZLB 4G8GB 4XCFH 4Y89A 4JPIB 2AJSH 4MQTB 1CU4L 4NQCE 3MQIA 5D71L 5B38G 2G2RA 2AEQL 1BQSA 3DGGB 5FA3B 5TQ0H 4F9LA 3C60C 4U6HA 1T0PB 4U7KA 3VRJA 4WV1C 3FQTA 1K5NB 2Y1VA 5M94B 3BHBB 3HC3H 3REWA 3TT1L 4NWUL 5KSBF 3HRZB 4WTZA 5KTEL 1VGKB 2EH7L 3C8HA 3X13B 3W82A 2HRPL 5FYLD 3RQ3A 1MQKH 2CLVB 3MRMB 1QR1A 2EEDA 2UZXB 3K0WA 4PJAF 4JDVA 5EU5A 2AABH 5DWUL 2AS5M 4MWFB 4DVBB 1MVUA 1UJ3B 5FGRA 4HX1A 1FQ9C 2ZCHL 1SJEA 4GRWE 4OBSA 2ZCHH 3O41A 1KCLA 4LCWD 3JWDC 4QRSA 3MRBB 3K8KA 2BVOA 1U8LA 4H0HB 4A6YA 4KHTL 1KCRL 3FQUB 3BDYL 5HYSA 1ZS8A 4PTUA 2XQBH 3GMNB 2NMSA 4K8RD 15C8L 1HHIA 1YNTA 4ONFL 2O5XL 4XNQB 5DRWB 4K94L 3CAFA 3RDTC 1XIWC 3BI9X 2HT4D 3MNZB 4KRMB 4AEEA 3TT1H 4S1RH 1AGCB 1J05B 3GNML 1EO5A 3MR9B 4K71C 4GW4B 1KCVL 4F33B 4ZSOB 2ZCLL 2NY4B 2FJGA 5FV1L 3V5DA 4PJIF 1ZV5A 1CFVH 3QCTH 1UVQB 4MAYA 1H8SA 3EFDH 3O8XC 5AG9A 4U2ZA 4AM0B 1N5YH 1QBAA 2X4SB 1H3WM 5HHME 2AAVA 1FZOB 1TVBA 1OTSD 3I85A 4OGYH 2YD3A 3RWJB 3CZJA 4NJ9H 5DFWH 3HMXL 2ICEB 3TO4C 4UT7L 1MHEB 1PY4A 4ZFFA 4JRXD 4QRPB 2LFGA 5HD8C 4KJQD 3MLXL 4O2FB 5DVLA 4K9EH 4ZSOA 4P9HH 2EIZB 5DMIL 5I71C 5KVEL 3ARYA 2E8YA 3MJ6A 3PF2A 3U4EB 1XGPA 3R0MA 2ZUWA 1T5WB 3TM6A 1G9NH 2ATPA 1MQKL 3WHE1 5D6DC 1O7VA 3O0RH 1V3LA 4P2QE 2DQGH 4HBCL 4PLJC 1TQBC 2NY0D 3GMLB 4MJ6A 1NFKA 3Q5OA 1BBDH 1UXSB 3RL2B 2HMIC 3QUYD 1PG7H 4WHYH 4F15B 1EFXD 3SKOA 5IHUL 2BVOB 4YBQD 5CP3A 1N5YL 5T1MA 5B3JF 4QRSB 5C3TA 3WHE0 1CG9A 4MNQA 1MVFA 1D9KA 1A1MB 4OT1L 5FXCH 2DIBA 3X14B 4PJ7A 1Z9SA 1DQTA 4JREB 3QRFM 2P4AB 3U2SA 3IU4L 4TUJA 5ICXA 5C0JB 4D2NA 4K55A 5L2KE 1MI5E 4HZAA 2CRZA 2LU7A 1ZGLP 3CLEH 4NZTH 3LEYL 3AU1A 1KB9J 5FO7B 3S8WA 4XVUC 3G5YB 1BVLA 3MLWL 4OCSL 5GGSB 1WWWX 2RCSL 3M1BB 2WBJC 2VITA 1PLGL 3IJSB 4MAYD 5B38B 1UXSA 1QSZA 1J8KA 5GSVB 4WI6A 2X4PB 4L4VB 3ZMRA 1N6VA 5GSRA 1G7LB 2HKFH 4YHIB 1E27A 4QRPD 1R3KB 5JZ7D 1G6RL 3ZKNC 3U1SH 3V79C 3G6AB 2J1KA 3QDME 3X14A 5LVEA 3DUHA 1ZVHA 3WS3B 4YHKL 3NA4A 3OF6D 3SOBH 1CDGA 1RZKC 4DTGH 2R39A 3ECBA 2NY6B 3MZTA 1IMHC 5L2KB 4LARH 5CINL 4CW1B 3DI2B 1PBYA 3BRGC 5JA9A 1S9XB 4EI5D 4BQ9A 4OLEA 1VPOH 2ATKA 4QNPF 3U48A 2BVUA 1EO7A 3QEUB 2AEPH 1KJ2B 2LTQB 2VLKB 3CK0H 4MNGB 5FUCE 4BH8B 4WI3A 5I1EH 2IAMA 1O0VA 4R4FH 4RBPH 3RVTC 4JE4B 2A9NL 1V7ML 2DN7A 5T1KD 1VB9A 4X6DE 4GSDL 3MXWL 1F42A 2VAAA 1I1FA 1CFSA 1I7ZA 2EECA 4G8IA 4M7KH 3GB7A 1XGRB 4HPYH 4P9ML 4ZSOE 4JJ5B 1WBXB 1T7WA 1RFDH 3SDCA 3MGAA 4QOKD 4DZBA 2BSSB 3KDMA 1E4XL 3NCBB 2PETA 4HKBB 4K8RL 4M61B 4ZO6A 3SO3B 5BO1L 1ADQH 2R15A 3MOAH 4B53A 1JFQL 3L3OA 1RJYA 1CTNA 5BV7C 5DD6A 1OARH 3VI3E 4JG0L 1P1ZA 1KXVC 4UTBH 3AY4A 2KH2B 1QFHA 2WP3O 1OT1A 1YEHL 3VFMA 1IT9L 4TULL 5F3HB 2XN9D 4JKMA 4KHXL 2AKRB 5GGQH 4Z7NF 4O02H 5SX4H 4K94H 1MLCB 5KVMC 5FYLL 4C56B 1BP3B 4L4TD 1KCRH 4CVXA 3PQYD 4D9QD 4F7MA 1CD0A 2YPLB 2PO6B 4P48A 2O93L 3G5ZB 4IRSA 5CBEB 1JNNH 1ZT1A 2EC9T 2EDBA 4C54A 3G04B 3BZEB 1YMHA 5BVPL 3EFDL 3ZSTA 4MJIA 4MNQD 1HHJB 1FE8L 2A38A 5E4EB 3UBXI 3OKMA 3QEUA 4HJJL 4HIJA 4GQ9H 4Y1AB 5IB3A 7CGTA 1H3UA 5BVJB 2CLRB 3HE6C 3Q0HA 5DD3H 1MRFH 4QGYA 1RU9L 1YEKH 2DICA 4IMLA 4R0LB 4WEBL 1A3LH 1FVDA 1J5OH 1BZ7A 5K9QI 1C08A 1XIWD 3QIBA 5B3NA 5ADPL 1IEHA 3UPRB 3OBAA 1MQ8A 4PJXB 1T7XA 5I19H 2VLME 1A8JH 1HIMH 2B39A 1NC4D 