3GT6A

Crystal structure of the hspa from xanthomonas axonopodis
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
100
structure length
100
Chain Sequence
b'TAQWVPRVDIKEEVNHFVLYADLPGIDPSQIEVQMDKGILSIRGERKSESSTETERFSRIERRYGSFHRRFALPDSADADGITAAGRNGVLEIRIPKRPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Low molecular weight heat shock protein
publication title Crystal structures of Xanthomonas small heat shock protein provide a structural basis for an active molecular chaperone oligomer.
pubmed doi rcsb
source organism Xanthomonas axonopodis pv. citri
molecule tags Chaperone
total genus 17
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3gt6A00
2CG9X 2CR0A 2WJ5A 2N3JA 1WH0A 1WGVA 3QORC 3IGFA 4ZJ9A 3W1ZA 5LUMA 3J07A 1WFIA 3QORD 4JUTA 2MNWA 2KLRA 3L1EA 2N0KA 1GMEA 4M5TA 3Q9PA 3EUDA 4I88A 3Q9QA 2JKIS 3QORA 1RL1A 4YLCA 4PBDA 2K8QA 3L1FA 4FEIA 4YL9A 4YE0A 2Y1YA 2Y1ZA 2O30A 5DS1A 2RH0A 2Y22A 1X5MA 3QORB 3VQLA 4MJHA 1SHSA 2WJ7A 4RZKA 2XCMC 3GT6A 3VQMA 4YDZA 3AABA 1EJFA 3AACA 2KMWA 3GUFA 4JUSA 4PCKA 4M5SA 5DS2A 3GLAA 4YLBA 4ELDA 3L1GA 3N3EA 2BOLA
chains in the Genus database with same CATH superfamily
1HK6A 3RFZC 1RUAL 5AFAA 5DJ6A 3V4PA 2B59A 2FECL 4NPJA 5T1LD 2BSEA 3A47A 4K0OA 3SE4A 3HUJB 1VFAB 4PMFA 1WTLA 2GC7C 3ROOA 2FO4A 5HVWA 4F8TA 2A83A 3L4WA 3PUCA 3MGOB 3BHBB 4JO3L 3MJWA 3U0PB 1KIRB 4MA3A 5KVFH 3RBGA 4RGND 3ARDB 2NOYA 1P84K 4A7TA 1DUZA 1CDIA 3AXIA 1B9KA 3ZL4H 2F5BH 2D4FA 2BDNL 3EF7A 4YDLC 1IGTA 2Y6SC 1YEEH 3VXUD 3VXMA 4JG1H 4S11A 2E3VA 2Z7WA 2YC1B 3FT1A 3RWDA 3H3KA 3Q1EA 4WAFA 2EQDA 3JV5A 2NTSP 3J07A 4BKSC 5HDQH 1KCUH 4M6NL 3O6FD 4G6FB 4ANVA 4NERA 3FFCA 1JPTL 5DLML 3ULUH 1L7TH 5CBEB 5C9KA 1I7RA 3LKNA 3AADB 3G5YB 4WW1A 5DJAB 4AQ8C 5LBSA 4G8EA 4XOCA 5J6HB 4W6YB 5KVEH 2CLRB 4GI9A 2FB4L 3OG4B 5CWSA 1NPJA 3SPGA 1G4MA 1UFGA 3AM8C 3ZU8A 2OKMA 1B0RB 4W4OC 1A4AA 1U93B 5BZWA 4PJFE 2PCPB 2MCAA 3MRJB 2ZKYA 3QXDA 3RU8H 2WN3A 1J1PH 3QARA 4DGIL 4JFHE 1BHGA 4AL8C 1RSYA 3VI3B 3L3OA 1ZPLA 3UAJA 3LKRB 1M4KA 5IJDC 2Z31D 3TO4A 4JG0H 3BWAB 4EZMA 5CM1A 1CDGA 2W65A 3CSGA 4OGXH 3FTUA 2BOBB 1IGJB 3GUTA 1KBBA 2WCPA 1GJWA 1OOWA 1K85A 5LKNA 3MOAH 3F65A 5BUGA 3BKCL 1BREA 4NQXA 4PRHA 5KVGL 1WLHA 3NMEA 2FJFB 2DLHA 1NBQA 4MS8C 1CN4A 3DSFL 3QFDA 3VFWA 1FPTL 4XMTA 4LAQH 5KYXB 2D7TL 2XPGB 4MHHG 3CZGA 5D7IA 3SDXF 3HBZA 3IKCB 4M7JL 3OJDA 1Z0MA 1F3JB 4Z7OF 2BH0A 4XRCB 1FL6B 3HBPA 3FOMB 1JI2A 3DX3A 4PWEA 3OGCA 4LT7A 3K46A 2HLFC 2NYYD 4WO4A 1S7XA 1CIDA 3ZKXB 4NRZA 4HC1H 2FHFA 3S97C 3DROB 1PZUB 4NQDA 5MEPB 3WSQH 2WVVB 4BK5C 3Q9PA 4G72B 5DA4A 1ZT7B 4IM8A 4B3VA 1JYWA 4DEWA 2X9XA 1OD9A 3MLRH 1C5CH 2F53D 2OR8A 1HILA 3MV7D 3QG7H 3BWUF 1XGYL 4N2LA 5DMGD 3M17B 1JK8A 5JHBA 5ILTH 3Q1SH 1YN7A 5BNXD 4YLBA 4F7EB 2WGNB 4BXSV 2WPGA 1JF1B 1MCJA 1ADWA 1WAPA 2P5EE 3QWRD 2XWEA 3ZX1A 4AM0A 4RISH 1B4RA 5CP7A 4FFZL 3WKNA 3OWRA 3ARFA 4Z7NF 1YHPA 3H9ZA 1CVSC 1NIFA 3BXNA 4LO9A 3VFPA 3RB5A 1JXFA 1JPFA 3H4FA 1KB5H 1FNEB 2WB1A 4JDTL 3NZHH 5E9AA 5AENA 2H3NA 4E9RA 4H8WL 3ASNB 4JREC 2KS0A 3WO3B 1SHSA 1G7LA 3FTWA 1WD9A 4NNPH 5KSBF 4RA0C 4JRYB 2V5YA 5KVDL 1M6UA 2FLBT 1CGVA 2ALWA 4XP5H 1A7OL 1G1OA 2X88A 3MMEB 5LJYH 3SCMA 3IU3B 5KSVB 3KLHC 4L3EE 5BO1L 3QG6B 1NANI 5INCB 4OF0A 3LEYH 4M61B 4HXAL 2E9JA 3CN2A 1FO0A 4ZAKA 4U6XA 3K72A 2GBUA 2ZCHL 3UC0H 1JN6A 1RL1A 1X3DA 4I0PC 4LVEA 5AOIA 3DO4A 5C7ZA 4H8VA 2BVUA 5CN2A 3SGDH 3D85D 5HHME 4W9EC 4IKJA 3THMH 4AUYA 3A6BL 4L1DA 2OL3A 2XZCH 4JFPB 3V4UH 1N68A 1RUMH 1HIMH 2PCXA 3X14B 1C8QA 4K8RL 1JD9A 4YDIH 5D93B 1PLGH 3E1F1 4JFWA 5D2LE 3MUGA 4FJYA 4GXFA 4WIQA 1NC4A 3QFJD 5JPNA 8PAZA 4NO2B 5EUKB 1U8NA 1RULL 4P3DB 1CBVH 3C60A 3LTVA 2LW3A 2G2RA 1BOGA 1QW8A 1UWEL 3RJOA 1OAUH 2X89A 2UXVA 2Y7SA 4NKOB 2EO1A 1D9KB 4N0UA 1GCFA 1SJHB 4LFHG 5SWSB 5SWZA 3S8WA 3FONA 1WBZB 2W60A 4I2XA 2QQKL 4QUOA 1QLEB 3W81A 4UT6H 1IC7H 1K5NB 2K4AA 4TULL 3BZEA 1A4CA 4LASL 1YEIL 4B0MB 5KSBA 1H19A 3GGWB 1JHLH 3LQAL 4MD4A 1THAA 4RQQB 3CN4A 1J8RA 2GW5A 1F0LA 2VLRD 4ELME 4RMQA 2GJPA 2NCMA 5DJ2A 5FO8B 1I8LA 1ZHNB 4MYWB 3NFSL 4N2OA 4OZIB 2KQNA 3CZJA 1XEDA 4N6RB 3B6SA 3IPEA 5GQBA 3T65B 2GJ6D 5HI5D 4HKJA 3CFCH 3P69A 1NGQH 5I73B 2WWMC 2Z1KA 1KCKA 5IEHA 3A5VA 4QNPE 4U33A 5FM4A 5B4MC 5DGRA 4XNBA 3IN2A 4XNAA 2F7PA 2JKNA 3GJFK 3L5WA 1Y1UA 2MCMA 5E9DE 5J1AA 3E8VA 2QR0B 1A6AA 5ICUA 2JJSC 4B9YA 1R6VA 2AK4A 2Y06L 3SBQA 3ZSSA 4YDKH 3PL6C 2XG5A 3EJJX 3KXFB 4UIKH 4N8VA 4XPTH 1MVUA 5DR5H 5EU6D 4XCYB 3LN5B 4RLDA 4UT7H 3MRBA 5D1XC 2O5XH 4XNUH 3TN0B 1S7SA 5J8OA 4JDVA 3NOIA 4QOKA 4I18B 5AAMC 2FYVA 4UV4L 3LZFL 4YSOA 4Y8AA 3UAFA 3VXNA 1P4LB 3BAXA 1F58L 1UWXH 2NY6B 3CQQA 4XVTL 2NW3A 1ML0A 2ITDA 2W07B 3D30A 3F2LA 3NA9L 5HHPB 1M71A 1HH6B 2Q3ZA 2ICWB 4LGPB 