3GT6A

Crystal structure of the hspa from xanthomonas axonopodis
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
100
structure length
100
Chain Sequence
TAQWVPRVDIKEEVNHFVLYADLPGIDPSQIEVQMDKGILSIRGERKSESSTETERFSRIERRYGSFHRRFALPDSADADGITAAGRNGVLEIRIPKRPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of Xanthomonas small heat shock protein provide a structural basis for an active molecular chaperone oligomer.
pubmed doi rcsb
molecule keywords Low molecular weight heat shock protein
source organism Xanthomonas axonopodis pv. citri
molecule tags Chaperone
total genus 17
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3gt6A00
1EJFA 4PCKA 2XCMC 3QORB 4YLBA 5DS2A 1X5MA 4YLCA 2Y1YA 4ELDA 1WFIA 4RZKA 2KMWA 2K8QA 4MJHA 1RL1A 4PBDA 3VQMA 2Y22A 3W1ZA 2BOLA 4JUTA 3VQLA 3GT6A 4M5SA 4M5TA 2KLRA 3QORD 3AABA 1SHSA 3GUFA 3L1GA 3L1FA 3QORC 4I88A 4FEIA 3J07A 4YE0A 3Q9QA 3N3EA 4YDZA 4YL9A 5LUMA 2N3JA 2N0KA 3L1EA 1GMEA 2Y1ZA 4ZJ9A 2RH0A 3Q9PA 2O30A 3IGFA 2WJ7A 1WGVA 3GLAA 3AACA 4JUSA 2JKIS 3EUDA 3QORA 2CG9X 1WH0A 2MNWA 2CR0A 5DS1A 2WJ5A
chains in the Genus database with same CATH superfamily
1FWXA 3SJVB 1LP9E 4JZJC 1MRCH 1AD0A 1FYHB 4QF1A 3W0WE 1XCQA 3U4AA 3QWOA 4NYLA 4N0RA 1LO3H 3DX8A 4DO5A 1EDYA 5ABDE 5GJTH 1H0DB 1FV1B 3GK8H 3NSCA 3VU2A 4DEWA 4QHKI 2Q5BA 5E9DA 3CSYB 4IKNA 2DQIL 2BNQA 2ZIDA 1W16A 1AY1L 3FTWA 3ILQD 4NKDB 1RIUL 5CEYB 1UOLA 4Q8BA 3V0VA 2QVFB 4HZLB 4E36A 3TA3B 5A2KH 1IC1A 5JUEH 4YMPA 1TU2A 1MEXL 3GDBA 2H0PA 4FRWA 3JV4A 1I9IH 4KQ0A 1IM9B 3AGWA 4JFPA 2VQ1A 3L4XA 1EWHA 2B2XL 4MS8C 1TMQA 5I1IH 3NEEA 4BRVA 2PLTA 1CLZH 4NB7A 4IU2A 1KWGA 1KCSL 3NDYE 3VRLF 3QW9A 4WV1B 2BW4A 3QCUH 4DQOL 5TFSL 1H8OA 4GMTL 4RSYA 3RVVD 2I24N 3VGBA 4AXWA 3CX5J 2XKUA 5A2CA 3GMNA 4GRWH 2NY1D 1JPSL 2QR0B 3DROA 4WSKA 1MCBA 1AD9A 1MCKA 4FL4B 4GIAA 4PFEA 2PW2B 3QUKA 1DSYA 2VDPH 2DLFH 4KVNL 5IJKC 3QXVA 1I1AA 3TH4T 4XAWH 1USZA 1P69B 3SCMD 3L3DA 4Q9QH 5F71A 1S8DA 2WYTA 3NT0A 3WDIA 5MEPB 4RMSA 2OL3L 2YSSA 5E2JA 1WPCA 4F9LC 4POUB 4LARL 1FJ1B 1ZVYA 2XWCA 1QFPA 3DV4A 5IB5B 3M8OL 4GUPB 4QKXB 1A3LL 2R29H 1MCQA 4W81A 5C6WH 5CR8A 1DQQA 5GRJL 4XCEA 3EGSA 1AGDB 4HIEB 5E2VL 1BQRA 2XNAA 1L9NA 4MVBC 4WFFE 4Q9CA 3FAXA 3B9VA 5FB8B 2R0WH 4FG0A 3V6ZA 3EYFA 3QQXA 1WS8A 2NTFB 1H15B 4WO4B 4ZZFA 4XP5L 1TJHH 2J1XA 2CDGA 3VM5A 4N5UA 3ZMRA 3X14A 4JO4H 2OULB 1I85A 2LR4A 4HJJH 1I8IA 4LKCA 5BV7H 4OLVL 3WUWB 4W9EC 1JHLL 4QHMB 3HCVA 4E41E 1WZ1H 3KAAA 4GRLB 5F6HJ 3KLQA 1AXSA 3J7HA 3FTGA 2C5DC 3WGUB 4FC3E 1MI5A 3FQTB 4WKZB 4ODWB 3BAIA 3BKML 4CMMA 1A3RL 5TF1H 1JZHA 4UV7H 2F8XC 3OJDA 1XR9B 1KN4L 3FFCE 3GJFA 1DDHA 1QFWL 4RFEA 5CKGA 1LQSR 4JPWH 3EJPA 1MLCA 2BOBA 4NI6A 2DW5A 4YC2B 3DVIA 4ZT1A 1ESOA 2A6JB 3LQAL 1MCJA 4JR9L 4CW1A 3MUZ1 5AW2B 2IGFL 4WSGA 2IMNA 4IBWA 1E3FA 5D7SH 4Z0XB 3VDCA 4L3FA 3N43B 4ZXBC 4I48B 3FU8A 3F00A 3KH4A 4K0OA 5DYOA 4ERSL 4UTAH 1SOXA 1J0ZA 3GI8H 4X6CB 4S1RH 1FORL 4MQTB 4YLCA 4HBQA 2R2CA 1RUKH 3MNWA 1L6XA 4N2GA 3JTBA 2YRBA 4F15B 2Y3AA 2VC2B 3IM1A 3Q6FB 3WS3B 4ELMA 3IMUA 3JVGA 5FC9A 1UT2A 1CGXA 1JZGA 3BAEL 1NGWB 4FQXC 4M02A 1CDCA 2RD0A 5C0FB 2WVTA 3S36H 1IGIL 3MLXL 2HRPH 2VR3A 3U36B 5D7IA 4B6ZA 5EZJA 3BMWA 3EJSA 2JSFA 2I07A 2WN2A 1HSBB 4EN3D 3ULSB 1JE6A 1OGTB 4U31A 2IG2L 5I74C 5HPOA 1F1AA 1TITA 2EH7L 1ACCA 1DVTA 2IQ9L 3CLWA 3QHZL 3F12B 4LHUA 1VERA 1FUNA 1WAAE 2GEEA 1EHNA 4PIRF 4K94C 3WKML 1UD5A 3EJUA 1TQSA 3QDME 3D85A 1XGTA 3NCMA 4XPTH 1SDAB 1KTDB 4M8RA 4H8HA 5IKCB 4UM9B 2P26A 2TSAA 3T8XA 1ZA6A 5C0AD 2X3CA 4OFKA 1CYWA 3NFSL 4X4XB 4J3OH 5HHXL 3OC8A 1SJEB 1P84K 4TNWF 1BF8A 3H6AA 5CJXA 1WAPA 1JPTH 1L9PA 3GLDA 3LN5A 2XKSA 3SHSA 1T04B 1M6OA 2PO6B 4B50A 3VGFA 2IANB 3BVNA 2AABH 2B15A 2VR5A 3TEYA 1HCVA 1MVUA 2ZE0A 3IXAB 3MKKA 4NZUH 4U7KA 1ZLUK 5BXFA 2NY3B 4H13C 4JFYA 5DHYA 2G4EA 4OGYL 4NRZB 2NY7H 4A2GA 3T6QC 4ACPA 4R4FL 3MQIA 3IJ7A 1BLNA 3L7EA 1V5JA 7PAZA 1RUMH 1E6JL 2VLMD 2OSYA 3L3GA 4HUWB 3FQXA 2WBJA 4LVHC 2BX5A 4PG9B 3K91A 4XMXA 1J8KA 3DX6A 4MJ2A 1MHEA 1A7PH 1CFBA 2L0DA 3L1OL 1F6AA 1RZJH 1NAML 5C8JB 1U8QB 3OJMB 4LCWD 3ISRA 1T0NB 1WBZB 2DTSA 2AQRA 4EI5B 1IGTA 5D1QA 3VXNB 1SLUA 5SV3A 2V5RA 2X12A 1OGAA 5EMYA 2W07A 1KMGA 1E4WL 1G7HA 2B4CH 2AJZB 2R29A 4R8WL 4AW4A 1W2KT 3RGVD 4G8FA 3SE4C 4QWWD 3OXRB 4MMZA 2BHFA 3LOWA 2CO3A 3HZYA 4K15A 4JG9A 5DWUH 4P9HC 2H45A 3O6FC 3MLYH 4PJEF 4WI7A 1TTAA 3VXPB 1XCTA 4F5CA 3RZCA 1G7LA 2HWZH 1P7KB 3AAZA 5EC2A 2W9LA 2CKBH 2HN7B 3MFFB 5AG9A 1BVNP 1EAQA 4KRNA 2QFPA 3G5VB 1FVDA 4C83B 4OZFB 3Q5OA 4XPBL 3FN0H 5HJ3A 5I0YA 1IO4C 3WELA 1IC5L 4LLUA 4HS8H 4UIKL 2HXAA 5KOMC 1HQ4B 4R4NC 2EC8A 2R39A 5JIKA 3F7YB 1ONQA 2CM5A 4KH9A 1I8KB 3TU6A 1VDGA 1I7TB 3K1DA 4U4IA 4PLKC 2OTWB 5LNDA 1W0YT 1JVOA 1A6UH 1UXSB 4ZW5A 5T3ZL 4XMWA 1DFBL 4LLWA 2G5BB 1NDGA 3IFLL 1TKWB 3MNVA 2G3ZA 3BFOA 4BDVA 3QNZB 1JNLL 4PRHA 1MHCB 5CUSH 3PHSA 1NAMA 1YHPA 4Y4HB 1RUQH 1J10A 1QBAA 1OKEA 3SPVB 4O2CA 2Y36H 2OI9C 3L8QA 1FAIH 2YGOA 1XF4A 3C5JB 5IHLB 5EO0A 4JO8A 4FI7A 1HI6B 2VR8A 1QRNE 4Y5VC 2XFXA 4WEEA 2VZVA 2W81C 2YRLA 5CF3A 2XSKA 4P2RD 1FZKB 3AG3B 1PKQA 3MLRL 1E8YA 3DGGB 3K6SB 5I2IA 3EJRA 1UZ8B 4E9LA 3DXAD 5KBKA 