3EZ8A 3UPAA 2DQFA 3RPIB 1YY9D 2D7NA 1BBDL 5MEPB 1EXUA 4TUKL 1L7IH 4OZGE 4OKVB 3UDWC 5AUMB 3RNQB 4S1DC 1CGUA 4EI6B 5CBEA 1ZAGA 5DRNB 5GGRY 3WE6B 3L1OL 4KPHH 1P7QD 1MUJA 1KPRB 1EHAA 4EI6A 4HK3J 4H88L 4M5YL 1L6ZA 1G9EA 2X4RA 1L0YA 3S37H 1TVDA 1KJ2H 1F4XH 4QRTB 3QQ4A 2ADIA 1I1AD 4X7SL 1QSEB 5CEYB 5HY9B 4NN5B 2R0ZL 4D0CB 4HV8A 2BNUA 1C7SA 2FEEI 3KXFD 3PGCA 2A6KB 5E2UH 3UPRA 4JZNB 3FT4A 2HMID 1NGQH 2VZTA 3WFDH 4ZFGL 4GJTB 4WFGE 2JB5L 1JHTB 4OZFG 1MCLA 5A40E 2OP4L 3KGRA 4JO2L 1CGSL 2P8PA 5I6XC 1ZANL 2YRZA 5EUOF 4X5WB 5F7DB 5IVZB 3U46A 2VDNH 5C0FB 3VD9A 3BH9A 4PRDB 4JPWH 1KXQE 4K3EL 3K8MA 3OKMB 2PUQT 4NN6C 3IDYC 5H94B 2ICWI 4PTUB 3BKCH 4GXUM 4Z7OE 3KVQA 4BH7B 1FH5H 2ITCB 4OGXL 3FOLA 2FLBT 1VEMA 1MRCH 3VFVA 4U7MA 3EOTL 2EE9A 1OP9A 1Z5LA 3V5HB 3P0YH 1OD9A 2I5YL 3ARBD 3FN9A 3BGMB 1JZ4A 2Z91A 3UTSB 4LEXL 3OXRB 1RAMA 4LU5H 4EUPH 4I9WD 8FABB 1S9XA 2RQ8A 4AM0A 3QA3A 1ND0B 4U05A 1VGEH 5ADOH 2DRUA 4O58H 2V2TA 5EU7C 1VENA 4EN3A 4JO4L 3CH1A 4MJ2A 4GT7A 4PRPA 5IV2B 3MRRB 3WFEH 4UOW1 4NBXB 1FJ1A 3G6AA 3D39B 1WC7B 1D5ZB 3JV4A 2AEIT 2IANE 1T04B 1MPAH 1X6LA 1N3NA 3LKPB 1Q9OB 1HN1A 3SDCD 4G8GA 1YEJH 4OLYL 3KXFB 4KI1A 4EUPB 3AM8C 1BWWA 4OCNC 4ODSL 1JYNA 1CU4H 5J1TC 3OHXA 4ONHA 5A2IH 2DB8A 4G6AC 4OV5B 5HTSA 3PGFH 3BH8B 3HZMB 5GGTH 2WWKT 1F4WL 1IGFL 1BQHB 5IIEB 1RHFA 3QDHA 3VXRA 4PRHE 5BV7B 3PP4H 1I9JL 4LVEA 4ORZC 1CG9B 2Z31D 4K3EH 1YQVH 3UZVB 2FSEB 5I8CB 5C3LD 1QLEL 4XC3L 5DHVH 4PJFF 2J5LB 3EIFA 5JW3H 4GW5A 4FP8L 5CILL 2P42B 1A7PL 1BAFH 2HG5B 4MJ6B 2BFVH 5CGTA 2WW8A 3CSPA 1RZJL 1XCQB 2CLRA 3ARBB 3OKLA 4NNXB 3ZO0A 1CLOL 3LRSA 4NQXA 1OAQL 3PWNA 2C7UA 4GG6F 4YC2B 5ITBL 1ZMYA 2EDYA 2EYRA 3OR7B 5GGVH 3UYRL 5AAMA 1A4JB 3RGVB 1NAMB 3MC0A 4W4NA 3ARDC 2XQYG 5SWQA 1QNZL 3RNKB 3BUTA 2IH3A 5JQ6H 1F6AA 1MHPL 1AGBB 3IDJA 1ORQA 1VEOA 5HYJB 3RP1A 2IBGA 3TWCH 5EBMB 3IFPB 4DGYL 4RGNB 3L5HA 1CLCA 1JGLH 3U7WH 2DLFH 2XY1A 2LAAA 4D9LH 2H6PB 4WFGD 3VRIA 1KSRA 2YK1L 1A64A 3L6FB 2GCYA 1FL3A 2C1OB 4MD0B 4LHUA 3BH8A 3HZMA 2IMNA 4LDEB 3U7YL 4PUBL 2OTWB 3ZT7A 1CLZH 5L2JA 5I19L 2NY4C 1A0QL 5FO8A 1DUYB 1X5JA 4HJ0C 1LNUB 1D3CA 1JPSH 1LDPL 2EDNA 43CAB 2DOCA 1MCPL 2R29H 2BMKB 1I1YB 1SJHA 4YGVA 4G8GE 1IM9D 1FV1A 2A6JB 3O8XD 4CRPA 4ETQB 5F72S 2J6EL 5FCSH 4OLZH 2AQ2A 2VQ1A 4KV5E 4XCEB 4EQ2A 1PDKA 2MPAH 3IS0X 3MRQA 5DMIH 4L29A 3MLYL 1VFMA 3MLYH 1OT2A 5I74C 5IMMA 1LQVA 4XMLL 2AP2A 2R0WL 1SVZA 1JTTA 5IVNA 2C9AA 3DECA 3F7YA 5GGTA 1IGCH 1ONQB 3RU8L 1J10A 4FQQB 4A6YH 4FQJH 1NANH 5CD5C 1MVUB 1IGJA 5IQ9B 4ZPTA 1CDYA 5EUKB 1ZLUH 5DC4B 4D8PA 1MJUH 5TDNA 4XPBH 2ILLA 3OKNA 2ICEA 2P44B 5EN2B 3DXAA 4FXLA 3UTTA 5EC2B 3CSYA 3FQNB 1TITA 4GUPA 5JDSA 1DL7H 3LQAC 4RGMB 3ARGD 4RDQG 4NM8L 4GW1B 3V5HA 3PWPD 4WY7L 1F6AB 1S9YA 3FTGB 4N0CC 3WLWC 2KL6A 1AGFA 1NDMA 2BJMH 2NNAB 3O4OB 3DOSA 1KB5L 2DD8L 1DFBH 3W9EA 4L9LC 4HLZG 2WINB 1T20B 2C7UB 4TSBH 5DXWA 5EBGA 1EHNA 1QFWM 2EH8H 2BNRE 4J12A 3V52L 1T4KA 4IMKA 4AG4L 1H15B 1Y0LB 2VDRH 1EPFA 1GGCL 1WZKA 3CD4A 2XI9A 3VFOA 3KJ6H 1JZ7A 5TQ2L 1CBVL 1KCGC 4I4WA 5DD5L 3VGEA 4PS4H 1TZGL 1H3VA 4XP6H 3SDXF 4PRHD 2VAAB 1FFNA 5GS3A 4LRNH 4YR6A 1MWAA 1YEGL 2I25N 3MRFB 3BO8B 3K2UH 1OL0A 5DI8B 2UWEF 1A2YA 4JRXB 4M3JA 4LLDA 4PV9B 1W72L 5F7LB 