1JDAA 4YLCA 2C9VA 5JIPA 1FGVL 4LCVA 3FO9A 3HI5H 2K45A 3L7EA 3N04A 3FT4A 5FR3A 5E2TH 1W72L 2F8IA 4XNMB 5F2FA 3TCLA 1FNGB 4TM9A 1RK7A 3VFTB 2WXMA 2QKSA 3P3UA 2H26B 3QWOB 1MFUA 1YECL 3BPOC 3FTXA 1IKNC 2ZUVA 1MELA 4IMKA 4GRLA 4FZEL 4XCEB 4OM1H 1X5ZA 2XZQL 5F3FA 2UVFA 3WELA 4WUUA 3BIAX 2R69A 2XXGA 1F42A 5BUAA 4R4BB 3EUDA 1OD7A 3L1OH 4TN9A 1S9WB 4P2RA 3ZE2F 3HB3B 2IG2L 2OW7A 3NCJH 1MWAH 3POHA 4HUWB 4AYFA 3GI9H 1HYSC 4RRPG 4FG4A 1QHQA 4Y2DC 2ZAGA 3QR1A 3QDAA 2BNRD 1C08B 2ESVB 3FOLB 2J8HA 1JZDC 2F15A 5EHFA 1R24B 3NCBB 4BK8A 5T1KB 2PF6A 1TQVA 3ROLA 5CD3A 5I8CA 4H1LG 3DGCR 4PJFF 4Y19A 5C0CA 2FGWL 4XH2B 3SPVB 5F0PB 2DYPA 3UBXA 3OVUB 3FQUA 4DFIA 5K59E 4XMLH 1SM3H 3ZO9A 2Z4QA 5E8OA 5FUZH 5SX5K 3GMNA 3OAUL 3FCSA 2ZP0T 3J7HA 3DX8A 1LO0L 1BZEA 1HEZA 3K0YA 4P5MB 4YHNA 3DX1A 4IOFD 4RGNC 4JHAH 4QXUL 1H3XA 1OZUA 1UEMA 1RK1A 3SY0A 2IGFL 3RIKA 1YC8A 2NXZD 5CNHA 4F7CB 3D87B 2GC4C 2Z7UA 1ZLWK 2IBBA 1MH5B 1KBPA 5KSUA 3VFGH 4B95C 2JKTM 4KMTL 4YSTA 1OHZA 4B9JA 4NQTA 1UZ6E 4G1MA 5HDBF 1B0IA 2VMFA 5AW1B 2W88A 1YNTF 2X7LA 1GIGL 1ZIBA 3HZVB 4PI2A 2IDFA 3EOAA 1T1ZB 4O2CB 2B3RA 1RZ8A 3O6FC 4F3FA 2VLMD 3WDHA 1ND0A 4AIXA 3BVNA 4WFFE 4X7TA 2W0PA 2K9UA 4IJTA 1MXDA 1MFEH 3TOPA 4OKVB 2YKLL 1N67A 2NY3D 2F54E 1TF4A 1F5WA 4MAYA 4ZSOE 1RZFL 1HCZA 3WHXA 2ED7A 2E6PA 5E0FA 1EBAA 3C2SA 3CDGB 5CZVH 2WIIB 1WT5C 3EO9H 4WHYG 3ZE1E 4XVSH 5F88B 5MHSD 3F58H 2A1WH 1KJMA 1R5VA 3FO0H 3BZ4A 1I8IA 4Y4HB 4JO5A 1JOIA 4OZ4A 4OI9A 4ZPVA 4Z7WB 4PJFA 2EE6A 2Z31C 4I1RA 3I3EA 4HUKB 2WQVA 3J27A 4KUCD 4AZUA 4F9PC 4LNRB 2P4AB 3PLYA 3TBTA 1ADQH 1XIWA 3D0LA 2JCCA 4EN3B 1UVQB 3S4SA 1G9MC 4OLUL 3B9KA 2RTTA 4F15C 1MVYA 2GSGB 3L3KA 5JOFB 1YJDL 4MJIB 3ISWA 3I50L 2IV9A 2ZWKA 2WQSA 1T89C 4JFFE 5F3BB 3QO1B 3OKLB 3T0XA 2WUBL 1EJ6A 2VZTA 4GO6B 4UQDA 2P5WD 1D6VH 1JXJA 1T4KA 5T1MA 4E5XA 5IBUB 2FQDA 3QDGD 1PLBA 1T6VN 1L0YA 1X5JA 3E80A 1H8SA 3P30L 3SOBL 1X9RA 3NJIA 4LLQA 5ERWB 3RPKA 5FB8A 4XCCL 1WISA 2NYYC 1IM3B 1YEJH 2VITB 4OBSA 3BZFA 4O51A 5JIDA 4WI0A 5FHAL 4HVBA 3NESA 1DFBH 1QTPA 2AJUL 4QR7A 5IWLC 2VE6A 2YIHA 3G04B 3IK2A 4HIJA 3V4PL 2FX9H 1N59A 4FP8H 3DNKA 4XPGL 5E8DH 4N2FA 4I88A 3FT3A 1CO1A 1T7XA 2WZPA 5DURD 5T5FA 1HZHH 3QUYD 4MTMA 3SYAA 1Y1DA 4F9LC 5ITFA 1ACZA 4B27A 2WLLA 3P2DA 5M95B 1DQJB 5DMGC 3HC3H 4G3YH 3HUJF 1AJ7L 1INEH 1LE5B 1RZKH 2N7AA 3PABA 3JQOB 1AOZA 4PLNC 5KUKA 1MHEB 1VFBA 2VDNL 3APFA 2MJWA 3B2UD 1KTLB 3UYOD 2CUMA 5DTFB 3TJEL 5IJCC 1JRHL 2V9TA 1XF4A 1JHKH 4P5KB 1JZ4A 1ZANH 1NCDL 1QI3A 1SYVA 2FYYA 2O4EA 4ICXA 4D94A 3CLEH 2H1PL 1NPUA 2P5EA 4TPRL 3ZDZB 5CJ5A 2FAUA 2N0KA 2WKOF 2Z8RA 3DTUB 1HZKA 3C87A 4NENA 3GZPA 4OD2A 1CGSL 4TL5A 3PHQA 4PCSA 4JKWA 2O6PA 2VISB 3JWNH 2FBOJ 3QORB 4OUUB 4TOYH 5ACLA 5LBSL 3AUWB 2FT8A 4ZTOL 2ZCLH 4MLSA 3SO5A 4L4JA 1KY6A 1A6WH 1INDL 1KN4L 4NT6A 3WFDL 5IY5B 4B97A 4GQZA 3X3FL 5E1HB 1WA2X 3LV3B 2IBZX 1AR1B 4JFXB 4FCAA 2ZCZA 4L3EA 5DQJA 4YDJA 1FLRH 3BEVA 5EU3A 5EDXA 5EBLA 2Z8SA 2CKBA 1YYMH 1HOEA 2R4SL 4C4BA 1WEJL 1EGJA 1FNSL 2EDWA 3T0EB 2V7HB 3QUMH 2ZPKL 3ESOA 3IMSA 2J1ZA 3ISRA 3EJUA 2F19H 2OXGB 2DI7A 1F4YH 2NSQA 4F7PB 4LHUG 3G5XA 5CP3H 4G6MH 5D7LB 1RJLB 3OQ3B 1SUHA 5DI8B 5F7AA 4ZD3L 3WI9A 3QDMD 3ZDXE 1XCTB 4N0YH 3OAYK 2H6UA 1RFDL 2XG4B 4OY9A 3BFWA 1AXTL 1HH9A 1KENL 1M05B 2FR4B 1CURA 1XR8B 1J9SA 2EIDA 3HI6H 5D2LA 5SWQA 4S10A 1ET5A 3IEAA 1Q9KB 1TITA 1ECZA 5DA0B 1T20B 5AWNL 2X1PA 4DQOL 1HQ4B 3E0GA 1U8IA 4U1IA 5FYLD 4A63A 4AUUA 1U8HB 2JVUA 4XPHL 3EGSA 4PFEA 3S34H 4FA8A 3DHPA 1NCTA 3NIFB 5LXVA 1G7IB 1V54B 1E50A 1RZ7H 5KW9H 1CDBA 3MV8E 1AP2A 2J5WA 2VXQA 3ZZLA 4FN0A 3GMQB 3ZYIA 1FV1B 2R9HD 2XQYG 3CH1A 5F7DB 5FCSH 3U2SB 5MEND 2O6EA 3LKQA 1DBKH 4DESA 5FYJD 5H94A 1A3ZA 1RUQL 5EU5A 1WP6A 4XE5B 3ULVL 1R17A 3IKKA 1A8JH 2WWKT 2ZX9A 3BQUA 4U6YA 1RZQA 3NIDB 1MJUH 3MJ8B 4I89A 4ELMA 3D12B 5HI5C 3LSOA 1XV8A 2BP0A 2I60L 1Z3RA 2B1HL 2P7TB 3QZPA 4HKXA 4XX1G 4YSUA 1EHLL 2CDGB 3QR0A 4UT9A 3L3GB 2MKWA 4BA8A 2JKSA 1FFOB 5EWIL 3GSNA 1PZAA 1R47A 3BSGA 3JTTB 5CO1A 1CJYA 3TBVB 1R0AH 3MJ9H 2Y0SA 4R7DB 1D5ZA 2QMKA 3C6EA 3TYGH 1VGKB 1MJ8L 3MNWB 1BMZA 4FXKB 3RI5F 2GTZA 1QBMH 1KBKA 3P4MB 4ZMYA 3ARWA 5E9DA 3VSUA 1NUGA 5E8EA 3QHFH 3TBSA 3IFNH 5AOLA 3NCMA 4Z7VE 3O9WD 1IMHC 2W1NA 4Z78A 4TQ8A 2FJGB 2YARA 5C0ND 4GAGH 3FB6A 1A7RH 1HQRB 3RNKA 3WAKA 4P2QB 5F0LB 2VDKB 2CD0A 4UQ3B 4UNTA 5DFAA 5DD1H 4EI5B 3R06A 2CGYA 2XI9A 3GMLA 3H53A 1OF2B 2EE3A 4TYUA 3NH7H 2ZKHH 4PJCB 3PGCA 3OG6B 3FT2B 1MJJB 2NLJB 2BCKA 2BX5A 3EJZD 5AYUH 4MX7A 3KDMA 2EC8A 1S7WA 1JZHA 4YAQA 1CK0H 2VWEE 3IFPB 3MBXH 3T8VA 1M7UA 2OL3L 1W91A 1MQKH 5ITBH 1J5OL 3HZMB 3W3BA 4I3SH 3UJIH 1LMIA 1K3IA 4PJ8D 4OLVL 2XTLA 5FOBA 4IRJA 3PQYD 5EORH 3QPQD 2JE8A 3SGDI 2F58H 2R1YA 2N0MA 4DQAA 5DYOA 2FT6A 2FEEL 