3GT0A

Crystal structure of pyrroline 5-carboxylate reductase from bacillus cereus. northeast structural genomics consortium target bcr38b
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
220
structure length
217
Chain Sequence
MDKQIGFIGCGNMGMAMIGGMINKNIVSSNQIICSDLNTANLKNASEKYGLTTTTDNNEVAKNADILILSIKPDLYASIIKEIIKNDAIIVTIAAGKSIESTENAFNKKVKVVRVMPNTPALVGEGMSALCPNEMVTEKDLEDVLNIFNSFGQTEIVSEKLMDVVTSVSGSSPAYVYMIIEAMADAAVLDGMPRNQAYKFAAQAVLGSAKMVLETGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Northeast Structural Genomics Consortium Target BcR38B
rcsb
source organism Bacillus cereus atcc 14579
molecule tags Oxidoreductase
molecule keywords Pyrroline-5-carboxylate reductase
total genus 62
structure length 217
sequence length 220
ec nomenclature ec 1.5.1.2: Pyrroline-5-carboxylate reductase.
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3730.10 Mainly Alpha Orthogonal Bundle ProC C-terminal domain-like fold ProC C-terminal domain-like 3gt0A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3gt0A01
1Y8QA 3TZKA 1YL5A 3OM9A 9LDBA 4RO0A 5CEEA 3EW7A 5IF3A 4OL9A 3OJLA 3Q0EA 2VWQA 4QXMA 4Y6SA 3FTNA 3ZDFA 4B8WA 1SOWA 4DA9A 3GEMA 3ST7A 3ZW9A 4OGWA 1DSSG 4EEZA 3PPIA 1E5QA 1YBMA 2UUOA 2AQKA 2PWZA 2A4KA 4UUMA 4PG6A 1MG5A 3L6EA 1Z74A 1AXGA 4BS9A 5B12A 2AA3A 1BW9B 3H9QA 4RCVA 3Q2KA 1I3MA 3NEPX 1O5IA 1P1JA 1WLYA 1IZ0A 2JHGA 3OJEA 1R12A 3ZNNA 1CEQA 4CM8B 4EEXA 5KCZA 1VJTA 5AQ1A 4FJ1A 3K2BA 4GX1A 4WCFC 2B5WA 3ETGA 4XYGA 1PTJA 3DBHA 1ZIDA 1CQJA 4HXYA 3K92A 3TPCA 5L4NA 4NNJA 1YH3A 4M1QA 2CDBA 3HADA 3WMXA 2JFGA 4WCFA 2ZTMA 5A1TA 4PZEA 1JWAB 3EZYA 1NWCA 2DTXA 3QY9A 3NT2A 4ND3A 4BNKA 2X0RA 1CDOA 3RKUA 3DZBA 3EVTA 2CSUA 4IS3A 1A4UA 4WLUA 4NU6A 3E8XA 3GNSA 3ONFA 3PQEA 1ZK2A 5U4QA 1YL7A 2CUKA 4XCVA 1GZ3A 5U9CA 1WDLA 4JN6B 1U4OA 2O4CA 5IXSA 2DUUA 4L73A 2NQ8A 4XRGA 4BKQA 3HFGA 3HFSA 5EMHA 3RBXA 3OSUA 1XEAA 4QFDA 3TN7A 2A92A 2C2XA 3C8MA 1XHLA 1CRWG 2EP7A 1Q7GA 4JX8A 3TJRA 2DQ4A 3TZ6A 3U4HA 3ZWMA 5A02A 4IPTA 2XPCA 5JO0A 4Q3EA 5ENDA 3U0BA 1F8FA 3MJCA 3WWZA 1ZSYA 4WEQA 4CMHA 3LC2O 2V6FA 1K5HA 4IDDA 2JAPA 4XB2A 3PHHA 4NPCA 5B4VA 1D3AA 3L6DA 1GPDG 3IAHA 3OJ0A 4NJOA 5C5IA 1LLUA 1ENYA 1HYHA 4BO7A 4ND2A 1ZVMA 4Z3DA 4CLRB 3WWYA 4IMRA 3CZRA 5KNLA 3VH1A 2VT2A 3IL2A 4BO9A 2OOSA 3OQ1A 1U3WA 3BMQA 2QG4A 4GBJA 4I8XA 3VH3A 4FCCA 1XKQA 3AJRA 1LUAA 4J90A 4MDHA 1E7QA 2BGMA 2POQX 1P33A 5TIIA 2UYYA 2QHXA 3Q6IA 3KYDA 4DQXA 4E33A 1HSZA 3HDHA 4IDAA 1NQOA 4J49A 4CV0A 4AJNA 2Y1DA 3SVTA 1YKFA 1R0LA 3ZWOA 8LDHA 4QFCA 4B79A 3A28A 3EUWA 3GRPA 4ALNA 5JS6A 3V2HA 2QRLA 3ASVA 1NASA 1JLLA 4AJJA 2GUGA 3DHYA 3ZWWA 1VI2A 2WYUA 3TFQA 1LLDA 2X5JO 2GN6A 4ZD6A 4MOWA 4E32A 5JSFA 2X7HA 3DZJA 3AOGA 2VTEA 1P1IA 4BO5A 1DJNA 1XA0A 1Z7BA 2DUWA 2BLLA 3RAJA 3ZU5A 5KTKA 2EP5A 1LC3A 3E9NA 2TMGA 3OIDA 3JYLA 2QYSA 5JMPA 4HADA 3PDJA 2O3UA 1E0DA 2IEBA 4OJNA 4PFJA 3INGA 5BT9A 4CLEA 5K0ZA 3ZN2A 4ND1A 4Q3CA 5F1PA 4AJIA 1QYVA 4K28A 3SLKA 4DC0A 5KJFA 3O8QB 3ENKA 1EBUA 2SCUA 4DYDA 3ITDA 5J23A 1PQWA 3DBLB 5EJ2A 3K8ZA 1GCUA 3KYCB 1KVQA 1VRWA 4BNWA 3NT4A 3RQSA 1R6DA 1UDCA 2EGHA 2E4AA 1V8BA 3H9GA 3ZNPA 1SNYA 2XOXA 2EERA 3JQ7A 1MP0A 2OGUA 1P31A 1V6AA 3D5QA 1ISIA 4LCEA 1NXQA 3FBGA 3SXPA 1EE9A 2NV6A 4YA6A 2VNAA 4OSOA 1A7KA 2D5AA 4BNGA 3UN1A 2WD8A 4XDZA 4XGIA 4IMPA 1H6DA 3HDQA 5AXCA 3WQSB 2P2SA 3PWKA 3VC7A 3CKYA 2GERA 3BIOA 4LCJA 3JD2A 3GGPA 4RGBA 4MIYA 4CMCA 4TSKA 4R1NA 2HKIA 1YOVA 2HAEA 2R00C 2I3AA 3ZW8A 4TZTA 3WNQA 3GPDG 2IYOA 1I3KA 1GUZA 4R1SA 1HRDA 2O48X 1R4MB 4J0FA 5COAA 5FI5A 1CETA 2PH3A 3IJPA 2Y0EA 2QX7A 3WIDA 4KTVE 3GMDA 2G1UA 1BXGA 1BTOA 4JIGA 4DRYA 1P3DA 2VTDA 3GY0A 1R15A 4Y98A 1G1AA 1EEHA 4CQMB 2VHWA 1B26A 3WICA 3QVXA 4UVGA 2IYPA 4FSHA 3JCZA 2DC1A 1LEHA 2FN7A 2RIRA 4LRTB 2BELA 2UVDA 1DDOA 1YWGO 3HHPA 5JYEA 3K5PA 4CMIA 1HEUA 3ADPA 3OF2A 2AQ8A 1PWZA 3GDGA 4ZVVA 1M6HA 5KIAA 1E1LA 1X7GA 1GCOA 2BF7A 4CUKA 2HDHA 3ZNOA 2DBZA 4KQXA 2VOJA 4UVEA 4MVJA 1X15A 3KSZO 3OJOA 4RLSA 4U7WA 3PWSA 4DIOA 4J43A 3VVBA 3U3XA 2Q2VA 4B7UA 2Q45A 4IGEA 1DAOA 4MIOA 4DLLA 3ZWVA 2PKQO 2ZK7A 4QO7A 5CEJA 2PD3A 2GN9A 1XELA 4B4OA 3N58A 2F1KA 4FFMA 4LK3A 3ZWCA 4PRLA 3DWFA 4J7CA 2Q46A 3V1UA 4E2WA 4Y6PA 5H82A 4CM4B 5A06A 3I6IA 1P44A 5B4TA 1V9LA 1ULUA 4B4WA 3GF4A 2I99A 5CEFA 1R37A 3V8BA 4BOYA 2PTGA 3JD0A 3QJ5A 2DLDA 1YVEI 1L7EA 4XJSA 3H2SA 2V6GA 3PJDA 2VWHA 3FNGA 4FN4A 5T64A 4XQGA 1N7HA 4AG3A 1I3LA 4TKMA 4EI2A 4J1SA 2CVOA 2HRBA 4IXTA 5U1PA 1KC3A 2I9PA 1DLIA 2ZATA 2Q3EA 2Y0DA 4B3IA 4RVHA 1YQGA 3E03A 3DO5A 4PN3A 5A03A 3RC7A 3VDRA 3GFBA 3DMYA 5A9RA 4KOAA 3KYDB 4WECA 1JKFA 3VTFA 1YJQA 4ALIA 1FK8A 3DFUA 3IS3A 2W2KB 1KEUA 4YWJA 3C1TA 2VYVD 4O6VA 1UP7A 3PVZA 2GZ2A 2ZCUA 4M54A 1T2EA 4JGBA 3W8DA 2VWGA 5HM8A 1EBFA 4FW8A 1E7RA 3QE3A 3KYBA 4YEDA 4U6QA 3W8EA 3I23A 3VPHA 1HDYA 1JAXA 4ND5A 3G3EA 2D1YA 5ENVA 1BXGB 1Q0LA 2D2IA 2AG8A 4GI2A 4C7JA 1KEPA 5G0WA 4EUEA 4HBGA 2W2LA 4MKXA 2YDXA 3AOEA 2C5AA 2Z1NA 1YDEA 1JQBA 2CDAA 4RZIA 2GGSA 4BO4A 1PJ4A 3WQQA 4MVJE 3V1YA 4CLRA 2P5YA 1N7GA 2ZKLA 4MP8A 4CMIB 2FOIA 4BNLA 3ITKA 3KSDO 2PFGA 1E1KA 3GG9A 1KVTA 1X7DA 4N54A 5DBIA 1EVYA 4TRJA 3WSWA 4KZPA 1A9YA 3HN7A 4OXNA 4G5HA 4BNHA 