3GSTA

Structure of the xenobiotic substrate binding site of a glutathione s-transferase as revealed by x-ray crystallographic analysis of product complexes with the diastereomers of 9-(s-glutathionyl)-10-hydroxy-9, 10-dihydrophenanthrene
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
217
structure length
217
Chain Sequence
b'PMILGYWNVRGLTHPIRLLLEYTDSSYEEKRYAMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGSRKITQSNAIMRYLARKHHLCGETEEERIRADIVENQVMDNRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYHIFEPKCLDAFPNLKDFLARFEGLKKISAYMKSSRYLSTPIFSKLAQWSNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Structure and function of the xenobiotic substrate binding site of a glutathione S-transferase as revealed by X-ray crystallographic analysis of product complexes with the diastereomers of 9-(S-glutathionyl)-10-hydroxy-9,10-dihydrophenanthrene.
pubmed doi rcsb
source organism Rattus rattus
molecule tags Transferase
total genus 76
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1993-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3gstA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3gstA01
17GSA 4PGTA 4GSNA 1M7TA 5G31A 2VLUA 1V9WA 2REMA 2VM1A 3GNJA 1VF4A 2EIQA 3D21A 3E3EA 3VFIA 3UVTA 1TP9A 2ON5A 4JE1A 2WJUA 2C3TA 2YZUA 4CW9A 3RHCA 3GUSA 1O8WA 2P0GA 4KDYA 4NXIA 1X5CA 3F4SA 3IE3A 2IN3A 2LSTA 1TRVA 2KUCA 4K8MA 5E4WA 3LYPA 2O7KA 5JCUA 1AQXA 4G10A 2LQQA 5L71A 1NHOA 2TRXA 3QFAC 2IMIA 1K0NA 2OADA 5DCHA 1LU4A 3DXBA 1YEPA 3D4MA 4MF7A 3G9BA 5KN1A 5J9CA 4WBJA 1Z6NA 3CTGA 4IQ1A 2LRTA 1GP1A 3FR3A 1TJDA 3DVXA 1DE1A 2GS3A 1R26A 2L5OA 4OCEA 1KBNA 1BYEA 5IQYA 3M9JA 2R4VA 4NV2A 1GNWA 3ZITA 4GCIA 4OD7A 2QKEA 1SJZA 3FEUA 1ABAA 2H76A 5EPFA 1PRXA 4MZBA 2DIZA 4ML1A 3RPNA 1B9XC 1GLPA 3EVIA 3BJ5A 4KF9A 3BCIA 3QDNA 1ZCPA 3S9FA 3C7MA 1X5EA 1YF1A 1R5AA 2HZEA 5KEJA 4KX4A 2HSHA 2I9HA 2TIRA 4E8HA 2C3QA 2DBCA 3FYGA 2MBTA 3WD6A 1FAAA 1AQVA 1U3IA 3TKRA 2HT9A 1OC9A 3BOAA 2FNOA 1SD9A 4NWYA 2ZUPA 4I2UA 2CVKA 2HRKA 1EEJA 4IS0A 3E9JB 2VCTA 3QAGA 5B8AA 1WWJA 4HU9A 3C71A 4POLA 1B4QA 1PN9A 3W8SA 2GSSA 1EV4A 2LV3A 1O8XA 1TU7A 1JHBA 4V2NA 1WP0A 2O89A 2PN8A 4IVFA 2FWFA 2YV7A 4K6XA 4BA7A 2XBIA 4LL1B 5JWQB 1HYUA 4KW6A 3MNGA 5F07A 2B1LA 1Y25A 2JL4A 18GSA 4Q5NA 4ACSA 3ME7A 3H93A 3QFBC 5H5RA 4EDYA 1VF3A 4O92A 3GFKA 1AXDA 2RM6A 3NOFA 5INYA 1XWKA 2L59A 2E0QA 3ZTLA 4ZL7A 4EXJA 2JADA 2OBKA 2WRTA 2YCDA 4K7NA 1OE8A 5FT3A 1SK2A 1F3AA 3HA9A 2MMOA 2HE3A 1PD21 3TJJA 2OE3A 4ZBDA 4AJ8A 3CRTA 4G0KA 2B5EA 1GSFA 4MABA 3H79A 1GL8A 4HJMA 4G19A 1WIKA 4TW5A 2YN1A 1PGTA 3A2VA 4KCAA 1GSSA 3WT1A 4TXOB 4FIWA 5B6MA 3PPUA 3F4TA 5JWRB 1A8LA 4RUVA 2GLRA 2A2RA 3TJKA 1O81A 1XOBA 4F9ZA 2JSZA 3FR6A 2CX3A 5HR1A 4ML6A 3EU4A 5G1KA 5B8BA 3GSTA 3TJGA 5E59A 4KCEA 4PTSA 1UA5A 2H74A 3QAWA 3F9UA 5ECOB 4YQMA 2VAFA 5GSTA 2LTKA 1G6YA 1WRYA 1VF1A 8GSSA 5GSSA 1Z6MA 4YQUA 2WCIA 3P8WA 2AJQB 5CREA 2L4CA 3GIXA 4RQRA 5ECRB 3IOSA 1OE7A 4POBA 1YDKA 2GSTA 4MJAA 3HJPA 3ZIVA 2GQKA 2C0DA 2HSYA 2BMXA 3DWVA 2YANA 2E2MA 4NPBA 3LGCA 4MLYA 3IK7A 3ZZXA 2L4QA 3HVSA 1ZOFA 2V2GA 2OE0A 1X0RA 1SKSB 4IN0A 5EL8A 1FOVA 3GMFA 1K0DA 4RI6A 5EVOA 1AC1A 2I81A 1QUWA 1YY7A 1ST9A 3GH9A 4GLTA 2IMDA 2YWMA 2VCXA 1AAZA 4RI7A 5F06A 2H66A 3OR5A 4BL7B 1EOGA 4KA0A 2HNLA 4ZL8A 1GSYA 4LMWA 1FHEA 1GUHA 3W8JA 4I97A 4F0BA 13GSA 3APSA 4XS6A 3EMXA 4PQHA 14GSA 2JZRA 4ULXA 11GSA 1JZDA 1XW9A 2HFDA 3FK8A 3GYKA 4OO5A 4WF5A 1XIYA 3TKSC 1ILOA 2DJ2A 3UL3A 4D73A 5DDLA 5ELAA 3ZL5A 1U87A 2V32A 4MMMA 3IV4A 2NDOA 1QMVA 2PBJA 4ZB6A 1V57A 4EO3A 1SL2B 3MDKA 3M8NA 2PERA 1R5PA 3BD2A 1EP7A 2H1BA 2N5BA 3CRUA 2PGTA 3I69A 2ES7A 1UVZA 3EINA 3EMPA 3DD3A 2P31A 4WXTA 1ZGNA 1B4PA 4MJCA 5D8IA 4GF0A 1WOUA 2F51A 4LLRA 4IJ3A 1J08A 5LCZA 3UARA 2R3XA 5D96A 5ECKB 3J7Yk 3APQA 3FHKA 1K0CA 4TVEA 4DSSB 5IO0A 4EE0A 2CZ3A 5KN2A 4DVCA 1Q98A 4ZB8A 3LQ7A 3UOMA 4PNGA 2VIMA 3N9JA 5J4UA 1HNBA 2H30A 4HU7A 2LRCA 3GTUA 2C1YA 4ISDA 1XPVA 3ZVJD 3KMNA 1OKDA 1OYJA 2R37A 3E0UA 2LJAA 2GZYA 2R2JA 4EUYA 3QAVA 3P90A 1O85A 1UC7A 1AW9A 1K3OA 4AJ7A 3KGKA 2LQOA 3I9V2 5GAPD 1T4YA 2GQMA 4YAPA 4IHUA 1BJXA 3LYKA 5DAKB 4QL7A 1M2DA 4FYUA 4LL4B 2H0IA 5EY6A 3VPQA 4BVYB 4NHWA 5GAND 4KDXA 3KXOA 2C4JA 4Q5RA 2X8GA 5J3RA 5IMCA 1BQ7A 4MJBA 2H6ZA 1GWCA 3CSIA 1Z5YE 1G7EA 3LFLA 3ZFBA 2EC4A 5DCGA 2YWIA 1FB6A 2YJHA 2AHEA 1QQ2A 2GT6A 4K0NA 1NSWA 4HUAA 5ABRA 1CQHA 2IJYA 1HD2A 5G5EA 2RM5A 5G30A 5CAXA 2G2QA 4N0ZA 4EL1A 1NW2A 2HQTA 3GRXA 3JCML 2KOKA 1AUCA 4MH3A 4F03A 3GX0A 5G2ZA 3PINA 3TKSA 4ZL9A 1XWGA 2M80A 1S3DA 4ZBAA 3I43A 3KM6A 2LJKA 2GZZA 3D4TA 1XCCA 2CQ9A 3TRPA 2EIOA 2MMNA 1PKWA 3GL5A 3DYRA 2X64A 1SKRB 2VCQA 1F2EA 2AYTA 1SKWB 1G0TA 2VOCA 10GSA 2M72A 1KTEA 1SU9A 1ZYQB 5DJLA 3U6VA 4RQXA 3F4RA 2CA8A 2VD0A 3MSZA 3VWUA 4N30A 1EV9A 1G6WA 1FVJA 2H0GA 3UVHA 1SL0B 3KP8A 4OMVA 2OKAA 3ERGA 1MEKA 1K0MA 4V1Ap 2VL2C 3IDVA 1XVQA 3VI7A 2H1AA 2QC7A 4JRRA 1QFNA 1T8EB 4PQ1A 4K7OA 1GUMA 1URMA 3WT2A 1HNCA 4PUFC 2VCWA 1J0FA 5IOWA 4V2LA 1E6BA 4XS4B 2WZ9A 2RUFA 3IPZA 2C80A 2KHPA 3ISOA 1DE2A 2FUG2 1O7UA 4AGSA 3IRAA 2CZ2A 3A3TA 1H4OA 2M46A 3ERWA 5H5SA 1USBA 2B1KA 3TJBA 1TXXA 3HXSA 1K0BA 5ENUA 3C1SA 4TOPA 5HR2A 3CSHA 1MDJA 1EGRA 3LG6A 2WDUA 1XW6A 1XW5A 1AIUA 5DQSA 3WGXA 5IPGA 1SD8A 2I4AA 2KP1A 4EC0A 4OFTA 1A0RP 4PURA 2PWJA 4BPYA 2DJKA 5ECNB 4YQVA 1A2LA 3HVXA 5ECQB 1T7PB 6GSYA 1EWXA 4MA9A 5IM9A 16GSA 1E2YA 3TB2A 4DSQA 4V2MA 1PL1A 3AY8A 5IOXA 4QQ7A 5HFGA 3KEBA 3F63A 3ME8A 5C00A 4J56E 4WETA 2H01A 2FA8A 6GSUA 3TOTA 3GKKA 4HEA2 1MD3A 4Q5FA 4MCUA 2H70A 2LKUA 3TDGA 4XRAA 1TOFA 3IR4A 3HZ8A 1TKDB 2GGTA 3FY7A 4GTUA 2L6CA 1KEBA 4OCFA 2GZPA 4KSMA 4WKWA 2ZCTA 4KGIA 1Z3EA 3GN3A 4NAXA 3J7Yb 4Q5QA 4BL7A 1ERVA 4GSTA 2C8UA 1FG4A 4G2EA 3HZ4A 1SYXA 1I5GA 4ZXGA 5AGYA 1O73A 2AV4A 3QOUA 2GVPA 2VCVA 4OFNA 1SK1A 2OJLA 3RAZA 2B5YA 2VL3A 1WE0A 4KE3A 3VWVA 2HXKA 2H72A 3Q6OA 3GH6A 3EWLA 3APOA 4G0IA 2YPMA 1RK4A 4GWRA 3P7XA 4EF0A 2PPTA 5DALB 1U3AA 2P5QA 4P3YB 1M2BA 5D9WA 4GQFA 19GSA 1X9WB 1U6TA 5ECPB 2Z9SA 3HHVA 4DEJA 4TR0A 2K9FA 2DIYA 3L9SA 2RUEA 4POKA 2VL2A 4TKYA 5J41A 1GH2A 3DVWA 2NTOA 1GLQA 3HJOA 1A2JA 3FZ5A 2O87A 1ZMAA 3IHQA 2HSNB 5HQPA 1VRSD 2OACA 2LNSA 4WBRD 4JU5A 2ZNMA 1TK8B 1GTIA 5G5FA 3I6AA 4K1FA 1XXUA 2O8VB 1TRUA 2L5LA 2FY6A 3KJYA 1MDKA 2RIIA 3EURA 2X8HA 1JLVA 3EYTA 3QPMA 2HSMA 2LUSA 2VCZA 2HZFA 4MH2A 3TKPA 1O6JA 2V1MA 1YEXA 2V6OA 1FO5A 3L9VA 1U88A 5COHA 2VUPA 4AJ6A 3MWHA 2FA4A 2K18A 3QCPA 1PL2A 2IFQB 1PSQA 4JBBA 1K0AA 3ZYWA 1YF0A 5A4UA 4MJEA 1GSUA 3CMIA 3VK9A 1HQOA 1F3BA 3KTBA 3TKQA 2FWGA 5ECSA 3UBKA 2V6KA 1WJKA 2KLXA 1OC9B 2H6YA 4IQAA 2YV9A 3RHBA 3KMOA 1GTBA 4BVYA 1X9SB 4ID0A 1J9BA 3A5WA 5H5QA 6GSXA 2IIYA 1T3BA 2QSIA 1V98A 3KH7A 4ZB9A 4GRFA 2WFCA 3Q18A 1V40A 3LWAA 2OE1A 4USSA 1S3AA 1A8YA 1WPIA 3HYPA 2HLSA 5ECLB 3IAS2 3HY2A 1B9YC 3TJFA 3EE2A 1TU8A 4ZIJA 1T1VA 1QGVA 1V2AA 3GX8A 3DIEA 3BCKA 4GXZA 4EKZA 2H1DA 1Z7PA 1T00A 2JU5A 5ECHB 3VPTA 1IYIA 1ML6A 4POMA 4MP4A 2GT5A 2HYXA 5FWGA 4MK3A 5IMVA 2X99A 1TRWA 1G7OA 1OVNA 2HRFA 4HZ2A 2V41A 5AISA 3KIJA 3D0ZA 5CRGA 3ZIJA 3DKSA 2PVQA 3GA4A 4PX1A 3DRNA 4FYBA 2IMFA 4JR4A 2F8AA 1VF2A 2IPAA 5IMZA 2OA7A 4TRXA 3P2AA 1PA3A 4JZQA 3HKRA 1XWCA 4K7IA 4JR6A 2GSQA 2DJ1A 2FWHA 3QR6A 5HFIA 1KNGA 4IBPA 2VD1A 3TOUA 2NVLA 1GNEA 3KH9A 2D2ZA 3D5JA 1W89A 2KP2A 3F6DA 3FZ4A 2DMLA 1BG5A 5KN3A 5CRWA 1Q4JA 4OFMA 4O32A 3GKMA 5B6NA 1BX9A 4HS1A 3MAKA 1TRSA 4XS4A 3L9UA 2C3NA 1OC3A 2E2GA 1JZRA 2YWNA 2IL3A 4F82A 3HCZA 3VLNA 3ZMKA 2B7JA 4HOJA 5HFKA 1LBKA 3IK9A 1K3LA 3H1NA 4DSRA 2A2SA 4MDCA 5ELGA 1SENA 4HJ2A 4I8BA 1N8JA 3GV1A 5IMDA 3KCMA 1ON4A 3CYNA 1ACVA 2XHFA 2WB9A 1N2AA 2VLVA 4CHSA 3A2WA 4IW9A 3L0HA 12GSA 2WS2A 1EEMA 5JCWA 4BVXB 1T4ZA 3DMLA 3ZVJA 3V1WA 4WF4A 3W6GA 1DSBA 1K0OA 2CX4A 1EZKA 1A23A 1YKCA 1ZYEA 4Z7XA 3PH9A 4L0UA 5IPHA 4OO4A 5AN1A 5LD0A 1PMTA 2CVBA 2LS5A 2FD3A 3D6IA 4EDZA 3FRCA 1GUKA 4ILFA 4FQUA 5LNKe 1OC8A 3HJMA 1RW1A 5D93A 1M2AA 2YP6A 1F6MC 1JLWA 3M1GA 5A4VA 1SYRA 2H75A 2I3YA 4N0VA 2NPBA 3GHAA 3C1RA 5DJMA 5D9XA 1Z7RA 4PXOA 3G7YA 2LNTA 2FWEA 5IO2A 4ECBA 3VWXA 4PQIA 1M9AA 4TR1B 4D73B 5IMAA 3K8NA 3WGEA 3EU3A 3FR9A 3TRXA 3CTFA 4F2IA 5DALA 4KAEA 4ZILA 4NHZA 2P5RA 2VM2A 1FB0A 5CP1A 3UIWA 3H8QA 1ZZYA 1THXA 3C73A 3H4KA 5C04A 1UN2A 4X1UA 4CDOA 2CV4A 4ECJA 3DGQA 1LJRA 1QXHA 3UAPA 5DVBA 5JCGA 2K8VA 4TXOA 1OKTA 2R6KA 1XOAA 4L5OA 5A5KA 3DEXA 3KZQA 3RBTA 1XWBA 3HD5A 2GDRA 1CQGA 9GSSA 3LORA 2FHEA 2X8CA 3L78A 2F8FA 2XPEA 4KDUA 3ZREA 1GSQA 3GTUB 4MPFA 1DBYA 4MZCA 2HI7A 1X9MB 1GRXA 2F3MA 4MF5A 2VL9A 4FO5A 1PX7A 5A4WA 2UZ8A 5ECIB 5B7CA 4JEDA 4OWYA 4X0XA 3IC4A 1XWAA 5G1LA 2IFQA 1A2MA 3O6TA 3HDCA 4TN8A 2DLXA 5AIVA 2L6DA 3TRQA 3NZNA 3WGDA 2DC5A 4BWQA 4HQZA 1C72A 3QD9A 3O3TA 3SWLA 2EIRA 1QK8A 1R7HA 1ERUA 2BTOT 2GQLA 2AUVA 4I5QA 2IMKA 1F9MA 3F8UA 4O7HA 1R4WA 6GSTA 3NIVA 1SJ6A 3ZMLA 1MD4A 3CBUA 4KSOA 1S3CA 1ZL9A 4V1Ag 2E7PA 1YKAA 5CRHA 5J9BA 3N5OA 3Q74A 1SK0A 4WR5A 3F6FA 5BMUA 2BJXA 4XHMA 1YQ1A 3FZAA 5IMFA 2AB6A 4I2TA 5ID2B 1I9DA 1ERWA 1PQNA 22GSA 3HVVA 4YH2A 2CAIA 4H86A 3C8EA 5AIXA 4G0LA 2H19A 1AQWA 4N11A 4G9HA 2FCHA 2DJ0A 4GSSA 4PUAA 2B5XA 4LA1A 4TR3A 6GSVA 2CT6A 3FKFA 1JZOA 4ECCA 5CYYA 1TK0B 1W4VA 3IBHA 3VURA 2DJJA 4AF2A 2PUKC 2QGVA 2JACA 2LRNA 4XTSA 2LJRA 2OBIA 1TDIA 1JFUA 3UEMA 1NM3A 1B8XA 1K3YA 2L57A 1NHYA 3UBLA 4EVMA 3GKNA 3KP9A 2K8SA 4XIHA 4O5RA 6GSWA 1GSEA 1EGOA 1GTAA 1TI3A 4FH8A 2XPDA 2YNXA 5DQYA 1RQMA 1XVWA 4J57E 4DSSA 2YWOA 2MMAA 3QMXA 2XC2A 3GSSA 3KD0A 2YJ7A 3Q19A 4BWSA 3VI5A 2GTUA 6GSSA 3ED3A 2JZSA 3D22A 1PX6A 4K0GA 2I1UA 3TUEA 5JWOB 2WGRA 4NV5A 1THOA 3IA1A 4TR4A 2J9HA 5HR3A 3LSZA 2HZEB 5KN0A 2DJ3A 3U5RE 4IP1A 5F8BA 1TW9A 3GL3A 4KUNA 4ECIA 3LJRA 2B6MA 2HRNA 4IP6A 1WMJA 4MPGA 1TK5B 1GULA 4IGJA 2MYGA 3F3RA 2VO4A 1M9BA 1A0FA 5J5NA 5DAKA 3PGTA 3GKXA 1M0UA 2H0HA 2HRKB 3SBCA 1SJIA 2C0FA 3IC8A 1IYHA 4BVXA 3LXTA 3M0FA 2ALBA 1OAZA 2HRAA 1VGLA 3M3MA 5ECMB 4YAVA 2B3SA 4LMVA 1EP8A 2YZHA 2IWTA 2YOIA 1B48A 3ZRDA 2DSAA 3G7JA 2AAWA 5CNWA 1TTZA 4PNFA 1MTCA 5DBQA 4NMUA 5GZZB 3IXRA 1YJ6A 2G0FA 2IMEA 4XCSA 5F05A 4TR1A 2TRCP 5CO3A 3RPPA 3CXGA 1EOHA 2R5GA 2JSYA 3O76A 4MF6A 1X5DA 4XS1A 2PVOC 4QL9A 1TI1A 3G7IA 3VWWA 5F0GA 3PR8A 3ZLPA 4I6XA 3KTLA 5FHIA 1FW1A 1BEDA 2N5FA 1YZXA 4N10A 2WULA 3F0IA 4FYCA 1XFLA 1HNAA 4IKHA 1DUGA 2ON7A 2A4VA 2H73A 4K9ZA 3ZFLA 2N5AA 5D9TA 3EC3A 4KB3A 2MBSA 4KNDA 4L0WA 4J2FA 5D9VA 3TGZA 4L5LA 1XBSA 2B7KA 3TCOA 5D73A 4HDEA 2HSMB 2H8LA 2H6XA 2MZCA 7GSSA 5CRDA 1A24A 3RDWA 3ERFA 1H75A 4TXVA 4IJIA 2RLIA 1M99A 4HZ4A 2PU9C 3GURA 1XZOA 4E8EA 2GSRA 4WEYA 1GTUA 2FGXA 1F37A 2MMZA 2FLSA 2H1GA 4GQCA 20GSA 4HQSA 1ERTA 3R3EA 3CSJA 3WYWA 2C0GA 3UMAA 1SL1B 3FZ9A 3LXZA 2VLTA 3LEFA 4F0CA 2CVDA 4MZWA 5IIZA 2F9SA 2C0EA 2JZTA 1PKZA 3FW2A 2LEGA 4XRDA 3A2XA 1Y6EA 2XBQA 1MDIA 3BBYA 2NBSA 4K2DA 4KH7A 2K6VA 4ZBBA 4IELA 1FVKA 4WR4A 4X43A 3US3A 3F3QA 4HI7A 1Z9HA 3IAM2 2J23A 3TKSE 1BAYA 4L8EA 2PMTA 5HR0A 3UJ1A 1V58A 2O85A 2H71A 2CAQA 3L4NA 3R2QA 2DMMA 1GSDA 5ID2A 3M9KA 1JZWA