5FLUA 1HZLA 3ME0B 2IDUA 3H2QA 5FK9A 4RBPH 2BC4A 3HZYB 4JFDE 5GGSB 4GEJA 3IDJB 3HMWH 5BXFA 3BUTA 4OT1L 4NNYB 1DQLH 3PE9A 4YXKL 5B1AB 3D34A 1AQKH 4FXGA 3PJLA 4TVPE 1XH3A 4LPXA 5H4ZA 1UTDA 3T4AA 1MRDL 1TVHB 3MROA 3CHXA 4OB5L 1BAFL 1T1XB 2FH6A 1E4XL 2NX5D 5DEFB 4BE6A 2R1WB 1WO2A 3H8NA 3LIZA 1BD2D 4G9FE 3LH2H 2HRLA 4IOFC 4UAHA 1QRNE 1ORQB 2Y24A 4KC3B 1YY8A 5L2JB 1QSZA 3HZKB 4WKZB 1BFOA 2NXZC 1XGRA 3JTBA 3AWGA 4KY1L 4Y2LA 1ES0B 2AXWA 4EDXA 3LNHA 1UOWA 4MRCA 2A99A 2CE6A 2DB8A 2NSXA 4QRUA 7PCYA 2CDEA 5I9QC 1PTZA 4OCWL 1A9BB 1S3KH 3DSNA 4MJ5B 3ESMA 3ZQWA 3WNPA 2X42A 3OKYA 3L4CA 1BX2A 5BQDA 4OZIF 3FUFA 4NFBA 1WDAA 3QCUL 3MO1A 4D2NA 5D4IA 2V9RA 3H42L 3KPSB 2EIZB 3AMLA 4GAYB 5AW2B 1NOLA 2G5BA 3KPOA 3GSUA 4S2SB 4UINL 2E75C 1N64L 3BEWB 5D4JA 5I74C 2GSIA 3B8YA 2A38A 3CLWA 4FTVB 1Z9PA 2F54A 3VD3A 1MPAH 5DS8A 5E5RB 4V1DD 3SZKC 1PJWA 4JUSA 1QR1A 1F4AA 1HN1A 4Q9BA 4X7SH 4B9IA 1IEAA 1UXSA 2XETA 3Q2VA 3EYUH 4KDWA 5EZJA 1QSFB 4HX1B 4IMLA 1Z9SA 4QJ3B 2XWJA 3SBWA 4Y4FB 1MW0A 3K4ZA 5L7XH 2R8SL 2A7BA 3WTYA 3FF7A 1BBJB 2I9LB 2X9WA 3DVIA 3DLQR 3ECQA 5G2NA 1FZOA 4WI9A 4IW4C 1JG9A 3MZGB 4ODVH 2X41A 3BP5A 4AIEA 3IE9A 1RUKH 1GZHC 4HUUB 4FRWA 4WJ5A 1MHHB 1X5LA 3U36A 2YKKA 1ZLDA 3CDZB 4NXSA 4WTZG 1E9OA 1S7UB 3ZT5A 2EYSA 3S96B 2OZ4A 3MJ7B 2V37A 1PYWA 1SGKA 2FJUB 2R56L 3PGDA 1GTNA 1M7IA 4XMPH 3H3PH 2MMXA 3A6CL 3I9AA 4PYGA 5HYEA 1D6EA 3SDCD 3UTSE 1G7JA 3MODL 4BH7B 1PZ5B 3OB0H 4AVIA 4BZ2A 3KPRB 2R69L 4JFFA 4IBVA 1BQSA 1JZEA 1IRAY 4JGUA 4PLOB 4FQ1H 3LXCA 4FYQA 4PUBH 3Q6FA 5I30L 2DKSA 5J9PB 3B2PA 1ZV9A 2B14A 4FGMA 3HC0A 1X4XA 4G70B 5DC2A 3BGFC 5BS0B 1KLFB 1X9QA 3DX6A 4OLZH 4P5RA 2HFGL 1EEZB 3K6OA 1OP9A 2V33A 2XHNA 4L4VB 1ED3A 1XGQB 2L7QA 1ZSDA 1XD0A 2GSMB 3VG0L 4OD3L 1UACL 3HTLX 5JW3H 2P80A 4AKQA 1N70A 1TJHH 3VRLF 4ZXBD 1PG7X 2AK1L 4QPEA 1MFBL 5GHWL 3QUYC 3COOA 5DUBB 4GSDH 2OMWB 2ZQKA 4OZGB 3LJ3A 4FEIA 3D9AL 5CD5D 1IC1A 2CJUL 3B2UC 3OZ9H 2WCSA 3WUWB 2ARWA 4YDMA 5IKCA 5C0DA 3QH3B 4ZDHA 1M9SA 5DJ0A 1KC5H 1NBYB 1TJMA 1AH1A 1YN6A 1IC4L 1AQMA 3HG1E 1NGWA 1BVNP 4XN9A 3IPBA 4LEBA 3UPRB 2YUZA 1TZHB 4XO8A 5CU5A 4D9RD 1HXYA 1SXBA 2F08A 3QUZC 4M00A 1D7DA 3WG7B 1IE4A 1CFNB 3VXOA 2NQ3A 3T1WA 3VXTA 1IZJA 3GBNL 2V2TB 3EJCA 5I71B 1CG9B 2Q7YA 3SO3C 2YFNA 3STBA 2MNJB 1OVZA 1MF2L 4L9LC 2VDRB 5GS1C 3VSTA 1KLUB 2CR3A 4BFGA 3U30B 5L88H 4LLUB 1AY1H 1C5BH 2H0JA 3ARBB 5B39B 4HG4K 4JDEA 4JO4H 5HDOA 3D51A 4LSQH 3S88L 4PHXA 3DUHA 1JZFA 4PBWD 1E2ZA 3LY6A 1KFAL 3BAKA 2PPAA 5LAXA 2ZYSA 2YAMA 1YEGL 5E95B 4P23D 5A1AA 2ZOLA 2MQGA 2JIXB 4M5ZH 3VQLA 1DR9A 2DOCA 4MJHA 1MIMH 4PRBB 4ONHB 3LS4L 3Q0HA 4F93B 3P9WB 3K6NA 3BYTA 2XWTB 1U8JB 3RDJA 3FQRA 3UO1L 2OBGA 4KX8A 1YY9D 1OK0A 1YQVL 3BPNB 4R2GD 4BRVA 4DKTA 1G0YR 1T1WA 4G8GE 3POCA 5JOEA 3UIZA 4H7VA 2C3WA 3R0NA 4DKDC 1DHKA 3SGJA 1MNNA 2Q0ZX 3O2WH 4X5LA 43C9B 3ZDYE 1Z66A 1PQZB 1OSPH 3ZL2A 4JR9H 4S1SL 4FQCL 3DOIA 4LIQE 4CRPA 3W5MA 3X12A 3IJ8A 1UH4A 2VXVH 4LCCA 2GUYA 3UJTL 1E8WA 4BFRA 1XGUA 2WTOA 5F1NB 3KVPA 4JHUA 1FCCA 3R4DA 1TZGH 2R9HC 4G7RB 2ZJSL 2NUPB 3T0BA 1BZ8A 2J25A 3TEUA 4U4BA 1CDCA 3CMOL 1L3NA 3F8UB 1LXMA 1MFCL 1PD6A 2JKIS 5AOMA 4PJIB 4MXWH 1AO7E 4YDLB 2F68X 3LKSA 5IB2A 2DH2A 2VN4A 3SKOB 5C07B 4DERA 5J6GA 1KJ2H 2WJ7A 4MNGB 5DD3L 5GSRA 3ETSA 3UBFA 4HZAA 4N85A 1AHMA 4LLMA 1ZRUA 3BWZA 1BVZA 4KPHH 2DAVA 1TCRB 3CHOA 4ODHL 2CG9X 3TT3H 3KS0H 2LTQB 4PVNA 1BZ9A 1MFMA 1EJOL 4V11A 1D5XB 2WNKA 4WSKA 3VTMA 3RHWK 1VFOA 3MRNB 4IOSD 2BDNH 2WV3A 3UJJL 4JFOB 3Q9QA 4DZ8A 2PLTA 5E1GA 3O9WC 2NDGA 1FAIH 4LCUA 4LU5L 1KGWA 5C0NC 4Z7VA 3SYCA 4HEME 3TH4T 1E0OB 4QRTA 1F6LL 1I7UB 1V3LA 4UDTA 5CINL 4UYPA 1ZA3B 5JQ6H 1TJIH 5TH2A 2UXTA 5DZPA 3X2QB 1N7MH 2VR3A 3OR7A 3SE9L 2X38A 4KJWC 5DU7A 2CHDA 2DIBA 3KYAA 5K5YA 1JDDA 4PJDB 2BP3A 3FU0A 1NIDA 4DT2A 3BCDA 3PP3H 3HKFA 4JPWH 1FVCB 4KHXH 1C7TA 2EXTA 5KANI 3TVMB 4JLRB 3FU8A 5FKPB 2CHNA 3S3SA 3EJZC 2CKBL 2YN5A 2FH8A 1UD4A 1EGJL 1JZ3A 2NY5L 4K73A 1CQKA 4PRNA 2RQ8A 1R5WB 4X6FA 4JGJA 1NCIA 2V7NA 4ODWA 3GHBH 1NUDA 4EN2A 1EK3A 2VDQH 4PJ8C 3WENA 1B2WL 2BSTA 2EEBA 2CQVA 4M43L 3QPQC 2C7FA 12E8H 3DECA 3LEXB 1NSNL 3F7RA 4KUZL 4P9ML 4WUKL 1P7KA 2B15A 1I1AA 3O45B 4GRMB 1T5WB 4D8PB 3HE7D 1Z6JT 2O5YL 5C0AE 3N1GC 3W0WD 1CL7H 1F56A 4PR5B 3SJVD 3RVTD 2C4FU 1TTFA 2WBKA 4HAKA 5I1LA 3BKCH 3QEQB 4KQ4H 2UV3A 2DLGA 3UCRA 4MXQD 1AS7A 3MLXH 1A3RL 2DWDB 4K8RD 2AC0A 3EBGA 4MZ2A 1AC0A 5B8CA 4OJYA 3VGDA 2VXSL 4JFDA 1SPDA 5GGVL 3VDBA 5KZCD 4JZJA 3LZOA 5JQIB 4L8DA 3RKDD 2O93L 3UPAA 1UB5A 1T80A 3L17A 4ZUSB 1Z1WA 1WIPA 4PRPD 4M6ML 1LD9B 3QQDA 2XRAL 4GIAA 1KY7A 1CGXA 4QXGH 5AZEH 4BSWB 5KWYC 3U7AA 2CLZA 4I1PA 5DRWA 2OCCB 1H8NA 3RVUD 2UVEA 5HYFA 2AEQL 1I1FB 3QDJB 4G9FA 1QRNA 2Y1ZA 3O4LE 4UOW0 3QEGH 4WEEA 2RQEA 1ZT4A 