3O81A 1KT2A 4MSWB 2CPCA 2DMBA 3NABL 1QSEA 1S9YB 1A9EB 4UILH 5E08H 4AQOA 5T5NF 3VDAA 4YJZL 1S5IH 2E8ZA 1DUZA 4RAUB 1WICA 1NGPH 2VE6A 1IILE 1UH2A 3VXSE 1A6VL 4Y4KB 5C0AE 2EDFA 2A9MH 3UTTB 3SGJA 3D0LA 2E5EA 4U0RB 3QEGH 5BCAA 2KKQA 4PJGA 1LQSR 5CLWA 3CJJA 3FOMA 2Z93A 1QACA 1K8DB 2MKLC 3QUXC 3SEPA 3PGFL 2APWA 3DYPA 3VD3A 1I8LA 3NPZB 3K4DA 2Z92B 4HGWB 1MAMH 3MGOA 4N0YH 1AQDA 2X4TA 3DGGA 3D39D 1JZ2A 5DVNA 2NQCA 1CLYH 3DX6B 3LH2H 3G6JE 4XP6L 5ILTH 1T7VA 5B38A 1LEIA 4XVTH 4LPWA 1YEJL 4YAQB 1SBSL 4O00A 3TFKC 3OF6A 3WNKA 2RB8A 4H25A 4MX7A 2YC1B 1TIUA 1U36A 5SWZA 2X44D 3MJGX 4AEFA 4BSVB 3VFTB 2MKWA 5H37H 4Y8AA 3FFDA 2VLKD 5IG7A 3JWNC 3UTSA 4QHNB 4NQSA 4U1HB 3TF7A 4G8EB 3VDBA 3MCLH 4DN4L 3R0NA 4HFUL 5FO9B 1PEZA 4QWWC 5IK3B 5EORL 3PL6B 1NAKH 4RIRB 5ERWA 4P5TB 3KYMB 2H6PA 3MRFA 5JA8B 3FCTB 3IKKA 1YQ2A 3K2UL 1YEIH 2PTVA 3A67L 4C57C 1FCGA 2VO5A 1NL0H 4YWGL 4F2MA 4N0YL 1F11B 5J06A 1RUAL 4NUGH 4OZIA 5EZJB 1NJ9A 4HUVA 5AEAA 5SWQB 2BOBB 1CD1A 4S10A 3GHEH 5DJ6A 5DTFA 1NC2B 4WGVB 3EDFA 4X6FB 3EYQD 4LNRA 3EW3B 5DRWA 3MROB 5C8JA 4UBDC 4FQCL 4KAQH 5D7IB 1DN0A 1P7QA 5IB4A 4P3DA 1BIHA 1U8LB 4X5XB 1NCCH 3EGSB 3TN0C 4XNUH 4GRLB 4UINL 1MHCB 1ZA6A 3ZL4L 4F58L 4XNUL 4MDIA 1NFDA 3DVGA 1ORSA 3G5VA 2VC2H 4LCIL 1RULH 3QIWB 1BQUA 2IADB 1EAJA 4QHNA 5FGBC 1FZOA 1TVBB 3NCEB 2VDOH 4IOIB 3T0ED 5IEHB 1R24A 1J1OH 1R5IB 1BD2D 1KN2H 1R3LA 3DRTB 4HGMA 4HWBH 3QNZA 1W0WA 3TVMD 4FQQA 3SY0B 2FH6A 5F8RC 4YWGH 2EDHA 2VDRL 3PHQB 3VCLB 5C9JA 4P2YA 3W5MA 3WHXA 3B9KD 32C2A 5EBWB 3I2CH 3HLAB 4X9HA 4Z0XB 4RFNC 2F53B 4PRBA 2HT3D 1WFNA 4XNQA 5F9AC 2FEEL 2GFBA 4BSWA 1FFPA 4DVRH 2PF6A 1GAFL 4AENB 3CXDH 4JFOA 5EULV 2DAVA 4N1HB 3OX8A 3NFPB 3DO3A 1LP9B 3NIGE 5GIRB 2KZ1B 1KBGH 1RJZB 2BC4A 2XV6B 4X4ME 5GGUB 1QOKA 5T1LD 5F8QC 4RQQB 1MRFL 4MHHG 5ITFB 1MAKA 3LV3B 5C07A 3S3JA 1T2JA 5F9DC 4M1GL 1FPTL 2WBKA 4DQOL 2JCCE 4QXTB 4URTB 2APXA 3FQRB 3O9WC 2PW1A 2JKXA 2ZUVA 3LPWA 2YK1H 2W0LA 4LLDB 1QSFB 1T66D 5D9SA 5LGJA 5JLZB 5ETUA 3MBEA 3X11A 3LKOB 3MV7D 1S9KC 4LMQE 4RX4A 1KJ3L 3DARA 5KSVA 3FT2B 1X9QA 3IFOB 2IWGA 1PGRB 2PYEA 3GMQB 4HF5L 3DO7A 5DJCB 2IGFH 5SWZD 4KI5D 3NCJH 5C0RH 1OAYH 1ETZB 2G2RB 2IADA 4OLZL 5E99L 1XF5B 4EZMA 3TCXA 4N5ED 5IFAH 4NZUL 1QFOA 1F3JA 4PJCF 4JB9H 4UILL 2OL3H 4KZEH 2IH1B 1B2WH 4HCRA 5DI8A 4Z78B 2FX8H 1U3YA 2QKIA 4Z77A 2NY7L 1FNSH 4OLUH 1D5XB 1UB6A 5F1NB 3ZE1E 2A6IB 1INDL 4G6FB 3H9HB 1NMAL 1FSKB 1WEJL 1Q9KB 3VE0B 5TH2B 4FQXC 3HN3A 3MUY1 4HIHA 1I1AB 4WO4A 2E9BA 3IJYA 3MACH 4R9HA 2F19L 2Z4QB 2R9HD 4PJIE 2PXYC 2H2PD 4O2FA 4RAVA 3HCVB 2ZCKL 1ZLVK 4TVPH 5KW9L 3OG4B 4HS8H 5FYKL 3TBVA 4OF3A 3G5XB 2WUCL 4ELME 4P57B 2DWEA 1W2KT 4WUUB 3LN4A 2NXYC 4Z95L 1U8NB 2VLLA 5BZWA 1KIUA 2AK4E 2X1WL 1MRDH 5E2WH 5C0DA 1T04A 1R3IL 3WJLA 5HGAB 5I1HH 1OCWL 1TMCB 2LVEA 5SWZB 2OSLA 4PPTA 3TNNB 1OAKH 4JRWA 5FB8A 4Y19E 3MV7E 5JOFA 2QTEA 4X6DA 2HVKA 1RZFL 2YHGA 1FO0B 4XH2B 5CP3H 5J11C 2HVJA 4ZQKB 3T4AB 1YPZE 4O51B 5EOQH 4V1DA 1FNFA 2FATL 4H20H 1FYTB 1KTRL 4KJWC 4TPRH 1PG7W 4NQEB 4ODXB 4JY4A 4PJHB 3QH3A 5B4MD 1Y18B 4OM1L 3OG6B 1HEZA 2J4WL 1UH4A 4UDTB 3RY6A 2DWEB 5EIIB 3RI5K 3L5JA 1BVLB 4R8WL 2JB6A 2C4XA 3KPQB 1IKNC 3N1FC 1H5BC 2B1AL 5F1IA 4Q58C 3TC9A 1N2RB 2LE9A 4V3DB 1DUYA 