chains in the Genus database with same CATH superfamily
17GSA 4PGTA 2R0PA 4GSNA 1M7TA 5G31A 4N3ZA 2VLUA 1V9WA 2REMA 2VM1A 3GNJA 1VF4A 4QMKA 2EIQA 3D21A 3E3EA 3VFIA 3UVTA 1TP9A 2ON5A 4JE1A 2WJUA 2C3TA 2YZUA 4CW9A 3RHCA 3GUSA 1O8WA 2P0GA 4KDYA 4NXIA 1X5CA 3F4SA 3IE3A 2IN3A 2LSTA 1TRVA 2KUCA 4K8MA 5E4WA 3LYPA 2O7KA 5JCUA 1AQXA 4G10A 2LQQA 5L71A 1NHOA 2TRXA 3QFAC 2IMIA 1K0NA 2OADA 5DCHA 1LU4A 3DXBA 2EFEA 1YEPA 3D4MA 4MF7A 3G9BA 5KN1A 5J9CA 4WBJA 1Z6NA 3CTGA 4IQ1A 2LRTA 1GP1A 3FR3A 1TJDA 3DVXA 1DE1A 2GS3A 1R26A 2L5OA 2HSNA 4OCEA 1KBNA 5J4YA 1BYEA 5IQYA 3M9JA 2R4VA 4NV2A 1GNWA 3ZITA 4GCIA 4OD7A 2QKEA 1SJZA 3FEUA 3IHGA 1ABAA 2H76A 5EPFA 1PRXA 4MZBA 2DIZA 4ML1A 3RPNA 1B9XC 5KOXA 1GLPA 3EVIA 3BJ5A 4KF9A 3BCIA 2WZSA 3QDNA 1ZCPA 3S9FA 3C7MA 1X5EA 1YF1A 1R5AA 2HZEA 5KEJA 4KX4A 2HSHA 2I9HA 2TIRA 4E8HA 2C3QA 2DBCA 3FYGA 2MBTA 3WD6A 1FAAA 1AQVA 1U3IA 3TKRA 2HT9A 1OC9A 3BOAA 2FNOA 1SD9A 4NWYA 2ZUPA 4I2UA 2CVKA 2HRKA 1EEJA 4IS0A 3E9JB 2VCTA 3QAGA 5B8AA 1WWJA 4HU9A 3C71A 4POLA 1B4QA 1PN0A 1PN9A 3W8SA 2GSSA 4AI6A 1EV4A 2LV3A 1O8XA 1TU7A 1JHBA 4V2NA 1WP0A 2O89A 2PN8A 4IVFA 2FWFA 2YV7A 4K6XA 4BA7A 2XBIA 3RGBC 4LL1B 5JWQB 1HYUA 4KW6A 3MNGA 5F07A 2B1LA 1Y25A 2JL4A 18GSA 4Q5NA 4ACSA 3ME7A 3H93A 3QFBC 5H5RA 4EDYA 1VF3A 4O92A 3GFKA 1AXDA 2RM6A 3NOFA 5INYA 1XWKA 4PI0C 1ZYNA 2L59A 2E0QA 3ZTLA 4ZL7A 4K2XA 4EXJA 2JADA 2OBKA 2WRTA 2YCDA 4K7NA 1OE8A 5FT3A 1SK2A 1F3AA 3HA9A 2MMOA 2HE3A 1PD21 3TJJA 2OE3A 4ZBDA 4AJ8A 3CRTA 4G0KA 2B5EA 1GSFA 4MABA 3H79A 1GL8A 4HJMA 4G19A 1WIKA 4TW5A 2YN1A 1PGTA 3A2VA 4KCAA 1GSSA 3WT1A 4TXOB 4FIWA 5B6MA 3PPUA 3F4TA 2WW3A 5JWRB 1A8LA 5A5HA 4RUVA 2GLRA 2A2RA 3TJKA 1O81A 1XOBA 4F9ZA 2JSZA 3FR6A 2CX3A 5HR1A 4ML6A 3EU4A 5G1KA 4Z2UA 2R0GA 5B8BA 3GSTA 3TJGA 5E59A 4KCEA 4PTSA 1UA5A 2H74A 3QAWA 3F9UA 5ECOB 4YQMA 2VAFA 5GSTA 2LTKA 1G6YA 1WRYA 1VF1A 8GSSA 4BIKA 5GSSA 1Z6MA 4YQUA 2WCIA 2WW2A 3P8WA 2AJQB 5CREA 2L4CA 3GIXA 4RQRA 5ECRB 3IOSA 1OE7A 5A34B 4POBA 1YDKA 2GSTA 4MJAA 1TXUA 3HJPA 3ZIVA 2GQKA 2C0DA 2HSYA 2BMXA 3DWVA 2YANA 2E2MA 4NPBA 3LGCA 4MLYA 3IK7A 3ZZXA 2L4QA 3HVSA 1ZOFA 2V2GA 2WVXB 2OE0A 1X0RA 1SKSB 4IN0A 5EL8A 1FOVA 3GMFA 1K0DA 4RI6A 5EVOA 1AC1A 4X4JA 2I81A 1QUWA 1YY7A 1ST9A 3GH9A 4GLTA 5BMUB 2IMDA 2YWMA 2VCXA 1AAZA 4RI7A 5J40A 5F06A 2H66A 3OR5A 4BL7B 1EOGA 4KA0A 2HNLA 4ZL8A 1GSYA 4LMWA 1FHEA 1GUHA 3W8JA 4I97A 4F0BA 13GSA 3APSA 4XS6A 3EMXA 4MNNA 2EFCA 4PQHA 14GSA 2JZRA 4ULXA 11GSA 1XG8A 1JZDA 1XW9A 2HFDA 3FK8A 3GYKA 4OO5A 4WF5A 1XIYA 3TKSC 1ILOA 2DJ2A 3UL3A 4D73A 5DDLA 5ELAA 3ZL5A 5J4VA 1U87A 2V32A 4MMMA 3IV4A 2NDOA 1QMVA 2PBJA 4ZB6A 1V57A 4EO3A 1SL2B 3MDKA 3M8NA 4K5RA 2PERA 1R5PA 3BD2A 1EP7A 2H1BA 2N5BA 3RFRC 3CRUA 2PGTA 3I69A 2ES7A 1UVZA 3EINA 3EMPA 3DD3A 2P31A 3HMJG 4WXTA 1ZGNA 1B4PA 4MJCA 5D8IA 4GF0A 1WOUA 2F51A 4LLRA 4IJ3A 1J08A 5LCZA 3UARA 2R3XA 5D96A 5ECKB 3J7Yk 3APQA 3FHKA 1K0CA 4TVEA 4DSSB 2WVYA 5IO0A 4EE0A 2CZ3A 5KN2A 4DVCA 1Q98A 4ZB8A 3LQ7A 3UOMA 4PNGA 4HSCX 2VIMA 3N9JA 5J4UA 1HNBA 2H30A 4HU7A 2LRCA 3GTUA 2C1YA 4ISDA 1XPVA 3ZVJD 3KMNA 1OKDA 1OYJA 2R37A 3E0UA 2LJAA 2GZYA 2R2JA 4EUYA 3QAVA 3P90A 2WW0A 1O85A 1UC7A 1AW9A 1K3OA 4AJ7A 3KGKA 2LQOA 3I9V2 5GAPD 1T4YA 2GQMA 4YAPA 4IHUA 1BJXA 3LYKA 5DAKB 4QL7A 1M2DA 4FYUA 4LL4B 2H0IA 5EY6A 2WVZA 3VPQA 4BVYB 4NHWA 5GAND 4KDXA 3KXOA 2C4JA 4Q5RA 2X8GA 5J3RA 5IMCA 1BQ7A 4MJBA 2H6ZA 1GWCA 3CSIA 1Z5YE 1G7EA 3LFLA 3ZFBA 2EC4A 5DCGA 2YWIA 1FB6A 2YJHA 2AHEA 1QQ2A 2GT6A 4K0NA 1NSWA 4HUAA 5ABRA 1CQHA 2IJYA 1HD2A 5G5EA 2RM5A 5G30A 5CAXA 2G2QA 4N0ZA 4EL1A 1NW2A 2HQTA 3GRXA 3JCML 2KOKA 1AUCA 4MH3A 4F03A 3GX0A 5G2ZA 3PINA 3TKSA 4ZL9A 1XWGA 2M80A 1S3DA 4ZBAA 3I43A 3KM6A 2LJKA 2GZZA 3D4TA 1XCCA 2CQ9A 3TRPA 2EIOA 2X4AA 2MMNA 1PKWA 3GL5A 3DYRA 2X64A 1SKRB 2VCQA 1F2EA 2AYTA 1SKWB 1G0TA 2VOCA 10GSA 2M72A 1KTEA 1SU9A 1ZYQB 5DJLA 3U6VA 4RQXA 3F4RA 2CA8A 2VD0A 3MSZA 3VWUA 4N30A 4FXYP 1EV9A 1G6WA 1FVJA 2H0GA 3UVHA 1SL0B 3KP8A 4OMVA 2OKAA 3ERGA 1MEKA 1K0MA 4V1Ap 2VL2C 3IDVA 2O5VA 1XVQA 3VI7A 2H1AA 2QC7A 4JRRA 3CHXC 1QFNA 1T8EB 4PQ1A 1M3JA 4K7OA 1GUMA 1URMA 3WT2A 1HNCA 4PUFC 2VCWA 1J0FA 5IOWA 4V2LA 1E6BA 4XS4B 2WZ9A 2RUFA 3IPZA 2C80A 2KHPA 3ISOA 1DE2A 2FUG2 1O7UA 4AGSA 3IRAA 2CZ2A 3A3TA 1H4OA 2M46A 3ERWA 5H5SA 1USBA 2B1KA 3TJBA 4K5SA 1TXXA 3HXSA 1K0BA 5ENUA 3C1SA 4TOPA 5HR2A 3CSHA 1MDJA 1EGRA 3LG6A 2WDUA 1XW6A 1XW5A 1AIUA 5DQSA 3WGXA 5IPGA 1SD8A 4O5QA 2I4AA 2KP1A 4EC0A 4OFTA 1A0RP 4PURA 2PWJA 4BPYA 2DJKA 5ECNB 4YQVA 1A2LA 3HVXA 5ECQB 1T7PB 6GSYA 1EWXA 4MA9A 5IM9A 16GSA 5A34A 1E2YA 3TB2A 4DSQA 4V2MA 1PL1A 3AY8A 5IOXA 4QQ7A 5HFGA 3KEBA 3F63A 2EFHA 3ME8A 4J56E 5C00A 4WETA 4E68A 2H01A 2FA8A 6GSUA 3TOTA 3GKKA 4HEA2 1MD3A 4Q5FA 4MCUA 3CWGA 2WVXA 4AKHA 2H70A 2LKUA 3TDGA 4XRAA 1TOFA 3IR4A 3HZ8A 1TKDB 2GGTA 3FY7A 4GTUA 2L6CA 4EIPA 1KEBA 4OCFA 2GZPA 4KSMA 4WKWA 2ZCTA 3EPTA 4KGIA 1Z3EA 3GN3A 4NAXA 3J7Yb 4Q5QA 4BL7A 1ERVA 4GSTA 2C8UA 1FG4A 4G2EA 1S4BP 3HZ4A 1SYXA 1I5GA 4ZXGA 5AGYA 1O73A 2AV4A 3QOUA 2GVPA 2VCVA 4OFNA 1SK1A 2OJLA 3RAZA 2B5YA 1Y1UA 2VL3A 1WE0A 4KE3A 3VWVA 2HXKA 1SVMA 2H72A 3Q6OA 3GH6A 3EWLA 3APOA 4G0IA 2YPMA 1RK4A 4GWRA 3P7XA 4EF0A 2PPTA 5DALB 1U3AA 2P5QA 4P3YB 1M2BA 5D9WA 2OT3A 4GQFA 19GSA 1X9WB 3MIXA 1U6TA 5ECPB 2Z9SA 3HHVA 4DEJA 4TR0A 2K9FA 2DIYA 3L9SA 2RUEA 4POKA 2VL2A 4TKYA 5J41A 1GH2A 3DVWA 2NTOA 1GLQA 3HJOA 1ZYPA 1A2JA 3FZ5A 2O87A 1ZMAA 3IHQA 2HSNB 5HQPA 3CQFA 1VRSD 2OACA 2LNSA 4WBRD 4JU5A 2ZNMA 1TK8B 1GTIA 5G5FA 3I6AA 4K1FA 1XXUA 2O8VB 1TRUA 2L5LA 2FY6A 3KJYA 1MDKA 2RIIA 3EURA 2X8HA 1JLVA 3EYTA 3QPMA 2HSMA 2LUSA 2VCZA 2HZFA 4MH2A 3TKPA 1O6JA 3FMWA 2V1MA 1YEXA 2V6OA 1FO5A 3L9VA 1U88A 5COHA 2VUPA 4AJ6A 3MWHA 2FA4A 2K18A 3QCPA 1PL2A 2IFQB 1PSQA 4JBBA 2VKZG 1K0AA 3ZYWA 1YF0A 5A4UA 4MJEA 1GSUA 3CMIA 3VK9A 1HQOA 1F3BA 2A2PA 3KTBA 3TKQA 2FWGA 5ECSA 3UBKA 2V6KA 1WJKA 2KLXA 1OC9B 2H6YA 4IQAA 2YV9A 3MYDA 3RHBA 3KMOA 1GTBA 4BVYA 1X9SB 4ID0A 1J9BA 3A5WA 5H5QA 6GSXA 2IIYA 1T3BA 2QSIA 1V98A 3KH7A 4ZB9A 4GRFA 2WFCA 3Q18A 1V40A 3LWAA 2OE1A 4USSA 5KOWA 1S3AA 1A8YA 1WPIA 3HYPA 2HLSA 5ECLB 3IAS2 3HY2A 4ICYA 1B9YC 3TJFA 3EE2A 3LW9A 1TU8A 4ZIJA 1T1VA 1QGVA 1V2AA 3GX8A 3DIEA 3BCKA 4GXZA 4EKZA 2H1DA 1Z7PA 1T00A 2JU5A 5ECHB 3VPTA 1IYIA 1ML6A 4POMA 4MP4A 2GT5A 2HYXA 5FWGA 4MK3A 5IMVA 2X99A 1FOHA 1TRWA 1G7OA 1OVNA 2HRFA 4HZ2A 2V41A 5AISA 3KIJA 3D0ZA 5CRGA 3ZIJA 3DKSA 2PVQA 3GA4A 4PX1A 3DRNA 4FYBA 2IMFA 4JR4A 2F8AA 1VF2A 2IPAA 5IMZA 2OA7A 4TRXA 3P2AA 1PA3A 4JZQA 3HKRA 1YVLA 2DKHA 1XWCA 4K7IA 4JR6A 2GSQA 2DJ1A 2FWHA 3QR6A 5HFIA 1KNGA 4IBPA 2VD1A 3TOUA 2NVLA 1GNEA 3KH9A 2D2ZA 3D5JA 1W89A 2KP2A 3F6DA 3FZ4A 2DMLA 1BG5A 5KN3A 5CRWA 5A5HB 1Q4JA 4OFMA 4O32A 3GKMA 5B6NA 1BX9A 4HS1A 3MAKA 1TRSA 4XS4A 3L9UA 5J47A 2C3NA 1OC3A 2E2GA 1JZRA 2YWNA 1N25A 2IL3A 4F82A 3HCZA 3VLNA 3ZMKA 2B7JA 4HOJA 5HFKA 1LBKA 3IK9A 1K3LA 3H1NA 4CY6A 4DSRA 2A2SA 4MDCA 5ELGA 1SENA 4HJ2A 4I8BA 1BG1A 1N8JA 3GV1A 5IMDA 3KCMA 1ON4A 3CYNA 1ACVA 2XHFA 2WB9A 1N2AA 2VLVA 4CHSA 3A2WA 4IW9A 3L0HA 12GSA 2WS2A 1EEMA 5JCWA 4BVXB 1T4ZA 3DMLA 3ZVJA 3V1WA 4WF4A 3W6GA 1DSBA 1K0OA 2CX4A 1EZKA 1A23A 2A4HA 1YKCA 1ZYEA 4Z7XA 3PH9A 4L0UA 5IPHA 4OO4A 5AN1A 5LD0A 1PMTA 2CVBA 2LS5A 2FD3A 3D6IA 4YKFA 4EDZA 3FRCA 1GUKA 4ILFA 4FQUA 5LNKe 1OC8A 3HJMA 4A5PA 1RW1A 5D93A 2UV8G 1M2AA 2YP6A 1F6MC 1JLWA 3M1GA 5A4VA 1SYRA 2H75A 2I3YA 4PI2C 4N0VA 2NPBA 4Z2RA 3GHAA 3C1RA 5DJMA 5D9XA 1Z7RA 4CY8A 4PXOA 3G7YA 2LNTA 2FWEA 5IO2A 4ECBA 3VWXA 4PQIA 1SVOA 1M9AA 4TR1B 4D73B 5IMAA 3K8NA 4AKIA 3WGEA 3EU3A 3FR9A 3TRXA 3CTFA 4F2IA 5DALA 4KAEA 4ZILA 4NHZA 2P5RA 2VM2A 1FB0A 5CP1A 3UIWA 3H8QA 1ZZYA 1THXA 3C73A 3H4KA 5C04A 1UN2A 4X1UA 4CDOA 2CV4A 4ECJA 3DGQA 1LJRA 1QXHA 3UAPA 5DVBA 5JCGA 2K8VA 4TXOA 1OKTA 2R6KA 1XOAA 4L5OA 2O3EA 5A5KA 3DEXA 3KZQA 2WW1A 3RBTA 1XWBA 3HD5A 2GDRA 5A1NB 1CQGA 9GSSA 3LORA 2FHEA 4O5UA 2X8CA 3L78A 2F8FA 2XPEA 4KDUA 3ZREA 1GSQA 3GTUB 4MPFA 1DBYA 4MZCA 2HI7A 1X9MB 1GRXA 2F3MA 4MF5A 2VL9A 1S3RA 3HVNA 4FO5A 1PX7A 5A4WA 2UZ8A 5ECIB 5B7CA 4JEDA 3A5IA 4OWYA 4X0XA 3IC4A 1XWAA 5G1LA 2IFQA 1A2MA 3O6TA 5BRTA 3HDCA 4TN8A 2DLXA 5AIVA 2L6DA 3TRQA 3NZNA 3WGDA 2DC5A 4BWQA 4HQZA 1C72A 3QD9A 3O3TA 3SWLA 2EIRA 1QK8A 1R7HA 1ERUA 2BTOT 2GQLA 1PFOA 2AUVA 4EIQA 4I5QA 2IMKA 1F9MA 3F8UA 4O7HA 1R4WA 6GSTA 3NIVA 1SJ6A 3ZMLA 1MD4A 3CBUA 4KSOA 1S3CA 1ZL9A 4V1Ag 2E7PA 1YKAA 5CRHA 5J9BA 3N5OA 3Q74A 1SK0A 4WR5A 3F6FA 5BMUA 2BJXA 4XHMA 1YQ1A 3FZAA 5IMFA 2AB6A 2QA1A 1SVLA 4I2TA 5ID2B 1I9DA 1ERWA 1PQNA 22GSA 3HVVA 4YH2A 4YKGA 2CAIA 4H86A 3C8EA 5AIXA 4G0LA 2H19A 1AQWA 4N11A 4G9HA 