2IANE 3ECUA 3PWJB 4NUPA 4P5TA 3VVWA 3GB7A 3NG5A 1HINL 2P49B 4Z7QB 1P9MA 1N4XH 3BLPX 1QBLL 4J8RB 4F91B 1OTUD 3GSNL 5LGJB 5IJKC 3BP6A 3DO7A 2XFXA 2FWOB 4L05A 5CXPA 1SEBB 4WW2F 1HS6A 2QSCL 2VT0A 1JHTB 4PREB 2ZUWA 1L0QA 2BNQD 1FVEB 3LNDA 2VMJA 5ISZE 4IBWA 2VQ4A 3UTZB 4OU3A 3SDDA 3KBEA 3WGUB 1JV5B 4QO1B 1I31A 2JQMA 5CJOH 4X80H 4WU7A 5HYQB 2Y5QA 5CMAB 4KTGA 1DQQB 3FU5A 2XZZA 4GO9A 2VC2L 4W70A 2P8MA 4MCMA 4HU2A 3L6FA 1B3JA 1TJGL 4G80B 5TGBB 4WNQA 3RE0A 1DO6A 2WCGA 1ZHLB 3U4BL 4EIGB 5HY9A 4ANXA 3CQFA 5AVWB 1FSKC 4HU8A 3H9HA 3NJVA 4UM8B 2PO6A 5LGHH 5TDPA 4KV5F 4Y5XB 3KCPB 3V7AG 4LSSL 3B7SA 1JV2A 4IK6A 4J3OH 3RDTD 1F4WL 4DP4X 4YDVA 4IDJH 3WIFB 1GC1H 3O41A 4YE4L 5E2UH 4H8QA 1TQCB 4ZUVA 4EUPH 3TEWA 1P5UC 2IXQA 4L3AA 3SDCC 1NAKL 1NEZB 2R23B 3C5JA 2VZOA 3FUJA 4AZ8A 4HZLA 1DQDH 1O9VA 5E51A 3FUNA 1IT9H 2VZVA 1MIEL 2DM2A 3UTSA 2ZG3A 2AI0H 1OAQH 1OEZW 2CXGA 1B88A 5IP4A 1EA9C 2R0LL 1UWXK 3NP3A 4XZUA 2MWCA 4GB9A 4WW2A 2DQIH 3HN3A 3NJJA 1J0HA 4K23L 1A1OB 3QIWA 1HDMA 1K4CA 2OXHB 3BPLC 1BQHA 3TPKA 2J5LB 4NO5B 5E99H 4H88L 1RUPL 4ZOAA 3IN0A 1PPIA 1PX8A 4XXCC 1KCRL 4M62L 4ZXBC 3GFUA 1B4JH 1U92B 1SYSB 5LNDA 3US0A 3F7QA 2QQKH 3IPFA 4DPCX 4JFUA 1YDPB 4KTYA 3KWUA 3KYOA 3Q2CA 4NPYA 2OA9A 5CD5C 3K7UA 1A1NB 2OPCA 3FCTA 5EEUA 2BERA 5EFIB 4CSTA 1UWYA 1DEEB 3LQAH 4WEMB 4HDIB 1T2XA 3MNVA 4D3CH 3EW3B 3MXVH 4C83B 4OCSH 4YR6A 2B1AH 4J12A 5JZ7D 2QSQA 1BPVA 1MFNA 4R96B 5CJBA 4LSUH 3M45A 4N2NA 3U4AA 4Q4IA 3FT0A 2Q1EA 1I4FB 2P9RA 1KIPA 2NTFA 2VKXA 5J13B 4LP8A 5D1XB 1BAGA 1ONQB 4J3BA 2OMUB 2YRZA 3ZDYF 5IG7B 4XO4A 3AREB 2MHAB 1J5HA 1VF5C 5D2NB 4ZW7A 1NIAA 1SDDB 1WBYA 5C09D 5D6CB 4C54A 3UBGA 5I1DB 5IUSA 5DGQA 3UZQB 3QULA 4S1RL 4MMYB 4OLWL 1N3NB 5JHDE 1T21A 3I2CH 3K5SA 2GI0A 2AXGA 3ZN6A 2ARJA 5E00A 5EF2A 3D3VE 3DMMA 3QUKB 3KWVA 5BW7A 3PXJA 4LVHC 2DLEA 3I6LE 5CBAA 1W8EA 3C8HA 1OGTB 2A6KA 1GAFH 2VR5A 1ZD6A 4NQVB 2ITCA 3LRLA 2H6PA 1DN2A 1W0VA 4P23C 3MRQA 3VA6A 2C3XA 1Z5LB 1UM5L 1ZS2A 3LZFH 4GSRA 3ZIYA 1OCWL 4HCRA 1S5HA 1HHIB 2FRGP 3L5JA 1PG7L 3NA9H 4XPBH 5L4FA 2ATAA 4IS6A 4X2UA 5GGUA 1Y07A 3A21A 2F8VA 4M6AA 2X28A 4PY7B 2EDTA 3OSKA 3R8QA 2H1XA 4XX1E 2ZKMX 1BVLA 5DD5H 1YY9C 4R2GC 3LEVH 4YVNA 1OV8A 2V2WB 2ICEB 2VLKB 2AQPA 3F7VA 3C2AL 2GK2A 3R4RA 4NBZB 5CSZA 3WO4B 4BZ2L 1C5DA 1SHMA 3DDGA 3QZOA 1U8QB 4G8GA 1OLZA 4MNQD 2IDSA 4KRPD 2W95A 3V5HA 1NCOA 3NN8B 4XO5A 2AXHA 2VZ1A 3N2JA 5I28A 1BJMA 1U3HA 3MLVL 4QTFA 4JGNA 5KYUA 2ITFA 5EBMA 4WGWB 4RMVA 3RB7A 5IREA 3BD5A 4WCYL 4BFIA 1YMMD 1B3IA 4AGQA 1JYNA 1EANA 1RP9A 2Z65C 1T1YA 2JJVA 3F7PC 4U6HB 1EHNA 1E5YA 1K4DB 3RTQB 3FJTA 3ZYZA 1NQBA 4MCYB 5DEGB 5DQDH 4K4KA 1QFWM 1AXSA 1A9EB 3MRKA 3QNYA 1VEMA 1WG3A 4F24A 3IDNA 2Q76B 4JRXD 1TU2B 5DK2B 2RFXB 3LXUX 1MUJA 3CK0L 1AO7A 3PWUB 3P40A 3Q13A 3TNNA 1AZBA 2BSED 4HJGB 1G0XA 1U8MA 3HEIB 2Y7LA 4MMZA 5CHNA 4KI5E 3ECBB 4CMHC 4AE0A 1PZSA 2MFNA 4X5WA 1KB5B 2Q8BL 5AVSB 4G6JL 4ZTPH 5GRVK 2P8PB 4XNYH 4HCGA 5C0BD 4AK2A 2FZ3B 5GS0L 3NGBB 5DUMH 4Z9KB 2DEYX 2XUWA 2WD0A 2Y3AA 3C08H 1CLCA 1QA9B 1K3ZA 1GZQA 3QRBA 3VFUA 1AIFA 3VXMD 2A74A 5DJZB 3DPBA 5ANME 2FSDA 2V9UA 1FL3A 3I75B 3SEPA 2HJLA 4KQ0A 2X4SA 3P1VA 1WFMA 2BZDA 4NDMA 4RRPA 4H4NA 1GMIA 4NUGL 3DETD 4HEMA 4JZOA 4LBAA 1RZFH 3FFCD 2HXAA 5IROA 2HFEA 3HG4A 4K2UH 4KHTL 3HNSL 2R0ZL 4H8WC 5KSAA 3HE6B 1DL7L 4H1LA 4X98B 2WLHA 4IIQC 4F15B 1FQ9C 1JPEA 3PWPB 4FQXB 3BLKA 2HPTA 3SDYL 3FFDB 5HYSB 4H5SB 5CU9A 3AT0A 2XKNA 1OAKH 1NBVH 3UEQA 2CH8A 3DA0A 4FLHA 5C97A 1ORSB 3UAJD 3LZQA 3IETA 4MXVE 3KJ4B 4D9LH 3TO4D 1D2OA 3CFDB 1L4IA 2XXFA 3HE7C 3PNRB 1JNNH 1W9XA 2NW2A 3VGAC 3BAYA 5EBWB 1HU8A 3RVTC 3CSYB 3TZVB 1JI1A 1G4RA 4I4WA 1AC6A 1EIBA 4P06A 4MXQC 1CR9H 4TSBH 4W9DC 5JIMA 5C0AA 4K8RC 3CD4A 1ZGLP 1JGUL 1BZ7B 1NDMA 2G75B 4GI8A 3QCTH 3II2A 3RKDC 3FRUA 4PG9A 3KWTA 3UAAA 1DEDA 5CJQL 3C5ZA 3B2MA 1QFUH 1KPVA 5GSVB 4DTGL 3TYFB 3TA3A 2F53B 3RWIB 3EG9B 1D2PA 3WJMB 1DVTA 1PKQB 5CUSL 3GDCA 3FH8A 4U1LA 4DO5A 2YAEA 1U58B 3CVHA 5FGBC 4JZNA 1WICA 4PBXA 1BFVL 2VAJA 5JDSB 1X5XA 3V9EA 4NKQB 1O0VA 5BRZB 1KIUB 3CXDH 3V55A 1TFPA 2X4OB 3O4LA 5FUOH 1KV7A 3RPBA 3FN9A 3L2MA 2WLJA 2H9GB 1HSAA 4YHPB 1UWGL 2IANA 4NZUL 1BMGA 4B9FA 4ZOEA 1OTUC 3VD9A 1NCJA 1YYCA 2EVHA 3EZ8A 2H45A 2WXKA 3ML8A 3SDAB 4R8WL 4HIEA 3PDGA 1TTUA 3ULVD 4JQIL 5JUEH 4DK3A 1WAAE 2D7MA 5KS9E 1TFHA 2NY4D 2FECI 1RZJL 3OJ2C 3GMMB 4ADGA 3HG5A 2HUHA 2WINA 4ONFL 3MTRA 4S1DD 1WCBA 2EXYD 3KH4A 4ICWA 4OCXH 1P5VA 2NY0D 4X9YA 1L6ZA 3ZT7A 3QPXH 5ISZA 4QDGA 5D7JA 2EE9A 1CWVA 2DMHA 2G4GA 4JHWH 2VERA 4L9DA 5KN5B 3JWDH 5I17A 1GA2A 3GEFA 1QQDA 1CGSH 1J18A 5CEYA 1E42A 3V52H 3FQTB 3HG2A 3ILDA 2CK2A 4MNHB 2AKRA 2CMRL 5GGSY 5I8OH 3EXJA 1SVZA 3L3IB 3BT2L 1QLRB 2PKDA 2CRYA 3RVWD 3RFZA 4GI6A 1I3VA 4HKZB 