4MAYB 1HZKA 2R69L 4GUQA 4BH7A 2Q3ZA 2VDKL 4OGAC 3U9UB 1EXUB 2X6MA 2A83A 3QO0B 1RZGB 3F65A 3IB4A 4JFUA 4KAQH 4UQ9A 3TA3C 3EBAA 3EUUA 4R4BA 1KXTB 1U8JA 5M94B 1YO4A 4FFYH 1UWXK 1G1YA 3OKDA 4Y19D 5DYFA 1KACB 4IRSB 5HD8D 2OMYA 2GFBB 2F19H 5FYKE 2CHDA 1A7OL 3AWEA 1W0WB 3VXMD 4F7KA 5AB1A 2W9EL 3A6CH 3PP3H 2BP8A 2YC1A 4HPOL 1DVFD 4DESA 4PGBA 3T2NL 2HLEB 5D8JL 2JKTM 3VAEA 2LAAA 1U58B 3HJ0A 3IE4A 4MHHG 5GS0C 3OMAB 1UEMA 2RQ8A 2ZOUA 2RAMA 4X5XA 5FHAL 2FWUA 2LHAA 3DTUB 1XZ0B 3QUYB 2ZWYA 1NCTA 1JVKA 1MHPH 3HR5B 4YDJB 1PZ2A 1UGKA 4QT5A 1XQ4A 4HUUA 2HT4C 4EO5A 3F7PC 3E6HB 1ZOXA 1K2DB 2P5ED 3O4LB 2E7CA 3NJNA 3OF6A 2RB8A 3B2UC 2GJ6B 5J12B 1HINL 1KFAL 2AKRA 2Z8RA 5HSFA 4I5BA 4WHTB 2QKSA 3NSJA 1BM3H 1G7IB 3D25A 4NQTA 4OCYH 1IRAY 3MRLB 3U2IA 3KWWA 4L8SB 4NO5B 3AMKA 3V0GA 3CDGA 2DEYX 3TCLA 2AQ3A 1SY6H 2IDSA 3I9IA 3LZQA 3BPNC 3U79A 2BWQA 3GBLA 3FB6A 4AM0B 2V37A 3EH1A 4OLYH 1S7QB 3HC0A 2J88H 3HE7B 1INEH 2VIRA 4P2AA 4MD0A 1YEEL 4A2DA 4Q4IA 2OMZA 3KXFD 4KJWD 4GRLC 3RFZA 1VACA 1VFAA 3SKJL 4K5LA 3RWJA 4CKQA 3TXAA 5ICYB 2EIBA 1IE4A 3LN4A 2YD8A 1ACXA 1ZKAA 1J0IA 3O8XC 5JHAA 3MLWH 2IBZY 1N3NA 5EUOB 4L0YA 3KYNB 3VXSA 5T3XD 2OMWA 4YDIH 3ZZLA 3BVTA 1S5IL 4YIQA 5AKSA 4GAJL 3QJZA 3TTSA 1BF5A 4JM2B 3SPHA 5DA0B 1FH2A 2F68X 3ULUD 2EKSA 3MC0A 4Z7WA 2D7NA 5AVUB 1LK3H 4BFKA 1ZD6A 4XCFL 4YHMH 3B5GA 4ZX3A 4XP9H 5JOPE 1SHWA 1CE6A 1ZLWH 5K1NA 5C0BB 4M5TA 1GRWA 5B7MA 1AO7D 3BAWA 2DYPB 4AGNA 2W65B 3UTSB 1AJ7L 1UWGH 3QFDA 4YGVB 1LK2B 4NKOB 4PY8J 3ZGHA 4HQQL 4F15C 1FA4A 4S0TD 1LO2L 5D96B 3ROLA 1P5UB 2ZKHH 4WVRA 2E46A 3GIVA 1L9MA 2WAQA 1XH3A 1JGEA 3UTTE 3ZE1B 4PGJA 3UZQB 5F1SA 3SD5A 4R90L 1VEOA 2FECL 2R2HA 4JKMA 5FA3B 1NCUA 2Z7YA 1AP2A 5E8PA 4FMVA 2Z4QB 1M1XA 4JM4L 4NPYB 1JHTB 3BQUD 4U1KB 3LVEA 3V5KB 5E2WL 4JRXB 5DUBB 4OZHB 2ZXEB 3MU3A 2MHAA 4DGUA 5IWLA 3QIBA 2Y23A 3ZTDC 1EDQA 1KLUA 1KYOK 3ARQA 4DCQB 5C0IB 1QBLH 3N9GH 4X7SL 5KVFL 1SHXA 3ATEA 3F6LA 4RISH 5FA4A 3X3GL 3K6DA 4NFCA 1XIWB 4XCNA 1I8MA 3MBEB 4N0UA 2M83A 3VRJB 2VDNL 1EERB 5GZNA 1WZLA 5SWSE 2UZIL 2BNUA 2QQKL 4H25A 4Y88A 5A2BA 4XBGB 4X9FA 5ILTL 4KKNA 4NM8H 3FT0A 1AE6H 5LGHL 3L3HA 2H4EA 4FXKA 3PHOB 5L9DH 5GGVL 1RURL 1JGUL 2IIJA 4WWID 1NKRA 5I6XB 2B20A 5F9JB 1MNNA 3QUXA 4FFYA 1R5WB 1BIIA 1A7QH 1IGCL 1CG9A 4PU2A 3T77B 3VMNA 5GISL 5JYLA 2CJUL 2PO6C 2UUDH 5DS2A 4IGBD 1UM5L 3LKNA 3UZVA 3HPLB 3IDNB 1NUDA 2H1PH 2AP2A 2J4WL 5HXMA 1G7JB 3VRIA 1IV8A 3HC3L 1OQOA 2EH8L 1RY7B 5KG9B 5C6PB 1MQ8A 5IB1B 5FECA 4N90E 1DQLH 1YN6B 3UC2A 4NRXB 4XC3L 4NN6B 2B9BA 3VNYA 2YGPA 4O5LL 2VLRB 2C4XA 1EHLL 3PAUA 4H0HB 4FZEH 5ALCL 1J1OH 1HAWA 3A23A 3A4FA 4L8BB 4KNQA 1GOFA 1BMGA 2I32A 4N68A 3CFBB 4WK2B 3CSFA 1PD0A 2ZJSH 1MFAL 2JLPA 3T71A 5B7FA 4NZTH 1JDDA 2WVSA 4JS7A 4PJGE 4KC3B 4XC1L 4O51A 2A74A 3E7JA 4JHAL 1P4IL 4YDVB 1EFXB 1K85A 2CO6A 3FNKA 3LRSB 4M7KH 4U05A 5AYUH 4ZDHA 4I9XA 2J6WA 5JW4M 2CBTA 1V3MA 4LP4A 1RI8A 3X11B 5CEXA 1J8HE 4X9YA 4XB8A 5EZOH 5CEZE 3HB3B 5HHMD 4FG4A 1EO7A 2ADGA 3PAYA 5C09E 2PR4L 5D7KE 3O2DH 1M1SA 2PTTA 3UYPA 1J9CT 1OTUC 2VDML 3QRGH 3S3JA 1IQDB 3Q2WA 4KY2A 1TLMA 4PS4L 2J72A 3WEAA 1XSIA 3U0WH 3L9EA 5F6HI 5INDA 1F3DH 1E2ZA 1L3WA 1ZE3C 3ZTCC 1DLFH 1B2WL 3GMRA 1RJZA 3UDWA 4OIIH 2GIMA 2AQSA 3CFEA 3PXJA 1E6OL 3UX9B 5A6LA 5GGUA 1CFVH 4YBQC 1E28B 2QHRL 3SDDB 4OCXL 2E0PA 2RGSA 3NDZE 5T1LD 3L5IA 7FABL 4LCIH 4I1NB 3G6AA 5E70A 4K71B 1YDPA 4RH4A 4AYDC 2Q9OA 1AQMA 5GZOC 1TTFA 2X1XR 3U1SH 4PBDA 4FABH 4NN5B 4CJ0A 1T0MB 3JT0A 4PJXF 5EB9A 3VG0H 3UTQB 2CD0A 4ZPVA 3VXRB 3P0VH 4JGUA 1T4KB 4JQVC 1V8HA 4WNJA 3DUSA 1N4XL 4DNLA 3KYOB 5C0ND 5JIPA 1NEZG 3GHEH 1XEDA 4UBDC 1FG9C 1QEXA 4Y4HC 1IBDA 4X9HA 1Z1WA 5C3LD 4BSVB 4LQ1A 5CHNB 3OM3B 3SBQA 4QRBA 2HKHH 4GPVA 1EAJA 3UGEA 2VDQL 4KDTA 3H9ZA 3DVGA 4LLMA 1A9BB 4M7LL 1FFPA 2GG1A 2QVMA 1JGDA 5TDPB 3LXCA 5B3SB 2V5MA 4QF1B 1F4XH 1TJMA 2A2QT 1ET5A 1VGEL 4NYLB 1G9NC 1PSKH 3CZSA 4OLWH 5CZXC 1HIMH 1JZFA 5HHOD 1JG9A 1GGBL 1DUZA 4MAYC 1YNKH 3WO3B 2NY5C 3O6ML 5TH2A 2A9NL 3T0VA 3ESNA 4BHUA 4GG8A 4HWEL 2NX5D 3ALXA 3ZE2E 5LUMA 2BNQB 4NSKA 4K3DH 4MXWH 3RDTB 4DTGH 4F91B 1UD2A 2P28B 4HKXB 3UG4A 1AQHA 4P46D 2FZ3B 3ULVF 2KHAA 4IRSC 2ZCZA 4XOAA 1TU2B 2ZX5A 2VSKB 2ZG3A 3O41A 4BFEA 3SDXE 2AQPA 3IGUA 3JV4B 4PWFA 5E7FA 5HDBB 4JFPB 2VQ1B 1NGPL 1A4CA 4PJDA 3L4UA 5CS7A 4DVRH 4D0DA 3LKSA 4TVPD 5E8NA 1OGPA 1OSZB 2L7QA 3A6BH 4UZGA 1BG9A 2LLGA 3QQ9C 4GFXA 2YEZB 4YBLB 2YJQA 1U41A 3ABMB 4I13B 2DL2A 4GRMA 5DZAA 2ZCLH 4P5RA 3VFPA 15C8L 2YK1H 4LCYA 5K59E 3CFMA 2CPUA 4Z3GA 1XR8A 1EO8H 3DROB 1CI5A 1JZ7A 1AD9B 1IAII 4QAWA 3QUYC 4GKOA 4YSAA 3KPSD 4KTDH 1I1AB 4JRYE 1HHJB 1T66D 5G2NA 3H1ZA 3L3DB 1S8DB 3BMVA 3GYRA 4X6DF 3ZSSA 4IRJA 2PCXA 2JB5L 1OEZW 2YSSB 4XHJD 4ODHH 1BJ1J 5FF6B 1A0QH 2EECA 1ZV9A 3SGEI 4YFEA 5J12C 5AG8A 2YRPA 5D6CA 2WQAA 4B9YA 3N1PC 4PEEA 4NO0A 4QY8B 5AW8B 4U6HB 4ZS6C 2VJ8A 4JX0A 4HISA 2N0MA 3B2MA 1BP3B 5HDQH 1NC2A 2NYKA 3O0RL 3KLLA 5E2TH 2Q1EA 3V6ZB 3EYFB 5DD3H 3X13B 1ZT1A 3I6KA 4GKZA 4HAKA 4U1GB 5L4FA 4TV3A 1RCYA 2L8AA 2Q20A 3QBTB 1JXGA 3LZLA 2CDGB 2EP6A 2Q86A 3HE7C 4B5ZA 1CI3M 2IV8A 4NP4H 3MRPB 3X14B 2HMID 2P49B 1EMTH 1KFGA 2F53A 4U0QB 3CU7A 3ULAB 3MREB 