2FCHA 2DJ0A 4GSSA 4PUAA 2B5XA 4LA1A 4TR3A 6GSVA 2CT6A 3FKFA 1JZOA 4ECCA 2O36A 5CYYA 1TK0B 1W4VA 3IBHA 3VURA 2DJJA 4AF2A 2PUKC 2QGVA 2JACA 2LRNA 4XTSA 2LJRA 2OBIA 1TDIA 1JFUA 3UEMA 1NM3A 1B8XA 1K3YA 2L57A 1NHYA 3UBLA 4EVMA 3GKNA 3KP9A 2K8SA 4XIHA 4O5RA 6GSWA 1GSEA 1EGOA 4AKXB 1GTAA 1TI3A 4FH8A 2XPDA 2YNXA 5DQYA 1RQMA 1XVWA 4J57E 4DSSA 3TU3B 2YWOA 2MMAA 3QMXA 2XC2A 3GSSA 3KD0A 2YJ7A 3Q19A 4BWSA 3VI5A 2GTUA 6GSSA 3ED3A 2JZSA 3D22A 1PX6A 4K0GA 2I1UA 3TUEA 5JWOB 2WGRA 4NV5A 1THOA 2QA2A 3IA1A 4TR4A 2J9HA 5HR3A 3LSZA 2HZEB 5KN0A 2DJ3A 3U5RE 4IP1A 5F8BA 1TW9A 4PHZC 3GL3A 4KUNA 4ECIA 3LJRA 2B6MA 2HRNA 4IP6A 1WMJA 4G01A 4MPGA 1TK5B 1GULA 4IGJA 2MYGA 3F3RA 2VO4A 1M9BA 1A0FA 5J5NA 5DAKA 1M3IA 3PGTA 3GKXA 1M0UA 2H0HA 2HRKB 3SBCA 1SJIA 2C0FA 3IC8A 1IYHA 4BVXA 1YEWC 3LXTA 3M0FA 2ALBA 1OAZA 2DKIA 2HRAA 1VGLA 3M3MA 5ECMB 4YAVA 2B3SA 4LMVA 1EP8A 4ZB7A 2YZHA 2IWTA 2YOIA 1B48A 3ZRDA 2DSAA 3G7JA 2AAWA 5CNWA 1TTZA 4PNFA 1MTCA 5DBQA 2R0CA 4NMUA 5GZZB 3IXRA 1YJ6A 2G0FA 2IMEA 4XCSA 5F05A 4TR1A 2TRCP 5CO3A 3RPPA 3CXGA 1EOHA 2R5GA 2JSYA 3O76A 4MF6A 1X5DA 4XS1A 2PVOC 4QL9A 1TI1A 3G7IA 3VWWA 5F0GA 3PR8A 3ZLPA 4I6XA 3KTLA 5FHIA 1FW1A 1BEDA 2N5FA 1YZXA 4N10A 2WULA 3F0IA 4FYCA 1XFLA 4Z2TA 1HNAA 4IKHA 1DUGA 2ON7A 2A4VA 2H73A 4K9ZA 3ZFLA 2N5AA 5D9TA 3EC3A 4KB3A 2MBSA 4KNDA 4L0WA 4J2FA 5D9VA 3TGZA 4L5LA 1XBSA 2B7KA 3TCOA 5D73A 4HDEA 2HSMB 2H8LA 2X49A 5A1NA 2H6XA 2MZCA 7GSSA 5CRDA 1A24A 3RDWA 3ERFA 1H75A 4TXVA 4IJIA 2RLIA 1M99A 4HZ4A 2PU9C 3GURA 1XZOA 4E8EA 2GSRA 4W66A 4WEYA 2EFDA 1GTUA 2FGXA 1F37A 2MMZA 2FLSA 2H1GA 4GQCA 20GSA 4HQSA 1ERTA 3R3EA 3CSJA 3WYWA 2C0GA 3UMAA 1SL1B 3FZ9A 3LXZA 2H1LA 2VLTA 3LEFA 4F0CA 1BF5A 2CVDA 4MZWA 4GDFA 5IIZA 2F9SA 2C0EA 2JZTA 1PKZA 3FW2A 2LEGA 4XRDA 4AKGA 1Y6EA 3A2XA 2XBQA 1MDIA 3BBYA 2NBSA 4K2DA 4KH7A 2K6VA 4ZBBA 4IELA 1FVKA 1I1IP 4WR4A 4X43A 3US3A 3F3QA 4HI7A 1Z9HA 3IAM2 2J23A 3TKSE 1BAYA 4L8EA 2PMTA 5HR0A 3UJ1A 1V58A 2O85A 2H71A 2CAQA 3L4NA 3R2QA 2DMMA 1GSDA 5ID2A 3M9KA 1JZWA
chains in the Genus database with same CATH topology
17GSA 4PGTA 2R0PA 4GSNA 1M7TA 5G31A 4N3ZA 2VLUA 1V9WA 2REMA 2VM1A 3GNJA 1VF4A 4QMKA 2EIQA 3D21A 3E3EA 3VFIA 3UVTA 1TP9A 2ON5A 4JE1A 2WJUA 2C3TA 2YZUA 4CW9A 3RHCA 3GUSA 1O8WA 2P0GA 4KDYA 4NXIA 1X5CA 3F4SA 3IE3A 2IN3A 2LSTA 1TRVA 2KUCA 4K8MA 5E4WA 3LYPA 2O7KA 5JCUA 1AQXA 4G10A 2LQQA 5L71A 1NHOA 2TRXA 3QFAC 2IMIA 1K0NA 2OADA 5DCHA 1LU4A 3DXBA 2EFEA 1YEPA 3D4MA 4MF7A 3G9BA 5KN1A 5J9CA 4WBJA 1Z6NA 3CTGA 4IQ1A 2LRTA 1GP1A 3FR3A 1TJDA 3DVXA 1DE1A 2GS3A 1R26A 2L5OA 2HSNA 4OCEA 1KBNA 5J4YA 1BYEA 5IQYA 3M9JA 2R4VA 4NV2A 1GNWA 3ZITA 4GCIA 4OD7A 2QKEA 1SJZA 3FEUA 3IHGA 1ABAA 2H76A 5EPFA 1PRXA 4MZBA 2DIZA 4ML1A 3RPNA 1B9XC 5KOXA 1GLPA 3EVIA 3BJ5A 4KF9A 3BCIA 3QDNA 1ZCPA 3S9FA 3C7MA 1X5EA 1YF1A 1R5AA 2HZEA 5KEJA 4KX4A 2HSHA 2I9HA 2TIRA 4E8HA 2C3QA 2DBCA 3FYGA 2MBTA 3WD6A 1FAAA 1AQVA 1U3IA 3TKRA 2HT9A 1OC9A 3BOAA 2FNOA 1SD9A 4NWYA 2ZUPA 4I2UA 2CVKA 2HRKA 1EEJA 4IS0A 3E9JB 2VCTA 3QAGA 5B8AA 1WWJA 4HU9A 3C71A 4POLA 1B4QA 1PN0A 1PN9A 3W8SA 2GSSA 4AI6A 1EV4A 2LV3A 1O8XA 1TU7A 1JHBA 4V2NA 1WP0A 2O89A 2PN8A 4IVFA 2FWFA 2YV7A 4K6XA 4BA7A 2XBIA 4LL1B 5JWQB 1HYUA 4KW6A 3MNGA 5F07A 2B1LA 1Y25A 2JL4A 18GSA 4Q5NA 4ACSA 3ME7A 3H93A 3QFBC 5H5RA 4EDYA 1VF3A 4O92A 3GFKA 1AXDA 2RM6A 3NOFA 5INYA 1XWKA 1ZYNA 2L59A 2E0QA 3ZTLA 4ZL7A 4K2XA 4EXJA 2JADA 2OBKA 2WRTA 2YCDA 4K7NA 1OE8A 5FT3A 1SK2A 1F3AA 3HA9A 2MMOA 2HE3A 1PD21 3TJJA 2OE3A 4ZBDA 4AJ8A 3CRTA 4G0KA 2B5EA 1GSFA 4MABA 3H79A 1GL8A 4HJMA 4G19A 1WIKA 4TW5A 2YN1A 1PGTA 3A2VA 4KCAA 1GSSA 3WT1A 4TXOB 4FIWA 5B6MA 3PPUA 3F4TA 5JWRB 1A8LA 5A5HA 4RUVA 2GLRA 2A2RA 3TJKA 1O81A 1XOBA 4F9ZA 2JSZA 3FR6A 2CX3A 5HR1A 4ML6A 3EU4A 5G1KA 4Z2UA 2R0GA 5B8BA 3GSTA 3TJGA 5E59A 4KCEA 4PTSA 1UA5A 2H74A 3QAWA 3F9UA 5ECOB 4YQMA 2VAFA 5GSTA 2LTKA 1G6YA 1WRYA 1VF1A 8GSSA 5GSSA 1Z6MA 4YQUA 2WCIA 3P8WA 2AJQB 5CREA 2L4CA 3GIXA 4RQRA 5ECRB 3IOSA 1OE7A 5A34B 4POBA 1YDKA 2GSTA 4MJAA 1TXUA 3HJPA 3ZIVA 2GQKA 2C0DA 2HSYA 2BMXA 3DWVA 2YANA 2E2MA 4NPBA 3LGCA 4MLYA 3IK7A 3ZZXA 2L4QA 3HVSA 1ZOFA 2V2GA 2OE0A 1X0RA 1SKSB 4IN0A 5EL8A 1FOVA 3GMFA 1K0DA 4RI6A 5EVOA 1AC1A 4X4JA 2I81A 1QUWA 1YY7A 1ST9A 3GH9A 4GLTA 5BMUB 2IMDA 2YWMA 2VCXA 1AAZA 4RI7A 5J40A 5F06A 2H66A 3OR5A 4BL7B 1EOGA 4KA0A 2HNLA 4ZL8A 1GSYA 4LMWA 1FHEA 1GUHA 3W8JA 4I97A 4F0BA 13GSA 3APSA 4XS6A 3EMXA 4MNNA 2EFCA 4PQHA 14GSA 2JZRA 4ULXA 11GSA 1JZDA 1XW9A 2HFDA 3FK8A 3GYKA 4OO5A 4WF5A 1XIYA 3TKSC 1ILOA 2DJ2A 3UL3A 4D73A 5DDLA 5ELAA 3ZL5A 5J4VA 1U87A 2V32A 4MMMA 3IV4A 2NDOA 1QMVA 2PBJA 4ZB6A 1V57A 4EO3A 1SL2B 3MDKA 3M8NA 4K5RA 2PERA 1R5PA 3BD2A 1EP7A 2H1BA 2N5BA 3CRUA 2PGTA 3I69A 2ES7A 1UVZA 3EINA 3EMPA 3DD3A 2P31A 3HMJG 4WXTA 1ZGNA 1B4PA 4MJCA 5D8IA 4GF0A 1WOUA 2F51A 4LLRA 4IJ3A 1J08A 5LCZA 3UARA 2R3XA 5D96A 5ECKB 3J7Yk 3APQA 3FHKA 1K0CA 4TVEA 4DSSB 5IO0A 4EE0A 2CZ3A 5KN2A 4DVCA 1Q98A 4ZB8A 3LQ7A 3UOMA 4PNGA 2VIMA 3N9JA 5J4UA 1HNBA 2H30A 4HU7A 2LRCA 3GTUA 2C1YA 4ISDA 1XPVA 3ZVJD 3KMNA 1OKDA 1OYJA 2R37A 3E0UA 2LJAA 2GZYA 2R2JA 4EUYA 3QAVA 3P90A 1O85A 1UC7A 1AW9A 1K3OA 4AJ7A 3KGKA 2LQOA 3I9V2 5GAPD 1T4YA 2GQMA 4YAPA 4IHUA 1BJXA 3LYKA 5DAKB 4QL7A 1M2DA 4FYUA 4LL4B 2H0IA 5EY6A 3VPQA 4BVYB 4NHWA 5GAND 4KDXA 3KXOA 2C4JA 4Q5RA 2X8GA 5J3RA 5IMCA 1BQ7A 4MJBA 2H6ZA 1GWCA 3CSIA 1Z5YE 1G7EA 3LFLA 3ZFBA 2EC4A 5DCGA 2YWIA 1FB6A 2YJHA 2AHEA 1QQ2A 2GT6A 4K0NA 1NSWA 4HUAA 5ABRA 1CQHA 2IJYA 1HD2A 5G5EA 2RM5A 5G30A 5CAXA 2G2QA 4N0ZA 4EL1A 1NW2A 2HQTA 3GRXA 3JCML 2KOKA 1AUCA 4MH3A 4F03A 3GX0A 5G2ZA 3PINA 3TKSA 4ZL9A 1XWGA 2M80A 1S3DA 4ZBAA 3I43A 3KM6A 2LJKA 2GZZA 3D4TA 1XCCA 2CQ9A 3TRPA 2EIOA 2X4AA 2MMNA 1PKWA 3GL5A 3DYRA 2X64A 1SKRB 2VCQA 1F2EA 2AYTA 1SKWB 1G0TA 2VOCA 10GSA 2M72A 1KTEA 1SU9A 1ZYQB 5DJLA 3U6VA 4RQXA 3F4RA 2CA8A 2VD0A 3MSZA 3VWUA 4N30A 1EV9A 1G6WA 1FVJA 2H0GA 3UVHA 1SL0B 3KP8A 4OMVA 2OKAA 3ERGA 1MEKA 1K0MA 4V1Ap 2VL2C 3IDVA 2O5VA 1XVQA 3VI7A 2H1AA 2QC7A 4JRRA 1QFNA 1T8EB 4PQ1A 4K7OA 1GUMA 1URMA 3WT2A 1HNCA 4PUFC 2VCWA 1J0FA 5IOWA 4V2LA 1E6BA 4XS4B 2WZ9A 2RUFA 3IPZA 2C80A 2KHPA 3ISOA 1DE2A 2FUG2 1O7UA 4AGSA 3IRAA 2CZ2A 3A3TA 1H4OA 2M46A 3ERWA 5H5SA 1USBA 2B1KA 3TJBA 4K5SA 1TXXA 3HXSA 1K0BA 5ENUA 3C1SA 4TOPA 5HR2A 3CSHA 1MDJA 1EGRA 3LG6A 2WDUA 1XW6A 1XW5A 1AIUA 5DQSA 3WGXA 5IPGA 1SD8A 4O5QA 2I4AA 2KP1A 4EC0A 4OFTA 1A0RP 4PURA 2PWJA 4BPYA 2DJKA 5ECNB 4YQVA 1A2LA 3HVXA 5ECQB 1T7PB 6GSYA 1EWXA 4MA9A 5IM9A 16GSA 5A34A 1E2YA 3TB2A 4DSQA 4V2MA 1PL1A 3AY8A 5IOXA 4QQ7A 5HFGA 3KEBA 3F63A 2EFHA 3ME8A 4J56E 5C00A 4WETA 4E68A 2H01A 2FA8A 6GSUA 3TOTA 3GKKA 4HEA2 1MD3A 4Q5FA 4MCUA 3CWGA 4AKHA 2H70A 2LKUA 3TDGA 4XRAA 1TOFA 3IR4A 3HZ8A 1TKDB 2GGTA 3FY7A 4GTUA 2L6CA 4EIPA 1KEBA 4OCFA 2GZPA 4KSMA 4WKWA 2ZCTA 3EPTA 4KGIA 1Z3EA 3GN3A 4NAXA 3J7Yb 4Q5QA 4BL7A 1ERVA 4GSTA 2C8UA 1FG4A 4G2EA 3HZ4A 1SYXA 1I5GA 4ZXGA 5AGYA 1O73A 2AV4A 3QOUA 2GVPA 2VCVA 4OFNA 1SK1A 2OJLA 3RAZA 2B5YA 1Y1UA 2VL3A 1WE0A 4KE3A 3VWVA 2HXKA 1SVMA 2H72A 3Q6OA 3GH6A 3EWLA 3APOA 4G0IA 2YPMA 1RK4A 4GWRA 3P7XA 4EF0A 2PPTA 5DALB 1U3AA 2P5QA 4P3YB 1M2BA 5D9WA 2OT3A 4GQFA 19GSA 1X9WB 3MIXA 1U6TA 5ECPB 2Z9SA 3HHVA 4DEJA 4TR0A 2K9FA 2DIYA 3L9SA 2RUEA 4POKA 2VL2A 4TKYA 5J41A 1GH2A 3DVWA 2NTOA 1GLQA 3HJOA 1ZYPA 1A2JA 3FZ5A 2O87A 1ZMAA 3IHQA 2HSNB 5HQPA 1VRSD 2OACA 2LNSA 4WBRD 4JU5A 2ZNMA 1TK8B 1GTIA 5G5FA 3I6AA 4K1FA 1XXUA 2O8VB 1TRUA 2L5LA 2FY6A 3KJYA 1MDKA 2RIIA 3EURA 2X8HA 1JLVA 3EYTA 3QPMA 2HSMA 2LUSA 2VCZA 2HZFA 4MH2A 3TKPA 1O6JA 3FMWA 2V1MA 1YEXA 2V6OA 1FO5A 3L9VA 1U88A 5COHA 2VUPA 4AJ6A 3MWHA 2FA4A 2K18A 3QCPA 1PL2A 2IFQB 1PSQA 4JBBA 2VKZG 1K0AA 3ZYWA 1YF0A 5A4UA 4MJEA 1GSUA 3CMIA 3VK9A 1HQOA 1F3BA 2A2PA 3KTBA 3TKQA 2FWGA 5ECSA 3UBKA 2V6KA 1WJKA 2KLXA 1OC9B 2H6YA 4IQAA 2YV9A 3MYDA 3RHBA 3KMOA 1GTBA 4BVYA 1X9SB 4ID0A 1J9BA 3A5WA 5H5QA 6GSXA 2IIYA 1T3BA 2QSIA 1V98A 3KH7A 4ZB9A 4GRFA 2WFCA 3Q18A 1V40A 3LWAA 2OE1A 4USSA 5KOWA 1S3AA 1A8YA 1WPIA 3HYPA 2HLSA 5ECLB 3IAS2 3HY2A 4ICYA 1B9YC 3TJFA 3EE2A 3LW9A 1TU8A 4ZIJA 1T1VA 1QGVA 1V2AA 3GX8A 3DIEA 3BCKA 4GXZA 4EKZA 2H1DA 1Z7PA 1T00A 2JU5A 5ECHB 3VPTA 1IYIA 1ML6A 4POMA 4MP4A 2GT5A 2HYXA 5FWGA 4MK3A 5IMVA 2X99A 1FOHA 1TRWA 1G7OA 1OVNA 2HRFA 4HZ2A 2V41A 5AISA 3KIJA 3D0ZA 5CRGA 3ZIJA 3DKSA 2PVQA 3GA4A 4PX1A 3DRNA 4FYBA 2IMFA 4JR4A 2F8AA 1VF2A 2IPAA 5IMZA 2OA7A 4TRXA 3P2AA 1PA3A 4JZQA 3HKRA 1YVLA 2DKHA 1XWCA 4K7IA 4JR6A 2GSQA 2DJ1A 2FWHA 3QR6A 5HFIA 1KNGA 4IBPA 2VD1A 3TOUA 2NVLA 1GNEA 3KH9A 2D2ZA 3D5JA 1W89A 2KP2A 3F6DA 3FZ4A 2DMLA 1BG5A 5KN3A 5CRWA 5A5HB 1Q4JA 4OFMA 4O32A 3GKMA 5B6NA 1BX9A 4HS1A 3MAKA 1TRSA 4XS4A 3L9UA 5J47A 2C3NA 1OC3A 2E2GA 1JZRA 2YWNA 1N25A 2IL3A 4F82A 3HCZA 3VLNA 3ZMKA 2B7JA 4HOJA 5HFKA 1LBKA 3IK9A 1K3LA 3H1NA 4CY6A 4DSRA 2A2SA 4MDCA 5ELGA 1SENA 4HJ2A 4I8BA 1BG1A 1N8JA 3GV1A 5IMDA 3KCMA 1ON4A 3CYNA 1ACVA 2XHFA 2WB9A 1N2AA 2VLVA 4CHSA 3A2WA 4IW9A 3L0HA 12GSA 2WS2A 1EEMA 5JCWA 4BVXB 1T4ZA 3DMLA 3ZVJA 3V1WA 4WF4A 3W6GA 1DSBA 1K0OA 2CX4A 1EZKA 1A23A 2A4HA 1YKCA 1ZYEA 4Z7XA 3PH9A 4L0UA 5IPHA 4OO4A 5AN1A 5LD0A 1PMTA 2CVBA 2LS5A 2FD3A 3D6IA 4YKFA 4EDZA 3FRCA 1GUKA 4ILFA 4FQUA 5LNKe 1OC8A 3HJMA 4A5PA 1RW1A 5D93A 2UV8G 1M2AA 2YP6A 1F6MC 1JLWA 3M1GA 5A4VA 1SYRA 2H75A 2I3YA 4N0VA 2NPBA 4Z2RA 3GHAA 3C1RA 5DJMA 5D9XA 1Z7RA 4CY8A 4PXOA 3G7YA 2LNTA 2FWEA 5IO2A 4ECBA 3VWXA 4PQIA 1SVOA 1M9AA 4TR1B 4D73B 5IMAA 3K8NA 4AKIA 3WGEA 3EU3A 3FR9A 3TRXA 3CTFA 4F2IA 5DALA 4KAEA 4ZILA 4NHZA 2P5RA 2VM2A 1FB0A 5CP1A 3UIWA 3H8QA 1ZZYA 1THXA 3C73A 3H4KA 5C04A 1UN2A 4X1UA 4CDOA 2CV4A 4ECJA 3DGQA 1LJRA 1QXHA 3UAPA 5DVBA 5JCGA 2K8VA 4TXOA 1OKTA 2R6KA 1XOAA 4L5OA 5A5KA 3DEXA 3KZQA 3RBTA 1XWBA 3HD5A 2GDRA 5A1NB 1CQGA 9GSSA 3LORA 2FHEA 4O5UA 2X8CA 3L78A 2F8FA 2XPEA 4KDUA 3ZREA 