1AGDB 1ET7A 3WFDH 1FZMA 1JVOA 2XSKA 2FEDD 3RDTC 2C34A 1PFCA 4J6IA 2IWEA 4RGNE 4OV6F 1XZ0A 1BFTA 2WXFA 3K4AA 1RI8A 2VQ1B 4HFUH 4XMZA 2IPKB 1X5FA 5SV3A 3VI3E 2ZCKL 2OK0L 1HOCA 5JIIA 2VSKB 3VXUE 2H4EA 4FMKA 1RY7B 4XPAH 5HGDB 4ZAKD 4PGJA 4PJEF 3EO0A 3IJYB 4DP7X 3VH8A 4X5XA 4K3JL 2WLMA 1S8DB 2V17L 1QWHA 4ZQKA 5A2LH 4ZT1A 2BVQA 5DHYA 2Y1YA 3E38A 3LIUA 2QKIC 5IEKB 3BAEL 3FO1B 3JBG7 1KENH 2WO4A 4QHMA 1J8HB 1NFDB 2DD8H 4W1TA 3TBYB 1T83C 5ID0A 4BSVB 2ZUXA 3LPPA 1AMXA 4LVNB 2QHRL 1D5BA 1U42A 3QIUB 1P7QD 3UDWC 2R1XB 4AQ1B 4AQ8A 5AWNH 2MPAH 5TDNB 4R26H 3BN9D 5IW6B 1IQDB 1TTGA 2FLMA 4Z7IA 2A6JB 3ATBA 4Q0XH 5IQLA 3RUGB 2CIKB 1TDQA 3DBSA 2HKAA 3N91A 3AM8A 4D0CB 4W4OA 4A7UA 2QTVA 2F18A 1YYLL 2VW4A 4QRPB 3VFVA 1IC5L 4F7KA 2C1OA 5SWZD 1II4E 5INDA 3KWXA 3HHSA 2X1XR 1DO5A 2G9HB 2ZUSA 2KDYA 4OJDH 1KTDA 5DRXB 5A43C 3QFGA 2WWKO 4PGCB 1LEKA 2BHYA 4RBPK 1A6TB 5JZ7C 1KLGB 1I3RA 4XCFH 3N0PB 1I7TB 5AVZB 2Y5TA 1SLXA 3VD5A 1OTTD 2DQTH 1A6ZA 5F1KC 4HPYL 3WXWH 5BVPH 4N9GB 4QRQA 1A7QL 2EH8L 3W39A 4RCAA 4Z7QF 4HK3J 2FJHA 1V10A 1U3NA 4HJ0D 3O81A 4IHOB 5GISH 2X3CA 5DJCB 5EWIH 1W0YT 4S1QL 3WLBB 1BZDA 2K7QA 3KYMB 4LPTA 1BVKA 2D9CA 5LGYA 4DP8X 5L0QC 3OLDA 5LDUA 4NCDA 4RZKA 3L4TA 2X4QB 3VXPB 3AXHA 3KPNB 1JK9A 4NKMA 3DV6B 1XF2B 3QWNA 4PJ5B 5JHDA 4BWTA 3V6OC 4RWYH 5K39B 4RNRB 3D3VA 3V0VB 5BZZA 4DEPB 4WSJA 1FL5A 1I85C 4B5EA 5GZNA 4X8JA 3EO1A 1QNZH 5B3JE 1HL5A 2K0RA 3OPZL 3U2JA 4DGYH 1NWOA 2YWYA 5ABZA 2XQYA 1M9WA 1NGYA 1SDYA 3B1UA 2GY7B 3M1CA 3PPSA 3CFJB 4GPVA 4X4KA 2XTSA 3ZO0A 1OPOA 1TKWA 4G83A 1C1EH 1RH8A 1FO0H 2IAMD 4L37A 3RWFA 4LL4A 4R0LA 3GPSA 4Y2OB 4FERA 4Z7UE 1NMCC 3QCVH 1NWPA 2BSBA 2DQEL 3T3PF 6TAAA 1HHHB 5G5DB 5IHHA 5DDHB 4UNVA 3MRGB 2R0WH 1EBPA 2R2HA 4HHAB 4QRAA 4WWKD 3WUWG 3B7UX 4E9SA 3RZCA 2IQAB 2XACC 4KRPC 4E0RA 4XOAA 2P48B 3MLSL 3TJHD 3O3EB 1YJDC 1JPSH 2OJ1A 2DJ4A 1JMXA 2BSRB 3ESUF 1KBGL 3AG4B 1T2QL 3ULSB 3TH2T 4XNXL 1GHFL 2DN7A 5EOTB 1H6FA 4FA6A 2I24N 5AB1A 1QO3A 2P26A 3EHBD 2HLAA 2UZXB 4ORGA 2J88L 4WUUD 2HKHL 2OMTA 3DVFA 4JM2A 4FD0A 1CFSB 4P2RD 4QGTA 1S9VA 3BUIA 4OT1H 1RJZB 4HMDA 4YHIA 2NNRA 3ZRCC 1S9XA 1CT8A 1DQIA 5I2IA 5A7BA 1R3HB 5EC2A 4PY8I 2ENYA 1FNLA 1IFHH 4UAOC 1MRDH 3BUYA 5I9QB 3T1FA 3OB0K 4PV1C 1OGPA 2AABL 5B39G 1TTRA 1E4XH 5BZXA 1CD1A 5C0CD 4JGMA 4YX2H 2DYPD 4Q2ZA 4ABVA 2G60H 1H15A 2AJVL 4DGUA 4G6KL 3SE4C 4I0PA 1KG0B 3BDYL 4PP1D 5T3ZL 1T5XA 4EVNA 4HWEL 3KLAB 4MXVF 4QAMB 5DHEA 3RGVB 1EFXB 1FHNA 2ZXWB 2CRMA 4N20A 2A6IB 3VI4E 1LNUB 4KY1H 1KB3A 2WSDA 1UZ8B 4BZYA 3DTXB 1S46A 1H3VA 3QFJE 5DUPH 3IDXH 4GBXB 3QQXA 3BE1H 5FC9A 5TE4L 1IQWL 3QA3B 2R2EA 3ULUF 3QXTA 2GITB 3KEDA 2PW2B 4GUCA 4MB4A 3BSHA 2IEPA 5IB3A 2HRHA 4FFVD 1JGEB 4X6BA 4OQ1A 5ANMA 3DETC 3UTQA 1N64H 2DQMA 4BJLA 3TPUA 3L3HA 1WZ1H 4XAWH 4Q9CA 4OF5A 5GJTH 4G7YH 3DGGB 2PW1A 3VU1A 3MLTA 1HSBA 4B9ZA 5DJYB 4WK0B 3QUMB 4IRSB 4PJXE 3SKNA 3PNWB 4E42B 3T9WA 3I3BA 4NKDB 2DWSA 3EZJB 4PWHA 5F71A 4BQ8A 2VLRE 5D9SB 2O30A 4NQCD 1NCCL 4HCRL 3A22A 4L48A 4HLZG 1JXGA 5FUCC 2HH0H 4APQB 1P1VA 4KXDA 1MRCL 2GJ6E 4M48L 2NYZA 3L3OC 1YA5A 5AOJA 3UAJC 3G9VA 3BCFA 5IMKB 1CS6A 2LR4A 3TO4C 3EYSH 4J8QA 3TU6A 5KS9F 4JFHD 3QAZB 3C5SB 1X5IA 4WTXA 1VFMA 1XIWD 4FQQA 2EE0A 2W38A 5JLZA 5JPMB 1CF8L 5F0MB 2C8NA 3BGFB 2WXQA 2YMXL 1PDKB 4LCWD 4NGHL 2ENSA 2IDQA 2DQHL 3C6SA 4U2ZA 1AQDA 1Y6NR 4X6CB 3DI3B 1Q90A 1HXKA 1V3JA 4HS6A 5IB5A 5EU6E 2R69H 3V0HA 4GKZB 3PL6A 4F7TB 5CS7A 2VZSA 1SOKA 1WS8A 2H0PA 1WWCA 3REWA 4GAJL 1ZWIA 2F61A 4LIQL 1U0QA 3V0JA 3OAZH 2ZXEB 1ETJA 1XR9A 2X4NB 3QJSB 4BDVB 4KZEL 4KK9D 2VL5B 5I1IL 5D1ZI 1M57B 4RIRB 2H47C 5AAMA 3P3SA 4YHOH 4OD3H 5FV1L 1PEWA 3HBQA 3CCHB 3QYCA 2O61B 1EX0A 1BQLH 1UURA 3D39B 1D7BA 4DKFL 1SEQL 3V7AE 1XL4A 4EEEA 5ESAB 5AUMA 4QTHB 3NYKA 3LH9A 4LEOB 2FO1A 1J1XL 1A47A 2B4CL 3M1BB 2XA8L 3ULVC 1GW0A 3QUZB 1F6AA 4R5VA 3D9AH 2BPBA 3VNYA 2D31B 2Z92A 2WZPD 2NY4C 1J11A 4YHML 4NZTL 4N0RA 3OR6B 1IKNA 3U0PA 2A9DA 1OXYA 1WAAA 4S1DC 4JFEE 1NAML 2EXYC 1W15A 1J9CT 2NY0C 2PYEB 4L29A 1NFIA 3B3IA 2HB0A 2EH7L 4PW4A 5DSCB 4GW4A 1GGBL 5DVLA 4OV5B 2XQBH 2J57A 1SMAA 3KL5A 4Y2DA 3RILA 2WXHA 3EYVB 4PGEA 2D03H 5G4MA 1UGNA 3UYPA 4AMKL 3L08A 4KKPA 5FECA 3FUHA 1HYRC 3VTAA 5JYMA 4OSUH 2CO7B 3RVWC 3TBWA 5CBEA 4K9EH 1EMTL 4JFTA 1JWMB 5DZOA 2FEDC 5T1LA 1EH9A 1IKOP 1J0KA 1HT6A 1SN5A 2YQ3A 3BUBA 5J6HA 4YHKL 4UI2A 1KTJA 2YXWA 4MFHA 3ARSA 1TYRA 4LCYA 3F7YA 4Z7WE 2YUXA 4CUCA 5F9DC 2X6UA 5FFLA 1UA6L 4L3ED 4ZAKC 2FX7H 2QPEB 5HP5A 3VI3A 1DUYB 3QSKB 5AVUB 2WMPA 3VXUA 3V79C 2FL5A 2VLME 4MJ6B 4ADIA 5E2JA 4DHLA 5FDWA 1GYVA 1VPOL 4XC1L 4RAHA 5FF6A 2J8UE 5MP6H 3UO1H 1JF5A 3PP3K 4OLYH 1PLCA 3I3DA 4WHTB 5HHMD 1IM9B 3ELQA 2B8OT 5TQ2L 3SQOL 3FTGB 3JT0A 5C0RH 1YPZB 5CJ8A 3BRDA 2B0SH 4NWUL 