4G5ZH 2BXYA 1F4YL 1QR4A 4FXGB 3MRJB 1I7UB 4ODHL 4TUJB 2HTKD 5HI3D 4KK9C 5ICXB 2Y6SC 3FN3A 4JDTL 4DW2H 3KPOA 1CF8H 3GM0A 2PO6A 3UBXG 4Q2ZA 2JK5B 4KU1A 3MO1B 4WO4B 4C56A 2PN5A 1FL6B 3UYPA 3RZCD 3BSZH 1DLFL 3QIWA 3RUGF 2E3VA 2A6IA 4Z5RB 3K4ZA 1KGCD 5GRVK 2ZOKA 3NCFB 4H20L 3VA6A 3LKSB 3PGDB 1VACA 3GHBL 4JKKA 3EJJX 4M6NH 4YBLC 4OF6A 1IJ9A 1Z9MA 3WSQH 2OM5A 4PR5A 4MQ7A 4OF8A 5DF0A 3W9EB 3IDIB 2WLYA 1ZLSL 5JXED 3MRJA 1BX2A 2VUOA 1XIWB 3MUJA 1A1NB 2Z31B 3U0TA 1LE9A 3NZ8A 3U9PL 1QSFA 1HYRC 4KROD 3HB3C 4P59H 4YZFE 3X11B 3QEQE 5DC9B 3GI8L 4KK5C 3JUYA 3IJHA 5DUML 1EGJH 1KULA 1WK0A 3T4AA 1HSBA 4HAGA 5ALBL 3OWEA 4LP4A 2HLFD 4YO0B 3RL1B 4OQTL 2FJGB 3O9WD 3AS3A 1ZLVH 3QCTL 5IROA 3EOBA 3WS6A 2L7JA 1FE8H 5FK9B 3VJ6B 4M4PA 3RVVD 2EO1A 5E0QA 4F7TB 2HH0H 4WVRA 4O5LH 5AYUH 3WS3A 1FFPB 5D7LE 4XBGA 1AHWA 3DWTA 4LKXB 1FHGA 2EDEA 4H1LH 3EO0A 3MOBH 1B90A 4P4KA 5TE7L 5L8JB 1FV1B 4R96B 4ZMAT 4NQUA 4D3CL 43CAA 4GKSA 5A3IC 4DKAA 3LEVL 5J57B 1LO3L 4H5SA 3U0PA 4JHAH 5FYLE 1TZGH 2E6PA 1T1WB 3LQZA 1YEFL 4ZNEA 4P2OA 5I1LA 2EDRA 5FM4A 3ARFD 4CKVX 4LRNL 4XMPL 3U1SL 2Z35B 1J1XL 1QRND 4DCQA 1GJIA 1X6NA 4IM8A 3SDXA 4NN6B 1BD2E 2R23B 1CXFA 3H9HA 1TZIA 9CGTA 1ORSB 1FZJB 2NY5C 5GJSH 3EYUL 4U49A 5JHDE 4PP1D 2I24N 4FQHA 3MLTA 2CKBB 2GAZB 4WU5B 1OP3H 1FNHA 1OW0A 3VI4F 1P7QB 3PDOB 5IB4B 4KTYA 5IESL 3CLEL 4K94C 1RIVL 2IF7A 1QKZH 4HS8L 4K2UL 2AJSL 4I4WB 1AGEB 5L9DL 2OI9C 3D85B 4M1CC 4X6FA 3AXLA 3QT2A 4OZIB 3L3HA 1YDPA 2BOBA 3T2PA 4L4TB 4ZTPH 1I7ZB 3ULUE 5DJ0B 3WE6A 3IFOA 3RGVD 2OR9H 4HUWA 4ZTPL 3W9DA 2GT9B 5F93C 2F5BH 5B21A 3GJFK 3MLZH 2OJEA 4PJ8A 3VFGH 4ENEC 1IFHH 5DYOB 4H26B 1JZ6A 1PG7L 4U1JA 1CFBA 2RBLA 4YIQA 3FTGA 3UX9B 2PXYD 3TEUA 1M1SA 3AM8A 1WQVT 4XB7A 4PJCE 5KOMC 5D7SH 4G9FB 4L3EE 4JRYB 2HT2C 3S3SA 3EJYC 1MUJB 4PP2A 4H8WC 3SBWA 3G08B 5HGBA 4EUPG 4MCYB 4K23H 3GMRA 4KY1L 1T1YB 2VXTH 4MXVF 1W0YT 5K59E 4K3JL 4M6MH 2VDQH 4LVHC 5IVXA 1TNNA 4S11A 5HYEA 2FDBP 3FRUB 4KK8C 4RNRB 3GMPA 5JXAH 1HQRB 1DVFC 5E5MB 4R96A 2FJFB 1KLGB 3WHXB 4G8GD 4RNRA 5DRXB 2Z92A 4JKPL 4KVCH 4NHCH 4QT5B 5E9DE 5TE6L 3EYSL 4AL8H 1KLFA 2J5LC 5JNYB 2VZVA 3QNZB 5C09B 5TGBA 2EICA 5KW9H 3CFIC 1NCCL 3GMRB 3D2UD 5LAXB 3GSXB 1XT5A 1A6WH 5BVJA 3AVEA 3O6FD 3DIFB 1HNGA 5I75C 3AGVA 3O2VL 1LE5B 1D5MB 2WWMD 5I8KH 3RBSA 3BPCB 3TBWA 4D9QE 3F7VB 1RZJH 4NHUB 2GCYB 4OUUA 5I1GL 3QULA 3VFVB 1A2YB 1UA6L 3FN0H 3MLUH 4PV9A 3FONA 3I3EA 2XPGB 5HHOB 3ZKMC 3KPMB 1XF2A 1A7RL 1DDHA 4HIEB 5TPWL 5JNYA 2D9QB 4Z9KB 4QTIH 3VXTA 1MIMH 4MJ5A 1A7PH 2P7TA 3BH9B 5KVEH 3QFJD 1F58H 5EOQL 2W9DL 2HJKB 5I6XB 1JNLH 1OQOA 5JIKA 1S3KL 5T3XH 5BZDA 5T3ZE 4DJMA 1ACYH 4RGNE 1U8IB 2DQGL 4X7TB 4F2MB 4JZJC 2OQJB 1RFDL 3FO9B 2YBRB 2I07B 1QBML 2NZ9D 1VKXB 4ZOAA 3SDAC 4XMKL 5HYFA 3PL6A 5C70A 2X10A 2Y5TA 1G84A 1GSMA 1ROWA 2BCKB 4XNMA 5IMLA 3BPNB 1JGUH 1NEZB 2BSSA 1JZ5A 4KK5D 2Y5EA 3RRQA 1MI5B 4EEEA 5HXMA 4ELMA 5EN2A 4RWYL 5JHLH 5EA0L 4XNZB 4KRNA 4M43H 1MIEH 1FYTA 4LSSH 5F7MC 4MDJA 4KMTL 3P77A 4FA8A 4WHYG 4NO0A 3ZT6A 4AL8L 3SE4C 3QIBC 5C2UB 2NR6C 2I60H 3B9KB 4HHAB 3K3QA 1JWSB 4UV7H 4FZ8L 4LCYA 1MFDH 3MV8A 1KCVH 3KPSD 5MEOB 3QUYA 3TNNA 3I75A 1JPFB 3RA7L 2HTLC 3P30L 3RIFK 4FTVD 1CE1H 4S1DD 1A4KB 5D7JD 1I75A 2COQA 1MJ8L 