3JQFA 1PQUA 4BMVA 5HBRA 1QP8A 3EGOA 3VPGA 1QLHA 4DMLA 1HDCA 4AJ2A 1HL3A 1I36A 1JTVA 4U0JA 3QVWA 3LLVA 4H16A 1NP3A 3TRIA 5AYVA 3RJ9A 3PIDA 4FFNA 3LZ6A 4XB1A 5BSEA 3JQAA 1LLQA 3F6YA 5KVQA 5L4SA 1GZ6A 1NQAO 3UOGA 4I9NA 1AN9A 1ISMA 4BB6A 5I9NA 1H94A 1L7DA 1X1EA 3S2FA 1A72A 1GDHA 1OI7A 3DBRA 4CMBA 1G0NA 3IMFA 4IBOA 3DBVO 1LBEA 4UEKA 3DBLA 4AL4A 1XSEA 1GQQA 3UFXA 9LDTA 4WPGA 4YAKA 3H9UA 2B37A 2GO1A 2WJPA 4J3FA 3ZU2A 2C54A 2X0JA 4RZHA 1ADBA 1SEVA 1V35A 3B70A 3HQ4O 3I4FA 3KHUA 2YUTA 4HY3A 3AM4A 5L7TA 4E12A 4FIZA 2Z1MA 2PH5A 3AUTA 5JY1A 4D43A 3ZV6A 3WGQA 4DTIA 4UREA 4QO8A 5BSHA 1Q0HA 4AJLA 3DHEA 3LC1O 3BA1A 2P91A 3RUFA 5DNAA 4YT5A 3FCOA 2GR9A 4ALLA 3OA2A 3CH6A 3C7CB 5L4LA 3BHIA 3MCVA 3H2ZA 3KEQA 3CTMA 3H7AA 1X0VA 4LVCA 4BKPA 1UDBA 2ZB3A 1X13A 1U2GA 4EW6A 4OQYA 3MEQA 5GY7A 3DXFA 3QRWA 3GZNA 3PK0A 4Z9YA 4RF4A 5EQFA 4DWVA 3ZI0A 4B4VA 1ZK1A 1YXMA 2FRDA 4H7PA 4NK4A 5L3ZA 5JDIA 1KETA 1Y5RA 1I2BA 4IDCA 3NTQA 1X0XA 3OICA 3ZWBA 5KJ1A 3HN2A 2BD0A 1RM3A 2QIOA 5TT1A 3GN2A 1OMOA 4N5LA 4WLFA 3ROQA 3A06A 3RWBA 2AE1A 1BVUA 1Z6ZA 4R1TA 4D41A 1GU7A 1U8FO 2HCTA 3BYZA 5G4KB 1HSOA 3OEYA 5F5NA 4CQMA 1EE2A 4ZQBA 3I5MA 4B3HA 1I10A 3RKRA 1HE2A 2IEDA 4J0EA 2O50A 4YAIA 4NBUA 1IOLA 4OKNA 2OZPA 4LW8A 2PKRA 4HKTA 4XYBA 4AJ1A 1E3WA 3L0DA 3MWEB 3K31A 4BNFA 2C59A 3DONA 5C37A 1GZ4A 4W99A 2BFPA 3RUEA 1VE9A 3F1KA 3WIEA 3GVXA 1GYQA 1DLJA 1KERA 5COQA 3QP9A 1LQUA 4NHEA 5G0TA 1ORRA 4LISA 2YFQA 5KVSA 4M89A 4GGPA 5DN9A 5AXAA 1TLTA 3GOHA 4X54A 1Q7CA 3GHYA 4W4TA 1TA4A 4OSPA 3AI2A 1C1XA 2GLXA 4BKUA 1V3VA 2PY6A 4PLCA 4UVIA 2EHDA 3TZCA 3BMCA 4ONEA 1FDSA 3KETA 5MGBA 4KTTE 4INAA 5KJEA 4RLHA 2DT5A 4ND4A 4BGVA 5A3JA 3ETDA 2P9CA 1DPGA 2UV8A 1ML3A 2FZWA 4HUJA 4J4BA 3UUWA 1D1SA 1VJ1A 5JBIA 5ILGA 1A71A 3QWIA 1LDMA 1YBVA 2PR2A 2R2GA 2EEZA 4YTEA 1CJCA 2CMDA 2B83A 2DBQA 1EZ4A 2HMTA 3ZGYA 3GEDA 1HWYA 1ISFA 5BSGA 2C20A 4PRKA 3ZCXA 1ZK0A 2B36A 4BMSA 3B6ZA 2DU8A 3PJFA 3CSDA 1Z7EA 2NQTA 4OO3A 1ZNQO 4W7IA 5CG2A 4GVLA 2NTNA 4RORA 4BO6A 3NX4A 5DCUA 2ZQZA 3P5SA 2EG9A 4BB5A 2BGLA 3DEYX 1E1MA 1TB4A 3PHGA 4W7HA 4FOOA 4BIIA 2PZJA 4AJHA 5I9LA 2EF1A 3AY3A 1YRLA 5JAZA 4FOSA 4GMGA 4PVCA 3ONDA 1NWHA 4EBFA 2NTJA 4M86A 3ZV3A 4FQ8A 2HO5A 1EDOA 5TF4A 2ET6A 2NU7A 3GMSA 5DBGA 2JAHA 2FHSA 1U4SA 3WGZA 4D0SA 1GL3A 2J3KA 3JTMA 3I52A 1RYEA 4BO0A 2QYTA 1K3TA 5I7SA 2I5PO 3EMKA 4D3FA 1HYGA 1QYCA 1WZEA 1Q2XA 2HK7A 4NU5A 3BMOA 3AU8A 1PJ2A 4E3ZA 5HTOA 5IDWA 4MVJF 4WNCA 4ESOA 4WLOA 4AJKA 2NU8A 3L07A 4ZGWA 4FC7A 3E5MA 4BGUA 4URFA 1E6WA 3T4XA 3TSCA 4NFYA 5JDCC 1ZMTA 1NAHA 1PSDA 5T8KA 4CM4A 5TQVA 1R66A 4DREA 1AHHA 1K6IA 2EKLA 1C3VA 2RH4A 3RUDA 1SMKA 4U0KA 1WNTA 1B3RA 3CINA 4UAGA 3O8QA 2P4HX 4O59O 3X2EA 3GG2A 1JN0A 1LSJA 3PQFA 3PHIA 2YHUA 2OMEA 4NZ9A 1IZ9A 1PR9A 1ZZEA 3RFVA 4ZA2A 4J1TA 4O1MA 2Q1WA 4PG5A 1NFRA 2E37A 1R4NA 3AUAA 4WKGA 1E7YA 1Y9EA 3COSA 1LRLA 5JW6A 1O94A 4XQEA 3R1IA 3QWFA 5LDGA 3ANNA 3W4IA 5JC8A 3SEFA 1VL8A 3L4BC 3BXXA 4BNYA 3RC2A 3PFFA 1UJMA 3GR6A 4HX5A 5FI3A 4KUGA 2E6UX 5IXYA 1FDTA 2PV7A 2CY0A 3TF5A 4D0RA 5IJZA 5CHEA 2YJZA 5I7EA 1QMGA 4HNHA 4GPD1 4MVJM 3NDJA 3Q2IA 2YDYA 4M55A 2Q50A 4W82A 3ZHZA 5C7IO 3GDOA 1LSOA 3CE6A 3JQEA 4B8ZA 1YDWA 3D7LA 2JJYA 4I08A 4KDEA 5H83A 1PS9A 4CM9A 2RH8A 2X86A 4YAEA 3W8FA 5CG1A 1BXKA 3RD5A 4M8SA 3CEAA 3LSYA 4I5GA 5IZCC 3Q11A 3PLRA 5LC1A 1LDBA 1TI7A 2O3SA 2Y1CA 4JP2A 4E4YA 4J1QA 2LDXA 1VM6A 4L4RA 2AE2A 3NDRA 1EVIA 3ORFA 4J16A 4R4JA 4RVSA 5JY6A 3QWAA 4GLLA 4NDNE 2R6JA 3N74A 1ZJZA 1P9LA 1D1TA 1Z82A 3D3EA 3H9JA 2HU2A 3ICCA 3VZQA 2NUAA 4YYZA 1OFGA 2VWPA 3WSVA 3DDNA 1JKIA 4TVBA 1RM4A 1U7HA 3AI1A 1TEHA 4A27A 1E7WA 4ID9A 1E5LA 3VOSA 4FD3A 2JD1A 4RQUA 1QKIA 1B15A 3JYQA 4RF5A 1I01A 1MUUA 1Y81A 2O3JA 5COBA 3LDHA 4Z6KA 1Q1NA 5KVVA 1C0KA 4L8VA 2JHFA 4J9UE 5FF9A 3VAZA 4XIJA 1KC1A 1ZKMA 2OFPA 3NT5A 1NHGA 4BNMA 1D7OA 3BMOB 6LDHA 3DAGA 2BFOA 3RC9A 2HMWA 3VZPA 4II2A 2WEKA 2ZTLA 1H6AA 3QLJA 5TX7A 4RDIA 3EVNA 1HE3A 1N5DA 4ILKA 2VHXA 2PNFA 1Y6JA 1GY8A 1VC2A 4GX2A 5F21A 1QXSA 1P74A 1DIBA 2PA3A 4FR5A 1A27A 3QVSA 1I2CA 3S2IA 1PJ3A 1YE3A 1LSUA 3L9XA 4YJFB 1GV0A 2VHZA 4WNIA 1O0SA 1O89A 2C07A 1DJQA 1MFPA 1Y5MA 4R54A 4BVAA 1OC2A 3S55A 1NR7A 3F4BA 5THKA 3OETA 3RUCA 1B8UA 4Z0PA 3PQDA 2AQHA 4QT0A 2FPPA 3E1KA 3TL3A 5F1OA 1H93A 1M6WA 2Y99A 1ULSA 3RVDA 3P2OA 3D0OA 4JQCA 4CL3A 4Q3DA 1IB6A 1YB1A 2X6TA 1BSVA 1O6ZA 1XWFA 5IDQA 3X2FA 1BXZA 3AY6A 3OIFA 3UICA 1NAIA 1QLJA 4YVFA 5DULA 3W1VA 1O8CA 1XU7A 3LYLA 4PLGA 5L95A 1XCBA 1U28A 2O4UX 5DP1A 3ICPA 3KLMX 4J7UA 1DRUA 1P1KA 1SB9A 4DBZA 4YR9A 2B4RO 4RDHA 4B7CA 4C4OA 1MV8A 2NTVA 3IP1A 5I8WA 3DBRB 4NR0A 2P9EA 3I6QA 3WYBA 1LDEA 4XIYA 5EN4A 4BV8A 5JDCA 4MPDA 3I3OA 4JJFA 4NK5A 1WAMA 3ZV4A 3S1LA 1UAYA 1TXGA 2Y1OA 1ISGA 1KVRA 3C7DB 4BNXA 5IG2A 1MFZA 3PDUA 4BO1A 2PZMA 2NLOA 2AG5A 1PR3A 2E48A 3O38A 2FR8A 3GPIA 5FFFA 4CR8A 1Q0QA 5CPBA 3C24A 4PLPA 3PP8A 3EC7A 1GQYA 5GZ6A 1PGJA 3D3WB 3ZWXA 5G0VA 1VKNA 5AXBA 3JQ9C 3JQBA 3T4EA 4FGSA 4IDEA 4L4XA 5IFLA 4L9RA 4HFNA 3GAFA 3SBOA 3H65A 1VLLA 3INRA 4Q39A 2XF8A 3D4OA 1KYQA 5ICSA 2X23A 4IZIA 3D4PA 3WMWA 4R51A 5B4UA 4QX6A 1KS9A 1WMBA 2BHLA 1WVGA 2V7PA 4CM9D 3N7UA 3RJ5A 4UVDA 2J3HA 4DPMA 4CM3A 2C2YA 2WDZA 4GVXA 1BWSA 