1GSQA 3GTUB 4MPFA 1DBYA 4MZCA 2HI7A 1X9MB 1GRXA 2F3MA 4MF5A 2VL9A 4FO5A 1PX7A 5A4WA 2UZ8A 5ECIB 5B7CA 4JEDA 3A5IA 4OWYA 4X0XA 3IC4A 1XWAA 5G1LA 2IFQA 1A2MA 3O6TA 5BRTA 3HDCA 4TN8A 2DLXA 5AIVA 2L6DA 3TRQA 3NZNA 3WGDA 2DC5A 4BWQA 4HQZA 1C72A 3QD9A 3O3TA 3SWLA 2EIRA 1QK8A 1R7HA 1ERUA 2BTOT 2GQLA 2AUVA 4EIQA 4I5QA 2IMKA 1F9MA 3F8UA 4O7HA 1R4WA 6GSTA 3NIVA 1SJ6A 3ZMLA 1MD4A 3CBUA 4KSOA 1S3CA 1ZL9A 4V1Ag 2E7PA 1YKAA 5CRHA 5J9BA 3N5OA 3Q74A 1SK0A 4WR5A 3F6FA 5BMUA 2BJXA 4XHMA 1YQ1A 3FZAA 5IMFA 2AB6A 2QA1A 1SVLA 4I2TA 5ID2B 1I9DA 1ERWA 1PQNA 22GSA 3HVVA 4YH2A 4YKGA 2CAIA 4H86A 3C8EA 5AIXA 4G0LA 2H19A 1AQWA 4N11A 4G9HA 2FCHA 2DJ0A 4GSSA 4PUAA 2B5XA 4LA1A 4TR3A 6GSVA 2CT6A 3FKFA 1JZOA 4ECCA 5CYYA 1TK0B 1W4VA 3IBHA 3VURA 2DJJA 4AF2A 2PUKC 2QGVA 2JACA 2LRNA 4XTSA 2LJRA 2OBIA 1TDIA 1JFUA 3UEMA 1NM3A 1B8XA 1K3YA 2L57A 1NHYA 3UBLA 4EVMA 3GKNA 3KP9A 2K8SA 4XIHA 4O5RA 6GSWA 1GSEA 1EGOA 4AKXB 1GTAA 1TI3A 4FH8A 2XPDA 2YNXA 5DQYA 1RQMA 1XVWA 4J57E 4DSSA 3TU3B 2YWOA 2MMAA 3QMXA 2XC2A 3GSSA 3KD0A 2YJ7A 3Q19A 4BWSA 3VI5A 2GTUA 6GSSA 3ED3A 2JZSA 3D22A 1PX6A 4K0GA 2I1UA 3TUEA 5JWOB 2WGRA 4NV5A 1THOA 2QA2A 3IA1A 4TR4A 2J9HA 5HR3A 3LSZA 2HZEB 5KN0A 2DJ3A 3U5RE 4IP1A 5F8BA 1TW9A 3GL3A 4KUNA 4ECIA 3LJRA 2B6MA 2HRNA 4IP6A 1WMJA 4G01A 4MPGA 1TK5B 1GULA 4IGJA 2MYGA 3F3RA 2VO4A 1M9BA 1A0FA 5J5NA 5DAKA 3PGTA 3GKXA 1M0UA 2H0HA 2HRKB 3SBCA 1SJIA 2C0FA 3IC8A 1IYHA 4BVXA 3LXTA 3M0FA 2ALBA 1OAZA 2DKIA 2HRAA 1VGLA 3M3MA 5ECMB 4YAVA 2B3SA 4LMVA 1EP8A 4ZB7A 2YZHA 2IWTA 2YOIA 1B48A 3ZRDA 2DSAA 3G7JA 2AAWA 5CNWA 1TTZA 4PNFA 1MTCA 5DBQA 2R0CA 4NMUA 5GZZB 3IXRA 1YJ6A 2G0FA 2IMEA 4XCSA 5F05A 4TR1A 2TRCP 5CO3A 3RPPA 3CXGA 1EOHA 2R5GA 2JSYA 3O76A 4MF6A 1X5DA 4XS1A 2PVOC 4QL9A 1TI1A 3G7IA 3VWWA 5F0GA 3PR8A 3ZLPA 4I6XA 3KTLA 5FHIA 1FW1A 1BEDA 2N5FA 1YZXA 4N10A 2WULA 3F0IA 4FYCA 1XFLA 4Z2TA 1HNAA 4IKHA 1DUGA 2ON7A 2A4VA 2H73A 4K9ZA 3ZFLA 2N5AA 5D9TA 3EC3A 4KB3A 2MBSA 4KNDA 4L0WA 4J2FA 5D9VA 3TGZA 4L5LA 1XBSA 2B7KA 3TCOA 5D73A 4HDEA 2HSMB 2H8LA 2X49A 5A1NA 2H6XA 2MZCA 7GSSA 5CRDA 1A24A 3RDWA 3ERFA 1H75A 4TXVA 4IJIA 2RLIA 1M99A 4HZ4A 2PU9C 3GURA 1XZOA 4E8EA 2GSRA 4W66A 4WEYA 2EFDA 1GTUA 2FGXA 1F37A 2MMZA 2FLSA 2H1GA 4GQCA 20GSA 4HQSA 1ERTA 3R3EA 3CSJA 3WYWA 2C0GA 3UMAA 1SL1B 3FZ9A 3LXZA 2H1LA 2VLTA 3LEFA 4F0CA 1BF5A 2CVDA 4MZWA 4GDFA 5IIZA 2F9SA 2C0EA 2JZTA 1PKZA 3FW2A 2LEGA 4XRDA 4AKGA 1Y6EA 3A2XA 2XBQA 1MDIA 3BBYA 2NBSA 4K2DA 4KH7A 2K6VA 4ZBBA 4IELA 1FVKA 4WR4A 4X43A 3US3A 3F3QA 4HI7A 1Z9HA 3IAM2 2J23A 3TKSE 1BAYA 4L8EA 2PMTA 5HR0A 3UJ1A 1V58A 2O85A 2H71A 2CAQA 3L4NA 3R2QA 2DMMA 1GSDA 5ID2A 3M9KA 1JZWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 17GS A;  4PGT A;  4GSN A;  1M7T A;  5G31 A;  2VLU A;  1V9W A;  2REM A;  2VM1 A;  3GNJ A;  1VF4 A;  2EIQ A;  3D21 A;  3E3E A;  3VFI A;  3UVT A;  1TP9 A;  2ON5 A;  4JE1 A;  2WJU A;  2C3T A;  2YZU A;  4CW9 A;  3RHC A;  3GUS A;  1O8W A;  2P0G A;  4KDY A;  4NXI A;  1X5C A;  3F4S A;  3IE3 A;  2IN3 A;  2LST A;  1TRV A;  2KUC A;  4K8M A;  5E4W A;  3LYP A;  2O7K A;  5JCU A;  1AQX A;  4G10 A;  2LQQ A;  5L71 A;  1NHO A;  2TRX A;  3QFA C;  2IMI A;  1K0N A;  2OAD A;  5DCH A;  1LU4 A;  3DXB A;  1YEP A;  3D4M A;  4MF7 A;  3G9B A;  5KN1 A;  5J9C A;  4WBJ A;  1Z6N A;  3CTG A;  4IQ1 A;  2LRT A;  1GP1 A;  3FR3 A;  1TJD A;  3DVX A;  1DE1 A;  2GS3 A;  1R26 A;  2L5O A;  4OCE A;  1KBN A;  1BYE A;  5IQY A;  3M9J A;  2R4V A;  4NV2 A;  1GNW A;  3ZIT A;  4GCI A;  4OD7 A;  2QKE A;  1SJZ A;  3FEU A;  1ABA A;  2H76 A;  5EPF A;  1PRX A;  4MZB A;  2DIZ A;  4ML1 A;  3RPN A;  1B9X C;  1GLP A;  3EVI A;  3BJ5 A;  4KF9 A;  3BCI A;  3QDN A;  1ZCP A;  3S9F A;  3C7M A;  1X5E A;  1YF1 A;  1R5A A;  2HZE A;  5KEJ A;  4KX4 A;  2HSH A;  2I9H A;  2TIR A;  4E8H A;  2C3Q A;  2DBC A;  3FYG A;  2MBT A;  3WD6 A;  1FAA A;  1AQV A;  1U3I A;  3TKR A;  2HT9 A;  1OC9 A;  3BOA A;  2FNO A;  1SD9 A;  4NWY A;  2ZUP A;  4I2U A;  2CVK A;  2HRK A;  1EEJ A;  4IS0 A;  3E9J B;  2VCT A;  3QAG A;  5B8A A;  1WWJ A;  4HU9 A;  3C71 A;  4POL A;  1B4Q A;  1PN9 A;  3W8S A;  2GSS A;  1EV4 A;  2LV3 A;  1O8X A;  1TU7 A;  1JHB A;  4V2N A;  1WP0 A;  2O89 A;  2PN8 A;  4IVF A;  2FWF A;  2YV7 A;  4K6X A;  4BA7 A;  2XBI A;  4LL1 B;  5JWQ B;  1HYU A;  4KW6 A;  3MNG A;  5F07 A;  2B1L A;  1Y25 A;  2JL4 A;  18GS A;  4Q5N A;  4ACS A;  3ME7 A;  3H93 A;  3QFB C;  5H5R A;  4EDY A;  1VF3 A;  4O92 A;  3GFK A;  1AXD A;  2RM6 A;  3NOF A;  5INY A;  1XWK A;  2L59 A;  2E0Q A;  3ZTL A;  4ZL7 A;  4EXJ A;  2JAD A;  2OBK A;  2WRT A;  2YCD A;  4K7N A;  1OE8 A;  5FT3 A;  1SK2 A;  1F3A A;  3HA9 A;  2MMO A;  2HE3 A;  1PD2 1;  3TJJ A;  2OE3 A;  4ZBD A;  4AJ8 A;  3CRT A;  4G0K A;  2B5E A;  1GSF A;  4MAB A;  3H79 A;  1GL8 A;  4HJM A;  4G19 A;  1WIK A;  4TW5 A;  2YN1 A;  1PGT A;  3A2V A;  4KCA A;  1GSS A;  3WT1 A;  4TXO B;  4FIW A;  5B6M A;  3PPU A;  3F4T A;  5JWR B;  1A8L A;  4RUV A;  2GLR A;  2A2R A;  3TJK A;  1O81 A;  1XOB A;  4F9Z A;  2JSZ A;  3FR6 A;  2CX3 A;  5HR1 A;  4ML6 A;  3EU4 A;  5G1K A;  5B8B A;  3GST A;  3TJG A;  5E59 A;  4KCE A;  4PTS A;  1UA5 A;  2H74 A;  3QAW A;  3F9U A;  5ECO B;  4YQM A;  2VAF A;  5GST A;  2LTK A;  1G6Y A;  1WRY A;  1VF1 A;  8GSS A;  5GSS A;  1Z6M A;  4YQU A;  2WCI A;  3P8W A;  2AJQ B;  5CRE A;  2L4C A;  3GIX A;  4RQR A;  5ECR B;  3IOS A;  1OE7 A;  4POB A;  1YDK A;  2GST A;  4MJA A;  3HJP A;  3ZIV A;  2GQK A;  2C0D A;  2HSY A;  2BMX A;  3DWV A;  2YAN A;  2E2M A;  4NPB A;  3LGC A;  4MLY A;  3IK7 A;  3ZZX A;  2L4Q A;  3HVS A;  1ZOF A;  2V2G A;  2OE0 A;  1X0R A;  1SKS B;  4IN0 A;  5EL8 A;  1FOV A;  3GMF A;  1K0D A;  4RI6 A;  5EVO A;  1AC1 A;  2I81 A;  1QUW A;  1YY7 A;  1ST9 A;  3GH9 A;  4GLT A;  2IMD A;  2YWM A;  2VCX A;  1AAZ A;  4RI7 A;  5F06 A;  2H66 A;  3OR5 A;  4BL7 B;  1EOG A;  4KA0 A;  2HNL A;  4ZL8 A;  1GSY A;  4LMW A;  1FHE A;  1GUH A;  3W8J A;  4I97 A;  4F0B A;  13GS A;  3APS A;  4XS6 A;  3EMX A;  4PQH A;  14GS A;  2JZR A;  4ULX A;  11GS A;  1JZD A;  1XW9 A;  2HFD A;  3FK8 A;  3GYK A;  4OO5 A;  4WF5 A;  1XIY A;  3TKS C;  1ILO A;  2DJ2 A;  3UL3 A;  4D73 A;  5DDL A;  5ELA A;  3ZL5 A;  1U87 A;  2V32 A;  4MMM A;  3IV4 A;  2NDO A;  1QMV A;  2PBJ A;  4ZB6 A;  1V57 A;  4EO3 A;  1SL2 B;  3MDK A;  3M8N A;  2PER A;  1R5P A;  3BD2 A;  1EP7 A;  2H1B A;  2N5B A;  3CRU A;  2PGT A;  3I69 A;  2ES7 A;  1UVZ A;  3EIN A;  3EMP A;  3DD3 A;  2P31 A;  4WXT A;  1ZGN A;  1B4P A;  4MJC A;  5D8I A;  4GF0 A;  1WOU A;  2F51 A;  4LLR A;  4IJ3 A;  1J08 A;  5LCZ A;  3UAR A;  2R3X A;  5D96 A;  5ECK B;  3J7Y k;  3APQ A;  3FHK A;  1K0C A;  4TVE A;  4DSS B;  5IO0 A;  4EE0 A;  2CZ3 A;  5KN2 A;  4DVC A;  1Q98 A;  4ZB8 A;  3LQ7 A;  3UOM A;  4PNG A;  2VIM A;  3N9J A;  5J4U A;  1HNB A;  2H30 A;  4HU7 A;  2LRC A;  3GTU A;  2C1Y A;  4ISD A;  1XPV A;  3ZVJ D;  3KMN A;  1OKD A;  1OYJ A;  2R37 A;  3E0U A;  2LJA A;  2GZY A;  2R2J A;  4EUY A;  3QAV A;  3P90 A;  1O85 A;  1UC7 A;  1AW9 A;  1K3O A;  4AJ7 A;  3KGK A;  2LQO A;  3I9V 2;  5GAP D;  1T4Y A;  2GQM A;  4YAP A;  4IHU A;  1BJX A;  3LYK A;  5DAK B;  4QL7 A;  1M2D A;  4FYU A;  4LL4 B;  2H0I A;  5EY6 A;  3VPQ A;  4BVY B;  4NHW A;  5GAN D;  4KDX A;  3KXO A;  2C4J A;  4Q5R A;  2X8G A;  5J3R A;  5IMC A;  1BQ7 A;  4MJB A;  2H6Z A;  1GWC A;  3CSI A;  1Z5Y E;  1G7E A;  3LFL A;  3ZFB A;  2EC4 A;  5DCG A;  2YWI A;  1FB6 A;  2YJH A;  2AHE A;  1QQ2 A;  2GT6 A;  4K0N A;  1NSW A;  4HUA A;  5ABR A;  1CQH A;  2IJY A;  1HD2 A;  5G5E A;  2RM5 A;  5G30 A;  5CAX A;  2G2Q A;  4N0Z A;  4EL1 A;  1NW2 A;  2HQT A;  3GRX A;  3JCM L;  2KOK A;  1AUC A;  4MH3 A;  4F03 A;  3GX0 A;  5G2Z A;  3PIN A;  3TKS A;  4ZL9 A;  1XWG A;  2M80 A;  1S3D A;  4ZBA A;  3I43 A;  3KM6 A;  2LJK A;  2GZZ A;  3D4T A;  1XCC A;  2CQ9 A;  3TRP A;  2EIO A;  2MMN A;  1PKW A;  3GL5 A;  3DYR A;  2X64 A;  1SKR B;  2VCQ A;  1F2E A;  2AYT A;  1SKW B;  1G0T A;  2VOC A;  10GS A;  2M72 A;  1KTE A;  1SU9 A;  1ZYQ B;  5DJL A;  3U6V A;  4RQX A;  3F4R A;  2CA8 A;  2VD0 A;  3MSZ A;  3VWU A;  4N30 A;  1EV9 A;  1G6W A;  1FVJ A;  2H0G A;  3UVH A;  1SL0 B;  3KP8 A;  4OMV A;  2OKA A;  3ERG A;  1MEK A;  1K0M A;  4V1A p;  2VL2 C;  3IDV A;  1XVQ A;  3VI7 A;  2H1A A;  2QC7 A;  4JRR A;  1QFN A;  1T8E B;  4PQ1 A;  4K7O A;  1GUM A;  1URM A;  3WT2 A;  1HNC A;  4PUF C;  2VCW A;  1J0F A;  5IOW A;  4V2L A;  1E6B A;  4XS4 B;  2WZ9 A;  2RUF A;  3IPZ A;  2C80 A;  2KHP A;  3ISO A;  1DE2 A;  2FUG 2;  1O7U A;  4AGS A;  3IRA A;  2CZ2 A;  3A3T A;  1H4O A;  2M46 A;  3ERW A;  5H5S A;  1USB A;  2B1K A;  3TJB A;  1TXX A;  3HXS A;  1K0B A;  5ENU A;  3C1S A;  4TOP A;  5HR2 A;  3CSH A;  1MDJ A;  1EGR A;  3LG6 A;  2WDU A;  1XW6 A;  1XW5 A;  1AIU A;  5DQS A;  3WGX A;  5IPG A;  1SD8 A;  2I4A A;  2KP1 A;  4EC0 A;  4OFT A;  1A0R P;  4PUR A;  2PWJ A;  4BPY A;  2DJK A;  5ECN B;  4YQV A;  1A2L A;  3HVX A;  5ECQ B;  1T7P B;  6GSY A;  1EWX A;  4MA9 A;  5IM9 A;  16GS A;  1E2Y A;  3TB2 A;  4DSQ A;  4V2M A;  1PL1 A;  3AY8 A;  5IOX A;  4QQ7 A;  5HFG A;  3KEB A;  3F63 A;  3ME8 A;  5C00 A;  4J56 E;  4WET A;  2H01 A;  2FA8 A;  6GSU A;  3TOT A;  3GKK A;  4HEA 2;  1MD3 A;  4Q5F A;  4MCU A;  2H70 A;  2LKU A;  3TDG A;  4XRA A;  1TOF A;  3IR4 A;  3HZ8 A;  1TKD B;  2GGT A;  3FY7 A;  4GTU A;  2L6C A;  1KEB A;  4OCF A;  2GZP A;  4KSM A;  4WKW A;  2ZCT A;  4KGI A;  1Z3E A;  3GN3 A;  4NAX A;  3J7Y b;  4Q5Q A;  4BL7 A;  1ERV A;  4GST A;  2C8U A;  1FG4 A;  4G2E A;  3HZ4 A;  1SYX A;  1I5G A;  4ZXG A;  5AGY A;  1O73 A;  2AV4 A;  3QOU A;  2GVP A;  2VCV A;  4OFN A;  1SK1 A;  2OJL A;  3RAZ A;  2B5Y A;  2VL3 A;  1WE0 A;  4KE3 A;  3VWV A;  2HXK A;  2H72 A;  3Q6O A;  3GH6 A;  3EWL A;  3APO A;  4G0I