1NCUA 1D9KD 5BZWB 1R5VB 1BD2B 2D7QA 5IFAL 1V3KA 4PJDF 3OKKA 3OAUH 5IR1B 3EOTH 1UWEL 3VDCA 4Y5YB 3SJVB 5DO2D 5ID1B 3UTTE 2R0ZH 3DX7A 1ZA3B 5CINH 5IESH 4XB8A 4HT1L 1INQB 2CR6A 4DOHB 3DROA 3QG7L 2ZG1A 1JWSA 4POZD 5GZOC 3SY0A 3GKZA 4EIGB 4KH2A 1HSBB 4N0FB 4WFED 1CD9B 3MRIB 4I1NB 4WEMB 4POYA 2FO4B 1MCFA 3ZZ1A 4X8JA 5MP6H 1UWXH 2CO6B 2ADGB 5JORA 1B0GB 1OGTB 4FXKA 3BO8A 3UEZA 3VWJD 5EBMA 3PNWA 4Y16B 3G5VB 2BNRA 1MH5A 2ED7A 2EYSA 2AQ3A 1QYGH 4Y2DB 2HN7B 1I1AC 4P9MH 4XI5C 4OFYD 5CEZH 2MQCA 4KJPD 4LCWB 4UUJA 4S2SB 1R5WB 3ULUH 2BSRB 4PJIB 2EYTA 4PRDA 3PWJA 1XCQA 3FFCA 5TE7H 1ZT4A 2X4OA 4ZOCA 3WIHH 1KJ2L 2BVYA 4G6KL 3TIDA 3VE0A 1JJUA 3DV4B 5C6TL 2MTPA 5B39A 3QUZD 1JUFA 4ENED 1A14L 1S78D 5GZND 4ZAKA 4G8FA 5T5FL 1V3JA 1SHMA 1HH9A 1T3FA 4OV6F 1BF8A 1ZHBB 3RJQB 3WFEL 5D1QD 3HG1E 1F3JB 4G8IB 5CEYA 3CX5J 4ERSL 1KG0A 1JPTH 3FO2A 3SKJL 3MV8D 3JWOH 1BJ8A 5D93B 3INUH 4N5EC 1E4JA 3VGAB 2ID5A 4NKIH 5AAWA 3UJIH 1YA5A 5ID1A 1CLOH 1F97A 5DRZA 3QAZB 3RWFA 1A1NA 5CJOL 4TSCH 1MFBH 3RVWC 5C08B 4OLYH 3EJYD 2UZIH 1MRCL 4PJDB 2WK2A 5C08D 1A3QA 1BFOB 1G7JB 3TF7C 3V5KA 1Q9OA 5I8OL 5D1ZB 1FFRA 3V6OA 3AREB 2BRRH 4ZPVA 4Y16D 5CUSH 1I8LC 2XIDA 3D39A 3HFMH 4Y4HC 4ZUSA 2HVJB 5HHOE 4C56D 5I75B 1JF1B 1WJ3A 3O6LH 2XRAL 3P4OB 4LAJH 2NY3D 3D39E 4YDVB 3IGAA 4Z7UA 1PZUB 2VLMD 4UQ2B 2XN9B 3E1F1 1P84K 3KPSE 1LEKA 3QWOA 4L4VA 5CILH 2ICCA 1OGAE 2E7LC 5HPMB 2BDNL 2MCG1 1J0KA 2VABB 3N0PB 4Y1AA 5IB3B 3L7EA 2R8SH 3V8OA 4ZDHB 3CPLB 4JY5H 5JW4N 4F3FB 1YEHH 4JPVL 1K6QL 4X9GA 5EORH 2VJXA 1ACYL 4DZ8B 2C1PB 5GGQL 2Y5TB 3LOWA 5T3ZL 2XACC 4DVRL 3VXSD 3MCLL 3VFRA 4JKWA 2IG2L 3EHBD 4Q0XH 4J1UA 2VXVL 3VFUB 4LLQB 2JB6B 5C7XH 5EG6C 1B4RA 3T1FB 4PBXA 1RURH 2YBRA 3RIFF 3L5XL 3H9SE 2YZ1A 1RURL 4HZLB 3NA9L 1R5IA 3GBLA 5SWZE 2J8UB 5KSAA 1JNLL 4NKDB 5DS8A 3QCVH 1N0XL 3MJ7A 1OOAA 3WJJC 2A77L 3ZYZA 1BGXH 4IIQA 1OLZA 3WFDL 2Q7YA 4ZFGH 5JTWA 2ERJC 5E8DH 2ADFH 1MHCA 2I9TB 3CZFA 2BNRD 2FX9H 4AEIL 4M4RA 2GJ6A 5FYJH 3FFCD 2X40A 3M8OL 5LQBL 2F58H 3QXDA 1T21A 4M7JL 2NX5B 1PKOA 3S6CA 5C0EA 1RSFA 2DQEH 1RU9H 1YEKL 4LVNB 1LO0L 5I8OH 1D6VH 2DQEL 3LDBC 7FABL 5E9DD 3C6SB 2FZ3A 1WGOA 3I02A 5E6IA 5DJCA 4H1LG 1F11A 3RWIA 3J7HA 3C6SA 2WQRA 4OCRL 2OTUA 4U1MA 3BKYH 1HILA 5DURB 1BQLH 4U3CA 1PX4A 5CBAA 1AR1C 3E0GA 1I8MA 1MLBB 1P4IH 2JCCA 3DX9B 2CUIA 4FFVC 4J23A 4LL9A 4J3TA 4OCWL 4PJ7F 4RFEA 4HS6A 5I1DB 1LEGB 5I73B 3QUYC 2X1OA 1U8PA 1YNLL 2BVQB 4KRPD 4LSRL 5DQ9B 2Q76A 3PWPB 4PJEA 3K1DA 3D3VD 1KJMB 2DWDB 3UAJC 5IGXL 1YJDC 1Q1JL 2IPUG 4OTXL 2QKIB 3TO2A 1KNOB 2BY0A 4PJHE 5DQDH 3VFTA 3GSOA 4N9GB 4B7IA 4APQB 3C9NB 4EDXA 5ICZB 2E6QA 2GJZB 5FF6A 4G9FA 2BJML 4W81A 3RL1A 1CDHA 4AZ8A 3SKNB 1IE5A 2OMNA 2HH0L 3TIEA 4Z7WF 2AJ3A 2HLFC 1FO0L 2HN7A 1ES0A 4PY7B 3WNPA 1EHXA 3C6LC 5FGSA 1U6AH 2QSQA 4KJYB 5HHPB 4DQOH 4M6AA 1XF4A 4MNQE 3ARFB 4GFTB 2GHWB 3T0EE 3B9DA 4FQLL 1JRHL 4N8VB 4FXKB 3ARRA 1TPXC 3GJFH 3U7YH 3HE7D 1M05B 1YJDH 3BWAB 2HKHH 3NFNB 3MRHB 2FGZA 3MUGA 4PJXF 4FRWA 4RQQA 4CADA 5ENWB 2DQHH 1M6OA 2O5YH 5INCA 3WFCH 4KQ3L 5ENWA 3MLXH 4ALAL 1FGNH 4NZUH 4GRMA 4MXQC 3SKOB 5E08L 1INDH 5EO0B 5JO5A 2XQYK 3CDCA 3QHFH 4I8DA 4CJ0A 4PJBB 1QEWA 2FX8L 1F13A 5IFJB 5EC2A 4ZS7L 5JDSB 1VFBB 3WIIL 5IWLA 5D93C 