1F8GA 5EINA 3ZWNA 3A14A 3UH1A 4QTZA 2HK9A 5EERA 3ZHXA 1QR6A 3VVCA 3RFXA 5CFZA 4OXYA 1R0SA 2QZZA 1PJSA 3K96A 1K0UA 3FPLA 1HZZA 4UUNA 3GQVA 3CIFA 2O7QA 3IDSA 2I67A 1FJHA 2BGKA 1GQ2A 1LLCA 1H9AA 3H5RA 5HWSA 1E77A 5BSFA 2JCVA 4F6LA 4IIUA 4WOKA 3HSKA 4DMMA 3DOJA 4YAJA 7MDHA 3U49A 3JYOA 3GAZA 3UXYA 1F0YA 4E13A 2ZB8A 3QWHA 1PZFA 3NRCA 4DPKA 3WGTA 4LSMA 2Y1GA 1VSVA 8ADHA 1PS0A 7ADHA 3NGXA 2D5CA 2OL4A 3WLEA 3SJ7A 4BGEA 1JAYA 2X9NA 1N1EA 4KMSA 2H63A 2GRAA 4PLHA 3HJAA 1GAEO 4PZCA 4CMKA 1T2CA 5B37A 3FNFA 4TMFA 2YV2A 1PWXA 2HUNA 3PEFA 1DIRA 3QVTA 1T25A 1SBYA 3FD8A 3KZVA 3TL2A 4NBTA 3PFWO 6ADHA 1H2HA 4CQLA 1HETA 1N92A 2EIHA 2W2KA 3MWDB 5JLAA 4NBWA 3KTDA 1SPXA 4CLOB 1FDVA 3RASA 3U5TA 1VPDA 2AEJA 2G0TA 3PYMA 4R3WA 5CAEA 4DIBA 2EKQA 1YBAA 1NHWA 4FS3A 1RM5A 1UH5A 3P7MA 4MVJG 1DFGA 2PGLA 2DPGA 1GYPA 3VKUA 1UXHA 1NFFA 1IE3A 3I83A 2BI8A 3O03A 4CMEC 3JD4A 2H6EA 1H0KA 3QW2A 2J6IA 3GZ4A 3PRJA 1ZEMA 3D4NA 2P4QA 3TNLA 3KYCA 1MA0A 4RQTA 1JW9B 1ZUD1 4BV9A 4CMEA 4IJUA 1E6UA 1R4NB 1OZAA 3D64A 2DAPA 3WNVA 1QYXA 5G2OA 1V3UA 3DMTC 3O4RA 4WLVA 1S7CA 4Z0HO 3GUYA 4QSMA 4OKIA 5AOVA 3R0IA 4ALKA 4NBRA 3NGLA 4GWKA 1FF9A 4IGFA 5TRTA 1LU9A 3OA0A 4B7XA 2IZ0A 2VHYA 3MJVA 4OMUA 3HE3A 4JK3A 4GL4A 4XX0A 2DTDA 2C5EA 1EUDA 1X14A 1IHYA 3A4VA 4L4SA 5CDUA 3OFSA 3H4VA 3L77A 4YRDA 3VPXA 1PJLA 4UVHA 3ABIA 2W2LD 3OH8A 3BMNA 1J0XO 1RWBA 1NQ5A 4IJWA 3RU9A 3WB9A 5TS3A 1J49A 2FP4A 2VQ3A 4R16A 5I7FA 5THQA 1ARZA 4OH1A 3Q1LA 2WD7B 2YY7A 4RVFA 3F4LA 3HG7A 4K1LA 4E5MA 4PG7A 3PGXA 1XGKA 4NG5A 3O9ZA 5L9AA 2YZ7A 2GN8A 3PYXA 4FFLA 1Y8RA 1PS8A 3H5AA 4PLWA 2YQ5A 5F1KA 3V5NA 4JBIA 4XJTA 4XD2A 4CLDA 3DOOA 1T4BA 2EW8A 2J8ZA 2Q99A 1IY8A 3ROKA 3K6JA 1T2DA 4K26A 4U8GA 2Z5LA 3JQ8A 4RPGA 5JDIC 1SZJG 4WUVA 2NWQA 4WLEA 1YB4A 2GNAA 1F06A 1EFLA 2NACA 1AXEA 4J4HA 2IE0A 4YJGA 1NQTA 3FN4A 3S2GA 2I66A 3WFIA 1P1HA 1NFQA 4HNGA 1Q7BA 3WJ7A 1JDJA 3BHJA 1PU2A 2EXXA 4R9SA 4D3DA 4FFPA 2P68A 4NFHA 4JJIA 1TT5A 2HLPA 2I65A 4XGNA 4GGOA 5G0SA 2XAAA 2GDZA 1IL0A 3M2PA 3PTZA 4R5MA 4JBHA 3ZWAA 4GLOA 1HLPA 2X0IA 5I8ZA 1XYGA 2X9GA 2HMVA 2JCXA 1KEWA 2VCYA 3JQ6A 3ZU3A 2OO5A 4NMHA 3TFOA 5KJCA 1GYRA 1R4MA 4WEOA 4LMRA 1HKUA 4RF3A 4YT2A 1DRWA 3AUSA 3NTOA 1QV6A 1A7AA 1GUFA 2JL1A 1HDGO 3C85A 3WLFA 5IN4A 3FHLA 3CPSA 2VZ9A 4P38A 4CLHA 5L7WA 1PJQA 3QIVA 3FWNA 3OP4A 4L0QA 3AU9A 1EUZA 3JQGA 1DIAA 4PG8A 2AW5A 1I3NA 4TZKA 5CDTA 4PIVA 4DQVA 1IYZA 1JWBB 3GRKA 4I9HA 4PCVA 3RUIA 3RCBA 2WTBA 5BQFA 3HNPA 4ZICA 1I24A 1H9BA 3EDMA 2C7VA 5TJHA 4DYVA 3GDFA 4TKLA 4Q9NA 2OHXA 4YT4A 1JKJA 3AW9A 1HTBA 2CF6A 3Q9UA 5F5LA 4BHTA 1B3BA 4E30A 1ADCA 2GYYA 5T8KC 4BQPA 4P4LA 4MP3A 4R9RA 3TZQA 3ZNQA 3BTVA 4NBVA 3WTBA 2DTEA 1SAYA 4ZQFA 4WGGA 3NJ8A 2DFDA 2UDPA 5AVOA 1AUPA 1C1DB 1R0KA 2DM6A 3ZU4A 4YJHA 2OBNA 2EWMA 1KVSA 3PGJA 5ER6A 4TQGA 1Z73A 3U4DA 1U3TA 4CR6A 1LRJA 1E3EA 2BFMA 2VOEA 4FJ0A 4PVDA 2IXAA 4TRRA 2PD6A 5IZCA 4RPJA 2CVQA 2PGDA 4BNVA 5HS4A 4AJPA 1EQ2A 2EV9A 1QYDA 4CUJA 1WDMA 1MX3A 4BNZA 4WOJA 1VSUA 2GASA 2JFFA 2BKAA 2GF2A 3PHJA 2RBEA 2D8AA 1I33A 1WPQA 4NFSA 1N8KA 1AGNA 3I9NA 4XA8A 3ETEA 4AJ4A 4A73A 1Y8QB 2CNBA 4F45A 4N5NA 5DCYA 1ISHA 5T67A 3I9JA 4NIMA 2DKNA 3H6KA 1DO8A 1LXCA 1EQUA 4BNNA 3G49A 4JCOA 4N18A 4CQMD 4JXKA 5IZ4A 3DR3A 3I9OA 4NJMA 4RVUA 1DB3A 4J9VA 4CMGA 3GT0A 5CDSA 5JCJD 3LF2A 4H3VA 4KUEA 2AQIA 4Z9XA 1CF2O 5EPOA 1DOHA 2TMDA 4EUHA 2G76A 3DL2A 3UF0A 3IUSA 3F1LA 2YFHA 1QRRA 3M1AA 3MOGA 4BKRA 4PLVA 1N1GA 3D1LA 4W6ZA 3IP3A 4PZDA 1JVSA 4K6FA 4LSWA 1VL0A 1CWUA 2RCYA 3H9EO 2FPGA 3OBBA 4CR7A 3EHEA 5DP2A 2FSVA 2HRZA 4S1VA 4M87A 3R3SA 1JVBA 4P8RA 1ZEJA 4EDFA 1T2AA 3BTUA 4RL6A 4A26A 4BO2A 4BNTA 3MZ0A 4IZHA 1PZHA 1UUFA 2C29D 3GLQA 3E18A 1EK5A 4DQUA 1D4FA 3ANLA 3DB2A 4Q3BA 4A0SA 1E92A 4DIFA 4IJKA 1PJCA 3BHMA 4J2OA 4QEDA 1CERA 1W0CA 4IS2A 4QUKA 4BMNA 1DIHA 1U5CA 4L75A 3RBVA 4OXKA 4I5FA 3GK3A 2QZ9A 3H3JA 4BNUA 3KVOA 3OIGA 2J3JA 4I5DA 4BO3A 2IODA 1Z45A 3H5NA 4ZRNA 4GSLA 5L7YA 1NVMB 3QQPA 3E9MA 4PLYA 4FJ2A 1A4IA 2Q49A 3M6IA 1DAPA 5L45A 4N5MA 1WP4A 3I9MA 3QWBA 2Q2QA 1HDXA 4UEJA 2CD9A 3B1KA 2NM0A 2OP1A 2O3TA 1B2LA 1W8DA 1ZSNA 2C7GA 4CM5A 1LC0A 3FWZA 2B0JA 1LQTA 3AY7A 2BMAA 4LGVA 4Y8VA 1I5RA 2D59A 4E2ZA 5BNIA 4XR4A 4RPLA 5EQDA 2GCGA 3RI3A 1MC5A 1N9GB 1F17A 1K6JA 3GNQA 1WDKA 2JD2A 4I9UA 1V0JA 3BMQB 3FNEA 4O5OA 4MVJH 2CVZA 5A4DA 4OQZA 3PIIA 2GSDA 4FDAA 5JCXA 2Q4EA 3BTSA 5ITWA 1MGOA 1CYDA 3GEGA 1HE5A 3F5SA 2ZJ0A 3VZSA 2X0NA 4K9DA 2GPTA 4LMPA 2W8ZA 3VHRA 4RJTA 1BMDA 1U8XX 3T7CA 1OOEA 3MOIA 3H8VA 1ZXBA 3KV3O 4MP6A 4BO8A 2Y67A 4CQLB 4LN1A 1E6EA 2X8LA 4WASA 4ZQEA 1DBVO 2NVUB 4II3A 3PZBA 2C0CA 2NVUA 1K2WA 3B1JA 4XRRA 4PG4A 2HQ1A 1NPDA 3AFNA 1DEHA 4UULA 3T7EA 2X22A 4ZU3A 2D3TA 2WSBA 1ZK4A 3B1FA 4J4TA 1YOVB 3BAZA 3DAFA 3L6OO 1AHIA 5C3MA 5CPFA 5GMOA 5DDIP 4P4GA 3VZRA 3AFMA 1E1NA 1UZNA 1QG6A 3AK4A 4D45A 5G4LA 3U62A 2X9VA 1T4DA 4OAQA 1JA9A 1E7MA 3K30A 3JQCA 3WJAA 2ZQYA 5L53A 3UW3A 1BW9A 4RVGA 1EK6A 2Y05A 1YONA 1W4ZA 5A05A 2YHIA 1G6KA 5I7VA 2B4TO 2YHIB 4CV1A 4DL9A 2OORA 1B8PA 4IDFA 3C1AA 3AWDA 1DC3A 2Y0CA 3JV7A 3GHHA 3DHNA 3NV9A 3U4CA 3WYCA 1ENPA 3KXDA 4XYEA 3UKOA 1E3WB 1PIWA 1RPNA 3IQDB 4IDGA 4R01A 1P1RA 4E5KA 2VYNA 4CUZA 3UHAA 1BGVA 2B69A 3BMCB 