A;  2YPM A;  1RK4 A;  4GWR A;  3P7X A;  4EF0 A;  2PPT A;  5DAL B;  1U3A A;  2P5Q A;  4P3Y B;  1M2B A;  5D9W A;  4GQF A;  19GS A;  1X9W B;  1U6T A;  5ECP B;  2Z9S A;  3HHV A;  4DEJ A;  4TR0 A;  2K9F A;  2DIY A;  3L9S A;  2RUE A;  4POK A;  2VL2 A;  4TKY A;  5J41 A;  1GH2 A;  3DVW A;  2NTO A;  1GLQ A;  3HJO A;  1A2J A;  3FZ5 A;  2O87 A;  1ZMA A;  3IHQ A;  2HSN B;  5HQP A;  1VRS D;  2OAC A;  2LNS A;  4WBR D;  4JU5 A;  2ZNM A;  1TK8 B;  1GTI A;  5G5F A;  3I6A A;  4K1F A;  1XXU A;  2O8V B;  1TRU A;  2L5L A;  2FY6 A;  3KJY A;  1MDK A;  2RII A;  3EUR A;  2X8H A;  1JLV A;  3EYT A;  3QPM A;  2HSM A;  2LUS A;  2VCZ A;  2HZF A;  4MH2 A;  3TKP A;  1O6J A;  2V1M A;  1YEX A;  2V6O A;  1FO5 A;  3L9V A;  1U88 A;  5COH A;  2VUP A;  4AJ6 A;  3MWH A;  2FA4 A;  2K18 A;  3QCP A;  1PL2 A;  2IFQ B;  1PSQ A;  4JBB A;  1K0A A;  3ZYW A;  1YF0 A;  5A4U A;  4MJE A;  1GSU A;  3CMI A;  3VK9 A;  1HQO A;  1F3B A;  3KTB A;  3TKQ A;  2FWG A;  5ECS A;  3UBK A;  2V6K A;  1WJK A;  2KLX A;  1OC9 B;  2H6Y A;  4IQA A;  2YV9 A;  3RHB A;  3KMO A;  1GTB A;  4BVY A;  1X9S B;  4ID0 A;  1J9B A;  3A5W A;  5H5Q A;  6GSX A;  2IIY A;  1T3B A;  2QSI A;  1V98 A;  3KH7 A;  4ZB9 A;  4GRF A;  2WFC A;  3Q18 A;  1V40 A;  3LWA A;  2OE1 A;  4USS A;  1S3A A;  1A8Y A;  1WPI A;  3HYP A;  2HLS A;  5ECL B;  3IAS 2;  3HY2 A;  1B9Y C;  3TJF A;  3EE2 A;  1TU8 A;  4ZIJ A;  1T1V A;  1QGV A;  1V2A A;  3GX8 A;  3DIE A;  3BCK A;  4GXZ A;  4EKZ A;  2H1D A;  1Z7P A;  1T00 A;  2JU5 A;  5ECH B;  3VPT A;  1IYI A;  1ML6 A;  4POM A;  4MP4 A;  2GT5 A;  2HYX A;  5FWG A;  4MK3 A;  5IMV A;  2X99 A;  1TRW A;  1G7O A;  1OVN A;  2HRF A;  4HZ2 A;  2V41 A;  5AIS A;  3KIJ A;  3D0Z A;  5CRG A;  3ZIJ A;  3DKS A;  2PVQ A;  3GA4 A;  4PX1 A;  3DRN A;  4FYB A;  2IMF A;  4JR4 A;  2F8A A;  1VF2 A;  2IPA A;  5IMZ A;  2OA7 A;  4TRX A;  3P2A A;  1PA3 A;  4JZQ A;  3HKR A;  1XWC A;  4K7I A;  4JR6 A;  2GSQ A;  2DJ1 A;  2FWH A;  3QR6 A;  5HFI A;  1KNG A;  4IBP A;  2VD1 A;  3TOU A;  2NVL A;  1GNE A;  3KH9 A;  2D2Z A;  3D5J A;  1W89 A;  2KP2 A;  3F6D A;  3FZ4 A;  2DML A;  1BG5 A;  5KN3 A;  5CRW A;  1Q4J A;  4OFM A;  4O32 A;  3GKM A;  5B6N A;  1BX9 A;  4HS1 A;  3MAK A;  1TRS A;  4XS4 A;  3L9U A;  2C3N A;  1OC3 A;  2E2G A;  1JZR A;  2YWN A;  2IL3 A;  4F82 A;  3HCZ A;  3VLN A;  3ZMK A;  2B7J A;  4HOJ A;  5HFK A;  1LBK A;  3IK9 A;  1K3L A;  3H1N A;  4DSR A;  2A2S A;  4MDC A;  5ELG A;  1SEN A;  4HJ2 A;  4I8B A;  1N8J A;  3GV1 A;  5IMD A;  3KCM A;  1ON4 A;  3CYN A;  1ACV A;  2XHF A;  2WB9 A;  1N2A A;  2VLV A;  4CHS A;  3A2W A;  4IW9 A;  3L0H A;  12GS A;  2WS2 A;  1EEM A;  5JCW A;  4BVX B;  1T4Z A;  3DML A;  3ZVJ A;  3V1W A;  4WF4 A;  3W6G A;  1DSB A;  1K0O A;  2CX4 A;  1EZK A;  1A23 A;  1YKC A;  1ZYE A;  4Z7X A;  3PH9 A;  4L0U A;  5IPH A;  4OO4 A;  5AN1 A;  5LD0 A;  1PMT A;  2CVB A;  2LS5 A;  2FD3 A;  3D6I A;  4EDZ A;  3FRC A;  1GUK A;  4ILF A;  4FQU A;  5LNK e;  1OC8 A;  3HJM A;  1RW1 A;  5D93 A;  1M2A A;  2YP6 A;  1F6M C;  1JLW A;  3M1G A;  5A4V A;  1SYR A;  2H75 A;  2I3Y A;  4N0V A;  2NPB A;  3GHA A;  3C1R A;  5DJM A;  5D9X A;  1Z7R A;  4PXO A;  3G7Y A;  2LNT A;  2FWE A;  5IO2 A;  4ECB A;  3VWX A;  4PQI A;  1M9A A;  4TR1 B;  4D73 B;  5IMA A;  3K8N A;  3WGE A;  3EU3 A;  3FR9 A;  3TRX A;  3CTF A;  4F2I A;  5DAL A;  4KAE A;  4ZIL A;  4NHZ A;  2P5R A;  2VM2 A;  1FB0 A;  5CP1 A;  3UIW A;  3H8Q A;  1ZZY A;  1THX A;  3C73 A;  3H4K A;  5C04 A;  1UN2 A;  4X1U A;  4CDO A;  2CV4 A;  4ECJ A;  3DGQ A;  1LJR A;  1QXH A;  3UAP A;  5DVB A;  5JCG A;  2K8V A;  4TXO A;  1OKT A;  2R6K A;  1XOA A;  4L5O A;  5A5K A;  3DEX A;  3KZQ A;  3RBT A;  1XWB A;  3HD5 A;  2GDR A;  1CQG A;  9GSS A;  3LOR A;  2FHE A;  2X8C A;  3L78 A;  2F8F A;  2XPE A;  4KDU A;  3ZRE A;  1GSQ A;  3GTU B;  4MPF A;  1DBY A;  4MZC A;  2HI7 A;  1X9M B;  1GRX A;  2F3M A;  4MF5 A;  2VL9 A;  4FO5 A;  1PX7 A;  5A4W A;  2UZ8 A;  5ECI B;  5B7C A;  4JED A;  4OWY A;  4X0X A;  3IC4 A;  1XWA A;  5G1L A;  2IFQ A;  1A2M A;  3O6T A;  3HDC A;  4TN8 A;  2DLX A;  5AIV A;  2L6D A;  3TRQ A;  3NZN A;  3WGD A;  2DC5 A;  4BWQ A;  4HQZ A;  1C72 A;  3QD9 A;  3O3T A;  3SWL A;  2EIR A;  1QK8 A;  1R7H A;  1ERU A;  2BTO T;  2GQL A;  2AUV A;  4I5Q A;  2IMK A;  1F9M A;  3F8U A;  4O7H A;  1R4W A;  6GST A;  3NIV A;  1SJ6 A;  3ZML A;  1MD4 A;  3CBU A;  4KSO A;  1S3C A;  1ZL9 A;  4V1A g;  2E7P A;  1YKA A;  5CRH A;  5J9B A;  3N5O A;  3Q74 A;  1SK0 A;  4WR5 A;  3F6F A;  5BMU A;  2BJX A;  4XHM A;  1YQ1 A;  3FZA A;  5IMF A;  2AB6 A;  4I2T A;  5ID2 B;  1I9D A;  1ERW A;  1PQN A;  22GS A;  3HVV A;  4YH2 A;  2CAI A;  4H86 A;  3C8E A;  5AIX A;  4G0L A;  2H19 A;  1AQW A;  4N11 A;  4G9H A;  2FCH A;  2DJ0 A;  4GSS A;  4PUA A;  2B5X A;  4LA1 A;  4TR3 A;  6GSV A;  2CT6 A;  3FKF A;  1JZO A;  4ECC A;  5CYY A;  1TK0 B;  1W4V A;  3IBH A;  3VUR A;  2DJJ A;  4AF2 A;  2PUK C;  2QGV A;  2JAC A;  2LRN A;  4XTS A;  2LJR A;  2OBI A;  1TDI A;  1JFU A;  3UEM A;  1NM3 A;  1B8X A;  1K3Y A;  2L57 A;  1NHY A;  3UBL A;  4EVM A;  3GKN A;  3KP9 A;  2K8S A;  4XIH A;  4O5R A;  6GSW A;  1GSE A;  1EGO A;  1GTA A;  1TI3 A;  4FH8 A;  2XPD A;  2YNX A;  5DQY A;  1RQM A;  1XVW A;  4J57 E;  4DSS A;  2YWO A;  2MMA A;  3QMX A;  2XC2 A;  3GSS A;  3KD0 A;  2YJ7 A;  3Q19 A;  4BWS A;  3VI5 A;  2GTU A;  6GSS A;  3ED3 A;  2JZS A;  3D22 A;  1PX6 A;  4K0G A;  2I1U A;  3TUE A;  5JWO B;  2WGR A;  4NV5 A;  1THO A;  3IA1 A;  4TR4 A;  2J9H A;  5HR3 A;  3LSZ A;  2HZE B;  5KN0 A;  2DJ3 A;  3U5R E;  4IP1 A;  5F8B A;  1TW9 A;  3GL3 A;  4KUN A;  4ECI A;  3LJR A;  2B6M A;  2HRN A;  4IP6 A;  1WMJ A;  4MPG A;  1TK5 B;  1GUL A;  4IGJ A;  2MYG A;  3F3R A;  2VO4 A;  1M9B A;  1A0F A;  5J5N A;  5DAK A;  3PGT A;  3GKX A;  1M0U A;  2H0H A;  2HRK B;  3SBC A;  1SJI A;  2C0F A;  3IC8 A;  1IYH A;  4BVX A;  3LXT A;  3M0F A;  2ALB A;  1OAZ A;  2HRA A;  1VGL A;  3M3M A;  5ECM B;  4YAV A;  2B3S A;  4LMV A;  1EP8 A;  2YZH A;  2IWT A;  2YOI A;  1B48 A;  3ZRD A;  2DSA A;  3G7J A;  2AAW A;  5CNW A;  1TTZ A;  4PNF A;  1MTC A;  5DBQ A;  4NMU A;  5GZZ B;  3IXR A;  1YJ6 A;  2G0F A;  2IME A;  4XCS A;  5F05 A;  4TR1 A;  2TRC P;  5CO3 A;  3RPP A;  3CXG A;  1EOH A;  2R5G A;  2JSY A;  3O76 A;  4MF6 A;  1X5D A;  4XS1 A;  2PVO C;  4QL9 A;  1TI1 A;  3G7I A;  3VWW A;  5F0G A;  3PR8 A;  3ZLP A;  4I6X A;  3KTL A;  5FHI A;  1FW1 A;  1BED A;  2N5F A;  1YZX A;  4N10 A;  2WUL A;  3F0I A;  4FYC A;  1XFL A;  1HNA A;  4IKH A;  1DUG A;  2ON7 A;  2A4V A;  2H73 A;  4K9Z A;  3ZFL A;  2N5A A;  5D9T A;  3EC3 A;  4KB3 A;  2MBS A;  4KND A;  4L0W A;  4J2F A;  5D9V A;  3TGZ A;  4L5L A;  1XBS A;  2B7K A;  3TCO A;  5D73 A;  4HDE A;  2HSM B;  2H8L A;  2H6X A;  2MZC A;  7GSS A;  5CRD A;  1A24 A;  3RDW A;  3ERF A;  1H75 A;  4TXV A;  4IJI A;  2RLI A;  1M99 A;  4HZ4 A;  2PU9 C;  3GUR A;  1XZO A;  4E8E A;  2GSR A;  4WEY A;  1GTU A;  2FGX A;  1F37 A;  2MMZ A;  2FLS A;  2H1G A;  4GQC A;  20GS A;  4HQS A;  1ERT A;  3R3E A;  3CSJ A;  3WYW A;  2C0G A;  3UMA A;  1SL1 B;  3FZ9 A;  3LXZ A;  2VLT A;  3LEF A;  4F0C A;  2CVD A;  4MZW A;  5IIZ A;  2F9S A;  2C0E A;  2JZT A;  1PKZ A;  3FW2 A;  2LEG A;  4XRD A;  3A2X A;  1Y6E A;  2XBQ A;  1MDI A;  3BBY A;  2NBS A;  4K2D A;  4KH7 A;  2K6V A;  4ZBB A;  4IEL A;  1FVK A;  4WR4 A;  4X43 A;  3US3 A;  3F3Q A;  4HI7 A;  1Z9H A;  3IAM 2;  2J23 A;  3TKS E;  1BAY A;  4L8E A;  2PMT A;  5HR0 A;  3UJ1 A;  1V58 A;  2O85 A;  2H71 A;  2CAQ A;  3L4N A;  3R2Q A;  2DMM A;  1GSD A;  5ID2 A;  3M9K A;  1JZW A; 
#chains in the Genus database with same CATH topology
 17GS A;  4PGT A;  2R0P A;  4GSN A;  1M7T A;  5G31 A;  4N3Z A;  2VLU A;  1V9W A;  2REM A;  2VM1 A;  3GNJ A;  1VF4 A;  4QMK A;  2EIQ A;  3D21 A;  3E3E A;  3VFI A;  3UVT A;  1TP9 A;  2ON5 A;  4JE1 A;  2WJU A;  2C3T A;  2YZU A;  4CW9 A;  3RHC A;  3GUS A;  1O8W A;  2P0G A;  4KDY A;  4NXI A;  1X5C A;  3F4S A;  3IE3 A;  2IN3 A;  2LST A;  1TRV A;  2KUC A;  4K8M A;  5E4W A;  3LYP A;  2O7K A;  5JCU A;  1AQX A;  4G10 A;  2LQQ A;  5L71 A;  1NHO A;  2TRX A;  3QFA C;  2IMI A;  1K0N A;  2OAD A;  5DCH A;  1LU4 A;  3DXB A;  2EFE A;  1YEP A;  3D4M A;  4MF7 A;  3G9B A;  5KN1 A;  5J9C A;  4WBJ A;  1Z6N A;  3CTG A;  4IQ1 A;  2LRT A;  1GP1 A;  3FR3 A;  1TJD A;  3DVX A;  1DE1 A;  2GS3 A;  1R26 A;  2L5O A;  2HSN A;  4OCE A;  1KBN A;  5J4Y A;  1BYE A;  5IQY A;  3M9J A;  2R4V A;  4NV2 A;  1GNW A;  3ZIT A;  4GCI A;  4OD7 A;  2QKE A;  1SJZ A;  3FEU A;  3IHG A;  1ABA A;  2H76 A;  5EPF A;  1PRX A;  4MZB A;  2DIZ A;  4ML1 A;  3RPN A;  1B9X C;  5KOX A;  1GLP A;  3EVI A;  3BJ5 A;  4KF9 A;  3BCI A;  2WZS A;  3QDN A;  1ZCP A;  3S9F A;  3C7M A;  1X5E A;  1YF1 A;  1R5A A;  2HZE A;  5KEJ A;  4KX4 A;  2HSH A;  2I9H A;  2TIR A;  4E8H A;  2C3Q A;  2DBC A;  3FYG A;  2MBT A;  3WD6 A;  1FAA A;  1AQV A;  1U3I A;  3TKR A;  2HT9 A;  1OC9 A;  3BOA A;  2FNO A;  1SD9 A;  4NWY A;  2ZUP A;  4I2U A;  2CVK A;  2HRK A;  1EEJ A;  4IS0 A;  3E9J B;  2VCT A;  3QAG A;  5B8A A;  1WWJ A;  4HU9 A;  3C71 A;  4POL A;  1B4Q A;  1PN0 A;  1PN9 A;  3W8S A;  2GSS A;  4AI6 A;  1EV4 A;  2LV3 A;  1O8X A;  1TU7 A;  1JHB A;  4V2N A;  1WP0 A;  2O89 A;  2PN8 A;  4IVF A;  2FWF A;  2YV7 A;  4K6X A;  4BA7 A;  2XBI A;  3RGB C;  4LL1 B;  5JWQ B;  1HYU A;  4KW6 A;  3MNG A;  5F07 A;  2B1L A;  1Y25 A;  2JL4 A;  18GS A;  4Q5N A;  4ACS A;  3ME7 A;  3H93 A;  3QFB C;  5H5R A;  4EDY A;  1VF3 A;  4O92 A;  3GFK A;  1AXD A;  2RM6 A;  3NOF A;  5INY A;  1XWK A;  4PI0 C;  1ZYN A;  2L59 A;  2E0Q A;  3ZTL A;  4ZL7 A;  4K2X A;  4EXJ A;  2JAD A;  2OBK A;  2WRT A;  2YCD A;  4K7N A;  1OE8 A;  5FT3 A;  1SK2 A;  1F3A A;  3HA9 A;  2MMO A;  2HE3 