4HH8A 1A64A 1TEGA 1EEZB 1H3VA 3RI5K 2JTYA 1PCXA 5LDUA 3TFBA 1D6EA 3FXIC 5J1SC 1OAUH 2CAKA 3NJMA 3KBEA 1B3JA 5BW7C 3C5ZA 1MI5B 4XCCH 1CS6A 3BP5A 1TEFA 4K23L 1TXKA 4JFDD 4MJID 4N0YL 3OLGA 1PLBA 1DDHB 3SGKA 4NWTL 4RFEB 5I5JA 1HWHB 3C60C 2MMXA 4JY5L 1MLCB 1BX2A 1IUZA 4GT0A 4A2HA 4C8XA 3WDHA 4OGXL 5CLYA 3QUMH 4NZRH 4HV8A 2OW6A 2C4FT 4KROB 4NBYB 1JL8A 4H8VA 3WENA 5ID1B 4G6JL 3V8CA 3Q6GH 2WLIA 25C8H 4L1DA 4L5FH 1OAJA 3BUIA 3EYOA 5DYOB 4XBPA 1X5XA 2JKLA 2H32H 4YE4L 4P5MB 3CH1A 4JKPL 3UZEC 12E8H 3PY9A 4LHJB 5I1CH 1GYVA 1MUJA 1QYGH 4PGZA 3T4YA 1NEUA 3SQOH 2BIQA 2A73A 3KYAA 2X3BA 3MNWB 1A7NL 3MUJA 3D08A 1BVLB 3MV8A 4W9JC 2IALA 4YHKL 3NBNA 3VW3H 1P5UC 3BISA 4OFDA 2FB4L 4RESB 3VUAA 4XWGH 1TF4A 4WFFD 2KUTA 1YMMA 2X0WA 1S7SA 5B4MD 3RL1B 4BKTC 4ZMPA 1ZLUH 2O30A 2PYEA 5EDXA 1EJOH 1UKTA 1KXVC 5E5RB 3RTLA 4N5EC 5GRZA 5BNXD 4RZCA 1MIEL 3IU4L 4NZ8A 5EZJB 2I07B 4XNYH 3V4VB 3CLFH 1Y7VA 2HFEA 4HHAB 2CKNA 2FX8L 4U33A 4MA7L 5GRUH 4U6VL 1MFNA 3WL9A 4J2XA 2X3AA 4Q9RH 4WJ5A 4LHUB 3VWKA 3UAJC 3GF8A 5BVJB 3NZ8A 2FLBT 1JGVH 4KI5F 5E8EA 4DN4L 5ESQB 4WF7A 5A2IH 1NPJA 3OBAA 5FO8A 2HKFH 3QG7H 1A1OA 1YMHA 1GC1H 5IW6A 3QORB 2D7OA 1CFNB 4HJIA 4QOKB 4NQCA 5IGXL 2J3SA 3P9MA 2CLVA 5I6XC 3QR0A 3MJ9H 2Q7NA 2IDUA 4LU5L 4LCUA 4YSEA 4Z7UE 2K78A 4AOFA 5I18L 1LWHA 4LPUA 3FUHA 3M1BA 4OZIF 3NZSA 4TXVB 4X7EC 2M1KA 3ABGA 2E4FA 3LN5B 1DHKA 1TQBB 4Z7QF 1M6OB 1OY3B 4ZFGH 4PWGA 3ROOA 3BVNB 3WNNA 4M3JA 3QCVL 4JUSA 1KEGH 2M26A 1LMIA 2AV1B 2J6EH 4M3KB 3ZYIA 4JFYB 2DLHA 2VLJA 3A6OA 1EZLA 2L7EA 3MLTA 3KLSA 3MRDA 1KB9K 2WK2A 3L7EB 2ZAIA 3TNNB 4GRWB 4PUBH 4ZO9A 4UTBH 3L3GB 1AXTH 1IGYA 1CDBA 3QSKB 3RHWF 1ND0A 3PXLA 3F85A 3NG5A 5B1BB 3HI6L 4UV4L 3DX6B 1JWSA 3THML 3DBSA 2VDPB 3VQ2C 5FHBL 1CU4L 4M5YH 4PB9H 1F6AB 1PY0A 3KLAB 2C3GA 3CK0H 3ZT7A 2EE9A 2DPKA 2Y0SA 5HGGS 1KYUA 4FNRA 4PRAB 3IBOA 1IGTB 4EE2A 4YXKH 1E67A 4JFEA 2DI7A 5CR1A 1SDDA 3A67H 3Q5TA 3L13A 2PWEA 4L1LA 3BYTA 4MCYA 1PZAA 3NESA 1OGAB 3OKMA 1J05B 2W07B 4D7BA 4JKNA 3PWUB 1NCDH 3D51A 2G5RA 4OF5A 4G8FB 5IV2A 4ODBD 4KFMA 2NYYC 4BZ2L 4C4BA 3O9WB 5IFAH 1J9TA 2DBLH 4LBEA 3Q2CA 4MMZB 3HZYB 5EU4B 1RVFH 1F6FB 1G1OA 2CO4A 2YAOA 2PPEA 4YO0B 4DAGL 3QDGA 4GNKB 4Z7IA 5LBGA 4GAFB 1XCTB 4N2BA 3RZCB 3GGWA 1FNEA 3AAZB 5F7DA 1Z9LA 4HUMB 4OCWH 4JN1H 3IDXL 6FABL 4G9FE 4P06A 3AM8A 3NIFB 4I0PC 4KK5C 5EU6D 3BPOB 3SYCA 1NKGA 32C2A 4E5XA 3G7TA 1FVDB 5BV7B 4KRMB 1HE7A 1ANUA 3LHPH 1UADC 3OV6A 3MA9L 4R5TA 4I3RL 3DYPA 1MHHA 1AHWB 2O5XH 3N1GC 3OHMB 1UWXH 2J8UA 4RGND 5CILH 4PJAA 1INQB 1ONQB 2JIXD 3LV3A 4K71C 1CCZA 2E6PA 3CDFA 5BO1L 3TBYA 2XG5A 4C4KO 1DDTA 1MFEH 5CD3A 4HGWA 2WLHA 1RLBA 4JZOA 4G5ZH 4HWZB 4E9XA 1NDGB 3BT2L 3DRQA 3PJSB 5HP5A 1AACA 3CDZA 1ICTA 3LS4L 4BDVB 3G6DL 2J5LC 4FG2A 2P5WE 2BWIA 4PJIA 3UC0H 4UT9H 2XV3A 5GGQL 2QV4A 4XMLH 1DN0A 4O2CB 2K6ZA 4KU1A 5C0DA 4OFIA 4YDKL 4IU3A 4PRIE 4D9RD 4FFWC 1EVUA 3RUGF 3V5HA 3KPLA 4X0KA 4PY8I 5IREA 1A14H 1HHGB 3ZX1A 2WXNA 2XFXB 2BM3A 2Y2TA 4Q56A 4HA1A 4OJAA 1YUHA 2O6CA 2GW5A 4DIXA 1D2OA 1J5OL 2B59A 4W9GC 3RA7H 2ESVD 5I2IB 2ADYA 4BZ2A 1QKZL 2B16A 4XE0A 4AWJC 1U8LA 5LVEA 3BUDA 2NY2D 3CFQA 2D2CC 3RDTC 2HSIA 3KPMA 3RBGA 2NQCA 1K9TA 2XZCL 3SCMA 5E6IB 3OR7A 4EBQH 3A0OA 2UX7A 2DIJA 2ZP9A 3NH7H 4L2YA 1T0PB 3IDIA 4TLSA 1CWVA 1NTDA 3IT8D 1UWEH 4AE1A 1K6QH 4AL8H 3QC6X 4NQDA 5HTSA 5IBTL 4NC1C 4YBLC 3B9DA 3DDFA 3QH3A 4ZFOB 2XPZA 5F7NC 3T6WA 3V0FA 5C0EA 1GXEA 3DSNA 4PGBB 2JQZA 5EU5A 4B97A 4LNRB 5DR5H 3Q2LA 4YZFF 5D1XA 2ZX9A 4KVPA 2FQDA 5DZ9A 5KOVC 1TNNA 1KCVL 5BUPA 3VB9A 3E1F1 3LZNA 3JTSB 4WEUD 3DX1A 1KIRA 1MCRA 4K7PH 2CGRL 3ZDWA 5EZLA 4KXAA 1OPGL 1YECH 3BAJA 4BFRA 3V6OC 3WY3A 2YFOA 4QT5B 4LO9A 1QFWM 1IAMA 1P6WA 2H6OA 3EH3B 4A7UA 3VCLB 4GG6A 3ZYJA 4IBUA 3G6JB 5AZUA 4XVTH 2DMCA 5IP4A 2VB5A 5AZEL 3FOLA 5JHBA 4TNVF 4AG4H 4MLIA 2F8OA 1FDLH 4I5BB 4N3UA 2VERA 4PG2C 3D25B 2J6EA 4HT1H 1JD7A 5LBVA 5CZVH 5IHUH 2NZIA 2RALA 4Y4KD 5C7XH 4U1GC 4UOW0 1URIA 4JQIL 2IBZX 4XP4H 5I1JH 1OAZL 5F6IC 3FTVA 3L9RA 4WW2A 5DC0A 3ZRSA 3MFGB 3ZZSA 1JI1A 3HC0B 4H40A 4MAUH 1MCOH 4RAHA 4JL2A 1OM3L 2VIRB 1LO0H 2NZ1A 5JQ6H 4ZMWA 4KTEH 1V3KA 4MD0B 1JNNL 3IGAA 2E9BA 2X2YA 2DMKA 4KX7A 5ERWB 2OYPA 3S3DB 4B3VA 2QADB 4M43L 1DJSA 2OMZB 4LSUH 1CDIA 3S9DB 1PS3A 1S9WA 1VFAB 1XL4A 2RJMA 1YNLH 3RWJB 2VMJA 3VH8A 1ZGLB 5CBAA 3W9EA 3LN4B 3R0MA 1RKRA 5F3BA 3T2QA 4POZD 4XN2A 4ZOCA 3WBDA 3PWVA 3E1ZA 8FABB 3TEUA 4MD4A 4G11A 1I8LA 5DUMH 3VXSB 1MJ8H 2OMWB 2DEXX 2X1OA 3HRZB 6TAAA 4YIQB 4A7GF 5BRZD 3ECBA 3S37H 3C6LA 3E8VA 2C34A 4Y1TA 2QTEA 3D69B 1R3JB 4OCMC 2DL9A 2XBZA 3HE6B 1TJIL 1A7RL 2N7SA 3G5ZB 1AOZA 4Z7WB 4KROC 1SJVA 2BNRE 3BZ5A 4LSPH 4U1NA 3FQRA 3MLZH 3NVQA 2CKBB 1TENA 3OAYK 3ZDZB 3ZYOA 1CE6B 2VOTA 1Z0MA 2DQJL 1PJ9A 5E00A 4WY7H 1DBJH 1JGLH 5CBEA 3WIFA 1K5WA 1QI5A 3P4OA 1CDGA 5DEGA 1L6PA 2NY6B 3AS1A 2Z3FA 2PP7A 3JWDC 1PFOA 3LN9A 3K8LA 4ANKA 1HXKA 5JQHC 1NBQA 1RZPA 3APMA 2FYVA 3CZGA 1AQKH 2XY2A 4JPKL 3BDYH 4MS8D 3MJ8B 4K3EL 5E7BA 5FUZH 1QSZA 2BOCA 1KGCD 1TPXC 1JGEB 1SEQL 1YEGL 4G2AA 2AQ1A 3GLEA 5C0AA 1T2XA 1WFJA 4UU9A 4D8OA 4RETB 1P6FA 1EAPB 1AHKA 4JQIA 5E8PB 2WWKO 4ALAL 4XAKE 1UM4H 3EW3B 1F0LA 1BOYA 