4E2OA 1CC3A 2V5SA 1FJ1B 3NVQA 1GOGA 4TNWK 3BN9C 4AGOA 5I8EA 2FJFA 5IOPB 3H7BA 2Y23A 2A0LD 1S7QB 4NQUA 4DN4L 3GIZH 3P9LB 5KYXA 4Y5YB 2XPGA 1KYOJ 3UJTH 5AB0A 4JFZL 1ILUA 1OCZB 4ORZC 3CVHL 35C8H 1E4WH 2WQWA 5KAQF 2Z31A 3KYNB 1D5IH 2EYTB 2IQ9L 5TTRA 5HHOB 3P4NB 3RWHB 3U46A 3O0LA 3OC5A 4F9PA 1R5IA 3GLDA 4OZHB 5I6XB 2R2BA 4PGBB 1OTTC 5T5FH 4FABH 2EDOA 5L6YH 2UXGA 2ZF8A 3DO3A 4LBEA 1WGVA 2WLYA 5MEPA 1I9RH 5DD3H 5EA0L 9PCYA 3RQ3A 3QC5X 4HG4J 1E43A 2ITEA 4HJ0C 3K6SB 4ZX4A 2P5WE 4M93C 5D72L 1KWKA 3L1FA 1NEZG 1XDTT 5J11B 3QDGE 4P4KD 2TAAA 2WWNA 6CGTA 3PV6B 3A6OA 3E9TA 5I1HL 5E08L 3GS7A 5I76B 2XN9D 4F7EA 3RGHA 4JNXA 5K33A 4UQ2A 1TVBB 4RFNC 5IFAH 1L9OA 1JXDA 4AYDC 2W0FB 2ZP8A 1DSFL 2J8OA 4K3EH 5DMIL 3P77B 4LOEA 3KG5A 3RBSA 2VDOH 1K2DB 4N28A 2I25N 1V05A 3E6HA 3T2OA 1YMHB 3WNJA 3BVXA 3WKMH 1ZE3H 3MBED 1FNEA 3ZMRA 5IFHH 4UMGA 3U0TB 5HGGS 3WFEH 4Q9RL 2HSIA 2J6EA 1K6QL 3L7FB 2VO5A 2XJLA 4EI0A 3JSSA 1SBSL 5EPMB 2IADB 2IAMC 1U91B 2BOCA 3CBRA 3WN5B 5D5ME 3IU3A 2CKBH 2ZXCA 1NEUA 1KEML 1EGJH 4FQJL 5B1JC 5GGQH 2WAHA 5I0YA 3VGGA 4WWKC 4NRYA 4Z7UA 1MZYA 1SF3A 1LO4H 2XTJB 3P0VH 1A4JB 2J2ZB 1QSEB 5E2VH 2G2PA 2QADD 3QWRA 3TJHC 5IB1B 2JK5A 4TMPA 4ODUB 1NJ9A 3BJ91 4HAGA 3E2HC 5AB2A 3L5IA 3QJVB 4WUKH 2Q7AA 1E9PB 4HJJL 4B9CA 3EHBC 3WIHA 4GLRH 4IRJD 3X14A 5LNEA 3WFZA 4BZ1A 1PF3A 1VRSA 3L13A 1KCBA 2X1WL 2Y72A 3OKKA 3SE8H 4OW6A 4P3DA 1MHCA 4L5FH 3FU7A 5DMJB 3X17A 3HS0C 3QNFA 1FFPB 3JTSA 4ECNA 4CVWA 2NY2B 2MOQA 4MGXA 1D9KA 2EKJA 3HFML 4GSUA 4P9HL 5GGRB 2XWDA 1WBZA 2V5TA 2VXQH 2XRAH 2JQZA 2YZ8A 4G8AC 1FH5H 3IMWA 3U83A 1FDLH 4IK7A 2DJMA 3OQRA 4LMQE 1J87A 2RGSA 1WAEA 3D85A 1SZNA 1T03L 3GGWA 3NJGA 3SYPA 2VLJB 3QDME 3BFQG 3QJHA 1D3CA 3BH9A 4GKLA 4Y5VA 3VI4A 5K1NA 1OHQA 1HINH 1Q9LB 4TNVK 4DNLA 5I75C 1ZHKB 1QI5A 4UT9H 1ZHNA 5IBTL 3QFJA 2WXJA 4ZPTA 5H37H 4DCQA 3CHRA 3F12B 3OKOB 4FFVC 4Z6AT 2D0FA 3ZIMA 3HA0A 2YAHA 4JY4B 1KEGH 2PCFB 1VACB 1F8TL 1HI6A 2OMBA 4IGBD 1JYVA 2XLLA 5D1QB 1QVOB 1FWXA 4QRRD 3VM7A 1LEGB 1JNLL 3N5AA 2VN7A 4H13C 1FSKB 4RETB 3EXLA 2WXNA 3T2NL 2X4PB 2PWFA 1EHKB 5ABDE 3EH1A 1Q9OB 2DL2A 2WYTA 4K7FB 2OR9L 2OMVB 5MENE 2OJEB 3RGBA 5FYJE 1J10A 3D5OF 5EOCJ 1WFOA 5CSBA 5BUPA 3ESNA 4PJXA 2E7CA 2UWEE 4NUJB 1X5MA 1SLWA 4C55A 2VLRA 5E2WH 1HL9A 4I18A 3GLAA 4FCHA 3ZY7A 4PJCE 1NBCA 2ISDA 1IL1A 1J7VR 2GJ6A 3EJQA 2AGJL 2HCZX 1XIWC 3INOA 1O9WA 2XZAH 4GAFB 1HH6A 1KDJA 2ICWA 3QNZA 3B9KC 1I3GL 1RKRA 4M5TA 1FH2A 1H0DB 3X13A 4QHPA 1NAKH 4KKNA 5HPMA 1RHHB 4HIXL 5ACZB 4G9DB 4ISVA 5E6IB 5EU4B 1KULA 5B38A 2FNWA 3AFLA 4PJHB 4KVPA 2WTRA 3FMGL 1NCAL 2Y2YA 3V4VL 5E4EB 4J2QA 3WOVA 4GFTB 4PV8A 5I6KA 2B5IC 2R0LH 4NO3A 4JFFD 1H3UA 4TSCL 5ES4B 1CYXA 5TE6H 5T3XE 4KK9C 4X8CA 4MB5A 4R4BA 5IZ7A 1O6VA 4GINA 1S9WA 4F8LA 4PW3A 4UTAH 2VR6A 2AFNA 2GJZA 1MEXH 1KJ2B 3QIBB 4MQSB 1C08A 5DMYA 1JE6A 2D9QB 3NJXA 3MRPA 1DBAH 2DKMA 3RWGB 3MGTA 1QABA 4E41B 4LPWA 5T1KA 3LIZH 2P80D 1OE2A 3QUXB 4XP4H 3L9YA 5LQBH 3AGVA 2GBVA 3ATDA 4RDQG 5C6TL 1LQBC 1HAUA 3EYOA 4MA1B 4U0RC 4DP1X 1SN0A 5HYSG 4GQ9H 3EJYD 5TPWH 3PQYE 3M88A 1AFVL 2JXMB 4JKPL 1DBBH 4P5MA 4AEHL 2A9NH 4FQHA 3K3QA 1E4XI 3ZTJH 2WBXA 3ZKMD 1LM8V 3EJTA 1RURL 4WWOA 2O26U 5D96C 1TYEB 4XWGL 2YEQA 4AG4H 1OTSD 2X6BA 3BVVA 4W68A 1TPXB 5FWRA 4JFEA 1MH5A 3O6KH 1H8OA 1GS6X 2F7RA 4YWGL 5JA9A 3RLSA 3KLSA 4ZZFA 1ZHBB 1KCSH 1INQB 4TSAH 1TTBA 3NAAH 2QPDB 3ZHKA 3KPSE 1AG0A 4Y1AD 2A3TA 2AZAA 1ZTMA 5GS0D 4QHKI 3VGFA 4DFHA 4KTDH 4WV1B 5A2FA 1BYNA 2BS8A 4NO0B 3CFBA 2XN0A 2NX5E 4JN2B 1ZVSB 2WZ0A 2WZ6A 4FTVE 1BD2E 3G6JE 1JPGB 4N24A 3B83A 1CICD 5IMLA 1FZJB 2VDQB 3CDGA 4YBHA 4AJYV 1OLLA 3IJEA 5EO1B 3LXAA 3HJ0A 2EXSA 3W9EB 1N2RA 4XN2A 4LLDB 4GMTH 5DK0B 1FIEA 2QLVB 3MCLL 3LD8B 3B2VL 5L4IA 4L8SB 3AVEA 3EH4B 3TIEB 4PW9A 1FNAA 2R0KL 4QHNA 4Z7WA 1GXEA 1PG7H 3PGFL 4P2OD 2NY5C 4TLKA 5IVZA 1OQOA 1VHPA 4P46B 4PJAE 1RD6A 2MTAA 4JAMA 1BIHA 3U4EA 3VXSD 3IDUA 2PPEA 3APMA 2JQAA 1GSMA 2OZ4H 5T33L 5DJXB 3NZUA 3AGWA 4RGMB 1GH7A 3CFTA 3DRTA 2B2XH 3CFQA 3UTPD 1MI5D 3NJMA 4HUXB 1HJBC 2R27A 4OGZA 1Q4NX 3C2AH 5FFGA 2J8UA 25C8H 2AJXL 2JTYA 1RMFL 2UX6A 3D4ZA 1U8PB 1MDTA 4V1DE 3EOTH 4XXWA 5M7QA 3X11A 3TC9A 4UF7C 4X6CF 3QO1A 2A0LC 2EEFA 4WLCA 2VDLL 3CX2A 3LKOB 2COVD 3HMXA 1I7ZA 3PJSA 2CR0A 5GS2D 4G7VL 5EF1A 4QT5B 3MLVH 3DIFB 4GG8B 2YRPA 4BFOA 3BX7C 3L54A 5C8JA 4RGOL 2FD6H 5GGTA 5BS0E 4BFBD 2E76C 1MCRA 4NN7B 4YHZH 3VVVA 3LZPA 4L4VE 4NAQA 2W9LA 3MNMA 1IU1A 5DS1A 4OCNC 5LDSA 2DM7A 4CMHB 2Q8AL 3FB8B 5D5MF 1USZA 1RZIA 2FE0A 3BN3B 2VAAB 5C0IB 1KZQA 1GZHA 3VXQB 3G04A 2L7UA 1XSJA 5IHLB 4DWHA 4W9HC 4GAAA 3UBXI 5E6YA 3NSYA 3V8OA 3HRZB 3HAEH 1QKZL 1FYHB 1RK0A 1SJEA 1F45A 5FV2A 3WHE1 4I5BB 4P4KC 3VXRD 5E6UB 2CU9A 2E4TA 4NQEB 3A4EA 2DS4A 3WIIL 2P5WA 3CU7A 