1GEGA 4MIEA 2QRKA 3PWZA 3FRJA 1JU9A 3EY4A 2NSDA 4KWIA 4J7XA 1VKOA 5TT0A 3WQRA 2X58A 1T2FA 1M76A 2EJWA 2WM3A 1B16A 3IKVA 2VYVA 3SJUA 1SOVA 2D0IA 4XEHA 1U5AA 4HFRA 3S2EA 1GR0A 4E5NA 2BRUA 4LRSB 4Y67A 5K9ZA 1EUCA 2WD7A 1KY5A 1B0AA 2VRBA 4IUYA 1I30A 2R00A 2PD4A 4DPLA 1MC4A 3F3SA 3OQBA 5ES3A 5JAMA 5JYDA 5DF1A 3MJ4A 3W6UA 4AJOA 1UP4A 1UXJA 4EGFA 4KUHA 2A35A 3MJSA 2LDBA 3GGGA 4P4NA 4E21A 4YAGA 3TZHA 3AOEC 2E49A 2V6MA 3NDIA 1BG6A 1FDUA 3D5TA 4R69A 3ADOA 2HK8A 3JYNA 1V3TA 2AEMA 2VUTA 1Z75A 1K89A 1PGOA 2Y1EA 2FWMX 1LDNA 1M2WA 2W4QA 1ZO8A 3JQ7B 4ZQHA 3ROPA 2WYVA 3VPFA 4J91A 2VRCD 4CPDA 3V2GA 4G2NA 1ZCJA 1ZSVA 1M67A 3HDJA 1H5QA 3I9LA 3S8MA 4AVYA 1E3SA 1TVEA 3IKTA 4C7KA 3E5RA 3C7AA 5ICMA 3WFJA 2VYND 4P22A 1XR3A 4ALMA 1XU9A 2J3IA 4CM1A 5A5EA 3BZUA 1ISJA 2ILTA 3F46A 4DXHA 2CFCA 5KVCA 2GD1O 3RUAA 1LI4A 3GFGA 1IHXA 3P19A 1PL6A 1NR1A 1P77A 3U4IA 1PEDA 4EJ0A 5AXDA 4MVJD 1I8TA 5HA5A 3DC2A 2RAFA 2VT3A 4G65A 1DXYA 4YRAA 3L4SO 1PZEA 4CODB 1HDRA 3TWOA 1PL8A 3I4CA 1IPFA 5DBFA 2Q1SA 1IUKA 2O2YA 3LT0A 1B14A 3E48A 1UDAA 3PLNA 1I32A 5IDYA 5L40A 5L51A 1LJ8A 3DZIA 3DZHA 4A5OA 3P2YA 3ZZNA 3GH3A 4ROSA 1NYTA 1Y8RB 2P9GA 1BRMA 1K6XA 1N9GA 3WBBA 4D3SA 2YYYA 5TJ9A 4E5PA 1C14A 2J5QA 3QV1A 3I9KA 2NADA 4WK6A 1UXIA 2X4GA 1ID1A 1DC5A 2G82A 4CMJA 2H1SA 4FBGA 1KVUA 3JSAA 1J6UA 1O95A 1RJWA 1LDGA 1IULA 1NBOA 5JPIA 4HP8A 2Q1UA 2BI7A 1GD1O 1EFKA 2RHRA 3DMTA 2ZTVA 2ZB7A 4DUPA 3AM3A 3DTYA 4A03A 4TRMA 1ADGA 3PJGA 1B7GO 3NAQA 4B4UA 3PXXA 1EVZA 5BNFA 1ZBQA 1XQ1A 2FPIA 1D8AA 3JQAB 3JQDA 3NUGA 5JE8A 3G17A 4L76A 4RV9A 3W4KA 3HB5X 5A9SB 2O7SA 1SCUA 4JROA 3FI9A 4RPKA 1PQPA 1LTHR 4RPHA 3K9QO 3UCXA 1F14A 3FTPA 1U9JA 3LK7A 3ONEA 2IZ1A 1L1FA 3GVPA 5CP8A 4GSKA 3ULKA 1MG0A 4XR9A 1GFSA 2O3QA 1HZJA 3AM5A 3NTRA 5JO9A 1J5PA 3K73O 3ON5A 3EYWA 1GTMA 5DZSA 2HSDA 1WZIA 1O9BA 4YXFA 2FZEA 3IC5A 4HFJA 2Q2WA 1HT0A 3DQPA 4N7RA 1T1SA 4JLWA 1MXHA 1MLDA 5JNLA 1YL6A 3DZKA 3GNTA 4YQYA 3RSHA 2YV3A 4A2CA 4EJMA 1VJ0A 3OQ6A 2DVMA 4EZBA 4S3MA 1T26A 4XQCA 4NH4A 3WGGA 2Q4BA 1NVGA 5CDGA 4DC1A 3GZNB 3RU7A 4E5YA 1PJBA 5ER9A 4UEOA 1SC6A 5GZ3A 3SX2A 4D42A 3R6DA 4A10A 4ZQGA 1P0CA 1LNQA 3BMNB 3VDQA 2OUIA 1ZW1A 4U6SA 4GH5A 2Y68A 1NX6A 3ASUA 3KO8A 4KP7A 5HS6A 3GVCA 2EJVA 2VN8A 4MKRA 3F9IA 4BGIA 4CMAA 4TRNA 2VUSA 3KOUA 4FB5A 1H6BA 5ITVA 3WR5A 3UVEA 3ZWYA 1PX0A 3VH4A 4AFNA 3F47A 1P1FA 3SC6A 1DC4A 1PZGA 2IDZA 1DHTA 3DAPA 2IZZA 1M66A 3LC7O 5LCXA 1OC4A 2GN4A 2ZB4A 4F6CA 4D7AA 5G0UA 1X7HA 4E0BA 4XKJA 5TNXA 2BFAA 3KLPX 3EZLA 4BKOA 5A3VA 1HDOA 2J5RA 4Z9FA 4XQ9A 4IQGA 5JAQA 3E82A 2UAGA 1WW8A 4EJ6A 1DFHA 3WS7A 4FPXA 3GN1A 4MO2A 1LX6A 4CL8A 3HZZA 1OBFO 3AUUA 3PYLA 4L74A 2X5KO 1N2SA 3TOXA 2O3RA 3PJEA 1TT5B 1DRVA 3MJTA 3LT2A 3B20A 1SEPA 2EKPA 2A94A 1GV1A 1Y9AA 3INTA 5G4KA 1A9ZA 1YO6A 4CLOA 4HFMA 4MVJI 1XIVA 1U3VA 2VZ8A 4FFRA 4LVUA 3KSUA 4XGKA 3STHA 1DFIA 4E2YA 3Q3CA 3UAGA 2ZTUA 3WG9A 5MDHA 2XXJA 4HV4A 3AI3A 4DVJA 4FGWA 4R68A 5TSDA 3VTZA 1GEEA 4O0LA 5JAIA 3FPCA 3OECA 1YJ8A 3OHSX 4XZ3A 4R1UA 5LDHA 1RKXA 2FMUA 3DBHB 5GZ1A 4RF2A 3UCFA 1ZFNA 1GPJA 2Y66A 2ZCVA 3HWRA 3M1LA 4GQAA 3WYEA 1LA2A 4D46A 3ZV5A 3VPSA 5ADHA 3MJEA 5IAAA 3WGHA 2YV1A 4J6FA 5DOZA 4XYLA 1A5ZA 4IM7A 5A5FA 2OBYA 4W9NC 4ALJA 1NNUA 1W6UA 4BL5A 1UZLA 4WJZA 1YQXA 4ZRMA 2VNSA 5CDYA 5FEUA 2WE8A 1C0IA 3W6ZA 3K2EA 3WDSA 1PJTA 4IQ8A 2OXIA 5KJ6A 1C1DA 2H5LA 3E6AA 3R3JA 2Y93A 3ROMA 3JQFC 3V2UA 3RBZA 1QYWA 1ZJYA 3LVFO 2A9FA 4CM6A 4QECA 3ZH2A 4DGSA 2OP0A 5I9MA 2WE7A 1H2BA 5BR7A 4HWKA 2EGGA 4GWGA 1WMAA 4GX0A 5ILOA 3FF4A 2E82A 3SC4A 5EESA 3ANMA 2B5VA 3BTOA 4GAEA 1NVTA 3DZFA 4IIVA 2P5UA 4F3YA 1ZH8A 1F12A 1I0ZA 5C7LO 1AE1A 3D3WA 3EAGA 2PZKA 4XDYA 3MTGA 2Y1FA 1KIFA 1G0OA 3RC1A 4G81A 3FBTA 1OAAA 3CMMA 5B1YA 3JQGB 3TQHA 1NM5A 2ZYDA 3JD3A 1WXDA 4JP3A 5FWNA 1T1RA 2AEFA 1QV7A 3ZHYA 4MKZA 2AMFA 3QVOA 4R3NA 3ZWPA 3CUKA 2DBVO 4XWYA 1RM0A 4TWRA 4M49A 3W4JA 2W98A 3GVHA 4QQRA 4TVOA 3WTCA 4IY1A 1KY4A 1PL7A 3KUXA 5JC1A 1QORA 3CZMA 1KOLA 1NTOA 1UP6A 1ZMOA 1C0LA 5KOIA 1YB5A 4YT8A 4PLZA 3KRTA 1HXHA 3FSRA 4RVDA 3TDKA 2WYWA 2X1HA 2CF5A 3NJ4A 1PGPA 2QRJA 4DLBA 1E7SA 3KB6A 5DT9A 1R16A 4ZJUA 4J2HA 4CV2A 5HRUA 2D4AA 4OOEA 3UGKA 1FXSA 2NVWA 3G1UA 1HDZA 4O63O 2G17A 5JFOA 1HYEA 3QA9A 2F00A 4ZN6A 2W90A 2ZIZA 4R5HA 2BH9A 1YQDA 4GKBA 1LDYA 3RROA 3A9WA 3IJRA 4CM8A 1CQIA 3O26A 1B8VA 2VRCA 1SO8A 3WX0A 2FY8A 1E3JA 4KQWA 5FYDA 3DFZA 2ZYAA 1E3LA 1U7TA 4OHUA 1KEVA 2DPHA 1FMCA 1EVJA 3QHAA 4BUCA 3GGOA 5IN5A 1DIGA 4WE3A 2DBRA 3F5QA 4H15A 3QSGA 1ENOA 4OYRA 4ITUA 5TC4A 3KBOA 4WCDA 1GUYA 4NJMB 5BNTA 4YRBA 2WWRA 2O2SA 5DCWA 5TGDA 3I1JA 1NPYA 4OM8A 2YQ4A 2EW2A 3GC6A 1GADO 1DHRA 5T57A 4YB8A 3V1TC 3L9WA 3LQFA 2WMDA 1UZMA 5K6AC 1CIVA 3VKVA 2NNLD 1DC6A 4AJEA 5DOVA 2RHCA 3IIEA 4CJXA 4KDFA 4K6CA 3TOZA 4FC6A 4R41A 2GZ1A 5H81A 3FR7A 3RFTA 4DBVO 2PZLA 3MTJA 1Y1PA 2HJRA 1FDWA 5K6AA 1XG5A 1WWKA 3NYWA 5KKAA 3KEOA 3VH2A 4IINA 4PGFA 2FR0A 3JYPA 4Z0TA 3FR8A 1YS4A 4D79A 4EITA 3WGYA 3ZHBA 4GX5A 1ONPA 2X5OA 1ZXLA 4NQZA 1ONOA 3G0OA 3LT1A 2AXQA 1UAGA 5C7OO 4YDRA 2VZ0A 1BVRA 1KBZA 4MVJP 4YCAA 4CV3A 5EIOA 5KWEA 5A04A 4YJGB 3HDYA 2FSSA 3HB4X 2PGJA 3WBFA 1IPEA 2B35A 4IXWA 1HE4A 2I3GA 4MINA 1EDZA 1U3UA 4Q3AA 1TT7A 1RYDA 