1NUFA 4Y4FA 4OCWH 3I75B 2H26A 5MEQB 2PW2B 5IIEA 3VXRD 4GSDH 1OPGH 3H9ZA 1ZHKB 3D3VE 4L8CA 4HWNA 3VW3H 2ZSWB 1QRNB 1RI8A 4EBQL 2NY5H 1UC6A 3NCMA 2DDQH 1GRWA 4YHML 1IKNA 5T1KA 2EEAA 4RMRA 1S9VB 1IL1B 2RJMA 2VDPL 2NY3C 4ELMB 5FGCB 4KUCD 3O6MH 1S7WA 3OGCB 2FR4B 2R1YB 3QI9C 4C4KT 3FFCE 5IQ7H 1DQLH 2EXWD 4XPHH 2CUMA 1Z0MA 4MDIB 2BRQA 5FDWB 3GRWH 5CSBA 2FWOB 4F7EA 4KZDH 2R4SH 1KNOA 1V3MA 4LQ1A 3ZYJA 2QQNH 4WI5A 1FO0A 4XH2A 3UROR 3T04D 3I6GB 1LMKA 3N9GL 1S7VA 1D7FA 1Q0XH 2JJTC 2WWMC 1SYVB 2ED9A 1L7TL 4Z7WE 1CXHA 4LU5L 1GOHA 4TPRL 3L6FA 1JP5A 3QCVL 4JHWH 4N8VG 1HH6A 3VH8G 4U1SB 2JIXA 3PV6B 4JHWL 3ZE0F 1ZHLB 1T1XA 3V0WH 1ZS8B 3BIKA 3MPCA 2ARWA 4NNYB 4WUUA 5BVPH 4BZYA 1MCBA 1F00I 1AFVH 1A6VH 1JI2A 4Z7QE 3WXWL 1ZLSH 3RGVA 2IPUK 3IF1B 5FO9A 1QFWL 2Y9RT 1EEQA 3BVNB 1UJ3A 4JHBA 2E27L 1E4KC 2AKRA 5CIPB 3GHBH 3GIZL 4N0RA 4CGTA 4MA3A 4EVNA 3BQUA 1A0QH 5I1AB 4MMZC 4QRPE 5DJDA 4DN4H 5K9OB 2Y07L 4NFBA 3MV8E 2RFXB 3CZFB 3CIQA 4NDMB 4HCRL 3IDYB 3PG2A 5I1GH 1BLNA 4NBZB 4P99A 1MCHA 4ZFOA 2VIRB 5E2VL 2D3VA 3VXPB 3NIDF 1HH6B 1WZLA 3BFOA 1SMAA 4CN6A 5GRUH 5CCKL 1JN6A 3BRDA 1DQQB 4DGYH 4M48H 2FGWL 1E0OB 4HV8B 4YLQT 1D6EA 1H9VA 3HMWH 4FFVD 1SM3L 3B9KC 1AHWC 3U7AA 5HHOD 5F7NC 3LRHA 2OZ4H 2ZSWA 4J1UB 3L1OH 4ELMF 4QHLB 5DFVC 2HG5A 4HWZB 5ITBH 3D6GA 4UT6L 4W6YB 4FABL 4Y0GA 5DJZA 2NY2D 5BJTA 3VI3F 1UQSB 5E7BA 4OGZA 3TVMC 3O9WB 2WBWB 3HAEA 4JM2F 4M6OH 4UQ2A 2BVEA 4U1NB 5A16A 1GGYA 4L3ED 4O51A 1D5ZA 3JV4B 4WW1B 4X98A 1R3JA 1BEYH 5A43C 5C07B 4HJGB 4NKOB 2IQAA 1RUMH 3IVKB 4X6DB 2DD8H 4WUKH 3FO9A 3S35L 5I1JH 1MJ7H 1NUGA 2Z8RA 1NAMH 4LEOA 2EKSB 2WY3A 1G7PB 5CZXC 4U1KB 4YXLL 2FO1A 3OMZA 3WD5H 2E27H 1LO5A 2VSCA 1MCWW 1I1RA 2NTFB 4NO3B 1T20A 1YNTB 4CNIB 1MCPH 2ARJB 5K59F 2VLLB 1T22B 1I85C 3G5YA 4XBPB 3JVGA 3ULUL 1YEDB 4NT6B 4NDMA 5L7XL 4U3XA 5DRZB 3RWFB 3NN8A 5DGRA 3JUZA 2XYCA 4HCRH 8CGTA 3O41B 5EOTA 3LEXB 3L9RB 1CIUA 1QQDA 3KG5A 4X7CC 5F7FA 5M95B 2WUBL 3WJJA 3MODL 1WZ1L 3HE7C 1KTLA 1WBYB 4EKXA 4RZCA 4YUEL 3S3PA 2DQDH 5C0FA 1WF5A 3OAYK 1G9NL 4LOUD 4XBEL 4J3UA 4PJXE 4OLXL 4JB9L 3QEGL 3SGDI 3GSRA 4PJGF 1OP5H 5LBSL 5DSCB 1KFAH 4OLUL 3EYUH 4R2GB 2W38A 4YX2H 1JYWA 3RAJH 1QRNE 1D5XA 1UB6B 1EA9C 1QO3A 1URLA 1RK1B 1MFAH 2YD9A 3TN0A 2E9WA 2ITCA 2YKLH 2FJFA 4AIXA 2CIIB 4G6ML 2HFGH 4JPIA 3VFSB 1NMCB 1IM9B 2E7CA 1PJ9A 3QPXH 4Z18A 5F9OH 3WDIA 1G7QA 1QSVA 2HYMA 4P4RA 5F7DA 1A6TB 1GGTA 3CFBA 1BQHG 2E7LE 1C5BH 4OZGF 4ODUB 3L3IB 1MHEA 3WFBH 2XG4A 4LSQH 2AJYL 3QUMA 3WFBL 2XTJD 4NRZB 3SE9H 5DMGD 4LHUB 2QR0B 2GITA 3DGCR 3G9AB 4P9HC 1FL3B 4C56E 3ZSSA 5AZ2H 3TBSA 3D5OF 3WD5L 3HAEB 2F74A 1C5DB 1A6AA 2VISA 1FZMA 1S9WB 1HH9B 1T3FB 4I2XA 3NZ8B 2AABL 5DWUH 4YEFA 4NQSB 4OM0H 5KZCB 5LXGH 4MVBA 3MR9A 3E2HB 1MFAL 3IKCB 4EN3C 3GK8L 1FCCA 4D0DB 4KMLB 1BF2A 1OTTD 4LSPH 3LQAL 1S78C 2QADC 1GYAA 5GRZA 4P5MA 3NZHL 4YXHH 5KVFH 3D85A 4PLKD 1IT9H 4TULH 4GH7B 2OI9A 5T3ZH 3GMNA 2UWEB 5TE4H 1JWMA 5CD3A 2IBZY 4S2SA 3UYRH 4B0MM 2YSSA 3MREA 1AIFB 1XGTB 3BDYH 3ABZA 1UWGH 2XZAH 3QG6A 4Z8FH 2Y7QA 4OFYA 1JN6B 4P23C 5D1XD 4O58L 1F58L 2J88H 2WBJA 3DRQA 3SJVD 4KUCF 5ID0B 3F7PC 3VXPA 3SCMC 2X09A 1W0WB 1KJVA 3MYZA 1FN4B 4MAUH 3W0WD 4HC1L 5FV2A 3BOVA 5B4MC 1BFVL 2XNAB 3DPBA 5B8CA 