A;  1PD2 1;  3TJJ A;  2OE3 A;  4ZBD A;  4AJ8 A;  3CRT A;  4G0K A;  2B5E A;  1GSF A;  4MAB A;  3H79 A;  1GL8 A;  4HJM A;  4G19 A;  1WIK A;  4TW5 A;  2YN1 A;  1PGT A;  3A2V A;  4KCA A;  1GSS A;  3WT1 A;  4TXO B;  4FIW A;  5B6M A;  3PPU A;  3F4T A;  2WW3 A;  5JWR B;  1A8L A;  5A5H A;  4RUV A;  2GLR A;  2A2R A;  3TJK A;  1O81 A;  1XOB A;  4F9Z A;  2JSZ A;  3FR6 A;  2CX3 A;  5HR1 A;  4ML6 A;  3EU4 A;  5G1K A;  4Z2U A;  2R0G A;  5B8B A;  3GST A;  3TJG A;  5E59 A;  4KCE A;  4PTS A;  1UA5 A;  2H74 A;  3QAW A;  3F9U A;  5ECO B;  4YQM A;  2VAF A;  5GST A;  2LTK A;  1G6Y A;  1WRY A;  1VF1 A;  8GSS A;  4BIK A;  5GSS A;  1Z6M A;  4YQU A;  2WCI A;  2WW2 A;  3P8W A;  2AJQ B;  5CRE A;  2L4C A;  3GIX A;  4RQR A;  5ECR B;  3IOS A;  1OE7 A;  5A34 B;  4POB A;  1YDK A;  2GST A;  4MJA A;  1TXU A;  3HJP A;  3ZIV A;  2GQK A;  2C0D A;  2HSY A;  2BMX A;  3DWV A;  2YAN A;  2E2M A;  4NPB A;  3LGC A;  4MLY A;  3IK7 A;  3ZZX A;  2L4Q A;  3HVS A;  1ZOF A;  2V2G A;  2WVX B;  2OE0 A;  1X0R A;  1SKS B;  4IN0 A;  5EL8 A;  1FOV A;  3GMF A;  1K0D A;  4RI6 A;  5EVO A;  1AC1 A;  4X4J A;  2I81 A;  1QUW A;  1YY7 A;  1ST9 A;  3GH9 A;  4GLT A;  5BMU B;  2IMD A;  2YWM A;  2VCX A;  1AAZ A;  4RI7 A;  5J40 A;  5F06 A;  2H66 A;  3OR5 A;  4BL7 B;  1EOG A;  4KA0 A;  2HNL A;  4ZL8 A;  1GSY A;  4LMW A;  1FHE A;  1GUH A;  3W8J A;  4I97 A;  4F0B A;  13GS A;  3APS A;  4XS6 A;  3EMX A;  4MNN A;  2EFC A;  4PQH A;  14GS A;  2JZR A;  4ULX A;  11GS A;  1XG8 A;  1JZD A;  1XW9 A;  2HFD A;  3FK8 A;  3GYK A;  4OO5 A;  4WF5 A;  1XIY A;  3TKS C;  1ILO A;  2DJ2 A;  3UL3 A;  4D73 A;  5DDL A;  5ELA A;  3ZL5 A;  5J4V A;  1U87 A;  2V32 A;  4MMM A;  3IV4 A;  2NDO A;  1QMV A;  2PBJ A;  4ZB6 A;  1V57 A;  4EO3 A;  1SL2 B;  3MDK A;  3M8N A;  4K5R A;  2PER A;  1R5P A;  3BD2 A;  1EP7 A;  2H1B A;  2N5B A;  3RFR C;  3CRU A;  2PGT A;  3I69 A;  2ES7 A;  1UVZ A;  3EIN A;  3EMP A;  3DD3 A;  2P31 A;  3HMJ G;  4WXT A;  1ZGN A;  1B4P A;  4MJC A;  5D8I A;  4GF0 A;  1WOU A;  2F51 A;  4LLR A;  4IJ3 A;  1J08 A;  5LCZ A;  3UAR A;  2R3X A;  5D96 A;  5ECK B;  3J7Y k;  3APQ A;  3FHK A;  1K0C A;  4TVE A;  4DSS B;  2WVY A;  5IO0 A;  4EE0 A;  2CZ3 A;  5KN2 A;  4DVC A;  1Q98 A;  4ZB8 A;  3LQ7 A;  3UOM A;  4PNG A;  4HSC X;  2VIM A;  3N9J A;  5J4U A;  1HNB A;  2H30 A;  4HU7 A;  2LRC A;  3GTU A;  2C1Y A;  4ISD A;  1XPV A;  3ZVJ D;  3KMN A;  1OKD A;  1OYJ A;  2R37 A;  3E0U A;  2LJA A;  2GZY A;  2R2J A;  4EUY A;  3QAV A;  3P90 A;  2WW0 A;  1O85 A;  1UC7 A;  1AW9 A;  1K3O A;  4AJ7 A;  3KGK A;  2LQO A;  3I9V 2;  5GAP D;  1T4Y A;  2GQM A;  4YAP A;  4IHU A;  1BJX A;  3LYK A;  5DAK B;  4QL7 A;  1M2D A;  4FYU A;  4LL4 B;  2H0I A;  5EY6 A;  2WVZ A;  3VPQ A;  4BVY B;  4NHW A;  5GAN D;  4KDX A;  3KXO A;  2C4J A;  4Q5R A;  2X8G A;  5J3R A;  5IMC A;  1BQ7 A;  4MJB A;  2H6Z A;  1GWC A;  3CSI A;  1Z5Y E;  1G7E A;  3LFL A;  3ZFB A;  2EC4 A;  5DCG A;  2YWI A;  1FB6 A;  2YJH A;  2AHE A;  1QQ2 A;  2GT6 A;  4K0N A;  1NSW A;  4HUA A;  5ABR A;  1CQH A;  2IJY A;  1HD2 A;  5G5E A;  2RM5 A;  5G30 A;  5CAX A;  2G2Q A;  4N0Z A;  4EL1 A;  1NW2 A;  2HQT A;  3GRX A;  3JCM L;  2KOK A;  1AUC A;  4MH3 A;  4F03 A;  3GX0 A;  5G2Z A;  3PIN A;  3TKS A;  4ZL9 A;  1XWG A;  2M80 A;  1S3D A;  4ZBA A;  3I43 A;  3KM6 A;  2LJK A;  2GZZ A;  3D4T A;  1XCC A;  2CQ9 A;  3TRP A;  2EIO A;  2X4A A;  2MMN A;  1PKW A;  3GL5 A;  3DYR A;  2X64 A;  1SKR B;  2VCQ A;  1F2E A;  2AYT A;  1SKW B;  1G0T A;  2VOC A;  10GS A;  2M72 A;  1KTE A;  1SU9 A;  1ZYQ B;  5DJL A;  3U6V A;  4RQX A;  3F4R A;  2CA8 A;  2VD0 A;  3MSZ A;  3VWU A;  4N30 A;  4FXY P;  1EV9 A;  1G6W A;  1FVJ A;  2H0G A;  3UVH A;  1SL0 B;  3KP8 A;  4OMV A;  2OKA A;  3ERG A;  1MEK A;  1K0M A;  4V1A p;  2VL2 C;  3IDV A;  2O5V A;  1XVQ A;  3VI7 A;  2H1A A;  2QC7 A;  4JRR A;  3CHX C;  1QFN A;  1T8E B;  4PQ1 A;  1M3J A;  4K7O A;  1GUM A;  1URM A;  3WT2 A;  1HNC A;  4PUF C;  2VCW A;  1J0F A;  5IOW A;  4V2L A;  1E6B A;  4XS4 B;  2WZ9 A;  2RUF A;  3IPZ A;  2C80 A;  2KHP A;  3ISO A;  1DE2 A;  2FUG 2;  1O7U A;  4AGS A;  3IRA A;  2CZ2 A;  3A3T A;  1H4O A;  2M46 A;  3ERW A;  5H5S A;  1USB A;  2B1K A;  3TJB A;  4K5S A;  1TXX A;  3HXS A;  1K0B A;  5ENU A;  3C1S A;  4TOP A;  5HR2 A;  3CSH A;  1MDJ A;  1EGR A;  3LG6 A;  2WDU A;  1XW6 A;  1XW5 A;  1AIU A;  5DQS A;  3WGX A;  5IPG A;  1SD8 A;  4O5Q A;  2I4A A;  2KP1 A;  4EC0 A;  4OFT A;  1A0R P;  4PUR A;  2PWJ A;  4BPY A;  2DJK A;  5ECN B;  4YQV A;  1A2L A;  3HVX A;  5ECQ B;  1T7P B;  6GSY A;  1EWX A;  4MA9 A;  5IM9 A;  16GS A;  5A34 A;  1E2Y A;  3TB2 A;  4DSQ A;  4V2M A;  1PL1 A;  3AY8 A;  5IOX A;  4QQ7 A;  5HFG A;  3KEB A;  3F63 A;  2EFH A;  3ME8 A;  4J56 E;  5C00 A;  4WET A;  4E68 A;  2H01 A;  2FA8 A;  6GSU A;  3TOT A;  3GKK A;  4HEA 2;  1MD3 A;  4Q5F A;  4MCU A;  3CWG A;  2WVX A;  4AKH A;  2H70 A;  2LKU A;  3TDG A;  4XRA A;  1TOF A;  3IR4 A;  3HZ8 A;  1TKD B;  2GGT A;  3FY7 A;  4GTU A;  2L6C A;  4EIP A;  1KEB A;  4OCF A;  2GZP A;  4KSM A;  4WKW A;  2ZCT A;  3EPT A;  4KGI A;  1Z3E A;  3GN3 A;  4NAX A;  3J7Y b;  4Q5Q A;  4BL7 A;  1ERV A;  4GST A;  2C8U A;  1FG4 A;  4G2E A;  1S4B P;  3HZ4 A;  1SYX A;  1I5G A;  4ZXG A;  5AGY A;  1O73 A;  2AV4 A;  3QOU A;  2GVP A;  2VCV A;  4OFN A;  1SK1 A;  2OJL A;  3RAZ A;  2B5Y A;  1Y1U A;  2VL3 A;  1WE0 A;  4KE3 A;  3VWV A;  2HXK A;  1SVM A;  2H72 A;  3Q6O A;  3GH6 A;  3EWL A;  3APO A;  4G0I A;  2YPM A;  1RK4 A;  4GWR A;  3P7X A;  4EF0 A;  2PPT A;  5DAL B;  1U3A A;  2P5Q A;  4P3Y B;  1M2B A;  5D9W A;  2OT3 A;  4GQF A;  19GS A;  1X9W B;  3MIX A;  1U6T A;  5ECP B;  2Z9S A;  3HHV A;  4DEJ A;  4TR0 A;  2K9F A;  2DIY A;  3L9S A;  2RUE A;  4POK A;  2VL2 A;  4TKY A;  5J41 A;  1GH2 A;  3DVW A;  2NTO A;  1GLQ A;  3HJO A;  1ZYP A;  1A2J A;  3FZ5 A;  2O87 A;  1ZMA A;  3IHQ A;  2HSN B;  5HQP A;  3CQF A;  1VRS D;  2OAC A;  2LNS A;  4WBR D;  4JU5 A;  2ZNM A;  1TK8 B;  1GTI A;  5G5F A;  3I6A A;  4K1F A;  1XXU A;  2O8V B;  1TRU A;  2L5L A;  2FY6 A;  3KJY A;  1MDK A;  2RII A;  3EUR A;  2X8H A;  1JLV A;  3EYT A;  3QPM A;  2HSM A;  2LUS A;  2VCZ A;  2HZF A;  4MH2 A;  3TKP A;  1O6J A;  3FMW A;  2V1M A;  1YEX A;  2V6O A;  1FO5 A;  3L9V A;  1U88 A;  5COH A;  2VUP A;  4AJ6 A;  3MWH A;  2FA4 A;  2K18 A;  3QCP A;  1PL2 A;  2IFQ B;  1PSQ A;  4JBB A;  2VKZ G;  1K0A A;  3ZYW A;  1YF0 A;  5A4U A;  4MJE A;  1GSU A;  3CMI A;  3VK9 A;  1HQO A;  1F3B A;  2A2P A;  3KTB A;  3TKQ A;  2FWG A;  5ECS A;  3UBK A;  2V6K A;  1WJK A;  2KLX A;  1OC9 B;  2H6Y A;  4IQA A;  2YV9 A;  3MYD A;  3RHB A;  3KMO A;  1GTB A;  4BVY A;  1X9S B;  4ID0 A;  1J9B A;  3A5W A;  5H5Q A;  6GSX A;  2IIY A;  1T3B A;  2QSI A;  1V98 A;  3KH7 A;  4ZB9 A;  4GRF A;  2WFC A;  3Q18 A;  1V40 A;  3LWA A;  2OE1 A;  4USS A;  5KOW A;  1S3A A;  1A8Y A;  1WPI A;  3HYP A;  2HLS A;  5ECL B;  3IAS 2;  3HY2 A;  4ICY A;  1B9Y C;  3TJF A;  3EE2 A;  3LW9 A;  1TU8 A;  4ZIJ A;  1T1V A;  1QGV A;  1V2A A;  3GX8 A;  3DIE A;  3BCK A;  4GXZ A;  4EKZ A;  2H1D A;  1Z7P A;  1T00 A;  2JU5 A;  5ECH B;  3VPT A;  1IYI A;  1ML6 A;  4POM A;  4MP4 A;  2GT5 A;  2HYX A;  5FWG A;  4MK3 A;  5IMV A;  2X99 A;  1FOH A;  1TRW A;  1G7O A;  1OVN A;  2HRF A;  4HZ2 A;  2V41 A;  5AIS A;  3KIJ A;  3D0Z A;  5CRG A;  3ZIJ A;  3DKS A;  2PVQ A;  3GA4 A;  4PX1 A;  3DRN A;  4FYB A;  2IMF A;  4JR4 A;  2F8A A;  1VF2 A;  2IPA A;  5IMZ A;  2OA7 A;  4TRX A;  3P2A A;  1PA3 A;  4JZQ A;  3HKR A;  1YVL A;  2DKH A;  1XWC A;  4K7I A;  4JR6 A;  2GSQ A;  2DJ1 A;  2FWH A;  3QR6 A;  5HFI A;  1KNG A;  4IBP A;  2VD1 A;  3TOU A;  2NVL A;  1GNE A;  3KH9 A;  2D2Z A;  3D5J A;  1W89 A;  2KP2 A;  3F6D A;  3FZ4 A;  2DML A;  1BG5 A;  5KN3 A;  5CRW A;  5A5H B;  1Q4J A;  4OFM A;  4O32 A;  3GKM A;  5B6N A;  1BX9 A;  4HS1 A;  3MAK A;  1TRS A;  4XS4 A;  3L9U A;  5J47 A;  2C3N A;  1OC3 A;  2E2G A;  1JZR A;  2YWN A;  1N25 A;  2IL3 A;  4F82 A;  3HCZ A;  3VLN A;  3ZMK A;  2B7J A;  4HOJ A;  5HFK A;  1LBK A;  3IK9 A;  1K3L A;  3H1N A;  4CY6 A;  4DSR A;  2A2S A;  4MDC A;  5ELG A;  1SEN A;  4HJ2 A;  4I8B A;  1BG1 A;  1N8J A;  3GV1 A;  5IMD A;  3KCM A;  1ON4 A;  3CYN A;  1ACV A;  2XHF A;  2WB9 A;  1N2A A;  2VLV A;  4CHS A;  3A2W A;  4IW9 A;  3L0H A;  12GS A;  2WS2 A;  1EEM A;  5JCW A;  4BVX B;  1T4Z A;  3DML A;  3ZVJ A;  3V1W A;  4WF4 A;  3W6G A;  1DSB A;  1K0O A;  2CX4 A;  1EZK A;  1A23 A;  2A4H A;  1YKC A;  1ZYE A;  4Z7X A;  3PH9 A;  4L0U A;  5IPH A;  4OO4 A;  5AN1 A;  5LD0 A;  1PMT A;  2CVB A;  2LS5 A;  2FD3 A;  3D6I A;  4YKF A;  4EDZ A;  3FRC A;  1GUK A;  4ILF A;  4FQU A;  5LNK e;  1OC8 A;  3HJM A;  4A5P A;  1RW1 A;  5D93 A;  2UV8 G;  1M2A A;  2YP6 A;  1F6M C;  1JLW A;  3M1G A;  5A4V A;  1SYR A;  2H75 A;  2I3Y A;  4PI2 C;  4N0V A;  2NPB A;  4Z2R A;  3GHA A;  3C1R A;  5DJM A;  5D9X A;  1Z7R A;  4CY8 A;  4PXO A;  3G7Y A;  2LNT A;  2FWE A;  5IO2 A;  4ECB A;  3VWX A;  4PQI A;  1SVO A;  1M9A A;  4TR1 B;  4D73 B;  5IMA A;  3K8N A;  4AKI A;  3WGE A;  3EU3 A;  3FR9 A;  3TRX A;  3CTF A;  4F2I A;  5DAL A;  4KAE A;  4ZIL A;  4NHZ A;  2P5R A;  2VM2 A;  1FB0 A;  5CP1 A;  3UIW A;  3H8Q A;  1ZZY A;  1THX A;  3C73 A;  3H4K A;  5C04 A;  1UN2 A;  4X1U A;  4CDO A;  2CV4 A;  4ECJ A;  3DGQ A;  1LJR A;  1QXH A;  3UAP A;  5DVB A;  5JCG A;  2K8V A;  4TXO A;  1OKT A;  2R6K A;  1XOA A;  4L5O A;  2O3E A;  5A5K A;  3DEX A;  3KZQ A;  2WW1 A;  3RBT A;  1XWB A;  3HD5 A;  2GDR A;  5A1N B;  1CQG A;  9GSS A;  3LOR A;  2FHE A;  4O5U A;  2X8C A;  3L78 A;  2F8F A;  2XPE A;  4KDU A;  3ZRE A;  1GSQ A;  3GTU B;  4MPF A;  1DBY A;  4MZC A;  2HI7 A;  1X9M B;  1GRX A;  2F3M A;  4MF5 A;  2VL9 A;  1S3R A;  3HVN A;  4FO5 A;  1PX7 A;  