1LSSA 4YQZA 2C82A 3JQ8B 5JMWA 2QW8A 3LF1A 3PHLA 1PGNA 2G5CA 4NI5A 5A9SA 4OIMA 1C1XB 1EMDA 3JQAD 4I5EA 1HLDA 2CZCA 2HMUA 3H3FA 3LT4A 1C0PA 4BNJA 1M75A 3KM0A 2AHRA 1LRKA 3OMLA 2I6TA 1ADFA 2IXBA 4E2XA 3GVIA 4YBZA 1HF3A 2IRWA 1BDBA 3CXRA 3OEWA 2PK3A 4WLNA 3U9LA 2I76A 1XQ6A 3SLGA 5TLSA 4XYMA 3GUCA 4OOFA 4F46A 4IQ0A 4GKVA 1I2ZA 2QQ5A 4YACA 4YJFA 4AICA 4IDBA 2PKQP 2V65A 2HMSA 2JKVA 2V6BA 4TROA 2UUPA 4PLTA 3IOYA 2NVBA 2VUUA 3PI7A 2JCYA 2J5KA 4I1IA 3UCEA 1UR5A 1P0FA 3Q9NA 2NU9A 4E31A 1NPTO 3C3XA 2ZYGA 1S6YA 2PLAA 2Q1TA 4EYEA 3GA0A 1X1TA 2H9IA 3CMCO 4WCFB 3WXBA 4ZHSA 4BNIA 4EUFA 1Y7TA 4JJGA 2ZJ1A 1PGQA 3G1TA 3ENNA 5A9TA 3WOHA 4UUPA 4YPOA 4CM7A 2NU6A 2O23A 1XDWA 4W9NA 4UUOA 2FR1A 2JD0A 5T5QA 4KWHA 3LU1A 3HUDA 1MB4A 3FNHA 4GMFA 1YGYA 3RIHA 3WGOA 3LLSA 4U5QA 3DOCA 4MJLA 4YJDA 3PZRA 3A1NA 1SB8A 1ENZA 1T24A 3WGIA 4JBGA 4A7PA 3DZGA 4Z3KA 1BDMA 5EL0A 4Q3NA 4B3JA 1H6CA 3C1OA 1U2DA 2DFVA 4IJVA 3U09A 5T6BA 5KKCA 4YJHB 1W73A 2XXBA 5JXWA 4DLAA 2Z95A 2GZ3A 2JFHA 3M2TA 5IDXA 3DTTA 4FFOA 1XLTA 3OJFA 1J4AA 3L4BA 2YW9A 1UXKA 2VHVA 1P45A 4BQRA 1MXFA 1QSGA 4PLFA 3G79A 1U1IA 2CDCA 4CLXA 4E6PA 3JQ9A 3JQBC 3NKLA 3IUPA 5F3RA 2B4QA 2HJSA 3EK2A 3RUHA 3JD1A 4Y6RA 1ZK3A 1BHSA 1E3IA 1VL6A 4J1NA 1UXGA 3E9QA 5JCJA 4D44A 1ONNA 4JNKA 4Y9DA
chains in the Genus database with same CATH superfamily
2ZYUX 3B13B 5YASA 1IFXA 3BDVA 1MDFA 3KJEA 3TR0A 2JCBA 4U2EA 4Y2QA 2GETA 3RM3A 3GEMA 4MUGA 3AYZB 2BEJA 3ZW9A 3H2YA 4YLGA 1VJGA 3CUWA 2F64A 4OGWA 2IX9A 2H8KA 4C14A 3VA7A 4RD4A 3PPIA 4EEZA 4HLUC 4ZVLA 1MOSA 4Z7OB 4X8LA 2I4RA 2PWZA 5K3DA 2X4IA 4UUMA 1J2RA 3L6EA 4IKPA 4QA9A 4WMLA 2Y77A 1BW9B 4L3VA 3H9QA 2I78A 5DGTA 4RCVA 3MWJA 1I3MA 5EHXA 1FZQA 1O5IA 1UKCA 1WLYA 1WNFA 4Q9IA 4X44A 2J3MA 3B3JA 3ZH9B 2W83A 1CEQA 1DKQA 4L22A 1ONSA 4UASA 4BN4A 4EEXA 4F72A 2WB2A 4JYAB 3A2NA 5AQ1A 5CH5A 1KO4A 3WKAA 4X1YB 2B5WA 1LY1A 1PTJA 4XUGB 3HB7A 3LXUX 2AFHB 2RCNA 2ZIAA 1DEOA 4G4JA 4NDAA 5HCIA 4K5QA 4AZ3A 4O3FA 4M9CA 3KKKA 1Y8ZA 4JI5B 4M37A 3WMXA 3UJNA 2O7NA 1ECFA 3EBPA 3G5LA 4RK7A 4YAUA 1Y3DE 1OX4A 3EZYA 2OHGA 5ANRB 1GPMA 3NT2A 4GOOD 4ND3A 3HRKA 1TE2A 2GWHA 4KVZA 1CDOA 3UM9A 2DFKB 3DZBA 3EVTA 1RKUA 2WFLA 2ZBPA 4NU6A 3V1LA 1PE0A 1DBSA 3ONFA 5U4QA 3RVSA 1YL7A 3K9HA 4XCVA 4YX9A 3P9YA 5KQSA 2HTFA 1I1OA 4PSKA 4R2XA 4TV9F 5ALIA 2IWHA 2WLSA 3A7EA 5AW1A 5JECA 5U9CA 9MHTA 4C6TA 4QGHA 5B2FA 4JN6B 1U4OA 4KV9A 1Q74A 5IXSA 3FOFC 5DO9A 4HNAA 1WTCA 4RIHA 3H05A 3CRMA 3O4IA 3OF5A 1I80A 3RBXA 1WY7A 2BFEA 2DJIA 2C2XA 2FPUA 3TLBA 2EP7A 4G1BA 1Q7GA 2ZR9A 4GP7A 4JX8A 3TJRA 4KR6A 3CX8A 4QM7A 2XPCA 1N2BA 3FMPB 1T10A 4Q3EA 4QVKA 3TCNA 2I0FA 1M1NB 1Z28A 4D57A 3MJCA 1G17A 1X80A 3MJDA 3WWZA 4NRDA 2J67A 3S2UA 1B1AA 3TE6A 1D3AA 2UZ4A 1GPDG 4NZOA 1LLUA 1WULS 2V1UA 1ENYA 4AO6A 4BO7A 2R48A 4WWHA 1N5KA 1YFJA 1KHHA 3CPEA 4UFPA 2NT4A 4RABA 3SZOA 2IDMA 3WWYA 5IJ9B 1NL3A 4DMUB 1LBIA 3GQBB 2CJYA 4FB4A 4NLLA 5DJ5A 1Z63A 3QKSA 2X0EA 2QG4A 4OJQA 1R0BA 2KPOA 4N82A 3SC2A 9ABPA 1EM6A 5ILQA 1K8YB 3AJRA 2ILVA 3FB1A 4GZMA 3OPYB 4ZAFA 3JWJA 1O7JA 4C78A 2L2QA 3EXG1 4MDHA 2P9FA 3WO1A 3TBKA 2W0SA 3QPUA 5D51S 5EJ8A 3KQYA 4BZXA 2XMGA 2YWBA 2OXRA 1A5SB 4EB0A 4C7OB 4XFKA 2W6OA 1DI0A 1PP4A 1NQOA 3KZ1E 3RFUA 3SKVA 4AJNA 4DSZA 2O2CA 1HYQA 1JEAA 2NXJA 3ASYA 3QFCA 1V5EA 4HLCA 3I2JA 3PBKA 5UKDA 3ESDA 1T9BA 4YP1A 1M2OB 2GK3A 2PL3A 4NCIA 3BCRA 3WZLA 4AW9A 1RSZA 3JATB 5DNEA 2PQ2A 1U2SA 1VI2A 2YZMA 3I6YA 4IRXA 2X5JO 2YUIA 1KFBB 3KD3A 4E32A 4QT4A 2RC5A 3D3JA 5JSFA 5L53A 3O7MA 5KVVA 5JANA 2PO5A 3C48A 1H0HA 1P1IA 2FTKE 3ZU5A 1IBSA 2BLLA 1BROA 2EP5A 1TX4B 1K7FB 2AWOA 2Z8ZA 4LDZA 1FX0B 4MRVA 3OIDA 3I53A 5HJ5A 1BFKA 1F5SA 2QYSA 1KK1A 4I6JA 5BV2P 3THWA 1WOMA 3PDJA 2O3UA 2DB3A 1A1SA 1EE1A 1UFVA 2WSSD 4L16A 4PFJA 1XRSB 1L2TA 2CLFB 3Q72A 1W48A 4CLEA 5K0ZA 1U7DA 4ND1A 4AJIA 3I5UA 3P9CA 5FOUA 5KJFA 1NKVA 1TW2A 2QY9A 1YZUA 4LX8A 4TL6A 2M1ZA 2PMBA 4W7SA 2JBHA 1XRQA 1GUAA 3ND9A 3V34A 1VRWA 3G68A 4LNHA 2HPZA 3IAAA 4YRFA 2WVJA 3VNSA 3OQVA 4DG8A 3HXMA 4RK0A 2JGJA 1RC0A 2XVZA 1SIBE 3EGXA 3P8ZA 3JQ7A 1OE0A 2G72A 1F2TA 3UFBA 3KU1A 1MP0A 2HIAA 1JUDA 1QAMA 2OGUA 4XXHA 4KV7A 3AP2A 4BFSA 1Z4LA 1NXQA 2PUWA 4W8OA 4G5YA 4AXXA 5HKBA 4DT1A 1HY3A 3NEJA 5E3JA 3F8SA 1YRYE 2YZ2A 2D5AA 2RBGA 3TKAA 3BB1A 4L72A 1J2YA 3RE1A 3TXAA 1TQHA 1OB2A 2WD8A 4K9RA 5AXCA 5K3SA 3WQSB 1FTYA 4Z0NA 2FETA 4GU5A 5HRAA 2GERA 3DPUA 4CKXA 4LCJA 4RGBA 1Q19A 1XN1A 1TTPB 1S89A 4EQZA 2QQGA 4YJKA 1ZM2A 2R00C 3A10A 2I3AA 1G41A 2B92A 4Y9TA 1DV1A 3ZW8A 2NGRA 2P9BA 4C3UA 5LJIA 5LNK6 3IP8A 2ZRCA 3WLIA 1QJ4A 4JR0A 1GWNA 4TZTA 5ESRA 5HHTA 2H92A 4CKEB 2BMWA 2IYOA 2WTMA 2XKAA 2DUMA 1EUCB 3UGQA 1SZPA 1Z6YA 1N36B 4J0FA 5COAA 1UT5A 1UPCA 3OC6A 5CFRA 2PH3A 3GXBA 3IJPA 3MB8A 3RPEA 3WIDA 2Q5OA 3U6BA 2IHVA 3PNMA 4WAUA 1ST2A 5ETJA 1KQOA 2G1UA 4WN3A 4Y9UA 2VTDA 3KCNA 1R15A 1CJTC 4J75A 4P9NA 2CXPA 4Y98A 4LTDA 2GILA 1EEHA 4CQMB 3L41A 1JH8A 1VA5A 1B26A 2MSKA 1X74A 2WJVA 1EI9A 4GIBA 4OLFA 5KI6A 3WICA 4EJFA 4CRWB 4EMUA 3PV0A 4HOYA 4FP9A 2VJMB 2IF0A 4HH0A 2JFNA 1I1NA 4COOA 3TNFA 5IANA 1DDOA 2Q5CA 4ZZ3A 3IB3A 1YWGO 3B3QA 3HHPA 2IYUA 2VTBB 4CMIA 1C30A 1SUDA 1BE6A 1G3MA 2C03A 5F51A 2AQ8A 3IBGA 3M9XA 2A5GA 3ZQJA 3CVOA 