1BOYA 4JJ5B 2H5UA 3FO2B 2GAZB 3GXFA 3QDGA 3VFRA 32C2B 1KTLA 1GY2A 1JWUB 3W9DB 1BLNA 2PTTB 3MA9H 3CZKA 1FBIL 5IESL 4AYSA 3FQXB 1E8ZA 4Y4KB 4CU7A 4LSVH 3OTTA 1MCFA 3MBEC 3QXAB 1MAML 2WXLA 4LLVB 4FFTA 5K9QI 5IQMA 4ZFGL 3UGUA 4EUPB 5T5NF 2ERJB 3Q8BA 3VJ6B 2R0ZH 4DKAA 1MWOA 3WEMA 3CIQA 3AABA 3FB7B 2OMXA 1ZMYA 2TRYA 3MXWL 3ZKQD 1WCQA 2P8LB 5JIQA 3P11L 4I3RH 4XNQA 3RA7H 3D2UB 4WWPA 2KC0A 5F9AC 5HJ3A 4PWJA 4HIHB 1IVTA 3VFSB 1SY6H 2QADC 1HKLL 1E6OH 5IHWA 3QJFB 5KZCB 3C6LD 4PWKA 4D9RE 1ZGLB 2HN7B 4Z7AA 4NYLA 4Q89A 3B3BA 3HPLB 4X0NA 3ARGA 3N9GL 5CLZA 5IVNA 1MLCA 4YE0A 4AENB 5DK3A 1UT2A 1W80A 3NFNA 4IRJC 3TH3T 1UM4H 1RU9L 1B4TA 5D70H 5IB4B 2W92A 1RJLA 4GW5B 1WHOA 5DI8A 4M7KH 4W6XB 1I1AD 4PJBF 5EIQA 4J3SA 3C8KB 4UWQB 2WANA 2XG4A 3FRPA 4WJG3 1JGUH 4JG9A 2YXMA 1JAEA 1YPZF 4MA8L 4YHLH 2Y4SA 4XBEL 4FQIL 4L9LA 5GS1A 1YAZA 4FNRA 4YSQA 4U4IA 4FOMA 4OIAA 4XZ4A 4AIZB 4HSCX 1T20A 3ZTNL 1Y7VA 4HOXA 4M56A 1HQ4A 2X40A 3GJFA 4JFDD 4FXGC 4XMKH 1N6VA 2A9ML 2DTML 2NR6A 2WW8A 5EZLA 4AT6B 1J5IA 1YC7A 3GSVA 4PJ9D 1ZA6A 4GXVL 3T4AC 4AVHA 1ZTXL 1L7IH 4HV8B 5AOKA 5CUSH 1ZT1B 1A7PH 3ZDWA 4B53A 3IVKB 4NAMA 2OAAA 1CFMA 4M6OH 1UUNA 2V2XA 1AD0B 5ICXB 1DVXA 1XD1A 4K15A 4RAUA 2PPDA 1U95B 1JP5A 2TSBA 3GSQB 5C0GA 1G9ML 2J4WL 3S48A 2Z7YA 3U2SA 5A16B 4A67A 2XV0A 4DPRA 2XN1A 3CVIH 4G9FD 3QDMA 4OZHF 4M03A 4PJGE 3U9UA 4NZUH 3WD5H 4LF3B 1MFAL 1U8KA 4ZFZB 3QBTB 1F00I 1IAOB 3BP4B 3CDFA 4R8WH 3BGMB 4N2KA 2IMNA 4BRJA 2AAAA 2ZT9C 2RBLA 1U21A 5ESVA 1ZLSL 1S7RB 4IGBC 2CDGA 5KVGE 1RZJH 3LRSB 5DRNA 1UA3A 2H8PB 3MCG1 1XH1A 4ONFH 2CLVB 1DCLA 3TBVA 5IHZB 1S9YB 1XWVA 1UCBH 3MV9B 2Y36L 3GBMH 2APBA 3S8GB 3GNMH 1QYGL 1IAIL 5CIPA 1OT1A 1VZHA 4DZBA 1Q1PA 2VIRA 2EP6A 4G43B 1LO3H 4WHDA 2VJXA 4GRWE 5F6IB 2NCEA 1FORL 2K3HA 5MENA 4IBZA 3BAJA 2J6EL 4F2MB 3S35H 1MREL 1WSST 3MLUH 3BKYL 4IBSA 4PJDE 4F7MA 2UWEA 1IGFL 1U3JA 3O0RH 2DBJA 4HGWA 5DZNA 4M8QA 3WDJA 1S5IH 4PJ7B 4H0GA 4PJCA 1GOFA 2PO6D 3VU2A 3NCYP 1BGXL 4AYID 1ZV5A 3FT2A 1MJJA 5CKAA 3E8UL 3KBFA 4NP9A 3RAJL 1WC7B 3SGEI 5D1ZB 1AZNA 3DYMA 2NT1A 2DWEA 3EADA 4HFWA 1BM3H 1DBML 3TV3L 1AGEB 1X5GA 1NGPL 4JPSA 2IH1B 4XBPB 3VX1A 1FRGH 1XTMA 2FX8L 1E90A 2BVOB 2X2UA 1JF6A 4YSRA 5FM8A 3JWNG 4IDLA 3WIHL 4RFEA 1X6NA 2JLLA 1JFQH 1QFOA 3UTSD 4BZ1L 2K6YA 3L4XA 3HC2A 5F89B 2ATPA 1KTCA 3GKWH 3MNZB 5AW4B 3FHEA 3S9DB 1Q94B 3ERXA 4P3WA 1OM3H 4GW1A 1E7UA 3AMKA 5JOPE 3LMJL 1ETA1 3HZYA 3CJJA 1MFDL 3I6SA 5GGSA 2HWZL 3V0WL 3F05A 3FU6A 1H5BB 1YEFH 4TVPH 5EN2B 4M4RB 4AGMA 1GYCA 1JVLA 1FG9C 1CBJA 2BP8A 5F7YC 5BMFH 1EAQA 4LK4A 1OAXL 3CC1A 3EJYC 3ARYA 3FAWA 2R1WA 1IFGA 1BMWA 2GIMA 4MMXB 4Z3EA 5C2BL 5CJXA 4LSTL 4JFQA 4NHUB 1N0XH 4RMUA 3W0WE 3PQYA 3IXAB 3SJVE 1OTSC 1T7YA 5C08D 5EZOH 5T3ZD 4EOWL 5H2BA 3VJ6A 1D5MB 5HVHC 1J05B 1ETZA 1VADB 4N8CH 1A7QH 1PY9A 1A9BA 1WS7A 3IS0X 4MJ5A 1L3WA 1LQSR 1JGIA 5GS0C 4XN8A 3MCKB 4P59H 4R7XA 3KPSA 1N0LA 2AXJA 2QGEA 2MOGA 3GK8H 4MQXD 4NUMA 4AH2B 3FQNA 4JY6A 1F90H 2NX5A 5BV7H 5HXMA 1XGTB 4FTVA 1BD2A 3TWCL 2HVKA 3G6JA 3E9UA 4I9WD 3H0TB 4LP4A 3KR3H 3DMMD 4KAQH 4LFHD 4PGDB 3ILPA 5KBDA 4WEUD 1E6JH 4TRPH 1DFXA 1FIGL 2UUDH 4HX1A 1BVOA 4GEIA 1M6OB 1JVKA 1O75A 2L04A 4P2OC 3CPLB 1SHXA 1XX9C 1MCOL 4P2CG 1CPUA 2IGLA 3U6XA 3T0AA 2YR3A 1JZ5A 2EYRA 1QLFB 2HP4A 4MSWB 4KKRA 1AIZA 4EPSA 3U7WH 1VKXB 4PJAA 4A2EA 2DY2A 4OCYL 2BNQE 1IE5A 3O8XB 1QUNA 5IJKA 1Q0YL 2UX7A 3CDZA 1R3IL 5HDWA 1S7UA 1E9QA 3IGUA 5E8PA 1AI1L 3QZMA 4XMUA 2I5YH 3IFLH 2GKIA 1NC2B 5AZ2H 1N8ZA 5CLYA 2W0KA 1KCVH 2CJTA 5I26A 1NM4A 4M4PA 4BH7A 4V1DA 5CLXA 1T0NA 1T2QH 1J5DA 1WVZA 3MVSA 4FC3E 4G8GD 2EJ1A 5E1AA 2YWZA 1KYUA 5IIEB 1CVRA 4K3DH 5DJ6B 2MCPH 4XNDA 1MCBA 4H25B 2B59B 4BWUA 1Y18A 1U3HD 3HNTL 4MB3A 4MWFA 3D18A 4JY5H 3MYJA 3ROOB 2CKNA 2FO4B 5CZKA 2A83B 4ANUA 5BS0A 4XP1H 2OM5A 1G9NL 3DHUA 2W91A 3GO1L 4L4VA 4YNYA 1QFWH 1Q9WB 1GPOH 2JKWA 2EVIA 1DUZB 4RDBA 5KVFE 2VCOA 1G7MA 3D6GA 3MJ6A 5IGXH 1YCSA 1QTSA 1DLFL 1IGTB 1W8NA 3PHAA 2AV7A 4X9FA 5DUBA 5D7SL 3RWDB 1P5UA 1AGBB 2NXYB 2XQ0A 3BDYH 4HK3N 2OMWA 2PPCA 4OZGA 4Q7DA 5EEVA 3OAZK 1T0OA 1NBZA 1VCAA 2EVGA 1XAUA 3AQZA 1XFPA 3S8FB 2VRAA 5IVXE 2N01B 1N18A 4DH2A 3EOYG 3WUWA 4O5LH 1I7RB 6PAZA 4XCNA 4ZNEA 3ARVA 3LKNB 4WW1B 4UZUA 1NBYA 4KGLA 1AAJA 3FUKA 4G8EB 5EUOE 1AE6H 1NLDL 2Z34A 2WP3O 5CWSB 1TZHA 3TCXA 1V7NL 5KVEE 2BRRL 1WUNT 5BZWB 3REVA 3OHMB 3AUVA 1NCWH 3NEOA 3QXDB 3NDYE 4XXCA 1OANA 2PR4L 4FX5A 4ZXBA 2OMZB 3O6ML 1VEOA 1QOKA 2OQJA 2OX5A 5D6DC 2P1YA 1CG9A 4YUEL 3TO4B 3PHSA 4KMLB 3IJHA 3KD4A 3U79A 2OP4H 2JB5L 2GVYA 1EEYA 2YPKA 5EF0A 3WNLA 2W65B 4X9HA 5I1GL 1HL4A 2KKQA 4FHKA 3VWKD 3ARBA 3TNMA 3NSXA 1HEJC 1LK3L 1KPUA 2X3BA 1FFQA 2YJLA 3GUTB 4V2BA 3MBWA 1UKQA 2DZEA 1X4ZA 3NCEB 3NSJA 4NQXB 2CO4A 1MRCH 4PRHB 4LOUD 