3BUYB 1DQDL 5J13C 3ULUD 1FZKB 5IB1A 1T1ZA 3QJHB 1U8MA 4IS6B 3V9FA 1TTFA 4LASH 4Z7UB 1VGKA 4NKMA 1EZVY 3HZVB 3ZL4H 5JQHC 1JF1A 4QRRB 3IDXL 3ARFA 4XPHL 4OD3L 3B3IB 4OB5L 3KXFE 4R26H 3G6DH 1LO0H 4HKJA 2CMRH 5ACLA 2YR3A 4QRUB 3C5SA 4PG2A 3CH8A 4HEME 3LVEA 4I13B 2DBJA 4YBHA 2ICWA 2G9HB 3PWUB 1FNEB 4G42B 4IMKC 1P4IL 1MCDA 4QF1B 5HDBF 4P5MB 4POUB 2R56H 2OK0H 3UCRA 5J89A 4U6YA 4KROC 2IEPA 3CVIL 2W0KA 1UACH 1KJMA 2DWDA 4FZEL 3BP4A 3BYTA 3HPLA 1PW3A 1T5XA 3S5LA 4XP4L 5J0BA 5E6IC 1GZPB 4LBEA 3TN0D 3UTTD 2NY2C 5EB9A 5EU4B 3EAKA 4J4PA 3UTQB 3EHBC 1IC1A 2B7DT 5EUOE 1MFEH 2VAJA 4OLWL 5K9JL 1RZIB 2D9CA 3IDMB 5T1DL 1M4KA 5CSZB 3FB6A 2YD1A 5DJZB 4NHUE 4M9OA 1BOGB 3GSXA 1TQCB 4JFXB 1LE9B 1LO2H 2H45A 1NCAL 4PTTB 5J1AB 4Y1AD 4HDIA 4HUNB 3BJ91 5EPMB 3LD8C 1NFIA 1U95B 2XICA 4PJIA 1TETH 3VG0H 4YHNB 2YS4A 4A2LA 1LEIB 2D7OA 4J4PC 1D6EB 3QJFA 5DK0B 4BH8A 2ZJSL 1VFBA 3I84A 4XPGL 2VDNL 4J3OC 3QISA 1XGQB 1BVZA 3VXTB 4GMSL 5E9DB 2X42A 1CFNB 2E6JA 5EUOB 1QPXA 2DQHL 5D2NB 5C0IB 3OAZK 3RVUD 1NANI 3Q6GL 3G08A 3RWGB 3HC0B 3K7UA 3U9UA 3VXUE 4FABH 5DQDL 3UJIL 5HYQB 2UYLA 4GG8B 3O6KL 2BZDA 4JR9L 3P0VH 2NY7H 5FOBB 5K9KA 1CICD 1LDSA 2ZNXA 3MJ9L 4JRYE 2MCPL 5I9QC 1A22B 4JM2D 4P2CG 5LAXA 3DBXA 4L4JA 3O6FA 1VHPA 3AY4C 3KNBA 5F88A 2F8XC 5EU6E 4XMPH 2CKBH 3JBG7 1F90H 4UT9L 3IYLW 1ED3B 2C3HA 3GSNB 3V4PL 3SDDB 2P5ED 3QEQD 3MXVH 1LO5B 4K2UH 4KJYA 2DDQL 4AG4H 1QVOB 3W0WA 5C9KA 4BUHA 5HPOA 1ZANH 2N1KA 4XC1H 3VXUD 4KVCL 2X4NB 5EZIL 1KUMA 3D9AH 5DK3A 3MA9L 2HRPH 5H35B 4YHNA 4Z7QF 3QFJA 1REIA 5CJOH 4YNYB 4MZ2A 3N1PC 1D9KB 2Q8AH 5LKNA 4M8QA 5ICZA 1ZTXL 3W39A 4XXDB 5IHZB 1P69B 1EBPA 2GAZA 3C87A 3O8XB 3QAZC 1HWGB 5HGAA 3ZDXF 5TDOB 1I3RB 1XMWA 5EUOA 1UT9A 3DMMB 3VG9B 1JK8B 5INDB 2QADD 3P4NA 4XNXL 3D85D 3L5WA 2V2WA 1FGVH 2AEWA 3O11A 2Q76B 3RZWA 3RWHA 4DKFL 3QZWA 1D5IH 4XNMB 1Y6KR 1MF2H 2EXWC 4NNPH 4YDLC 1HHKB 2UZIL 4OLXH 3PJSA 4YPGA 2DM2A 1IL1A 2ZPKL 4ODTL 5T5FH 3TLRA 2OTPA 4U7SA 2FATH 1HDMA 3U4AA 2FIKA 4JFDE 3ULVD 3G04A 3NGBB 4XC3H 1E6JH 2OL3A 1U8JB 1HDMB 2HP4A 2R56L 2OK0L 4PGZA 3BGAA 2XFXB 3TH3T 2O26U 2XWTB 2F5BL 3Q1SH 1QFUL 4G7YH 1AGEA 4RFOL 1IKFL 4GOSA 1T03L 4PJFB 4NCC1 5I15H 5KS9A 5DT1H 5B39G 3SE8H 2F58L 4OIIH 5BS0E 5MERA 5INDA 4MS8A 3SE8L 2AEQH 3H2WA 4Z77B 1Q8MA 3NOIA 5DJAB 4LSTH 2NX5E 3MFFA 3MLVH 2QHRL 4KTEH 3UXFA 1JNJA 4NQDA 1SJEB 1R3HB 2CJUH 2W60B 3QFJB 4QRRA 1N0XH 4JM2A 4MD0A 1B3JA 4HLJA 5BQ7B 3A0OA 4RA0C 4MCZA 3UJJH 2EYSB 2PYEB 3OZ9H 2W9EH 1KTLB 1WBYA 5HYJA 1QQDB 2JTDA 3IDJB 4JGUA 3KYMA 1VESA 1OB1A 2Z31A 4LLMA 4JO3L 4Z7VF 4DN3L 2DTML 1I8KB 3FRPG 3X17A 5MENE 3KPPB 2FX9L 4PRIE 3WXWH 3NA9H 3FT3B 4FQXB 4XNZC 5C0CA 4O2CB 5C7XL 4L8BB 3TO2B 3ZE2F 3VH8A 3VRLE 3GMOA 3QUKA 3TA3A 3O3DB 1UYWH 3IVKA 2HT4C 4KMTH 3TO4A 1RJCA 4LLWA 1F4AA 2P5EE 5KG9B 1U8PB 4ZPVB 3MBXH 3R4DA 4UIMA 4LLYB 1L9MA 5CEXA 1H3XA 3ZYIA 1FNAA 2XFXA 3MX0A 2OP4H 4JO2H 3RA7H 3U4EA 5JIPA 4N0UB 1L4IA 4R7DA 1CL7L 4LCYB 4QOKE 1MAJA 2FIKB 5B3JE 1JHKL 1CL7H 5IKCA 1UM5H 3ZDYE 3RFZC 5KANG 5FO7A 2V6HA 3O2WL 5EC1A 4XX1E 4W6XB 4PYGA 4CU6A 2YA1A 3ARGA 5EOCL 5H8DA 2X41A 4M43L 2RGSA 4P46A 4QKXB 4OKVA 4HIXH 2G5BA 4PJ7E 3HNVL 2H41A 2IMMA 4QO1A 1EXUB 3CXDL 4JZOB 1AKJA 2MOVA 3SGEI 4MJ4A 3MRGB 