2YO3A 4P23D 3V0HA 2X7LA 2DQDL 3UCRA 2P48B 3R4DA 2PXYA 3HLAA 3QIBB 3TN0B 3N06B 2Q3XA 1XHHA 4UT9A 2BVPB 4P9MH 2V3DA 1KLUB 4D3CL 1NFKA 3VMPA 1NWOA 7CGTA 1N64H 4XCNB 5DC4B 1I8MB 4WFGE 3D39E 3VWJB 3TCXA 1JWMB 3ZQ9A 4ZMOA 4ONHA 3BUPA 3QNYA 3FHQA 4XMPH 4DP2X 1UCBH 5CD5D 1MFCH 2EDEA 1I3GL 1Y18A 2ZOLA 3KH3A 1CLYH 3KHOA 1A21A 3QORC 2CA3A 3ZHNA 4MVBD 1EZVY 3FPXA 4ZTOH 4FXKB 2VDOL 3WDJA 5IESL 2HTLC 2ZCKH 4G42B 1LILA 4HK0B 1C8PA 2TSBA 4AENA 1N2RA 5D1ZC 2W95A 3KJ6L 2WBKA 4I1RA 1PIFA 4PHXA 2BZDA 2WXGA 1T89C 3VG9B 5DK2B 3QUXB 1BIIB 3L17A 1TQBC 3P1VA 2EE0A 3LKNB 3UZVB 4ODTH 4P4KA 2G75A 4MD5A 3N91A 3EO9H 3RGVA 3SEPA 3VRIB 1J18A 1SMOA 2OAAA 3S2AA 3NAAL 4AQEA 2VQTA 4HMEA 5IVZA 4S0SD 2VLKA 4U3CA 5KEZA 2F54A 4PTUB 1SLXA 3ARTA 3CBJB 5EWIH 3TIEA 4NM4H 4QPEA 1S7WB 1F58H 3ULUH 1GPOL 3GDCA 2ERJC 5D7LD 1WWAX 1YPZA 3DHUA 9PCYA 4HG4K 1BFVL 3L5XH 4G6ML 4ZS7H 5CGMA 4F93B 3GSVB 1NGZB 1O6VA 4XBEH 4D9LL 4WGVB 1UXWB 4EZKA 2CALA 3W3BA 3W9DB 3VD2A 3FO2B 4O51B 2RACA 5K33A 2BDNH 1S7TA 2CO6B 4RFNB 1FLRH 1QATA 4ZDHB 1IM3B 4YDLC 3PGCB 5CEXB 2AJYL 2XPYA 3GZPA 4GI8A 5I1EH 4ZXBD 3C2AL 3O9WC 5G5DB 4JN2A 3UBXG 4ODXA 5MEND 3V8OA 4JCMA 3CFKA 1I53A 1INDL 4R0LB 3SDCC 3TEXA 2IH8A 5GGTL 1EXGA 3BKJH 3UJJL 1CMOA 4F92B 1QI3A 2G3MA 5J13B 1JZ5A 3WKQA 5JPMB 4FQXD 5M95B 4QTFA 4LLQA 4KH2A 5E1AA 1JWUA 4QRPE 5INDB 5KTEH 2Z91A 2BINA 3GMRB 3ZKXB 2JFCA 1GHFL 4M1CC 1AHWC 3A5VA 2JKIS 3CFEB 4Z7OB 2EDQA 4XNUH 3U4KA 3MUGB 3MV11 5J4MA 3LY6A 5GGUB 1U3YA 4P2RA 4Z3JA 3GPSA 4PM1A 4Z7VA 3QIUC 2CK0L 2VM3A 2EC9U 2W60A 3G6AB 2BZ7A 3NCXA 3IRZA 4CNIB 3DXAA 2Y1VA 1XFPA 3QS2A 2JKSA 5C2UB 2X4PA 4N90D 3MNMA 5ITBL 4ZPVB 1FL3A 4AIZA 3QNXA 3ARBD 3CXHK 3DUSB 1BA9A 3VFMA 4XN9A 4G3YL 4J3BA 4I7ZC 4Y19A 3EGDB 2A77L 4DKEL 2V2TB 3AWGA 1L0QA 1A8JH 1C08A 1FPTL 4TOYH 4JFHE 3QYMA 2FJFA 4F27A 4G6FD 3H53A 1KZYA 4WWNA 1ZIAA 5EN2A 4Z7NE 5IEHA 3VXMA 5I16A 1NQBA 4WHCA 1FFPB 4Q0XL 4EQ2A 1T03L 1DBML 1JGDB 1EAOA 4HEMA 4FKEA 4I87A 4RA3A 5T3XL 1YN7A 3SKNB 3QEQA 5I8CA 4LLVB 3O3AB 4G6KL 5BZXA 3SDYL 4OF3A 1DUZB 5L8JB 2X2UA 3L3KA 4MJ6A 4M29A 5D2NE 5TH2B 1KGJA 4LP8A 4PJ7F 5CEZD 4AKPA 1CBVL 1AKPA 3GBDA 5JA8B 4BK8A 5GGTA 1XF2A 1U2YA 5E6IC 1L9SA 4AH2A 4O2FA 3GSRA 4G43B 2A7BA 4MGXA 1VZGA 3CLEL 4PJFE 3RWHB 2GJJA 4HLEA 2Z7ZA 3C08H 3IAPA 5TK4A 1M9WA 1RJYB 2GUOB 2P5EA 4MDJA 3PLYA 4R7DA 1HXMA 2V33A 3UBHA 2JI2A 2DRUA 3B7YA 4OQTL 3T65A 4X8GA 4BUQA 4FS0A 3NA4A 3P0YL 4ADJA 3LVTA 4LCYB 1RFDL 1GGIH 1MW3A 1XAUA 1B4LA 3SE8H 3GXIA 4KHTL 1XR8B 1WDAA 3EDFA 3UYRH 4WFEE 3K74B 5KBPA 4AQ1B 1G6VK 1IZJA 1YY8B 4F37K 1BEXA 1A8ZA 4IS6B 3BE1H 5TQ2H 2L7JA 3M1OA 1RMFL 1PG7H 1DQMH 1AI1L 2YPVH 4FTVB 4J3OC 4PJ5B 2DF3A 4UMGA 3WHE1 5ICXA 4IRJB 4ZUVB 1KCUH 2WC7A 4NNXB 5D6CB 2WTOA 3BWSA 4Y8AA 3FB8A 1IX2A 1U8PA 4GAGH 1FYTE 2G9KA 1EGJL 4O9HL 3X1GA 3L3JB 3CXDH 4YQXH 5GIRA 5I1GL 1WYJA 5DF0A 3L45A 2E7LA 2WZ6A 1U3NA 4R4ND 4Z23A 1QZNA 5A40E 4KQ4L 2WY3B 4TULL 3TYFB 4XXCA 5CSBA 1SQ2N 2Q86B 3FFDA 4IW4C 1VFOA 3GTNA 4HIJA 1C5BH 4QCIA 3CN2A 3QEHB 3VTMA 4JO3L 2D2OA 4NQVA 1RZJC 1T1XB 3QO1A 2JQMA 4XMUA 2OMVA 3P40A 1MJUL 1AO7A 1KCBA 2HRHA 3Q1SH 4MA1B 3FO9B 1WZAA 3DV6A 1D6EB 1SXZA 3U9PL 1TJGL 5GS1A 4B7LA 2ORBL 5J5EA 3C5ZB 1H6TA 4NUQA 2FTAA 5ESAB 3SYAA 4OQTA 4MB3A 4G7VL 4WTZA 3BP7B 2KT6A 3N40F 4HBCL 2FD6H 1JF5A 1KENL 3HRZC 4Z9KB 3FT2A 3HG1A 3SJVD 5J9PA 2APTA 5DMKA 4A38A 5GJSL 3M7OA 4Y5XA 1J8SA 1X3DA 2W0PA 1RK7A 1BX2B 1LEGB 4IDLA 1QAWA 2G2PA 3HE6C 4NOBA 5JR1H 1JRHL 1B4JL 1SYSA 3GFUA 1PZ5A 3L48A 4TLTA 3BQUA 5FYJL 1A6ZB 4NIKB 2OQJA 3RWCB 4HV8B 3AU1B 4HCGA 3CZUB 1MF2L 4NNPL 4OGAD 4M6NL 4RAUB 5IMOB 1D5BB 2TRYA 2WLIB 1GGCL 2ZP0T 3EYOB 1UXMA 3TA3D 1QZ1A 3EFDH 1JYNA 4XBPB 5H35B 1IKFH 1DUYA 2E9JA 2LFGA 2NY6C 4HZ1A 4PJXE 5E8DL 3CH1B 4JFWA 3RDJA 1IAIL 1IM9D 4JFZH 1JGIA 1OCCB 1U6AH 2DOCA 2NR6C 4ZX4A 2AK1L 2A73B 2Z8VC 2DV6A 2JXMA 3DX9A 2IALB 3G5YA 3MRHA 1TVHA 1QUNA 3FRUA 2LU5A 4JRWA 5ADPH 1E9PB 3EYVB 1WSST 4HX1B 1U95A 4Q74A 4TUJB 5DZVA 1S7SB 1OWWA 2IEPA 3CHPA 4MB4A 1Y6NR 5AOJA 4L4TB 5GS0D 1XL6A 1J1PL 3H3KA 2W0FA 3IJSA 4YHZH 5DTFA 1C1EL 2FJUB 3OGCB 2V0AA 1T2QL 3PDGA 3WNMA 3TN0C 2HFEB 2R4SH 4YJZL 3RKPA 1XSKA 3KNBA 2FL5B 3WL9B 4JFSA 4IGBA 2FEDC 1T7XA 5JMRA 1JK8B 3PHAA 1UD8A 1KIPA 1PDKB 1WIUA 4QEGA 1MREH 3ZR5A 3VWJC 3CG8A 2EIZB 4DVBA 2HT4D 3D5OF 3NZ8B 3ULVE 5E8EB 4LFHD 4YR6A 2IDTA 4E42B 2Z31C 1N5AA 3B2UD 5FO8B 2VQ4A 5AUMB 3T3MB 3TV8A 5FUOL 1A1OB 1YMHB 4FLSA 2DWYA 4KX8A 4OZ4B 3SD2A 3ZKNC 43CAA 5DQJB 2LQRA 4WJKB 5ADOH 5KSBF 3MXVL 5IW6B 4ZUSA 5EBLA 1TYJA 5FWRA 4NQCB 3ZDYB 4GEIA 1JFQL 3K2UH 3JUZA 3RX8A 3EOBB 3P9MB 3D3VE 3DARA 1BZEA 2VM4A 1OL0A 1DSFL 3HNSH 4LCUB 3QPQD 4WO4D 3L9BA 4P5TA 3VG9C 2AVFA 3T04D 3LPWA 4JM2F 3QQNA 5LO7A 4A6YL 2GT9B 5DHVH 3KVQA 4DH2A 1DLHB 1MCNA 4Y7OC 1CE1L 4MMYA 3VI4B 1Q9WA 4IMLA 3AY4A 3P3YA 3DX3A 3H0TA 5AW6B 4GRLD 2OMBA 3Q2VA 1UM6L 1UENA 1QLRB 1IIKA 2VXVH 4N3TA 4X6DE 5LXVA 5FAAA 1DEEA 3SIKA 3QI9A 5DURB 1GYWA 2PCYA 2N4IA 5I15H 3O8XD 1JXFA 4LIQE 1IGYB 2VRQA 1WHOA 2VTFA 1ND0B 1CDYA 1NL0H 1ORSB 3QIWB 3PL6B 4PAZA 4YUEL 4WI9A 1JWSB 2DM4A 2Q8AL 2QFRA 3NCJH 2CJ3A 3DLQR 3ZE1F 4XNAA 2YPVA 3MOAL 2JCCB 3CZJA 2WQXA 1KXHA 1UUNA 