5A4W A;  2UZ8 A;  5ECI B;  5B7C A;  4JED A;  3A5I A;  4OWY A;  4X0X A;  3IC4 A;  1XWA A;  5G1L A;  2IFQ A;  1A2M A;  3O6T A;  5BRT A;  3HDC A;  4TN8 A;  2DLX A;  5AIV A;  2L6D A;  3TRQ A;  3NZN A;  3WGD A;  2DC5 A;  4BWQ A;  4HQZ A;  1C72 A;  3QD9 A;  3O3T A;  3SWL A;  2EIR A;  1QK8 A;  1R7H A;  1ERU A;  2BTO T;  2GQL A;  1PFO A;  2AUV A;  4EIQ A;  4I5Q A;  2IMK A;  1F9M A;  3F8U A;  4O7H A;  1R4W A;  6GST A;  3NIV A;  1SJ6 A;  3ZML A;  1MD4 A;  3CBU A;  4KSO A;  1S3C A;  1ZL9 A;  4V1A g;  2E7P A;  1YKA A;  5CRH A;  5J9B A;  3N5O A;  3Q74 A;  1SK0 A;  4WR5 A;  3F6F A;  5BMU A;  2BJX A;  4XHM A;  1YQ1 A;  3FZA A;  5IMF A;  2AB6 A;  2QA1 A;  1SVL A;  4I2T A;  5ID2 B;  1I9D A;  1ERW A;  1PQN A;  22GS A;  3HVV A;  4YH2 A;  4YKG A;  2CAI A;  4H86 A;  3C8E A;  5AIX A;  4G0L A;  2H19 A;  1AQW A;  4N11 A;  4G9H A;  2FCH A;  2DJ0 A;  4GSS A;  4PUA A;  2B5X A;  4LA1 A;  4TR3 A;  6GSV A;  2CT6 A;  3FKF A;  1JZO A;  4ECC A;  2O36 A;  5CYY A;  1TK0 B;  1W4V A;  3IBH A;  3VUR A;  2DJJ A;  4AF2 A;  2PUK C;  2QGV A;  2JAC A;  2LRN A;  4XTS A;  2LJR A;  2OBI A;  1TDI A;  1JFU A;  3UEM A;  1NM3 A;  1B8X A;  1K3Y A;  2L57 A;  1NHY A;  3UBL A;  4EVM A;  3GKN A;  3KP9 A;  2K8S A;  4XIH A;  4O5R A;  6GSW A;  1GSE A;  1EGO A;  4AKX B;  1GTA A;  1TI3 A;  4FH8 A;  2XPD A;  2YNX A;  5DQY A;  1RQM A;  1XVW A;  4J57 E;  4DSS A;  3TU3 B;  2YWO A;  2MMA A;  3QMX A;  2XC2 A;  3GSS A;  3KD0 A;  2YJ7 A;  3Q19 A;  4BWS A;  3VI5 A;  2GTU A;  6GSS A;  3ED3 A;  2JZS A;  3D22 A;  1PX6 A;  4K0G A;  2I1U A;  3TUE A;  5JWO B;  2WGR A;  4NV5 A;  1THO A;  2QA2 A;  3IA1 A;  4TR4 A;  2J9H A;  5HR3 A;  3LSZ A;  2HZE B;  5KN0 A;  2DJ3 A;  3U5R E;  4IP1 A;  5F8B A;  1TW9 A;  4PHZ C;  3GL3 A;  4KUN A;  4ECI A;  3LJR A;  2B6M A;  2HRN A;  4IP6 A;  1WMJ A;  4G01 A;  4MPG A;  1TK5 B;  1GUL A;  4IGJ A;  2MYG A;  3F3R A;  2VO4 A;  1M9B A;  1A0F A;  5J5N A;  5DAK A;  1M3I A;  3PGT A;  3GKX A;  1M0U A;  2H0H A;  2HRK B;  3SBC A;  1SJI A;  2C0F A;  3IC8 A;  1IYH A;  4BVX A;  1YEW C;  3LXT A;  3M0F A;  2ALB A;  1OAZ A;  2DKI A;  2HRA A;  1VGL A;  3M3M A;  5ECM B;  4YAV A;  2B3S A;  4LMV A;  1EP8 A;  4ZB7 A;  2YZH A;  2IWT A;  2YOI A;  1B48 A;  3ZRD A;  2DSA A;  3G7J A;  2AAW A;  5CNW A;  1TTZ A;  4PNF A;  1MTC A;  5DBQ A;  2R0C A;  4NMU A;  5GZZ B;  3IXR A;  1YJ6 A;  2G0F A;  2IME A;  4XCS A;  5F05 A;  4TR1 A;  2TRC P;  5CO3 A;  3RPP A;  3CXG A;  1EOH A;  2R5G A;  2JSY A;  3O76 A;  4MF6 A;  1X5D A;  4XS1 A;  2PVO C;  4QL9 A;  1TI1 A;  3G7I A;  3VWW A;  5F0G A;  3PR8 A;  3ZLP A;  4I6X A;  3KTL A;  5FHI A;  1FW1 A;  1BED A;  2N5F A;  1YZX A;  4N10 A;  2WUL A;  3F0I A;  4FYC A;  1XFL A;  4Z2T A;  1HNA A;  4IKH A;  1DUG A;  2ON7 A;  2A4V A;  2H73 A;  4K9Z A;  3ZFL A;  2N5A A;  5D9T A;  3EC3 A;  4KB3 A;  2MBS A;  4KND A;  4L0W A;  4J2F A;  5D9V A;  3TGZ A;  4L5L A;  1XBS A;  2B7K A;  3TCO A;  5D73 A;  4HDE A;  2HSM B;  2H8L A;  2X49 A;  5A1N A;  2H6X A;  2MZC A;  7GSS A;  5CRD A;  1A24 A;  3RDW A;  3ERF A;  1H75 A;  4TXV A;  4IJI A;  2RLI A;  1M99 A;  4HZ4 A;  2PU9 C;  3GUR A;  1XZO A;  4E8E A;  2GSR A;  4W66 A;  4WEY A;  2EFD A;  1GTU A;  2FGX A;  1F37 A;  2MMZ A;  2FLS A;  2H1G A;  4GQC A;  20GS A;  4HQS A;  1ERT A;  3R3E A;  3CSJ A;  3WYW A;  2C0G A;  3UMA A;  1SL1 B;  3FZ9 A;  3LXZ A;  2H1L A;  2VLT A;  3LEF A;  4F0C A;  1BF5 A;  2CVD A;  4MZW A;  4GDF A;  5IIZ A;  2F9S A;  2C0E A;  2JZT A;  1PKZ A;  3FW2 A;  2LEG A;  4XRD A;  4AKG A;  1Y6E A;  3A2X A;  2XBQ A;  1MDI A;  3BBY A;  2NBS A;  4K2D A;  4KH7 A;  2K6V A;  4ZBB A;  4IEL A;  1FVK A;  1I1I P;  4WR4 A;  4X43 A;  3US3 A;  3F3Q A;  4HI7 A;  1Z9H A;  3IAM 2;  2J23 A;  3TKS E;  1BAY A;  4L8E A;  2PMT A;  5HR0 A;  3UJ1 A;  1V58 A;  2O85 A;  2H71 A;  2CAQ A;  3L4N A;  3R2Q A;  2DMM A;  1GSD A;  5ID2 A;  3M9K A;  1JZW A; 
#chains in the Genus database with same CATH homology
 17GS A;  4PGT A;  2R0P A;  4GSN A;  1M7T A;  5G31 A;  4N3Z A;  2VLU A;  1V9W A;  2REM A;  2VM1 A;  3GNJ A;  1VF4 A;  4QMK A;  2EIQ A;  3D21 A;  3E3E A;  3VFI A;  3UVT A;  1TP9 A;  2ON5 A;  4JE1 A;  2WJU A;  2C3T A;  2YZU A;  4CW9 A;  3RHC A;  3GUS A;  1O8W A;  2P0G A;  4KDY A;  4NXI A;  1X5C A;  3F4S A;  3IE3 A;  2IN3 A;  2LST A;  1TRV A;  2KUC A;  4K8M A;  5E4W A;  3LYP A;  2O7K A;  5JCU A;  1AQX A;  4G10 A;  2LQQ A;  5L71 A;  1NHO A;  2TRX A;  3QFA C;  2IMI A;  1K0N A;  2OAD A;  5DCH A;  1LU4 A;  3DXB A;  2EFE A;  1YEP A;  3D4M A;  4MF7 A;  3G9B A;  5KN1 A;  5J9C A;  4WBJ A;  1Z6N A;  3CTG A;  4IQ1 A;  2LRT A;  1GP1 A;  3FR3 A;  1TJD A;  3DVX A;  1DE1 A;  2GS3 A;  1R26 A;  2L5O A;  2HSN A;  4OCE A;  1KBN A;  5J4Y A;  1BYE A;  5IQY A;  3M9J A;  2R4V A;  4NV2 A;  1GNW A;  3ZIT A;  4GCI A;  4OD7 A;  2QKE A;  1SJZ A;  3FEU A;  3IHG A;  1ABA A;  2H76 A;  5EPF A;  1PRX A;  4MZB A;  2DIZ A;  4ML1 A;  3RPN A;  1B9X C;  5KOX A;  1GLP A;  3EVI A;  3BJ5 A;  4KF9 A;  3BCI A;  3QDN A;  1ZCP A;  3S9F A;  3C7M A;  1X5E A;  1YF1 A;  1R5A A;  2HZE A;  5KEJ A;  4KX4 A;  2HSH A;  2I9H A;  2TIR A;  4E8H A;  2C3Q A;  2DBC A;  3FYG A;  2MBT A;  3WD6 A;  1FAA A;  1AQV A;  1U3I A;  3TKR A;  2HT9 A;  1OC9 A;  3BOA A;  2FNO A;  1SD9 A;  4NWY A;  2ZUP A;  4I2U A;  2CVK A;  2HRK A;  1EEJ A;  4IS0 A;  3E9J B;  2VCT A;  3QAG A;  5B8A A;  1WWJ A;  4HU9 A;  3C71 A;  4POL A;  1B4Q A;  1PN0 A;  1PN9 A;  3W8S A;  2GSS A;  4AI6 A;  1EV4 A;  2LV3 A;  1O8X A;  1TU7 A;  1JHB A;  4V2N A;  1WP0 A;  2O89 A;  2PN8 A;  4IVF A;  2FWF A;  2YV7 A;  4K6X A;  4BA7 A;  2XBI A;  4LL1 B;  5JWQ B;  1HYU A;  4KW6 A;  3MNG A;  5F07 A;  2B1L A;  1Y25 A;  2JL4 A;  18GS A;  4Q5N A;  4ACS A;  3ME7 A;  3H93 A;  3QFB C;  5H5R A;  4EDY A;  1VF3 A;  4O92 A;  3GFK A;  1AXD A;  2RM6 A;  3NOF A;  5INY A;  1XWK A;  1ZYN A;  2L59 A;  2E0Q A;  3ZTL A;  4ZL7 A;  4K2X A;  4EXJ A;  2JAD A;  2OBK A;  2WRT A;  2YCD A;  4K7N A;  1OE8 A;  5FT3 A;  1SK2 A;  1F3A A;  3HA9 A;  2MMO A;  2HE3 A;  1PD2 1;  3TJJ A;  2OE3 A;  4ZBD A;  4AJ8 A;  3CRT A;  4G0K A;  2B5E A;  1GSF A;  4MAB A;  3H79 A;  1GL8 A;  4HJM A;  4G19 A;  1WIK A;  4TW5 A;  2YN1 A;  1PGT A;  3A2V A;  4KCA A;  1GSS A;  3WT1 A;  4TXO B;  4FIW A;  5B6M A;  3PPU A;  3F4T A;  5JWR B;  1A8L A;  5A5H A;  4RUV A;  2GLR A;  2A2R A;  3TJK A;  1O81 A;  1XOB A;  4F9Z A;  2JSZ A;  3FR6 A;  2CX3 A;  5HR1 A;  4ML6 A;  3EU4 A;  5G1K A;  4Z2U A;  2R0G A;  5B8B A;  3GST A;  3TJG A;  5E59 A;  4KCE A;  4PTS A;  1UA5 A;  2H74 A;  3QAW A;  3F9U A;  5ECO B;  4YQM A;  2VAF A;  5GST A;  2LTK A;  1G6Y A;  1WRY A;  1VF1 A;  8GSS A;  5GSS A;  1Z6M A;  4YQU A;  2WCI A;  3P8W A;  2AJQ B;  5CRE A;  2L4C A;  3GIX A;  4RQR A;  5ECR B;  3IOS A;  1OE7 A;  5A34 B;  4POB A;  1YDK A;  2GST A;  4MJA A;  1TXU A;  3HJP A;  3ZIV A;  2GQK A;  2C0D A;  2HSY A;  2BMX A;  3DWV A;  2YAN A;  2E2M A;  4NPB A;  3LGC A;  4MLY A;  3IK7 A;  3ZZX A;  2L4Q A;  3HVS A;  1ZOF A;  2V2G A;  2OE0 A;  1X0R A;  1SKS B;  4IN0 A;  5EL8 A;  1FOV A;  3GMF A;  1K0D A;  4RI6 A;  5EVO A;  1AC1 A;  4X4J A;  2I81 A;  1QUW A;  1YY7 A;  1ST9 A;  3GH9 A;  4GLT A;  5BMU B;  2IMD A;  2YWM A;  2VCX A;  1AAZ A;  4RI7 A;  5J40 A;  5F06 A;  2H66 A;  3OR5 A;  4BL7 B;  1EOG A;  4KA0 A;  2HNL A;  4ZL8 A;  1GSY A;  4LMW A;  1FHE A;  1GUH A;  3W8J A;  4I97 A;  4F0B A;  13GS A;  3APS A;  4XS6 A;  3EMX A;  4MNN A;  2EFC A;  4PQH A;  14GS A;  2JZR A;  4ULX A;  11GS A;  1JZD A;  1XW9 A;  2HFD A;  3FK8 A;  3GYK A;  4OO5 A;  4WF5 A;  1XIY A;  3TKS C;  1ILO A;  2DJ2 A;  3UL3 A;  4D73 A;  5DDL A;  5ELA A;  3ZL5 A;  5J4V A;  1U87 A;  2V32 A;  4MMM A;  3IV4 A;  2NDO A;  1QMV A;  2PBJ A;  4ZB6 A;  1V57 A;  4EO3 A;  1SL2 B;  3MDK A;  3M8N A;  4K5R A;  2PER A;  1R5P A;  3BD2 A;  1EP7 A;  2H1B A;  2N5B A;  3CRU A;  2PGT A;  3I69 A;  2ES7 A;  1UVZ A;  3EIN A;  3EMP A;  3DD3 A;  2P31 A;  3HMJ G;  4WXT A;  1ZGN A;  1B4P A;  4MJC A;  5D8I A;  4GF0 A;  1WOU A;  2F51 A;  4LLR A;  4IJ3 A;  1J08 A;  5LCZ A;  3UAR A;  2R3X A;  5D96 A;  5ECK B;  3J7Y k;  3APQ A;  3FHK A;  1K0C A;  4TVE A;  4DSS B;  5IO0 A;  4EE0 A;  2CZ3 A;  5KN2 A;  4DVC A;  1Q98 A;  4ZB8 A;  3LQ7 A;  3UOM A;  4PNG A;  2VIM A;  3N9J A;  5J4U A;  1HNB A;  2H30 A;  4HU7 A;  2LRC A;  3GTU A;  2C1Y A;  4ISD A;  1XPV A;  3ZVJ D;  3KMN A;  1OKD A;  1OYJ A;  2R37 A;  3E0U A;  2LJA A;  2GZY A;  2R2J A;  4EUY A;  3QAV A;  3P90 A;  1O85 A;  1UC7 A;  1AW9 A;  1K3O A;  4AJ7 A;  3KGK A;  2LQO A;  3I9V 2;  5GAP D;  1T4Y A;  2GQM A;  4YAP A;  4IHU A;  1BJX A;  3LYK A;  5DAK B;  4QL7 A;  1M2D A;  4FYU A;  4LL4 B;  2H0I A;  5EY6 A;  3VPQ A;  4BVY B;  4NHW A;  5GAN D;  4KDX A;  3KXO A;  2C4J A;  4Q5R A;  2X8G A;  5J3R A;  5IMC A;  1BQ7 A;  4MJB A;  2H6Z A;  1GWC A;  3CSI A;  1Z5Y E;  1G7E A;  3LFL A;  3ZFB A;  2EC4 A;  5DCG A;  2YWI A;  1FB6 A;  2YJH A;  2AHE A;  1QQ2 A;  2GT6 A;  4K0N A;  1NSW A;  4HUA A;  5ABR A;  1CQH A;  2IJY A;  1HD2 A;  5G5E A;  2RM5 A;  5G30 A;  5CAX A;  2G2Q A;  4N0Z A;  4EL1 A;  1NW2 A;  2HQT A;  3GRX A;  3JCM L;  2KOK A;  1AUC A;  4MH3 A;  4F03 A;  3GX0 A;  5G2Z A;  3PIN A;  3TKS A;  4ZL9 A;  1XWG A;  2M80 A;  1S3D A;  4ZBA A;  3I43 A;  3KM6 A;  2LJK A;  2GZZ A;  3D4T A;  1XCC A;  2CQ9 A;  3TRP A;  2EIO A;  2X4A A;  2MMN A;  1PKW A;  3GL5 A;  3DYR A;  2X64 A;  1SKR B;  2VCQ A;  1F2E A;  2AYT A;  1SKW B;  1G0T A;  2VOC A;  10GS A;  2M72 A;  1KTE A;  1SU9 A;  1ZYQ B;  5DJL A;  3U6V A;  4RQX A;  3F4R A;  2CA8 A;  2VD0 A;  3MSZ A;  3VWU A;  4N30 A;  1EV9 A;  1G6W A;  1FVJ A;  2H0G A;  3UVH A;  1SL0 B;  3KP8 A;  4OMV A;  2OKA A;  3ERG A;  1MEK A;  1K0M A;  4V1A p;  2VL2 C;  3IDV A;  2O5V