1A1MA 4JN1H 3OR6A 5T33H 1UM6L 2VWEC 4WI8A 1HINL 3PXHA 3B9EA 3SDAA 5FDYA 4X4ZA 4MB4A 3WDHA 4CADB 3QIUC 4ONGH 3THMH 3LN5A 1CGVA 5IV2A 1OD7A 4OGAD 2GJ6D 1U91B 3REVB 4D0BB 1P4BH 3ETBF 1DR9A 4WFFD 4Z0BH 4NC2B 1JPTL 3D1MC 3KPLB 3HTLX 1M05A 5LG1A 5K9OA 4PGBA 1A7OH 2H1PH 1YY8A 1YPZB 4GQPH 4TNVK 5E94A 3BKCL 2H2PC 3JZ7A 2YZ8A 3K81A 3T65A 2O5YL 1TJIL 3K2MC 2ICWB 4XTRC 5C92A 4FXGA 2ZCKH 4KK6C 4J3VA 4F15C 3L9RA 2KZWA 4DZ8A 1TXKA 5D5MB 1CDUA 1A7QH 4NQCD 5AYUL 5FUCC 2A1WL 4N0CD 5HHVH 4NFCA 3V6ZA 4ELKA 4NT6A 5FM8A 5E4EC 4KKCD 2R4SL 5C0CD 1HEZB 5H94A 2ARJA 1N7MH 1ZLUK 5SV3A 3MV9D 4NZTL 3S36X 2DLGA 1MJJB 1FZKA 2H32H 1MCNA 5GZNC 1MWAL 3GI9L 4AQ1B 4IRSD 3S34L 1WSST 2H3NA 3BD3A 3U0PB 1ZK9A 4ERSH 2J8HA 3I6GA 4ODVL 1DQJA 3QB7C 3O3EB 4JLRB 4KKNA 1OP3K 3QSKB 4Y2OA 1INQA 2WBJB 3DRQB 1N64H 5ID0A 3JTSB 3ULVE 2MMXA 3QXAA 4DEPB 3DX6A 4YDLB 1RZGB 4GLRH 5IHUH 3VMPA 3JWOL 2W0FB 1SEBA 3MRLB 1T22A 5H37G 1H8OA 3BP5B 3D2UB 4L29B 4OFDA 1AFVL 1U8NA 1EJOL 1YNKL 2H32B 2OTUB 4HWEL 4WGWB 3WO4C 1FDLL 1CT8B 2FBJL 3IDNB 5CSGA 5BS0D 1SYSA 2E7MA 5GGRA 1FDLH 1Q0XL 1KIPA 1I8IB 3ULVC 4K23L 3FB6B 4PJ8C 5BV7H 4WWKC 5I71B 2YMXH 4NBYB 1RULL 2Y36L 1KG0B 1U3HD 2D2OA 4HKZA 3V4UL 4LBEB 4OI8A 2XRAH 1U2HA 3GI9H 5D1QA 4XRCB 5KOVC 1E6OL 2ESVA 1KPUA 2QR0A 2AK4A 3QNXA 4GKOA 3A6OA 4O2EA 3CLFL 4G7VL 5AWNH 4Y5XB 1OW0C 1ZTXH 2AJXH 4N0UE 3U79A 1A1OB 4R26L 1ZHNB 1Z9LA 2AJUH 3MLVL 1A7QL 2GUOB 2NW2B 3BGFB 5HHMB 3KPNB 4TNWF 4LCWE 5DJYB 1NKOA 4JREC 3LQAH 3PXJA 5ACZA 2P45B 3MFGB 3S7GA 3TH2T 5JHDA 3CFJA 5D7LB 3M17B 1IC4H 5T3XD 1KPVA 5T5NG 4JY6B 2X4PA 2CDFA 1QVOA 5BRZE 3OKEA 2VQUA 2HJKA 3MLTB 1X7QA 35C8L 3U4BH 4Z5RA 5I76B 2HJLB 1JNNL 1DBJH 1YMHB 3VRLF 2X89D 1E6JL 4FP8H 4K7PY 4KHTH 4NKMB 4WW2B 3NIGF 2VABA 4DKDC 4LCCA 2F15A 4WFEE 4DCQB 1TPXB 3QXTA 2WNGA 1WWBX 1MJJA 1BBJB 3GM8A 1ZSDB 5EDXA 4MXVE 1CYGA 2PR4L 1YNKH 1ZEAH 4M8VA 2HFFB 5ITFA 1A6WL 3HR5B 1JI1A 4MYWB 4KUZH 3MLSH 1RY7B 3AUVA 4FFEX 4P4KD 5KN5B 4J3WA 3ELAT 5IBUB 4KTDH 4L1HA 3QFJE 1ZT7B 4H0IA 5E2VH 5GGTL 1ULVA 2VC2L 4LCIH 1LP9F 3TYFA 4LHJB 4OCLC 1MNUL 4YH6A 4PV8A 3CUPB 5AZEL 5GISH 1TETL 5I73C 4LRIA 5H2BA 2C3XA 2HJFB 2IANA 1CVRA 2VR9A 4X6CB 3BN9C 1FIGH 4QOKB 2OXGA 4Q9BA 2P43B 5FFLA 4JN1L 4YXLH 1SVCP 3JV6A 4BJLA 1P7KB 4NP4H 3T4YA 3D25B 4P5TA 4C83B 2C1OA 1IGCL 4KDTC 1I7TB 5GJTH 1D5BA 3ZHKA 2DQJH 5MEQA 4OTXH 3TPUB 1CXKA 4OSUL 4JRYA 3IXTB 3HI5L 3TYGH 2YWYA 4WW2A 1YECL 4F8TA 3UTOA 2ATKB 2V5RA 1QBBA 4ELKB 3N1QC 2FJHB 5CHNA 3WFCL 4M6OL 5EU4A 4GO6B 1G7MB 2VZUA 2HFTA 1EAPA 1I3RA 1S8DB 5HVGB 3OB0H 2D0FA 4XXDA 1FVEB 2AJVH 2XA8H 5FHAH 5IBLD 4XXCC 3U82B 4IIQC 1XH3B 4XGZA 3GBNH 4MNGE 3VXOB 5CWSB 2NY6D 4ZUWB 1QHOA 3PP3K 4X7TA 4LVOB 2B4CH 5HDOA 3RKDC 4UV7L 3LKRB 3RGVC 1MOEA 1KXTB 2P5WA 4L8SB 5DEZA 2V7NA 4FQLH 2W9LA 1IGFH 4P23B 4WW2F 3WFHA 5JMOC 4FMKA 1KELH 4KXZI 2PYFA 5E2TH 1T66C 4XNYL 3UBXA 1DBKH 1I4FA 3MRPB 1M7IB 2HRLA 5C86A 2DQUL 1KIQB 1GOFA 4JANA 1Q38A 3O2WH 2XWBB 2BHYA 1CDIA 4YBQC 5J13B 4GRLD 2VR4A 1JCKA 3IU3A 4U0QB 3QULB 4KKCC 3BPCA 3TBWB 1HHGA 1BQHA 3MUGB 4NHUA 4OM1H 4OUUB 3VXMB 3RY6C 4U33A 1DBMH 3RX5A 1Y6NR 1KCUH 4FTVB 2G75A 1PFCA 3T2QA 3WNNA 3DHJA 3O45A 1A47A 3T1WA 4ZS7H 3C5ZB 3L7FA 1Q72H 4G5ZL 4UOW0 1S7SA 1MFBL