4TVPL 3IKKA 3D09A 1LXMA 2Z1PA 1SDDB 4M4RA 4HSAC 4MCYB 4N2DA 3RY6A 1U8IA 3OKMB 2BW5A 1YG9A 2ITFA 4ZTPH 3QFGA 5E2UL 4ZRGA 3DPDA 2WQ8A 3GKWH 4UCFA 5T1LA 3O3DA 3QK0A 3S35H 4PVLA 1JZJA 1OHZA 4YSRA 3APNA 4R0LC 4LSTL 1BXUA 5I66A 4HLZH 3RWFB 4PHZA 3QDGB 3IU3A 3C9NA 4TRPL 1DVUA 1XBDA 3MV9E 3GGWB 1FNEB 1JPST 1S7XA 5JPMC 4RGOH 2WIMA 3QISA 4OVVA 5A16A 5BS0E 5DGRA 1HJBC 1MSPA 2MJWA 2ADJA 4R2GB 4X5WB 5DHXB 1SEBA 4X8JB 3BN3B 3MUHL 2EE2A 5EO1A 3ZKXC 4E5XB 1PLGL 4NHCL 3HMWL 4A7VA 4EDWH 3P4LA 4IQHA 2X2IA 1QHOA 3CSGA 4JVUA 2Q8BL 1X9QA 4WZ9A 4HJGA 1MDTA 4Z77B 4CMHC 4GW5B 3TASA 1VFUA 4HXBL 4U1MB 1XGYH 1NSNH 2ZSVB 5HHOA 4KZCA 3VFGH 3KWUA 1LEKB 4I18B 3PV6B 2XG5B 2NUTB 2IO5A 4HGWB 3FH8A 1DZ0A 2NX5A 2LVCA 4GO6B 2VR7A 4JZOB 2LABA 5JQIB 2NOYA 4P46A 2KZBA 3OLEA 3CDZB 2UVEA 4UM9D 4IDJH 5JLZB 3G3LA 3M7FB 4PR5A 3W2DL 2ED7A 3QUMB 3B6SA 3PCYA 5D5ME 2Z9TA 4HWUA 3S4SG 3RYMA 3P2BA 1VRSA 1USQA 5IHZB 4IU3B 1KGXA 4H7VA 4APQB 5IOPB 3US0A 3UMNA 3VJ6A 3LEYH 3BH4A 1GL4B 4YHOL 2DQEL 2H32B 2X05A 2F7QA 4B9KC 1HH6A 2PO6D 3SE9H 3US9A 3DOIA 1ILUA 5CJ5A 4J7RA 2XN9E 1U8LB 1BXXA 3U7WL 1MJJB 1EVTC 3CVHL 5D7EA 2N1KA 3AUWB 3NIGF 3KPMB 1JN6A 4N2FA 1JSYA 5DRXA 2WUCL 5ACLA 1RIVH 5ABZA 3SCMB 4KI5E 4BINA 3ILPB 3OR7B 4IJTA 5TK2A 4FHJA 5CGBA 3IDIB 1CGSL 4HFWB 1S9YA 3BESR 3RX7A 1RIHH 2A9DA 5IGXH 3HG2A 2MOGA 1N67A 4NQDB 3TFKC 3BRGC 1CBJA 3QH3B 5EU5B 4EI6B 5D1XB 1LP9A 4PJHB 1J9SA 1IAKA 2VDRL 2NQDA 5BMFL 4OZIE 1YVLA 2AV7A 2B1AL 4LSVH 5DEJA 3UPRA 4JFFD 4AQ1C 5AD0B 2ZOKB 4FNUA 4F9PA 1BFTA 1KIRB 3AQZA 5EZLB 2ZNXA 1OARH 5TJWK 3FT4B 4HKJA 5T8IA 4S10A 3X3FL 3II1A 4M62L 1OSPL 1OTUD 2AEPL 5IR1A 4AITA 1HWWA 4GG6B 3NP3A 1OB1B 1HWGB 4YPJA 1GZHC 4M9OA 2YKLL 4BFIA 4PYHA 4X4YB 3BWAA 4YEFA 5HYJB 4UINH 1U8NA 1TVBA 2QVIA 2V2XB 2GABA 3OAYH 4HK3N 4UQCA 4YZWA 3P11H 3PWPE 1DBBH 2HT3C 2YD1A 3BGMA 4PH8A 5DT1H 1BBDH 5FV2A 4YXLH 4U3XA 3D4CA 4Q6IA 3GRWL 4YBQD 3IGFA 3DNKA 1Q72H 1J0JA 2Q3AA 4AMWA 1CQKA 3FT3A 4PJBB 2FR4A 3IYLW 3PGFH 1ID5I 4ZX5A 4UNUA 4YLQT 3CVHA 3CTTA 3FB5B 2UXGA 3GTTA 3E3QE 1NGQL 4DPBX 5GZOD 1CVRA 3HI5L 3PFUA 3H4HA 2RQEA 4N6RA 2DM3A 4HUKB 4MA1C 2XDHA 1T1ZA 3DOSB 1FIGL 1KTRL 1RULH 3TVMB 1MJ7L 3ZTJG 4Y1AE 4KDVA 4MTMA 4AEHL 4CDGC 3BEVB 5T5NG 4Y4HD 3W9EB 3RVTD 3RBSA 5FS5A 5HDBF 4MD4B 4KHXH 4L4VB 2MNWA 4KRPB 5HYQB 2Y5EA 4MWFB 3TIDA 3CQFA 2NNFA 5KJ7E 3C6LB 5L7XL 5CZXD 5BCAA 3S3CB 4IKLA 1KN2H 4MAYD 3FRPB 2DQHL 3LNHA 5KJRL 2WQWA 8PAZA 3PQYE 4U1NB 3X1FA 4KUCD 1XMWA 1A3QA 1LVEA 3HHSA 2BS71 3VXUE 3O45B 2GTWA 1FFTB 2Y7NA 3QRBA 3SSGA 5CBEB 2H26A 4IRSD 3P4OB 5DEGB 2ALWA 3NCYS 1CURA 4XN4A 1M71B 2WSPA 4M93B 4CU8A 3QFJE 4AQ8C 4DP1X 2WLMA 3KBFA 4ANWA 2OJZH 4GKSA 2VMFA 4N28A 2FSEA 3BEWB 2HH0L 3QQ9D 4JANA 4MYPA 3UERA 1XH2A 2P5PA 4YSSA 3GRWA 3NACL 4UU9B 2BVOB 2YOCA 2VLLB 1CUOA 1HKLH 4OD1L 2YPLE 2X7LB 3S2CA 1EZVX 2PXYB 3HLAB 5LKNA 2DWDA 3QUYD 4ES9A 1U8MA 2GTZB 1OAQL 3MTRA 1O9WA 4HDIA 3Q2NA 4AGLA 3AT0A 1S78D 3K72A 4Z3EA 1LO5A 4JDEA 1IGFH 4OZGA 2UZPA 2P42B 3AQXA 1X5ZA 3O4LD 3MV7E 1TFHA 4ZSOA 4N87A 3HS8A 2GJ6D 4ONHB 4YSDA 3QNYB 2P1YA 2M2DA 1KCRH 1LYQA 2CCWA 2R0LL 4OB5H 4OD3L 1HL4A 2QPFA 3TA4D 4H5SB 4LCCC 3ELAT 5LCVL 2ZOLB 3OKEA 3HZVA 1KBWA 4N2AA 4ZS6D 4MQ7A 1OK0A 2ZXAA 2ZKYA 5CU5A 1U21A 4FP8L 1ORQA 1SDYA 4OKVA 5DMIH 2FUTA 1DCLA 2F58L 2IAAC 4AENB 4I3SH 4AQAB 2HG0A 5LGJA 5KVEL 2JTDA 2ZCHH 1MNUL 4OSUH 2IC2A 3HE7D 5EZIH 3AXLA 4L0PB 5FYKH 2BK8A 3LKQA 3QQ3B 1KTBA 4P3CL 3FB7A 9CGTA 3KPOA 4P4KB 1H3PL 4RBPK 2VUOA 3FQWB 4L8DA 1T80A 4BA0A 5C08B 3K5RA 2BIMA 3BD3A 3N50A 4H1LH 3DVNA 5IVZB 3I02B 2XA3A 1LQBC 2VLKB 2F54B 5I8EA 1JK9A 5DRWA 3OMIB 4N2NA 4NLAA 5IF0A 1CICB 3ABLB 3QIWC 3PL6C 4NGHH 1BVZA 1YPZB 1R5VB 3EO1B 1A65A 4N0CC 4HGKC 3VD0A 3DMMB 3NCYP 4ELMF 1OO2A 2ZWZA 5KSAC 2EIEA 3C60D 4JO2L 4KNSA 5EU6A 4LEOA 2GB2A 4R7XA 3NIDB 1E65A 1MCPL 3NEXA 2MPAL 1A25A 2OZ4L 1R3IH 1YEIH 2ZKMX 1Z9MA 4HFUH 4X4ME 5D7IF 3U4BL 3FU0A 4GLRH 3MXWH 4XZUA 3SZKC 1WP6A 3ZKMC 3PNRB 5C0BD 2DYPD 1JCKA 1EZSA 2JIXA 3MGAA 2FEJA 4JN2B 4R97C 1RUAH 1ZT7A 3SQBA 5LGYA 4M6AA 1TOXA 3W39A 4BZ1L 4ODXB 5DMJB 3CFKB 2GIXA 1KULA 3MYJA 5LCVA 2E5EA 1FZJB 1L5GA 2BOLA 1T22A 3GT6A 4R5XA 2XACC 3TT3L 1U91A 2VAAA 1T2JA 4JHZA 5E1AB 4X99B 4M48H 1I1CA 4XCYA 3BP6B 1CDHA 2Z91B 5AZ2H 3B8YA 2AZUA 2J71A 4ONGH 3WFCL 5CJBA 4H26A 1E7UA 3KEHA 4JRXD 4N5ED 4HPHA 1S9VA 4TNWK 4FFVC 4JQXA 2WXFA 4FD0A 2LE9A 5TE4H 5CWSA 4B7IA 1L7TH 4ODUA 4XRCA 4KJYB 5L8KB 1GGTA 4Z7VB 3CFCL 3CZFA 3GI9L 2BMKA 5D93B 4NQQA 2Q2EB 4I18C 2IF7A 1SOQA 3IETB 2YBGA 1XIWD 3UAJD 3MCKA 4CJ1A 1GS6X 1J86A 2X28A 4HCFA 1A6WL 2IWGA 3N3EA 2BRRH 1K72A 4JGJA 3QNXB 5BPPA 1T3FB 2AERT 4OM1H 4QO1A 4W68A 3IE9A 3V4PH 2Q7AA 5EIIA 2MOQA 1NMAL 4G80B 4LSDA 4WIQA 5EC1B 4APQC 2FJFB 5BVPL 2BVYA 4RIRA 5EV7A 5EN2B 2ZAHA 5IEHB 3HUJE 1IQWL 2OZ4A 3ZHLA 3UJTL 4MCZA 4KKCC 2VSDA 3FUFA 2W8CA 2YQ3A 2GSIA 1MZYA 2BJML 3NTCH 4UT7L 2R8SH 3QEQB 3H55A 2DJSA 2ENYA 2BC4B 4ZFFA 4OCNC 5JW5A 4AGPA 4YN3A 4JJOA 2O5ZL 4MBOA 1FNSH 1FP5A 4G59C 2QGBA 3HA0A 2XA8H 3L3KB 2VITA 4CDHA 3FFOA 5C0CE 2QSCL 4ABWA 4FXTA 4KMQA 1XF2B 2IGLA 1F6LL 4G8GE 4R3SB 4AH2B 3FZUC 4GSRA 4O2FB 5KJ4A 4KKQA 1FHGA 1X4YA 3O3UN 5EEZA 1OAKL 