3WA7A 5KIAA 5EG5A 3KOMA 4WOCA 3ZXSA 2CXRA 1RBYA 3VKWA 1IXZA 3ZNOA 2LRHA 4QU5A 3I2IA 1XZEA 1G21E 1X7ZB 3ZUGA 3KT3A 4UVEA 4MVJA 3QBVA 1YNOA 4EHIA 1X15A 3A58B 2FUCA 1PJZA 1XDZA 2REOA 3KSZO 3O4FA 4JQOA 1TQ2A 4MJ3A 4U7WA 1CEYA 2PL1A 3LGSA 4JV5B 3B6JA 3EDCA 2Q2VA 4JLOA 1A3CA 5AD1A 1X8LA 5GONF 4MIOA 5BW5A 4DLLA 3GGSA 3WLTA 1WXQA 3BZWA 4QO7A 5CEJA 1XL1A 2WIAA 3OZCA 5EMMA 2C92A 2F1KA 2ONYA 4FFMA 4G85A 2CV0A 3DWFA 2RK4A 2YXEA 4G24A 4YLYA 4CTJA 3PS9A 4CM4B 3P2EA 1CDDA 5AW4A 5CVDA 1FP6A 4B2PA 4L3OA 5E3IA 3VU1A 5JRZA 2I99A 1TYEB 4YJ2F 4OA5A 4RXMA 3T3IA 5CEFA 1H2YA 2PTGA 1OBOA 4Q9JA 2BEUB 2V6GA 3G2KA 3TW6A 1JQAA 2BEUA 3SU8A 2CLMB 2AZ4A 3NEYA 4M0KA 1TNDA 2G8LA 4FN4A 4NYJQ 3W6PA 5BWLA 4XSGA 4WBNF 2FWNA 4AG3A 2R85A 1Y1TA 4CETA 1IBRA 1BKSB 2BL4A 4MLDA 4R0VA 2A0XA 2CVOA 1C8BA 2HRBA 5HILA 1CJMA 1ZGBA 4IXTA 2NO6A 1QIEA 2ASVA 2ZRKA 1DLIA 2MMGA 3NNNA 5EZYB 4ACBA 3UIEA 4EHNA 4FWIB 3GH1A 1KJJA 3NBYC 4PGAA 4BCDA 1SQGA 4ZANA 2R8XA 4FHEA 3WK6A 3DO5A 3BOSA 2NUAB 1Q0ZA 1Z5GA 1DJMA 3SFZA 1PRYA 1T6XA 3GFBA 4KQIA 4AF7A 3N53A 3OX1A 3CZQA 1WCYA 1NBHA 5A9RA 5E3HA 4MAFA 3V8PA 2XGJA 4RA9B 1E2EA 1K7XB 4QXRA 4X91A 3AUJB 2H06A 2O07A 5CBKA 4YMGA 3KDAA 1YJQA 4AWBA 2NIPA 4UTPA 1QFSA 1FK8A 1HC7A 2JIBA 2ZR7A 5HE8A 5GV7A 1KEUA 4YWJA 4AMBA 5B2EA 1VL5A 3IILA 1PWHA 5CT6A 2GZ2A 4M54A 2IUUA 1T2EA 4JGBA 3UA3A 1OXSC 1TGVA 2IPAB 4JENA 1EBFA 3RTGA 2GZAA 5HM8A 2A5FA 3ZC3A 4KI0A 4OP1A 5L6MB 4NSNA 2WTAA 4GMDA 2AJCA 1HDYA 2QSUA 4ZZ0A 2CWWA 5CLGA 1JAXA 3G9UA 3X1DA 3CEHA 4ZOLB 5BORA 4LRQA 5ENVA 421PA 3RJMA 3U7GA 1OTXA 1Q0LA 2D2IA 3BEOA 1BE1A 4B5KA 5G0WA 3QSYA 2J33A 2C1ZA 5EKSA 1MB2A 3D8NA 5D00A 3AOEA 1Q83A 3QYFA 2IYSA 3SCZA 4BVJA 2EJUA 1C4WA 1NVDA 2O20A 4BO4A 2Z6VA 3HBLA 4IVQA 3V1YA 4I14A 1P4JA 2MDTA 3IDOA 3FW1A 4DNQA 4OHCA 3G7SA 1E32A 2AIRA 5A3SA 5KMGB 4B3GA 3C8DA 4CMIB 3OOYA 4CKBB 1AD2A 1N9ZA 2PFGA 1E1KA 3GG9A 1KVTA 1Z2EA 1ZIOA 2OC4A 4G0NA 3WA6A 1A9TA 3X43A 4BP9A 5K6TA 4AY3A 4KIUA 2X8JA 1EVYA 1YC2A 3PQ2A 4AKEA 3M49A 1A9YA 3HN7A 1XMVA 4GYJA 3C87A 3DFKA 3IBFA 3JQFA 4BNHA 1MTOA 4BMVA 5HBRA 3I0NA 4U7JA 1ZGAA 3EGOA 4U9IS 3DT8A 2ATVA 4D0NA 6REQA 4RMJA 1ZVJA 4JUCA 2P75A 1ORDA 3B1WA 2V55B 4JQYA 1KQPA 3LVQE 1QK5A 3DAHA 5DHPA 3JQAA 4HAOA 5KYKA 4OU4A 4G4SP 1RJEA 4ZALA 5L4SA 3C6QA 2ZRBA 2IHKA 2I1QA 1AN9A 3DMNA 1ISMA 1QNFA 3PFBA 3WWDA 2BDUA 3ILXA 4OB8A 2V7XA 3TRJA 1QIKA 2PMEA 2XCLA 1Q3HA 3ETHA 1A72A 1RLUA 3NHRA 1NXWA 1ZOOA 4NHOA 1A0OA 1ST3A 4NCJA 2AL7A 4EMTA 1LBEA 3CRZA 4AL4A 1CZUA 1R0CA 1YAHA 5HIKA 2DBYA 4MV1A 4YN3A 1IWOA 1O97C 2O6LA 2QZPA 5AVJA 3UJDA 4YAKA 2CYBA 3ER9A 3THYA 3VC3A 1GPAA 5BR8B 4IW3B 3IEUA 1ADBA 2WIJA 4O33A 3FHOA 3AHCA 4YLEA 4HRVA 4E12A 5AK0A 4FIZA 1WU8A 2PH5A 3WGQA 2CCJA 3OKCA 4UREA 1ZA2A 2GX6A 1Q0HA 5CA0B 2EL9A 4BVHA 1SA0A 3AINA 3LC1O 3E3MA 2P91A 4BECA 1ABBA 1L5RA 3EA0A 5DNAA 2ZR8A 3K9NA 2YY6A 2FN8A 2V45A 1OZ0A 1RKQA 4JP1A 3C7CB 5DLQC 3WMGA 3AVTA 4QJ3A 2H5IA 3BHIA 3PB3A 2JFPA 3KEQA 3IQXA 3H7AA 4EF5A 2AT1A 2G9NA 1U0BB 5LLSA 3T1HB 4LVCA 2J3DA 4QPDA 1RJ9A 7ABPA 1XN4A 1UDBA 3FNRA 4FCWA 4KR2A 4EW6A 2OECA 4YDHB 5A2GA 5HOEA 4P0PB 2IC5A 1IQPA 1V11B 3GZNA 3PK0A 3LIIA 1MX1A 1D1QA 4DWVA 3H4IA 4EL0A 3QA3E 1YXMA 2FRDA 3EQZA 3MM4A 2Q5HA 3JASB 4B2YA 1LBQA 3DUWA 4IFTA 1DKUA 5KDDA 3NTQA 2EP8A 3BH7A 2QXTA 4PY2A 2YRFA 3B82A 4L8LA 3NRJA 221PA 4RKQA 4F2WA 2WMNB 2JCSA 4G9BA 4BEWA 4N5LA 3ROQA 3S7ZA 3GIDA 2QPTA 2WM9B 3NPAA 1Z6ZA 4W5QA 1U1DA 1ZGJA 3QKSB 4LMAA 4KSCA 3PD7A 1U8FO 4TMZA 3LTEA 2JAWA 3SQDA 1YA6A 1EFRD 4X1IA 5ITSA 1JYEA 2HLDA 4F06A 4DB2A 5EYPB 1CS4C 1EE2A 3N0TA 2GM3A 1HE2A 1D9ZA 4J0EA 4YAIA 5LQRA 1IOLA 4CN9A 4TTIA 2QL5A 2NYUA 3X1XA 3ZK9A 1F2DA 1HI9A 4AJ1A 1E3WA 5K0FA 2HBYA 1SKQA 3DEKA 1I7PA 3EXHB 1T1JA 4FONA 1DZIA 3DONA 1VGQA 3GFOA 3ISJA 2ZE8A 4KQ6A 4KODA 4W99A 3RUEA 1QRSA 2PRYA 5HUHA 2EFGA 4JBYA 3N70A 4AROA 3AF0A 1REQA 2OB2A 4A8JB 3EA4A 3QP9A 1LQUA 3ZIUA 2O57A 1ORRA 4MQMA 3WZMA 3G9ZA 3C16C 2YFQA 3PVCA 1L3IA 3Q7RA 4GGPA 4A8JA 1L4GA 2FJUA 1R88A 4I55A 1N3YA 3GBSA 1IB0A 2VJMA 2DWUA 4LQCA 3KUDA 4XTRA 4OSPA 3WLRA 2PX4A 3O31A 5AESA 5F2EA 2LW7A 5T4EA 4UVIA 4ZZ1A 3TZCA 4OFBA 2IOFA 1XEWX 2CL6X 5G3YA 1QAOA 2Y71A 3W5DA 2GKGA 2PLNA 4FMPA 4QOHA 3RSSA 5DMHA 3VHQA 3ETDA 5E4YA 2B5OA 2VP5A 1FLNA 5A3JA 1AXRA 1XFDA 4HUJA 4JKIA 2AMJA 1N3IA 2EJTA 1IMJA 4HSEA 4B09A 2ZVPX 2ATXA 1TZCA 2I2BA 4MI1A 2HADA 1LDMA 1YBVA 3PNSA 2PR2A 2EEZA 2FFRA 4PCLA 4YTEA 2B83A 2JK0A 3W7AA 2HMTA 4RMGA 1MTZA 1N2XA 1RHRA 4PRKA 2IYEA 4RAQA 1VG9B 3FVQA 4Y2PA 5EXTA 2B36A 4R8LA 2J9GA 1EFPB 3B6ZA 5AMXA 2DU8A 5K3OA 4X62B 1LD3A 2PGOA 1QF9A 4BZZA 2OHOA 5DNCA 3HCFA 1Z38A 3NX4A 2R4QA 2FNAA 3I9V6 2KI5A 1YR7A 2JIDA 4Z4EA 4LRYA 2J0UB 1DZ3A 1R74A 1OFUX 4MUXA 4NV3A 3NDBB 1IK4A 1U3FA 1JHDA 1EP2B 3TTSA 1TB4A 5BV8A 1N2GA 2UXDB 1ULHA 2NTEA 4PAQA 4CT5A 1SCJA 2I80A 4KN6A 4FOOA 1NXTA 3V4OA 4BIIA 1BU8A 3OPYA 1K8QA 3ZHRA 5I9LA 1JMKC 4QZVA 2JFQA 2V4UA 1IHPA 1JDTA 2P3QA 4EBFA 3GW8A 1K06A 2CBGA 2AX3A 2NTJA 3BCHA 4FQ8A 5AVSA 5K7SA 1A04A 4IYRA 1FVFA 3NASA 3NHWA 2EFDB 5ELMA 4EPRA 4B3RB 2Y2UA 2FHSA 4KIWA 1U4SA 3VAYA 821PA 4Q7JB 2Q5QA 3KYIB 1W9MA 5H02A 4LGMA 3Q7QA 3VSAA 5EJEA 2YFKA 2DPMA 3LCUA 4HDKB 3A9UA 1U3DA 2FKNA 4PINA 5I7SA 1E3TA 