A;  1XVQ A;  3VI7 A;  2H1A A;  2QC7 A;  4JRR A;  1QFN A;  1T8E B;  4PQ1 A;  4K7O A;  1GUM A;  1URM A;  3WT2 A;  1HNC A;  4PUF C;  2VCW A;  1J0F A;  5IOW A;  4V2L A;  1E6B A;  4XS4 B;  2WZ9 A;  2RUF A;  3IPZ A;  2C80 A;  2KHP A;  3ISO A;  1DE2 A;  2FUG 2;  1O7U A;  4AGS A;  3IRA A;  2CZ2 A;  3A3T A;  1H4O A;  2M46 A;  3ERW A;  5H5S A;  1USB A;  2B1K A;  3TJB A;  4K5S A;  1TXX A;  3HXS A;  1K0B A;  5ENU A;  3C1S A;  4TOP A;  5HR2 A;  3CSH A;  1MDJ A;  1EGR A;  3LG6 A;  2WDU A;  1XW6 A;  1XW5 A;  1AIU A;  5DQS A;  3WGX A;  5IPG A;  1SD8 A;  4O5Q A;  2I4A A;  2KP1 A;  4EC0 A;  4OFT A;  1A0R P;  4PUR A;  2PWJ A;  4BPY A;  2DJK A;  5ECN B;  4YQV A;  1A2L A;  3HVX A;  5ECQ B;  1T7P B;  6GSY A;  1EWX A;  4MA9 A;  5IM9 A;  16GS A;  5A34 A;  1E2Y A;  3TB2 A;  4DSQ A;  4V2M A;  1PL1 A;  3AY8 A;  5IOX A;  4QQ7 A;  5HFG A;  3KEB A;  3F63 A;  2EFH A;  3ME8 A;  4J56 E;  5C00 A;  4WET A;  4E68 A;  2H01 A;  2FA8 A;  6GSU A;  3TOT A;  3GKK A;  4HEA 2;  1MD3 A;  4Q5F A;  4MCU A;  3CWG A;  4AKH A;  2H70 A;  2LKU A;  3TDG A;  4XRA A;  1TOF A;  3IR4 A;  3HZ8 A;  1TKD B;  2GGT A;  3FY7 A;  4GTU A;  2L6C A;  4EIP A;  1KEB A;  4OCF A;  2GZP A;  4KSM A;  4WKW A;  2ZCT A;  3EPT A;  4KGI A;  1Z3E A;  3GN3 A;  4NAX A;  3J7Y b;  4Q5Q A;  4BL7 A;  1ERV A;  4GST A;  2C8U A;  1FG4 A;  4G2E A;  3HZ4 A;  1SYX A;  1I5G A;  4ZXG A;  5AGY A;  1O73 A;  2AV4 A;  3QOU A;  2GVP A;  2VCV A;  4OFN A;  1SK1 A;  2OJL A;  3RAZ A;  2B5Y A;  1Y1U A;  2VL3 A;  1WE0 A;  4KE3 A;  3VWV A;  2HXK A;  1SVM A;  2H72 A;  3Q6O A;  3GH6 A;  3EWL A;  3APO A;  4G0I A;  2YPM A;  1RK4 A;  4GWR A;  3P7X A;  4EF0 A;  2PPT A;  5DAL B;  1U3A A;  2P5Q A;  4P3Y B;  1M2B A;  5D9W A;  2OT3 A;  4GQF A;  19GS A;  1X9W B;  3MIX A;  1U6T A;  5ECP B;  2Z9S A;  3HHV A;  4DEJ A;  4TR0 A;  2K9F A;  2DIY A;  3L9S A;  2RUE A;  4POK A;  2VL2 A;  4TKY A;  5J41 A;  1GH2 A;  3DVW A;  2NTO A;  1GLQ A;  3HJO A;  1ZYP A;  1A2J A;  3FZ5 A;  2O87 A;  1ZMA A;  3IHQ A;  2HSN B;  5HQP A;  1VRS D;  2OAC A;  2LNS A;  4WBR D;  4JU5 A;  2ZNM A;  1TK8 B;  1GTI A;  5G5F A;  3I6A A;  4K1F A;  1XXU A;  2O8V B;  1TRU A;  2L5L A;  2FY6 A;  3KJY A;  1MDK A;  2RII A;  3EUR A;  2X8H A;  1JLV A;  3EYT A;  3QPM A;  2HSM A;  2LUS A;  2VCZ A;  2HZF A;  4MH2 A;  3TKP A;  1O6J A;  3FMW A;  2V1M A;  1YEX A;  2V6O A;  1FO5 A;  3L9V A;  1U88 A;  5COH A;  2VUP A;  4AJ6 A;  3MWH A;  2FA4 A;  2K18 A;  3QCP A;  1PL2 A;  2IFQ B;  1PSQ A;  4JBB A;  2VKZ G;  1K0A A;  3ZYW A;  1YF0 A;  5A4U A;  4MJE A;  1GSU A;  3CMI A;  3VK9 A;  1HQO A;  1F3B A;  2A2P A;  3KTB A;  3TKQ A;  2FWG A;  5ECS A;  3UBK A;  2V6K A;  1WJK A;  2KLX A;  1OC9 B;  2H6Y A;  4IQA A;  2YV9 A;  3MYD A;  3RHB A;  3KMO A;  1GTB A;  4BVY A;  1X9S B;  4ID0 A;  1J9B A;  3A5W A;  5H5Q A;  6GSX A;  2IIY A;  1T3B A;  2QSI A;  1V98 A;  3KH7 A;  4ZB9 A;  4GRF A;  2WFC A;  3Q18 A;  1V40 A;  3LWA A;  2OE1 A;  4USS A;  5KOW A;  1S3A A;  1A8Y A;  1WPI A;  3HYP A;  2HLS A;  5ECL B;  3IAS 2;  3HY2 A;  4ICY A;  1B9Y C;  3TJF A;  3EE2 A;  3LW9 A;  1TU8 A;  4ZIJ A;  1T1V A;  1QGV A;  1V2A A;  3GX8 A;  3DIE A;  3BCK A;  4GXZ A;  4EKZ A;  2H1D A;  1Z7P A;  1T00 A;  2JU5 A;  5ECH B;  3VPT A;  1IYI A;  1ML6 A;  4POM A;  4MP4 A;  2GT5 A;  2HYX A;  5FWG A;  4MK3 A;  5IMV A;  2X99 A;  1FOH A;  1TRW A;  1G7O A;  1OVN A;  2HRF A;  4HZ2 A;  2V41 A;  5AIS A;  3KIJ A;  3D0Z A;  5CRG A;  3ZIJ A;  3DKS A;  2PVQ A;  3GA4 A;  4PX1 A;  3DRN A;  4FYB A;  2IMF A;  4JR4 A;  2F8A A;  1VF2 A;  2IPA A;  5IMZ A;  2OA7 A;  4TRX A;  3P2A A;  1PA3 A;  4JZQ A;  3HKR A;  1YVL A;  2DKH A;  1XWC A;  4K7I A;  4JR6 A;  2GSQ A;  2DJ1 A;  2FWH A;  3QR6 A;  5HFI A;  1KNG A;  4IBP A;  2VD1 A;  3TOU A;  2NVL A;  1GNE A;  3KH9 A;  2D2Z A;  3D5J A;  1W89 A;  2KP2 A;  3F6D A;  3FZ4 A;  2DML A;  1BG5 A;  5KN3 A;  5CRW A;  5A5H B;  1Q4J A;  4OFM A;  4O32 A;  3GKM A;  5B6N A;  1BX9 A;  4HS1 A;  3MAK A;  1TRS A;  4XS4 A;  3L9U A;  5J47 A;  2C3N A;  1OC3 A;  2E2G A;  1JZR A;  2YWN A;  1N25 A;  2IL3 A;  4F82 A;  3HCZ A;  3VLN A;  3ZMK A;  2B7J A;  4HOJ A;  5HFK A;  1LBK A;  3IK9 A;  1K3L A;  3H1N A;  4CY6 A;  4DSR A;  2A2S A;  4MDC A;  5ELG A;  1SEN A;  4HJ2 A;  4I8B A;  1BG1 A;  1N8J A;  3GV1 A;  5IMD A;  3KCM A;  1ON4 A;  3CYN A;  1ACV A;  2XHF A;  2WB9 A;  1N2A A;  2VLV A;  4CHS A;  3A2W A;  4IW9 A;  3L0H A;  12GS A;  2WS2 A;  1EEM A;  5JCW A;  4BVX B;  1T4Z A;  3DML A;  3ZVJ A;  3V1W A;  4WF4 A;  3W6G A;  1DSB A;  1K0O A;  2CX4 A;  1EZK A;  1A23 A;  2A4H A;  1YKC A;  1ZYE A;  4Z7X A;  3PH9 A;  4L0U A;  5IPH A;  4OO4 A;  5AN1 A;  5LD0 A;  1PMT A;  2CVB A;  2LS5 A;  2FD3 A;  3D6I A;  4YKF A;  4EDZ A;  3FRC A;  1GUK A;  4ILF A;  4FQU A;  5LNK e;  1OC8 A;  3HJM A;  4A5P A;  1RW1 A;  5D93 A;  2UV8 G;  1M2A A;  2YP6 A;  1F6M C;  1JLW A;  3M1G A;  5A4V A;  1SYR A;  2H75 A;  2I3Y A;  4N0V A;  2NPB A;  4Z2R A;  3GHA A;  3C1R A;  5DJM A;  5D9X A;  1Z7R A;  4CY8 A;  4PXO A;  3G7Y A;  2LNT A;  2FWE A;  5IO2 A;  4ECB A;  3VWX A;  4PQI A;  1SVO A;  1M9A A;  4TR1 B;  4D73 B;  5IMA A;  3K8N A;  4AKI A;  3WGE A;  3EU3 A;  3FR9 A;  3TRX A;  3CTF A;  4F2I A;  5DAL A;  4KAE A;  4ZIL A;  4NHZ A;  2P5R A;  2VM2 A;  1FB0 A;  5CP1 A;  3UIW A;  3H8Q A;  1ZZY A;  1THX A;  3C73 A;  3H4K A;  5C04 A;  1UN2 A;  4X1U A;  4CDO A;  2CV4 A;  4ECJ A;  3DGQ A;  1LJR A;  1QXH A;  3UAP A;  5DVB A;  5JCG A;  2K8V A;  4TXO A;  1OKT A;  2R6K A;  1XOA A;  4L5O A;  5A5K A;  3DEX A;  3KZQ A;  3RBT A;  1XWB A;  3HD5 A;  2GDR A;  5A1N B;  1CQG A;  9GSS A;  3LOR A;  2FHE A;  4O5U A;  2X8C A;  3L78 A;  2F8F A;  2XPE A;  4KDU A;  3ZRE A;  1GSQ A;  3GTU B;  4MPF A;  1DBY A;  4MZC A;  2HI7 A;  1X9M B;  1GRX A;  2F3M A;  4MF5 A;  2VL9 A;  4FO5 A;  1PX7 A;  5A4W A;  2UZ8 A;  5ECI B;  5B7C A;  4JED A;  3A5I A;  4OWY A;  4X0X A;  3IC4 A;  1XWA A;  5G1L A;  2IFQ A;  1A2M A;  3O6T A;  5BRT A;  3HDC A;  4TN8 A;  2DLX A;  5AIV A;  2L6D A;  3TRQ A;  3NZN A;  3WGD A;  2DC5 A;  4BWQ A;  4HQZ A;  1C72 A;  3QD9 A;  3O3T A;  3SWL A;  2EIR A;  1QK8 A;  1R7H A;  1ERU A;  2BTO T;  2GQL A;  2AUV A;  4EIQ A;  4I5Q A;  2IMK A;  1F9M A;  3F8U A;  4O7H A;  1R4W A;  6GST A;  3NIV A;  1SJ6 A;  3ZML A;  1MD4 A;  3CBU A;  4KSO A;  1S3C A;  1ZL9 A;  4V1A g;  2E7P A;  1YKA A;  5CRH A;  5J9B A;  3N5O A;  3Q74 A;  1SK0 A;  4WR5 A;  3F6F A;  5BMU A;  2BJX A;  4XHM A;  1YQ1 A;  3FZA A;  5IMF A;  2AB6 A;  2QA1 A;  1SVL A;  4I2T A;  5ID2 B;  1I9D A;  1ERW A;  1PQN A;  22GS A;  3HVV A;  4YH2 A;  4YKG A;  2CAI A;  4H86 A;  3C8E A;  5AIX A;  4G0L A;  2H19 A;  1AQW A;  4N11 A;  4G9H A;  2FCH A;  2DJ0 A;  4GSS A;  4PUA A;  2B5X A;  4LA1 A;  4TR3 A;  6GSV A;  2CT6 A;  3FKF A;  1JZO A;  4ECC A;  5CYY A;  1TK0 B;  1W4V A;  3IBH A;  3VUR A;  2DJJ A;  4AF2 A;  2PUK C;  2QGV A;  2JAC A;  2LRN A;  4XTS A;  2LJR A;  2OBI A;  1TDI A;  1JFU A;  3UEM A;  1NM3 A;  1B8X A;  1K3Y A;  2L57 A;  1NHY A;  3UBL A;  4EVM A;  3GKN A;  3KP9 A;  2K8S A;  4XIH A;  4O5R A;  6GSW A;  1GSE A;  1EGO A;  4AKX B;  1GTA A;  1TI3 A;  4FH8 A;  2XPD A;  2YNX A;  5DQY A;  1RQM A;  1XVW A;  4J57 E;  4DSS A;  3TU3 B;  2YWO A;  2MMA A;  3QMX A;  2XC2 A;  3GSS A;  3KD0 A;  2YJ7 A;  3Q19 A;  4BWS A;  3VI5 A;  2GTU A;  6GSS A;  3ED3 A;  2JZS A;  3D22 A;  1PX6 A;  4K0G A;  2I1U A;  3TUE A;  5JWO B;  2WGR A;  4NV5 A;  1THO A;  2QA2 A;  3IA1 A;  4TR4 A;  2J9H A;  5HR3 A;  3LSZ A;  2HZE B;  5KN0 A;  2DJ3 A;  3U5R E;  4IP1 A;  5F8B A;  1TW9 A;  3GL3 A;  4KUN A;  4ECI A;  3LJR A;  2B6M A;  2HRN A;  4IP6 A;  1WMJ A;  4G01 A;  4MPG A;  1TK5 B;  1GUL A;  4IGJ A;  2MYG A;  3F3R A;  2VO4 A;  1M9B A;  1A0F A;  5J5N A;  5DAK A;  3PGT A;  3GKX A;  1M0U A;  2H0H A;  2HRK B;  3SBC A;  1SJI A;  2C0F A;  3IC8 A;  1IYH A;  4BVX A;  3LXT A;  3M0F A;  2ALB A;  1OAZ A;  2DKI A;  2HRA A;  1VGL A;  3M3M A;  5ECM B;  4YAV A;  2B3S A;  4LMV A;  1EP8 A;  4ZB7 A;  2YZH A;  2IWT A;  2YOI A;  1B48 A;  3ZRD A;  2DSA A;  3G7J A;  2AAW A;  5CNW A;  1TTZ A;  4PNF A;  1MTC A;  5DBQ A;  2R0C A;  4NMU A;  5GZZ B;  3IXR A;  1YJ6 A;  2G0F A;  2IME A;  4XCS A;  5F05 A;  4TR1 A;  2TRC P;  5CO3 A;  3RPP A;  3CXG A;  1EOH A;  2R5G A;  2JSY A;  3O76 A;  4MF6 A;  1X5D A;  4XS1 A;  2PVO C;  4QL9 A;  1TI1 A;  3G7I A;  3VWW A;  5F0G A;  3PR8 A;  3ZLP A;  4I6X A;  3KTL A;  5FHI A;  1FW1 A;  1BED A;  2N5F A;  1YZX A;  4N10 A;  2WUL A;  3F0I A;  4FYC A;  1XFL A;  4Z2T A;  1HNA A;  4IKH A;  1DUG A;  2ON7 A;  2A4V A;  2H73 A;  4K9Z A;  3ZFL A;  2N5A A;  5D9T A;  3EC3 A;  4KB3 A;  2MBS A;  4KND A;  4L0W A;  4J2F A;  5D9V A;  3TGZ A;  4L5L A;  1XBS A;  2B7K A;  3TCO A;  5D73 A;  4HDE A;  2HSM B;  2H8L A;  2X49 A;  5A1N A;  2H6X A;  2MZC A;  7GSS A;  5CRD A;  1A24 A;  3RDW A;  3ERF A;  1H75 A;  4TXV A;  4IJI A;  2RLI A;  1M99 A;  4HZ4 A;  2PU9 C;  3GUR A;  1XZO A;  4E8E A;  2GSR A;  4W66 A;  4WEY A;  2EFD A;  1GTU A;  2FGX A;  1F37 A;  2MMZ A;  2FLS A;  2H1G A;  4GQC A;  20GS A;  4HQS A;  1ERT A;  3R3E A;  3CSJ A;  3WYW A;  2C0G A;  3UMA A;  1SL1 B;  3FZ9 A;  3LXZ A;  2H1L A;  2VLT A;  3LEF A;  4F0C A;  1BF5 A;  2CVD A;  4MZW A;  4GDF A;  5IIZ A;  2F9S A;  2C0E A;  2JZT A;  1PKZ A;  3FW2 A;  2LEG A;  4XRD A;  4AKG A;  1Y6E A;  3A2X A;  2XBQ A;  1MDI A;  3BBY A;  2NBS A;  4K2D A;  4KH7 A;  2K6V A;  4ZBB A;  4IEL A;  1FVK A;  4WR4 A;  4X43 A;  3US3 A;  3F3Q A;  4HI7 A;  1Z9H A;  3IAM 2;  2J23 A;  3TKS E;  1BAY A;  4L8E A;  2PMT A;  5HR0 A;  3UJ1 A;  1V58 A;  2O85 A;  2H71 A;  2CAQ A;  3L4N A;  3R2Q A;  2DMM A;  1GSD A;  5ID2 A;  3M9K A;  1JZW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...