3QAQA 2CRIA 3TPUA 1VCAA 2VLRD 4NJ9H 3T0DA 1KC5L 4HWBH 3U6RA 5FO2A 3CC5A 2P5EB 4V1DE 4P3DA 3DUUA 1TZGH 4X6FA 5KVDL 4Y7MA 4I3GA 1RPQA 3D18B 5FCSH 3PABA 1FVEA 1MW0A 3BCDA 1BAGA 3NIFF 5D1XC 1UKSA 5I73B 5J7CC 4HIIA 4X9BA 1U3ZA 4LGSB 4F33A 2K7PA 3BJLA 4Y4KA 4YXHL 2OMTB 3EYUH 3I3EA 1U2HA 4I77L 3P3RA 4JM0A 4UWQB 2BFVL 3ZTEA 1ZANH 1HQRA 1I7UA 2ZD0A 3MROB 1ZHLB 4HEPA 2NYYD 3S8GB 1CFQA 5F9WB 3EJCA 2Y22A 1ZDSA 3H42L 4NQSA 2YZ8A 5E5MA 3IKCB 3QUZB 4FFZH 4XPAH 4WHYG 2W9DL 4LRNL 1FH5L 1F1DA 4QXTA 4L3AA 5DU7A 3DGDA 4PJ6A 4JFHD 1TYRA 1RJLA 2MEJB 1QSEE 2DQGH 1IBBA 2DQ6A 4I0PD 4KK5D 1JXKA 3FB8B 3WJJC 3GZQA 4GS7C 3CCHA 3QDJE 1KJ3H 4HPYH 4KKBC 5TE6H 2VR6A 4PJCB 1SVBA 3WIHH 1N7MH 1FIEA 4LAJH 4B0MB 3EJQA 5D2LB 4GEJA 1IBGL 1MY7A 3WNPA 4HSQA 4JZJA 4XN5A 4H1LA 3SDDD 5BRZA 4K94H 3W1ZA 1HOEA 1HFUA 1T6BX 2NMSA 2Q2LA 5CSZA 1XF5A 3QDAA 4C55A 5HDLA 4M1GL 3T0AA 3CMGA 3FFDB 2JJTA 4HIJB 5AW7B 4QCIB 3NSYA 4AUYA 1OLLA 4N0FA 1KYFA 5JO5B 5E6UB 4YFDB 3VXRD 3P30L 4G7RB 3SBWA 3WIAA 1PAMA 5D72L 2AXJA 4U7MA 2CDFB 2OMVB 3TVMC 2DYSB 3V6BR 4UNVA 1FZMB 1ASOA 2MOVA 4XT1C 1FL5A 1KJ2H 2BP3A 3K1KC 1A02N 4L9LB 4Y9EA 1HYSC 4N25A 1V7ML 5B1JC 4KRPC 4FFWD 3U2SA 1CD1A 5J9PB 3HG1B 5CEZH 2Z1KA 2XTJB 5F7BA 2NW2A 3CDCA 5KVMC 3VSVA 2DMGA 4XOCA 4YSCA 1JI2A 3KZ8A 2ENSA 4DFHA 1SYSB 1PZ5B 3FL7A 1CT8A 3S88L 3MTXA 4FLHA 2CMRH 2I26N 2OQJB 4PRNA 4DGWC 5FIEA 4NENA 4MX7B 3F64A 1WEJH 3FSWA 3RDTD 3FUDA 4AZ8B 2EO1A 5IJKA 5FDWA 4BFJA 4Z78A 1NLDH 3KYKL 5JHDE 2F5BL 1DUYB 2J2ZA 1ZGLP 4JPVH 2EDTA 4W4OC 1DVYA 2A3TA 3L1GA 2EEBA 2FO4A 1RSFA 4M93C 3DO4A 4UILL 2BCMA 4F7CA 2WLLA 4F9LA 3B34A 2ILLA 1JZ6A 2ATPA 5HGBB 2JXMB 1ZLEA 1TVHB 2X4TA 3FRUB 1WC7A 3T2PA 2BCKA 2P9RA 2UXFA 4ZOBA 1DJGA 1DEDA 1AIFA 1E5YA 1U95B 4E9VA 5I1LA 3EZJB 1DQJA 4YX2H 3PWJA 1JV2A 2A4EA 4P9HH 1MWAH 4WWKB 1V27A 1QLFB 3RILA 2W0FB 2OX5A 1FI8C 2XIBA 1GZQA 2YMTA 4KITB 5E99L 1Q9KB 2PXYC 4YL4A 2WSKA 1DR9A 1T21A 4U1IB 1QNIA 3VFSB 3T0EC 3D8MA 2DD8H 5G55A 4PJ7E 4WO0A 4QD2E 3NJVA 4JG1L 3JV5A 3L6FA 2YARA 1E5BA 2YMXL 4AC4A 4PS7A 1I7ZA 1W72L 2GVYA 3SKOA 4YR6B 4PMFA 1ZWIA 3TBVB 2BERA 1UATA 5L6YH 1U3HC 1P7HL 4FYQA 43CAB 4F7MA 4XNBA 2EC9T 4ZUSB 3F01A 5D7LA 1R0AL 1IEBA 4GI9A 3HAEH 1E4XH 4WUUE 2O26U 1D7CA 3LRLA 3PPEA 3QJFB 4NQEE 2FRGP 1TJXA 3FH5A 3LS5L 4P5TB 1LTXA 4B41A 1AZRA 2AJXH 4YHPB 2GY7B 4OLZH 5C0GA 1W6LA 4LOUC 4Z7WF 1BCIA 4MMYB 5F7WC 1TETL 4AL8C 5I5MA 1Q9WB 4IMLB 2CRYA 2EDRA 3AT9A 4XP1H 4APXA 4ZXBA 4JO1H 3T1FB 1QVOA 3ZDZF 1R75A 4WAFA 4PP1C 3ZL4H 4OUUA 5BRPA 3O11A 1YEFL 1JOIA 4M7LT 2D7MA 5MENA 1OAYL 1ADQH 2MCPL 1AGEB 5E6YA 1DEEB 1VGKA 1MQKH 2JLLA 1SXAA 3QI9B 5FLUA 1CICC 2YIHA 3UABA 1JNHA 5ICUA 5F44A 2J43A 3ASOB 3H3PH 3VD7A 2MQ3A 4WUKL 4Z18A 3DMMC 1O7DE 1QHPA 2VN5A 3FJTA 4FQXA 4L37A 1TQTA 4GKLA 4N2HA 4TLUA 2KPWA 4HUCA 4MNQE 1KJVB 2JCWA 3N6YA 3ECQA 4E9WA 2YGVA 3Q3GB 1Q90A 3GC3A 3H9HA 5IROA 4KROD 1DL7L 3E9UA 4EZJA 1OF2A 2C3XA 5HDWA 4MNGA 1Y1UA 4O2EA 1U8IB 1RPUA 1UXLA 3PWLB 5D7JC 1E7VA 1W6WA 1II4E 3OG6B 3HC4L 2AJVH 5G4MA 3IU3B 4GIPD 3C9NB 3K6NA 1GCYA 4LB8A 4XP6L 5CJOL 5DVKA 2Y25A 4G7YL 4TSCH 5EBMB 5A16B 4P05A 3D1MC 2ADJB 2F7IA 5L2KB 5C3IA 1F45A 2XWJB 5EO1B 5CLXA 1NLBH 4J6RL 2VT0A 4DZBB 3H9SE 4KKPA 4WEMB 3LD8C 3NN8A 3VE0A 3V52H 5DQDL 1TZIB 1KJ2A 5DD0L 3D0VA 3ERXA 2YWYA 4PB0H 3K2MC 1EFQA 1FO0L 4JFTA 4LOEA 1X5LA 4OFVA 5D93C 4Z76A 4P0DA 4LHUD 4S11A 5HHOB 1J8HA 3MRJA 4G1EA 3RJOA 2CLZA 7TAAA 1N8OE 1WFNA 1EJ8A 5DLML 5DJAA 3KGRA 5JOEA 3PAVA 2WMPA 4HALA 1IC7L 5I0WA 1JZDC 4N8CH 5C09A 5I6OA 1UD6A 5F9OL 4XPFH 3HKZA 5C9KA 5EU7C 2AXFB 2XZAL 3QORD 4H8QA 3N1MC 4N24A 2NUPB 2XWEA 3WIIH 4QOKD 2GTQA 5FYLE 1IBFA 2CCVA 2CM6A 4OV5B 1A4BA 2UZXA 3RU8L 5CCKL 1G6RL 3CZEA 2HTLD 4HKBA 5EOCH 5FUCC 4QRUB 5I1KL 1HKFA 2ZF8A 4LGRB 3K4ZA 1MIML 4F24A 1XGRA 1QO3B 2HAZA 3UEZA 4OUOA 2BHYA 2WXPA 2LU7A 4JFQA 4XVSH 2VH5H 5FXCH 2AK4E 4CN1A 3V0JA 4S1SL 4KO9A 1TR7A 4P4RA 3RJQB 3SE4A 2QPSA 2YA0A 3ZMEA 4PD4J 3WAKA 4A2FA 4V33A 1JHKH 3D0AA 3ARZA 3OXSA 3FQ2A 1UA7A 3O6FA 4I2XE 2C1OA 1SF5A 1BQHA 3LIZL 3K4DA 2EACA 3MV9D 4K3JL 4N2OA 4F2ME 4IRZH 3KCWA 3KGTA 3SGDI 2XRAH 4YNYA 1S9YB 5FGSA 5TPWL 1RHFA 5DRZB 5KSBE 4P2QE 5GSVA 1RZ7H 3IAQA 3PIQA 2A9AA 2E76C 2OCJA 3HMXL 3T3PE 5I73C 4C54A 5KS9E 4N4YB 1UYWH 1LP9B 1N0XH 2G2RA 3W0WB 4TNFA 1FO0A 3HOGA 1NCWL 2B3RA 1VLXA 4C4UA 4Z7OF 4JKWA 2I7SA 1R34A 1B4RA 2YD6A 3PDOA 1ET7A 2BSED 2R0KL 5GS0L 3O9WD 1BVOA 4XNMA 5F9WC 3MRIA 1DJIA 3IMWA 1OLZA 1WH0A 2X9ZA 4DP8X 5EH1A 3KPQA 4UB0H 5C6TH 3HAEA 4KXZI 4XNXH 3QUZC 2HFGL 3GSNH 3SDCD 2DB8A 2VJXA 4P2OB 1ZSDB 3RZCD 4HXAH 4O58L 5DI8A 1T1YA 3LNFA 1EANA 5IR1B 3STZA 1JS4A 1G6RA 1BECA 4WGKA 2NZ9C 1EO5A 3SPIA 5DHVB 2XQBL 3V4UH 5AB9A 1LE9A 2JB6A 1U8NB 4P3WA 2CCLA 4DGVH 4P59H 4DGIH 2CR3A 4M1CD 3SJVA 1FGNL 4XXWC 1Q0XL 4Y5VA 4LPCA 5JIDA 3F6JA 4Q6IB 4HOWA 3LQAC 3ME0B 1TQUA 1I9JL 1KB5H 1YNTB 1Z5LB 2B5IB 3QIUD 1IAIM 5JW4N 1CFTA 2XN9D 1F11A 2WLNA 1IE5A 3LEVH 2BXYA 4PGCB 4KZDH 3CSYA 4UNIA 4XNQB 4WWOA 4JRYA 4K9EH 3LIZA 4NKDA 1WRFA 4HZLA 5DVOA 3A22A 1PX8A 3TA3A 1T1ZB 1SBSL 2X4QB 4EMZA 1NIFA 5HGHA 1OP3K 4L9LC 1F90L 3MRGA 3QULB 5I8KL 3NMEA 5JOFB 3HMXA 3MRMA 2HLAB 4MXVF 4PJDF 