2ZAYA 4R98A 3H99A 4KQKA 2PLRA 4RD2A 4UHBA 1WHSA 4M6WA 4D3FA 4PNEA 1YZLA 5CBPA 5H4GA 2QI9C 3DL7A 5T3UA 1ZMBA 2OCYC 2XCUA 5AW5A 5CYGA 1UM9B 2O1SA 2BGUA 2FMIA 1Z16A 3REFA 5HTOA 1I6MA 1KP3A 1JEJA 3WL6A 2NU8B 1JZTA 4WLOA 2NZJA 2IIBA 3TMAA 2B61A 3B6MA 3FZYA 1TUGA 4H18A 4R2JA 1E6WA 2SECE 1MNAA 2GB4A 5DN6A 4IIFA 2AOTA 1EFUA 4EABA 2P6OA 4KB5A 3JVUA 4M0UA 4PC3A 2XKJE 5T8KA 5TQVA 4ZV7A 2YJGA 1FYDA 1P4AA 4Z8XA 5A7HA 1AHHA 4QOEA 2L17A 4DM7A 4DREA 1K6IA 2EKLA 3OZSA 1J2TA 4JR1A 1SMKA 3MT9A 1UDXA 5ERYA 3R74A 5ICEA 3GG2A 2RGXA 1PJ8A 3RS9A 1M0SA 3EMVA 3C2QA 2OMEA 2OVFA 1ZZEA 1ABFA 2AJTA 2Z43A 4ZA2A 4DUYB 2FAXA 5CYFA 5JROA 1Y9JA 3GLGB 1G38A 4H1TA 3OQNA 4PG5A 3AUAA 1Z36A 1FY2A 1YZQA 2WKPA 4E94A 3NTLA 1FVXA 2JZCA 3I5YA 2HV9A 5CX4A 3WRXC 3MS2A 3ANNA 5LDGA 3W4IA 4CEJA 5ICCA 4NOMA 2TSYB 1VL8A 2ECPA 3L4BC 3OX2A 4MVYA 5C3UA 3RC2A 3SEFA 2B7CA 3WK5A 4BNYA 3KB8A 2WTXA 3T9EA 4ARAA 5FI3A 4PYQA 1UQRA 1FDTA 2PV7A 2QUZA 2CY0A 2NUTA 4QDJA 3TF5A 4U2CA 4HDMA 1PSWA 4MUBA 5CHEA 3ESZA 2J5XA 2YJZA 3DKRA 3MWFA 4ZCRA 2IH2A 4JX9A 2ST1A 4UCFA 1VCOA 3IIIA 3Q2IA 5LQNA 1KZ1A 4QYMA 3ZHZA 1IRXA 3QJGA 1C9DB 1DBPA 3C70A 4X1OA 1TYDE 2IHBA 3H1GA 2K2WA 2R84A 5C7IO 3DG9A 4BQFA 4YRSA 4MQFA 4TYPA 4MI6A 4NYIR 1YDWA 4B8ZA 2JJYA 3E9EA 1VZ2A 2WAYA 4X61A 3BFPA 3IO3A 3NWPA 4FDTA 4CM9A 3TLMA 1FFXB 1UZUA 4Z0TA 5K0TA 2P9QA 3DOFA 1KQGA 3HVHA 2X86A 1BXKA 3O94A 1JPVA 2HUPA 4M8SA 3CEAA 3IV9A 3FWHA 4H31A 1WCIA 1U8AA 3PLRA 4M0MA 5JS1A 4ECEA 3L8GA 3CS3A 3OZBA 3PNPA 4EA7A 2AE2A 2PXXA 1JR2A 1LV8A 1FFEA 2YMLA 3FGZA 2QD2A 5CX1A 3WIUA 1R00A 1NLMA 2R00A 3RBAA 4GLLA 2D13A 3N74A 2XMPA 4ZVRA 1Z82A 1SXJE 2FSHA 2VYCA 3FA2A 1YCDA 4R2WA 3T35A 5EUQB 2NUAA 4ZT6A 1OFGA 1PHPA 2VWPA 5K3AA 3WSVA 5AI9A 3F2IA 4TVBA 5EWJB 2QJWA 2N42A 1TEHA 5DSTA 2H9YA 5DLYA 5JT1A 2GYVA 3C97A 3O8NA 1IN8A 4YUWA 3HV2A 1NXOA 16PKA 1YD7A 5COBA 3U61B 3LDHA 5A7GA 2I6UA 4JOCA 4P33A 4JJEA 5FF9A 4DJ5X 1MB3A 2Q0QA 1W29A 2B8EA 1X7ZA 3FIJA 1YRQA 3SDZA 1KC1A 1ELOA 1NTRA 2R97A 2HLDD 3B9QA 3NHAA 4DA7A 3PX3A 4MR9A 3KWJA 4KX5A 5EIHA 3QX3A 1D7OA 4MB2A 3DVAB 3BMOB 3VU8A 3KELA 6LDHA 1WL8A 2WG1A 4D80A 1KMMA 1K7EB 1V26A 4BTLA 2HA7A 4II2A 2PS9A 1VJDA 2ZTLA 3FRHA 4OUKX 5F2NA 3L0ZA 5CCBA 3R7WA 1VLMA 2NUPA 3UC5A 4BATA 2NZ2A 2E4YA 1N5DA 4ETIA 2OHVA 2V6IA 2VHXA 2HW8A 1Y6JA 2VAXA 3DLTA 1K66A 3R2JA 4TXJA 3TLXA 3M8KA 3NTUA 3J7AC 1YR9A 3FZNA 1TMYA 1SJ9A 1T3GA 4LF7B 3IR7A 4U1RA 3UJ7A 3NW9A 5MHTA 1LSUA 2WC1A 4YJFB 4AYTA 3R3YA 4CFZA 4HDRA 2C07A 1DJQA 4R54A 3K9WA 5KTOA 3O3NB 3B12A 4LZZA 3F4BA 5THKA 3OETA 2V1XA 2Q3FA 4F6RA 1VYVA 3RUCA 1ESMA 2BMFA 2KBFA 1Q21A 2PX0A 1WETA 5KTYA 1I9GA 4ZCSA 1CUBA 5AVVA 1DG1G 3O8OB 1H93A 3A27A 5PGMA 2Y99A 1JILA 3P2OA 4KGXA 1G291 2X6TA 4FDVA 5KNBH 2GSWA 4CEIB 1C1HA 1MNQA 3L8FA 1S3FA 4YPVA 1M5RA 3W1VA 1XU7A 3BMXA 5L95A 1FLAA 3RFFA 1XCBA 3ICPA 3H1BA 5D1HA 1U0LA 3QBDA 2C7PA 4J7UA 4B3BA 1B76A 3UGJA 3PEEA 2FW1A 3TSOA 4GI7A 3FUXA 4X3CA 1O95C 2BGTA 4MUYA 2FQXA 2B4RO 4RDHA 1GCIA 5K6RA 4B7CA 4GICA 4LJYA 3KZOA 5DWQA 5KNDA 5I8WA 1N57A 3CLSC 1JHOA 2ONJA 4N0QA 1F48A 1W4CA 3A04A 4IJ6A 4M0CA 1LDEA 1HFWA 5EN4A 5FR2A 3SIWA 3WYBA 1ZR4A 2WUWE 4JC8A 1P5ZB 1RU3A 2HU8A 2XB9A 1XTSA 4ODIA 5JDCA 3EPHA 4JJFA 2ZJ7A 1O96B 4S1TA 4NK5A 4KYUA 2EKBA 1UAYA 1TXGA 2Y1OA 5ESXA 4RMHA 5DWDA 3B8HA 3PDUA 3PUXA 1L5VA 2PZMA 2O52A 2NLOA 3A26A 5DSZA 4JJ4A 1R50A 2Q3LA 2WB4A 4H4EA 4CR8A 4PLPA 4IH9A 3I01M 2VPIA 1E3QA 1IVNA 1GQYA 4DM4A 2OV1A 3ZWXA 3LHKA 1DTEA 2MU1A 4U5XA 5FV7A 1VKNA 3BXGA 5EQJB 5EIEA 2BTOA 2MJLA 4Q93A 4QHTA 3IAM6 1OBHA 4L4XA 1ZDMA 4ROTA 1OLXB 2B82A 3VC2A 2OZLB 2WPNA 3NHYA 1MJHA 3GAFA 4RE5A 4V24A 2E55A 1ZUWA 3H65A 3BXHA 1N2OA 4MYDA 5LZ2A 3D5EA 4G5RA 1KK0A 4IZIA 5ICSA 5F9HA 2JI8A 5ITZB 2EX1A 4BQOA 4UHDA 3EMDA 1KS9A 3H1TA 5B1SA 1QFZA 2BHLA 3IXMA 4KFUA 4Q19A 5DBEX 2I29A 4WOPA 3WY9A 3AR4A 3G82C 2UUAB 2GM9A 4Z8YA 4GVXA 3S0JA 4NTZA 4AP9A 2MSEB 4QTZA 2HK9A 1X39A 3Q7EA 3ZHXA 4C7OA 1Z3IX 2FRVA 3OAAD 3BE6A 1KH2A 3MCTA 2EF0A 1R0SA 4MPTA 2NPFA 5CFZA 5AKJA 3UAVA 3EZXA 1WB4A 3CZ5A 2YOHA 5AW3A 3K96A 1K0UA 2IIVA 2WJWA 4U9UA 3UWOA 2O7QA 5IT4A 4X92A 4EP1A 1EK1A 2I67A 4AF8A 2BGKA 2HF8A 2C04A 4EY8A 2O2EA 1T3ZA 1LCIA 1LLCA 5IBQA 3DDSA 3ZTTA 3TEMA 4FHDA 1I94B 2JCVA 1GL9B 4TLDA 2QQ0A 3FBWA 3JYOA 4MLZA 2JEZA 1Q0UA 5C8ZA 3FWPA 2Q3DA 2ZB8A 3H5WA 1AMNA 1SBIA 2ONZA 4NWIA 1SXGA 3AL2A 3IAXA 1XZCA 4DPKA 1L4BA 4WESB 3TQOA 2CFSA 2ZYSA 1W93A 2XZOA 2ZJBA 1XCLA 2FK8A 2ZBUA 3CQ9A 2J5BA 5L3SA 2C5LA 3Q7SA 3ZZMA 2C9DA 2D5CA 3B9BA 2OL4A 3T0IA 2PVPA 4EO9A 2CV2A 1Y7LA 1R4AA 3WLEA 2PMCA 5LL6P 3VDMA 4BGEA 2A0YA 1A77A 3QUBA 5KWJA 3H13A 4E14A 4KMSA 4RZXA 2VKTA 5IXJA 1IZYA 1U8ZA 3G9TA 4OBWA 2E5LB 4PSCA 1T5DX 4MWGA 3SSNA 3IR5A 1DL5A 4FNMA 4L57A 4TMFA 2ZRAA 3EGXB 3W7BA 2YV2A 3T7KA 1PWXA 2ODPA 3LW7A 5E9WA 4EKEA 1E2DA 4YP0A 5J40A 3ZD7A 3TMYA 1Z4JA 1T25A 2C3UA 3HACA 1NQVA 1E2KA 1W76A 3O73A 3TL2A 3KG2A 6ADHA 2YJTD 1GTG1 1N92A 2YH2A 4EENA 3K1ZA 5A6SA 2W2KA 1QG0A 4P3YA 3ZY5A 4NBWA 4US0R 3DBIA 3NAZA 1Z8FA 4LWZA 3KZNA 2I2DA 4KOEC 3MMSA 5TVGA 2FXVA 1W59A 4IR7A 2VQDA 1G8PA 3U5TA 3ICEA 4QPJC 1NHWA 1XFAA 3TH5A 3SM3A 5B36A 1UH5A 4UNIA 5IK2D 1XKTA 2WWWA 3MD9A 3CB2A 3CX3A 3FCXA 4TOIA 2PGLA 7MHTA 1CFJA 