5AL0A 4BGLA 3KR3L 1TQCB 3CE1A 1NPUA 3BSZH 4JGMA 1Z5HA 2E9IA 3DPBB 4ANXA 5IQNA 4N6QA 1QSFE 3REVA 2DBJA 5EEYA 4UAOB 4IOSD 2PW2A 4KX9A 3QYCA 3MODH 4GSDH 3SZ6A 2WYIA 3OKOB 3HHSB 5FM5M 1JP5A 2XXGA 4LT7A 5E6ID 4LEXL 3V0WH 4L48A 2H26B 4PCKA 3TEWA 1ZA3A 3FSOA 5LWYH 2FX7H 5FO9A 3WUWG 5DJ2B 4GUPA 4NC0B 3W56A 3FCTA 4OCSH 3WEMA 1NBYA 2WZAA 4GKSB 3A21A 1VPOH 4JMXA 2CK2A 4HIEA 2X5PA 2UVFA 4RBPH 2Z92B 2VC2L 4DK5A 3FFCB 3GSOA 3IJHA 5FB8A 4WWKC 1KIQB 3QHTC 2UY6A 5LXGH 1Q38A 4OQ1A 4BGDA 1NBVH 3BXNA 2UV3A 1U36A 1H15A 1M56B 3K3QA 3RTQC 5FLVA 4FQ1H 4LASL 3KMDA 4WQOA 4CC0A 1A5FH 1U8MB 3FMGL 2HT2C 4FLOA 1T7ZA 3JWNG 4W9KC 1JTTA 4HDIB 1ZE3H 3NIGE 4J3OD 3K72B 1LO5B 3R19A 4JDEB 4FXGC 4QHMA 1M3JA 3BUBA 5I19L 3TL5A 4ZSOB 2XUWA 1U4FA 3OZ9L 5ANME 5B3NA 2AITA 2CO2A 3FQTA 2OMNA 4WKZA 4ODWA 4KRLB 4G82A 3MZGB 4AY0A 3O8XA 3HZVB 4FI8A 1XR9A 1URLA 1QX1A 3FN9A 1GIGH 4L2LA 3CVCA 1F3DJ 2D9CA 2D73A 3WU1A 2AI0H 2BFGA 1I8AA 1U30A 1HC1A 1AMYA 1WICA 1WUZA 4LK4A 5IOKA 4RWHA 2A6JA 4F7TB 4LDLB 5F96L 4IRZA 3AXLB 5IJBC 2Z93A 5IQMA 3FB7B 3AY2A 4FNTA 4Z0XA 3T0EE 2WXRA 5BOZG 4LPVA 5JXAL 2QADD 5F7HA 4I48A 4ONFH 2AAAA 4L8DB 5GGRA 1BAWA 2GBVA 2ID5A 4X6CA 4AYID 2X1WL 4DWHA 5DHDA 3V2AR 1YEJH 1TSRA 1XSJA 4YK4C 3OKNB 1P4BL 4RGMB 1NEZB 1GKEA 3MLPA 3QDMB 2K4WA 3BN9D 5IF0B 4QJ4B 5FPIA 2HPOA 3L3IB 3FUJA 3WS3A 5HI5D 1B0IA 2NY5H 1IBZA 3OZKA 1NGWA 1E5ZA 3KD4A 4B9JA 3F83A 5C0FA 5IW1A 2XXCB 1G84A 4WCYL 3MSPA 3HE6D 4PRPD 3U36A 2EXYC 4LEOB 3GSNA 2D9QB 4Z7UA 2UZYA 4DUVA 3SOTA 4BSJA 1HSBA 3VFWA 1RJCA 4JG0H 1OGTA 3EF4A 4TPRL 1QBBA 2JH2A 1W91A 2ZP8A 3SQBB 1RD6A 2WBWB 2NY6D 3W39B 5E9DE 1PNCA 2V3EA 3R0NA 4KY1L 2RFXB 4CSSA 3MYJB 1L5GB 3VQ1C 1OOAA 1T22B 3GD1C 2YJLA 4EI0A 1CDUA 1U91B 4UM9A 2VAAB 2JMRA 2OR9H 1E2WA 3GNMH 4GI6A 2WM0A 3D50A 4UQEA 4WNQB 4PW4A 3SPCA 3GB7A 3HNVH 4GQRA 3ZDYF 3MRCB 4H26B 3ZKQD 4LDEB 3STLA 5GHWL 3LSOA 3J8F7 1S9VB 1SJEA 5GGSB 1NCAH 5C07E 3T4AA 3TN0D 1BEYH 1JFHA 5LAPA 3VD3A 1ZJAA 3Q06A 4RMRA 3MAWA 3CFDB 2PO6A 3CZFB 2J1YA 4KTYA 2FEDD 2BMKB 2FATL 3A47A 3T9WA 2VMDA 2VRAA 3MCKB 5JIMA 1PD1A 3VWJD 4HCRL 4TQ8A 3VGDA 2DLIA 1SYVA 4YEEA 5JHMA 4YHLH 2Z31D 2UWEE 4J2QA 2P7TB 4QO1B 1J0HA 3RHWK 3ZKND 4PV1C 3GMMA 4PG9A 2YAPA 5EIIB 1H3UA 4G9FA 4IEFA 4Y5YC 3NRQA 1PG7W 4RIRB 4H4NA 3RWIB 4DEPB 2CA4A 1BM7A 4PRDB 3GIZH 4AKOA 4MCZB 4OFQA 2EDBA 1C16B 2Z34A 3JXAA 3VXNA 4ZODA 1NC4A 5J6GB 1S5HB 2FBRA 4NKMA 3M17A 2PYFA 3LQZA 4ZFFB 2OSXA 5JW5B 2AJZA 3CHOA 4JFFA 3RLSA 1G9NL 5IUSA 2VITB 3OXRA 1TDQA 3GHBL 2BXZA 4CVXA 4PWHA 2N59A 5K1JA 1RUPH 1PLCA 1AHMA 2DIAA 3TPUB 3VXPA 4QI3A 4MSWA 3ARXA 2VABA 5MHSE 3U6RB 5EU7E 1RHHB 3CC5B 2CHNA 3PGDB 2FH8A 1QW9A 2HN7A 3MFFA 4MXQC 3MDJA 2WUBL 1VAHA 5FOBB 2Y9RT 4PRIA 1ZT4B 3G5VA 4AMKL 4NFBA 3PABB 1FVEB 4OZFA 5SWZE 4JPSA 4J3SA 1RU9H 1QRNB 3FK3A 1QBMH 3EOTH 1AKJB 5F88A 3I9PA 4WSJA 2NY0B 4F33B 1IM3D 3NSXA 1NANI 3F7YA 3IFPA 1Z3GH 1FQ9C 1HQRB 1I7UB 2J8UF 4HCRA 5JHLL 1T20B 1YYMH 1F1GA 1ZHKA 2APVA 2HCZX 1AFVL 2OTWA 3L08A 4PJAF 5F3FA 1IEAB 5ALBH 1UXSA 3NPSB 4NQSB 4TQEL 2VL5A 1L0XA 2YAMA 4HHWA 4P2OC 4N9OB 5E5MB 5K9QI 2G5BA 4JDTH 5IT2H 4AJWA 1FAKT 1TKWA 3U6XS 1HVXA 4JQVA 3N55A 1SF3A 3QHFL 3JQOB 1RZFH 1MHCA 2V4LA 1ROWA 3EG9B 2C3VA 2CIKB 2FGWH 3MOBH 5KVGL 4K7FA 4FTDA 4DKFL 2N7AA 2VXUH 4QRRE 4PJIF 1FGVL 2FWOB 3C5JA 4HD9A 4ELME 1XF3B 3I85A 3OPZH 4KVCH 4R7NA 3Q7JA 1N18A 1HI6A 3CAFA 1M42A 4WI8A 3GSUA 3ARYA 4FZ8L 4JZJB 1FZKA 3GXMA 4FERA 4H1LB 5CSGA 2OTUA 2B5IC 5L4IA 4U1JA 5CSZB 5D7IE 1H8NA 3ES6B 4OCRH 4XPHL 1AR1C 1CIDA 1UZ8A 5F8RC 4XVJH 5B38G 5L88H 3I74A 3TBCA 4MAYA 2KDGA 5C0CD 4GINA 1Y6KR 4X4ZA 2YD2A 3ATDA 1EXUA 2VL4A 2IADA 2XFGB 5F0JB 4AEIL 1HDMB 1TIUA 4JKKA 3GS4A 4JB9H 5TQ0H 3EDEA 4HW6A 2R56H 1SN5A 4G5AA 4IRSA 4X7TA 4BQBA 1KGYE 3GBEA 3SODB 4B9IA 1QG3A 2GFBA 3HBQA 4J8QA 5L4JA 5LG1A 3TZVB 3QXAB 1CF8H 1FZOB 2A9MH 2O61A 4NT6B 3U2SB 5F1KC 1F2QA 1FN4B 5H2BA 4F58H 3FBQA 3VX1A 1BG1A 1TQCC 2JV6A 2NW2B 4HMDA 2Y72A 1DBKL 3OSVA 2XHNA 3A4DA 4H88H 4KK9C 1U58A 3HHMA 5JHLA 4M6OL 4WFHD 5KBNC 1CZ8H 2K4AA 1CT8B 4UAOC 3BFWA 3C8HA 2XETA 2XV6B 4PRNB 3VVWA 4NENB 5KZCB 4G8AC 5A43C 1XZ0A 3QUYA 3CBKB 4AEEA 4FLQA 4S0HA 4PMEA 4WU5B 1EDHA 3M07A 2EEFA 4Z78B 1GTNA 4DW2L 4BFBD 4A66A 1PMYA 1ZLVH 4ZQTA 5GS2H 3KLHC 3E6HA 1K2DA 4FNLH 5AEAA 1MFDH 1YEWA 2FO4B 3O4LA 2WLLB 2GJ6A 3Q8EA 4TNVK 2XVLA 3BDXA 4GG6F 2X4TB 3TFKD 1Q1JH 3ARGB 1CR9H 3QDJD 1WC7B 5IIEB 2BCKB 3AITA 3EF7A 2G60L 1MRFH 4H8WH 5I1LB 4JPQA 1C5CL 1DQJB 1KEML 3ZTJH 4D0CA 1AS7A 4MZIA 2DTMH 3PWJB 1JV2B 4OM0H 3UH8A 4EZLA 4OAWA 1A6VH 1HH9B 3PV7A 2AJUL 1U8OB 3W11C 2OX5B 4GY4A 2BVQB 1M2OA 3K6OA 1GZQB 5D1QE 4ADGA 1D5IL 1ZTXL 3MACH 3V4PB 2IAMC 3NA9L 5A2JH 2JF1A 1S7QA 3HE7A 1YCSA 4A7TA 4WW2F 4FTVD 2DIEA 4PJ5D 3ZLQC 3INUH 1NOLA 4ZMYA 1FVCA 2RCSL 3L6FB 4FNQA 4IRJD 4GUOA 1GJUA 2AVGA 3GBNH 5DD1L 1XB8A 1IEHA 4TL5A 2WPGA 4Y2OB 2HG5A 5ICYA 4PI2A 3SKOB 4X5LA 3RVUC 5GRWA 2OBGA 3S5LG 3KCPA 4LVOB 1W8NA 2VISA 4XXDA 3CD4A 2ADFL 2B0SL 1BFSA 3VFTA 5BW7A 3E0GA 1VEMA 4GFTB 5CM1A 2BSBA 3GXNA 4OLUL 1MAMH 3J27A 5EUOA 5KYXB 1CK0H 5IFJA 2Y7SA 2IWKA 3OAZK 5AW1B 3UTTB 1IEBB 3FPYA 3PUCA 4GQ9L 2HT3D 2MKLC 3Q0HA 4U6XA 1K3ZA 4ANVA 