1RKVA 1HE8B 1TA0A 2FN3A 2ZJ2A 1OXVA 2JEOA 4E3WA 2R1TB 3EEBA 3H2GA 1IE3A 3C3DA 2BI8A 3I83A 4IIXA 2GEJA 3GZ4A 2DKFA 1H8HD 1C2TA 3WGLA 3EVBA 4AUNA 4IVRA 1G20A 4MYSA 3AZQA 4QYXA 5IVIA 1MA0A 4RQTA 3ZHQA 4F6RB 2I1WA 4OU5A 4IJUA 1NU6A 4BCBA 1NI5A 1OZAA 3D64A 3CLHA 1ZZGA 3ODPA 2F55A 2OWDA 1XDGA 3DMTC 2H1RA 1KSJA 1S7CA 2YJ4A 2IPMA 4TV8F 2C9ZA 3GUYA 4Z0HO 3R0IA 3B6EA 4YRJA 1AKYA 1KKMA 2AJLI 2V7QA 1SKAA 3NGLA 4WDRA 1ZH6A 3KTOA 4OLAA 2XUFA 4B7XA 4LFBB 2VHYA 2VJNA 3ITEA 2OUKA 3LM8A 4L6IA 4HXEB 3HE3A 1GG5A 3MTDA 3EULA 4XX0A 5D3MA 1RRGA 2DTDA 2C5EA 1EUDA 1XO1A 1QTNA 1NRWA 2C4NA 5SYAA 3EWNA 2GYWA 1X14A 2VRNA 2F9LA 2ORWA 1R5JA 4FX5A 4L4SA 3VKHA 5CDUA 1XXHA 4B3MB 3NNDA 3LDAA 2JJ1A 3DVAA 4X64B 4JJ8A 3IVGA 2IFTA 1PJLA 4IDHA 3ZGXA 2QB5A 3ZCVA 4FWTA 4QRDA 1OYOA 3ABIA 3OH8A 4UVHA 4A3SA 4A9AA 3F5FA 5EC8A 3AVXA 4IJWA 3GJZA 1J23A 1YRWA 2VQ3A 2QMOA 5EIWA 4PX5A 2PVCA 5KAPA 4WY8A 4LRWA 3WYAA 1RBMA 1NIPA 4N12A 3JU3A 1XVIA 2Y0PA 3NOQA 5LWQA 3OOEA 4EG1A 3F4LA 2P9ZA 5HM6A 1A8PA 4HLQB 3V97A 1FU7A 3KZXA 2JDIA 3JYHA 1SZCA 4Q4HB 3LUJA 3DV0A 4NG5A 2DRIA 1T9CA 4BFLA 4QBGB 2DYKA 4MA4A 1KMQA 3ZGVA 3IMKA 3MLEA 5D2CA 1GZVA 3CUSA 1D6SA 1JE1A 1YDHA 3Q3GE 3LOUA 4CLDA 5KNCH 3BIWA 2EW8A 4RE6A 1WO8A 1K68A 1JL3A 2Q99A 3D3NA 1T2DA 3QKRB 2G9UA 3I0ZA 4G0ZA 1BD4A 2YC4C 3P9ZA 3JQ8A 2FRDC 4K26A 4RPGA 4ZI5A 1K4MA 2R8EA 2FUEA 3WKDA 2WSSA 3BXEA 3F8TA 3T0GA 3PTAA 1YB4A 2ODAA 1GAQA 3K1YA 4FZJA 3Q8LA 5FNVB 1F06A 1K8XB 3DXXA 3BKWA 3LPCA 4MV4A 1AXEA 5JQGA 1O9GA 1U6KA 2MYNA 4ZHQF 1U1CA 3RK4A 2BZGA 3FN4A 3S2GA 2HC9A 5AM3A 1QQ7A 4V03A 1NFQA 1O2DA 3L7JA 3QVKA 5BQOA 2ZAGA 1PR4A 2GAIA 1B6GA 2EXXA 2X2OA 3O3OB 3ORSA 4FFPA 4XDGA 3E05A 3TD2A 4ZV4A 2HLPA 5TPZD 4HPWA 4XGNA 5DRTA 2XAAA 3HCDA 3LP8A 3PTZA 3TLCA 5DYYA 3UT0A 1D2CA 5DNDA 4KN8A 1ZINA 4S1WA 4RBNA 3C4QA 4EY7A 1QU3A 2IA5A 3I3SR 4LZAA 1V9SA 4YBRA 1VBFA 3W9YA 2I1VB 1G5RA 3E2PA 5AH0A 2DXIA 3RS4A 3E35A 1IDN1 3JQPA 3M4JA 3NTXA 4RF3A 1MHPA 2F3TA 2OORC 1DRWA 2OMKA 4LJRA 3KJXA 3ECSA 3AFOA 2LIVA 1F9EA 1KAMA 3TSAA 1C2YA 3WHPA 4MH0R 3FHLA 3CPSA 6GPBA 5C9ZA 1RKBA 4HZGA 1PJQA 3QIVA 2XHEA 1Q1ZA 2W4IA 5AM4A 2LTAA 2B7LA 3GJSA 1DIAA 1I3NA 2QUHA 4KRXA 3UBMA 4PIVA 1HO3A 4BPBA 1JWBB 1JSXA 3GRKA 2FHPA 2DQKA 3RUIA 3AC0A 5EVCA 4G86A 5IHXA 2PLFA 3SEAA 1ILWA 2Q3CA 4PFKA 1H9BA 4ZICA 5FUQA 5MF6A 4TKLA 2GOYA 2OHXA 1F4VA 3IEXA 2CF6A 1G6OA 1UWVA 1Q0TA 1YHZA 4MS1A 4E30A 3CLUC 4MS3B 5T8KC 2C58A 3MJRA 4MS1B 4KYVA 1SUCA 4MO9A 4P4LA 5BP7A 1E2FA 4MP3A 4R9RA 3PCRB 2A67A 4ZT3A 3ZNQA 2YHAA 4MWBA 3BTVA 3K1JA 4F8EA 4XVUA 2G6BA 5EZYF 3WTBA 4WDQA 1SAYA 2GBIA 1ANKA 1XZHA 2WHYA 3HVKA 2R7NA 4FR0A 3LW8A 2BFBA 1RYYA 3BJEA 3NJ8A 4YJ3B 1P6QA 2FWJA 5AVOA 2DM6A 3R23A 3MSXA 4MR7B 4ZODA 3S81A 1I4OA 1JPNA 2WOJA 2PT5A 3OIUA 1IY1A 4Q12A 1VIMA 1G9TA 4R8RA 1MABA 4K9PA 1USKA 1R6UA 4N1AA 1HQDA 1E3EA 1PO7A 1PZXA 5DI3A 3WL7A 4PVDA 2IXAA 5IZCA 3SNKA 1HNWB 3KX2A 4RPJA 5HFAA 1NJ5A 4BNVA 3GLIE 4DOMA 3PITA 3Q7TA 4PC1A 1CUZA 1CUUA 3HYCA 4P3OA 3OJWA 1AF7A 4O4HA 3GLHE 4CFSA 1WDMA 2GBPA 2O8FA 5EE9A 3LOPA 4WOJA 3AKYA 2B1GA 4HQOA 3WXMA 2BKAA 2WHPA 2J6CA 5B1DA 2XZDA 3PHJA 4EGAA 5FLKA 2QDKA 2AXNA 3MINA 3TZEA 3D0QA 1IM2A 1AGNA 3CJQA 4DXAA 3SKYA 2OV2A 4OD0A 1OZFA 2GXSA 4AJ4A 2XH8A 4A73A 3NR2A 1NVBA 3OMXA 3D6AA 3PDHA 5DCYA 1VBNA 2JARA 3ID6C 2BVNA 4QREA 5ALZA 4IH4A 1AH2A 1H5NA 1EQUA 4TKVA 4BNDB 5BNZA 1LBHA 4BRWA 1KAGA 1U80A 3A4YA 2WFZA 1YKGA 4GC9A 4K6KA 1JV2B 4JCOA 3R7BA 4QU8A 2ZE6A 4JXKA 4WFKA 3A11A 4DLWA 3IP5A 3CWCA 3U56A 4U9HS 4BJ6A 1N78A 2TMYA 3GT0A 3PPXA 3IQZA 2C9CA 2QU7A 3FGPA 3QX8A 3O8LA 4A2WA 1VJRA 3I30X 1UADA 4KUEA 1GL7A 4NNPA 5EPOA 3KJHA 3STVA 5E95A 1OXMA 5GP1A 4JI2B 2YYSA 3F1LA 1BH2A 5K8IA 2CJPA 1QRRA 3HYNA 4DRXB 3RAEC 1SC3A 2RI0A 4UOZA 1IUOA 1SOMA 4MPPA 4D02A 4BKRA 4QAJA 5ADVA 2XTMA 1AKMA 3AR3A 3ZY6A 1A82A 4M22A 1F4PA 3RS0A 1R0YA 3HJHA 3H9EO 2R4UA 1ZPDA 2YTZA 5AOAA 1RXSA 3KQSA 4LNUB 5C8YB 4HGPA 4Z54A 1SVOA 5EFOA 5J2UA 3U4QB 1KOFA 5BPFA 2DERA 2D0PB 4G25A 4M87A 4WKBA 4IP0A 1G20B 1LPNA 1JVBA 4P8RA 2EBHX 4QUAA 2JJMA 2OK8A 4JSRA 4MULA 1CUXA 4G9EA 1HR0B 4PYOA 4V1CA 1Q20A 2R1TA 1GPWB 1WP9A 2D5IA 2RHOA 5L3SB 3HJNA 2UXCB 5ADWA 2R0QC 2OEPA 1UMBA 3WK4A 5CT9A 3O1HB 1NATA 4XPIA 3EH1A 4DIFA 4GD3Q 2B4YA 4K86A 1JB1A 1NJGA 2CDNA 3T3EA 2ZP1A 4RYLA 4IS2A 1YQ9A 1O6BA 1YE5A 2MSCB 3PUKA 2ZUCA 4HQ6A 3TPZA 1QQ6A 4IXDA 5AUPB 1D6NA 2G6TA 4KXWA 3GK3A 3H3JA 3LKBA 3OIGA 4BZQA 1Q1BA 1HURA 4LY0A 3HCWA 4PTYA 4BO3A 4HH4A 4K9KA 4KE6A 5DU2A 5CBPB 3IEIA 3USES 2A8YA 1MD9A 3I28A 3IUJA 4IO1A 1ZUNB 4FJ2A 5CJJA 4DABA 4G8JA 1RPJA 3FJOA 3L1VA 3SAJA 5AO9A 4JI8B 5DX8A 3IAFA 1MDBA 3QWBA 2HHAA 2Q2QA 2IS1A 3Q9LA 2CD9A 1JFRA 1FCJA 3CV3A 4HZIA 4JI1B 2HA3A 3K4HA 5LVAA 3A1CA 5ALSA 3DQQA 4ENSA 1Z15A 4JWKA 5DW0A 2B0JA 3ORHA 4BFYA 3AY7A 2BMAA 1AQJA 1QH8B 1RHKA 2GRUA 2ZYTX 3D59A 4RPLA 4ZREA 3ZGLA 3CKLA 5J43A 2AUMA 4AZ0B 4EF6A 1PL0A 2GCGA 1N9GB 1NNSA 2YY5A 1K6JA 3GNQA 5J2TF 4DADA 1FIUA 1M1YA 2SICE 2OKGA 4D8WA 1Y5IA 3DCYA 1DCFA 3FNEA 1A95A 1X1DA 4H59A 4WOBA 1SU7A 4O5OA 3EVGA 3HJCA 3PIIA 4ECAA 2GBLC 4BV2A 1W2WB 2PUJA 4TXLA 4E5UA 3F5SA 2ZJ0A 3RYFA 2VJOA 4KYTA 3O2QB 3VR4H 2V0NA 2W8ZA 3B7PA 2VATA 4FBLA 4NS1A 3VHRA 4B3FX 1U8XX 3LXRA