4QHPA 4FQ2H 2XYBA 3BKYL 1WF5A 3C60A 4ZUUA 2A4CA 4MS6A 1CXIA 1Q9OA 1KELH 4FQIH 4NUGH 1YQVH 2IFFH 5C0GB 4X80L 1SOSA 4I0KA 3TBBA 3VI3E 5IQ7L 5HHVH 1T0OA 1HS6A 3PU7A 4JZNB 3SBRA 4UIMA 4B27A 5DVMA 4ZBJA 4OTXH 5C0BA 4BQ9A 3KBHE 1MOEA 1OALA 2ZPKL 2XTLA 2DYPA 4APXB 4PVBA 3SOBH 5CN3A 1MZZA 4OUUB 1LWRA 4PWJA 5D2LE 3WKNA 3UZEA 1CB4A 4NKIH 4RGMC 3P69A 5D7HA 3BWUC 5DZPA 3C5ZD 4YGVA 5JPNC 1LK2A 5T1JA 3O2WL 4NKOA 6PCYA 5SWSB 3QZWG 3OKLA 1J48A 1K4CA 2DQCL 3VFVA 1P5UA 3BRFA 1H6UA 4PRHE 1BAFH 4FA7B 3IDJB 2GJZA 5SWQB 3OQRA 5BQ7A 2P46B 1EZUA 3RAJH 3TYGL 4L37B 1RSYA 4H20L 3A4EA 3F58H 3HBPA 2Z4QA 4NPYA 4U1KA 4A2LA 1H5BB 1KXVA 4GAYB 4JRXA 4AUJA 1G1CA 4OZHA 4YSTA 3SYQA 4R96B 2EVJA 4BK5C 1PKQE 5C9JA 4O2EB 3KPPA 4FX5A 2CUAA 3LH2H 1TUPA 2NQ3A 4DCQA 4LSRL 2YAQA 2NLJA 4OI8A 5CINH 3WXWH 3UAJA 2WJ7A 3O3EB 3X1EA 2QPUA 4I8DA 3VRJA 2GJPA 2VXQL 3D30A 4FYSA 2NSMA 4J23A 4TUOB 3G9AB 2XY1A 1HHKB 3TC9A 1KPUA 4ONOA 3GUTA 2OV0A 2EDFA 2G3XA 4L4TD 4FQCL 4F57H 2OP4H 2QQNL 4R26H 1WO2A 4GXVL 5HYSG 4JQXC 4PJGB 5LG6A 5F9JA 4UYPA 2V5SA 3Q8AA 2YD0A 3NN8B 4B9ZA 3N42B 3LH9A 1JIBA 3T77A 3F7RA 1KJ2B 2PABA 4M8VA 5IBUG 2CRZA 5ITFB 1CLOH 1EEYB 3HPLA 4Z76B 1HZHH 3TESA 1J8HB 3K8KA 1G7JA 3MRJB 2CLZB 5DJAB 4LXFA 3U30C 5T3ZE 5KG9A 2JK5B 2IPKB 3VVVA 5IB1A 5EEWA 1U92A 1YN6A 4NRXA 3FQUB 4QXWA 5C09B 2NNAB 2WKOA 4POYA 4XN1A 4GXUN 3AWFA 3D07A 2XZZA 2UX6A 1XGQA 2VLRA 4A7QA 4LVHB 4P2CG 5KSUA 3WFEH 1ETJA 5I1AA 3CFBA 5GS3A 1YPZF 2K0RA 3I6LD 5H37G 4KKRA 2ETWA 5AKRA 1KY6A 3IPBA 3MHZA 1L9RA 1GZPB 3ABZA 5FKAA 3S36X 2CLRB 2Z7UA 3LRGA 3GSXB 2L7UA 3X11A 2L3BA 4JFQB 4KQ3L 2XBDA 4KMTH 5CFAA 5DD6A 4B96A 1ZMYA 4BFNA 2VXQA 3TJEH 5FO7B 4PSPA 1TTUA 2ZSWA 4JDVA 5DURD 2JJSC 3LZOA 2E7HA 1MWAB 3O6FB 4MZ3A 1YZZA 4Y2DB 4GYBA 1UASA 1QEWA 1BGXH 3L4TA 3QIWD 5EN3A 3PL6D 5E94A 3CSPA 4YPGB 2HVBA 4YNYB 4N0CD 1ZLDA 2CE6A 5KSAD 5TF0A 4L4JA 1PZDA 4Z0BH 5GSVB 3B9EA 1G9MH 3PIQB 4OT1H 4I0PA 3TT1H 3JYCA 3DC0A 1KYOJ 4MB5A 1SOKA 1G9HA 3ULVH 2V7HA 1Z7JA 2NY0C 5DEZA 2VE6B 1LO4H 1FO0B 4C58B 3JWDH 1EJ6A 1ED3A 4MA8H 4M7JL 1E28A 1HNGA 2VZOA 3ZKMD 5A7BA 2I60H 1OCWH 5IVXE 2VZSA 3U7AA 3PDOB 4AJYV 3WO4B 2A1WH 5AAWC 3AXIA 1MCIA 3U2JA 4HGMA 4Z7VF 2VUKA 5D70L 5BUAA 3F7QA 3TWCL 3WXVL 2AJSH 4K8RH 2OR8A 4FQJH 3ZE2B 3HAEB 1T0MA 3MUY1 5TE7H 5DQ9A 1N6QL 5KBMA 5PAZA 3VXRA 1T4KA 1Z6JT 2YD5A 1BJ8A 4QIRA 4PJFA 3SDXB 5HPMB 3LMJH 5C70A 3SO3C 4R2GD 3MCLL 1J1XL 4XO4A 3S8WA 2PN5A 3V4LA 2JB6B 1CGYA 5JW3H 3LRMA 1FBIH 2EDWA 1QFUL 1N12A 4FFVD 5TDPA 1C7SA 4Y5VB 2FHCA 1I8UA 1OQXA 1L9QA 3MLSL 3EGXB 3NZHH 5F2FA 4LIQH 1BWMA 1CFTB 3ZSTA 2JJTC 1F11B 2H2PC 3ZTNL 3ZUCA 2YRZA 2I27N 1HESA 2QKIB 4JRYB 1E3ZA 4QXUH 3RDTA 3SBWC 1RZIA 4HKXA 2FZ3A 4L3CA 2APBA 5BZWA 3RVXC 3P4MB 3BLBA 4N0UE 3TZVC 1ZIBA 2APSA 5HGHB 5JIQA 1OE1A 5GRVK 5J6HB 1UOWA 3MRGB 4GBXC 3H2PA 4APQD 1OSZA 3MRMB 3CWGA 3MLVH 4EOWL 2YEZA 2PW1B 4CN6A 3FN3A 1MG2C 4KKCD 1FRGL 4NWUH 4TSAL 2R4RL 4NIYE 4I89A 1NCCH 3E9TA 2WYHA 2R7EB 4ZO6A 4ZUTA 3WFHA 3B1TA 2WXIA 4BRJA 3REVB 3Q44A 2YEQA 1TCRB 4TUKL 1AC6A 1F4AA 4Q2ZB 5F9AC 4DGYH 3I2CL 1UA6L 3TF4A 1HHJA 1ADWA 3FTXA 3V6OA 3FZUD 1HJCA 1NINA 2LT9A 1ZA3B 4XTRC 3SY0B 3UTPE 1AANA 3E8UL 5FO9B 3MZTA 2O5YH 5FF6A 1BVNT 3RVWD 3EBGA 2WO4A 4FOMA 4NQDD 3FCTB 4W1TA 3WSQL 3ARGC 4EIGB 1NBYB 1CL7H 3N44F 3U4EA 2AF2A 2YD9A 4LSQH 2R51A 4PG2A 4QY8A 3B37A 2V9UA 4U6HA 5D1XD 3GSOB 3IJHB 1THAA 1BQLH 1MFMA 3OJ2C 2UY6B 4OF8A 3X13A 4HWNA 3BXNB 3II3A 4MBRA 1S9KC 3HBGA 3LPOA 2IBGA 3BPNB 3GO1H 5HJDA 5ES4B 3MRPA 4LAQH 3JUYA 3BKCL 3TLRA 3O6KL 3VQMA 3V4VL 3UBXB 3ULUF 5KVFE 3MREA 1UH4A 1NFIB 2QEJA 5LNEA 4QTIL 1F4YH 1EEZA 4QUOA 5IEKB 1LDPL 3GMLB 4Z3IA 1E5CA 4LVOC 4MMXC 1UACL 5HYJD 1DBAL 1FFOB 3Q9PA 3ZR6A 1OOWA 5F3HB 1MRCL 2BRQA 5F7FA 3L2LA 4AE0A 3WN6A 3O8XB 1LO3L 5E51A 2ZUSA 1KDJA 2WCSA 5I6PA 1DVXA 5GJTL 2X6VA 3SE3C 3GK8L 4X42A 2QTVA 5J6SA 2D7QA 3AREB 2JKNA 5EPMB 4LSSH 5JZ7C 1T83C 2OR7A 5D71H 3VQLA 5DFAA 5EOQH 1F8TH 5JUEL 2Z93B 4QRAA 5ID1A 2Z64C 4AJ0A 2E6JA 3HFMH 1I9IL 3WY1A 2A0LC 4PQXA 3ZE0F 1QNZH 3B5HA 3RL2B 3ILEA 3K4AA 3TVMD 5GGRB 3ZL1A 3BZ4A 4P5MA 5I1IL 3QE5A 5LBSH 5LLIC 3EO0A 1CLZL 2X9WA 2XLLA 4ES8A 3LKRA 3QCUL 1BVLA 4RX4A 1HYSD 1CXFA 4KXCA 4L4VD 4ESKA 3LNIA 4KRPD 2B08A 4TTDC 1NFDE 4IOFC 2VXSH 1Y1DA 2KZKA 4IBYA 3RL1A 5IW1B 3C6LD 3UPAA 1BZDA 3NUKA 5B8CC 2YD4A 2AXHA 3KG5A 4JCLA 5I1DB 4NDMB 2VDPL 2DLFL 3D3VA 3T2LA 2H6PA 4FA6A 1H5BC 1SXCA 3TCTA 3GSNB 4Z7UB 2UZYB 5IROC 4XAWL 3WYRA 1BVKA 1IFHH 4Q9QL 3GPEA 3V4VA 4U6TA 4HHAA 3VFWB 5DLLA 3QPXH 5IG7B 2C9RA 4XR8C 5D6DC 3GQFA 1WLHA 2R29L 2HP4A 3ZPDA 5BVJA 3D4GA 1OSYA 2AEOA 4LVNB 3QZPA 2VW7A 3MX0B 1OTSC 3TONA 2WIIB 4IBQA 4ETQA 5ESQA 5JDJA 1KCWA 2V17H 5ENWB 3B5TA 2R0WL 3OWRA 1KB5B 4NAQA 2VZ1A 1VHPA 3TBWA 4XOEA 3QORA 1CFNA 1TJHL 4PJDE 4QOKA 2N56A 4HLJA 3GB7B 3RIKA 1KTCA 1EX0A 3FKUS 4JO4L 3STLB 3LSOB 3H85A 3EADA 5D1ZA 4HJJL 1RL1A 3FYIB 3T4AB 4AIEA 5BV7L 1T89A 2PXYD 2WP3T 3CHXA 2DAVA 2GIYA 2FNWA 1WZ1L 4ZFZB 3D2UD 2OYKA 2AV1A 1E8WA 1DCEA 1TQWA 1SYVB 2CUIA 2VXTH 2X42A 4UV7L 5TF1L 3TBSA 2X44D 2MIZA 5KANG 3PG2A 4FQQB 4KXDA 2C8NA 4FNPA 4NNYB 3TNNA 1R46A 4JPWL 4D9QD 5DFTA 4LF3A 2MKWA 3GMMB 3MV9A 3UJIH