3KYKL 3O2DA 3NK3A 3WFCH 4A55A 4HJTA 3QFDB 3VFWB 5F3HA 5F8RC 1CXKA 5D7IB 1GGCL 1AHWC 2ZWYA 3OJDB 5IT2H 4ONHA 4B50A 2NT0A 1I1AC 2VN6A 3LHPL 3OKEB 4NZJA 5C09E 3ZKND 4MAZA 5LWYL 4U7SA 5HGBA 3PAVA 2C26A 1OAZL 3OGCB 3W11D 3Q7JA 4HF5H 5KTEL 2OMYA 4L4TB 5BO0D 3HMXL 3LRKA 4NKIH 4WO4B 4EDWL 1YEWA 3WKYA 3CZSA 1LE9B 1JPST 1NLBL 3SPIA 4LDLB 4NRZB 3HG0A 3H4HA 2X4UA 3JV4A 1XSIA 4C4KO 4DPBX 3FHQA 4RWHA 4DUVA 4JZJC 3UAEA 4NQDB 2DWTA 2NSMA 4LIQH 4PJ9C 5TQ0L 3C5ZD 5CCKL 1F4XH 1QHPA 2PUQT 2NPLX 1HE7A 5F72S 4N2BA 5GRJL 3WIAA 1XL6A 1AKJB 2VDPH 43CAA 3VG9C 5I15H 1PCXA 2NY4B 3TA3D 1GGIL 3CHQA 5I1IH 1HILB 4HJIA 2J1XA 1JNHA 5DF0A 5DHDA 1JK8B 4FNQA 3KPMA 2X6VA 1YN7B 3TS8A 1GVIA 4ZUWB 4UM9D 1NCUA 2I26N 5DJDA 4MCZB 2EDQA 1V7ML 4AM0B 4DVBA 1DSYA 3EBHA 5CGYD 3NPSB 3SKOA 4YO0A 2IIJA 4MNQE 3U2IA 3O4LD 1J5CA 4PJGA 5DJ8B 5LHDA 2O5ZH 3ARFB 2FO8A 5D8JH 3MRFA 3VFPB 3BXNB 3HN8A 2UY6A 3LKPB 4YHMH 1JPFB 4LP5A 1EJFA 3KJ6H 2Z91A 1BIIA 2DYSB 2H3NB 2R83A 2PABA 1G7LB 2HMID 4QTIL 1YMME 2DBLH 1DZ0A 2CPUA 3VWJA 3MRNA 1CGTA 1F97A 2WC7A 3SCMB 3KM1A 2J3SA 3QXWA 4JO1L 4XI5D 3SZ6A 3D05A 3MLZL 1JDCA 5L8JB 3MACL 5KYNA 3K2UH 3X1GA 1N6UA 1FO0B 4ZAKB 3BIKA 3NACL 1NIBA 3K72B 4JRXE 4OLXL 4U6XB 1JN6B 5FAAA 4D7PA 4JHZA 4Z3FA 3IF1B 1KB9J 4OD1H 5E56A 3ZR6A 4PJDA 5HHQA 4YC2C 1O6SB 4Z0BH 5AVXB 4CADA 2Y3NA 2PO6C 4Z0XA 4L1HA 2XDHA 4TV3A 4JRWA 1KELH 1MAJA 1WITA 3L9BA 5C0BE 4KKZA 3MUGB 4PB0L 1NC4B 2XVGA 4PRDA 5JPNB 2CGRL 1U8NB 1KCLA 3AT9A 1G1KA 4IOSA 3C60B 4UBDD 5FKAA 1GL4B 4W6WB 3TEYA 2G2RB 1BOGB 2DM4A 4UV7L 5EV7A 3Q44A 5EIIB 2KMWA 1DJIA 5BOZG 1CD9B 5I6LA 4N0UB 2PP7A 1CU4L 3FONB 3P4OA 4I2XB 4FMVA 5DC0A 4GUQA 2YD1A 3BZEB 4KTEL 4PR5A 5KSBB 3DHMA 5C7XL 4LHQB 4K71B 5D7EA 2DWDA 2ZUQC 8FABA 1NANH 4FQLL 3FXIC 3OZLA 4FG0A 3NK4A 5F1IA 2ENJA 3NCXA 3VB9A 4AKOA 4YK4C 4IIQA 5E1IA 4RESB 5JNYB 2AQNA 4HUCA 3QZWG 4XTRD 1MHPL 2I32A 3AG2B 5DJ2B 5FUCE 4NWTL 4ZOBA 4ZUSA 3DGDA 2Q7NA 4JO8A 1ZPUA 3OJMB 1DVSA 3V6FA 1GGUA 4ALAC 4HKJB 1OGAD 4M93B 3RIAK 4BSWA 4XNZC 5IEHB 2Y07L 3GQFA 4KKBD 5H8DA 1I1FA 1GKOA 3OHXA 5HI3D 4OGYH 3L5WB 3VO0A 5JMRA 4HIIB 5J1AB 4F92B 1A6AB 3HE7A 2IC2A 3PWJA 4NJ9H 5AW9B 3W0WA 3SJVA 2AK4B 4C4UA 3QP3A 5D71L 2NUTA 4KKCD 1PNDA 4Q8BA 3VDAA 4N8VB 2M8XA 3I02B 5CCJA 1MVUB 3EKCA 2P24A 4LHUD 3MRBB 2L7JA 3UBHA 2YA1A 1KXVA 3P0GB 2J1KA 1S7SB 2E7HA 4KK6D 4MQXC 1A5FH 1SEBA 3RVXD 4PREA 4QOKB 4OUOA 4P4RA 4MKTA 4KRNA 5DVNA 1FVEA 2CK0H 2F8OA 3FF8A 3NIGE 2ITDB 3BIBX 5E0QA 3QUHA 1ACYH 1DSFH 3O3DA 4FFYL 3DMMC 4QO1A 4EKXA 4AEIL 3GXIA 3FO9B 5CMAA 5JHDD 3L7EB 3AG1B 3FT4B 2NY7H 1DQQA 5FCUH 2VABA 2V5RA 4HWNA 2ODIA 4LRNH 4L2YA 4JS7A 3WDIA 1K6QH 4NXKA 1P4BH 2HKFH 3ULVE 3SD2A 3ARUA 4N8PA 4GRLB 2PMZA 3BSZL 4PI0A 1FYTD 1UXWB 3KCPA 1KEMH 3QQNA 2P52A 1XVSA 2EO9A 4JFYA 3T0DA 4PJ7F 4IU2A 3H9SD 2BNQA 2ZWZA 3TT1L 2IWKA 3D33A 5EUOF 2VH5L 4XN5A 3DX7A 1NEZA 1RIHH 2R23A 4U3CA 3CVCA 3D48R 2Y7QA 3S36H 2JV6A 3UYRL 4Z95L 3ROLB 5KYYA 1NIEA 4Y19B 4ZMZA 4JN1L 3UBXB 1UB6B 4OIBA 3TO2A 4ODSL 4IRZL 2GABA 1U3HC 2DDQL 2H6OA 5EBGA 2Z4QB 5E8OB 3UOAB 1JGVH 3DOSA 5T3XL 4JO2L 1VGEL 4DW2L 1WK0A 2MQ3A 2YRLA 2CNZA 3FCSB 3GMNB 3DX8B 4RMTA 3VD0A 4M7LT 2RH0A 3GZOA 5KJ4A 3WN6A 3GSWA 1BBDH 4ZUUB 3PAUA 4FZ8H 4KRMB 3RUGE 2PTUA 1WBXA 3L4ZA 3T6XA 4X6DE 3RDTA 1E40A 2XIBA 2AQRA 2BY0A 5JXAL 2W9EH 2GIYA 5ADPH 5KSUB 1U92A 3TEZA 4AL8H 3ILEA 4HMEA 4NN5C 4X4XA 3ZBMA 2N7SA 3ABMB 4G1MB 1A6VH 3GM0A 3ASWA 3MN8A 2ENQA 3EOAB 4RVBA 2FTAA 3IDIB 1RZ8B 2G0LA 1HX0A 4L3FA 4KROD 4F3FB 1UM6L 1R3JA 1AQHA 4FYTA 5EFIA 4XHQA 1ND0B 4XX5A 2B4CC 3RI5K 1R3LA 1TQBC 3BVNB 4PWGA 1W72A 4HDIA 2P28B 4MMZC 2GT9A 3VMNA 2QQNL 1I9IH 5C0JB 5LVEA 3OM3B 4MAYB 4HEPG 5IVXA 5KBPA 1M1XA 3GUFA 5C2UB 3W82A 3WHXB 2VQTA 4R96A 5IBTH 4KI5D 2QKIA 2X2IA 1J0ZA 2Y5EA 1C9SA 1HNYA 4WHCA 1T83A 5EUOA 1A4KA 4G8FB 3DXAB 1KJMB 3BZ4B 1ZGLM 1CYGA 1F8TH 1I8IB 5MI0B 2XOTA 2OMUA 1H9VA 1XF5B 2MHAA 3M7OA 4ZPVB 4FLSA 4PJFB 1JNLH 5SWZE 2C4XA 4ZFFA 1HNFA 1SDDA 3UZVA 4WTWA 4Q58C 5E8NA 2X1OA 3KBHE 4XO9A 5EF3A 9CGTA 1EVUA 2OR9H 3VWKC 4C56D 2ZYHA 3D0LB 1WRFA 4PP2A 1CXEA 3RWCA 3S4SB 3NEXA 3B9KB 4BKLB 2B9AA 4BA0A 1OGTA 2LABA 5F96L 4MRBA 1VERA 2GTWA 4HT1H 4LOUC 1UKTA 4XVJH 2EIJB 3WCYA 3C12A 1XBDA 1FVDA 3IMBA 2IALA 3B7RL 4K94L 1FA4A 4GQPH 1YNTB 3IT8D 5D55A 4CGUB 1T4KB 5DWUL 4B3EA 5T1MB 2F1BA 2CRZA 2EEAA 1KGCD 3ZKNC 4E5XB 4B60A 1I3GH 3L4YA 4JE0A 5JIHA 3W11C 4A2GA 4YH6A 4LLQB 5FB8B 1DJHA 3BUPA 4YGVB 5FFOA 5C09A 3G6DL 3NZ8A 3BO8B 3D8MA 3PRZA 3RX9A 1SOSA 3MA7B 3BZFB 4A2LA 4WI0B 3AB0C 4FI8A 2VE6B 4ELKA 3AWFA 3WUZA 3C5ZC 4HIJB 3N44F 2HJKA 3L5HA 2AQ2A 4WNSA 1N59B 3WY1A 3MLWL 3FT3B 1I85A 5DUJA 5ITFB 3TA3C 2O5NA 2F5AH 3CVDA 2PXYD 2WLLB 1UD2A 2K6ZA 4PRID 4J3OG 4OM0L 3MQIA 2Z8WC 5DVPA 4YPJA 3LQZA 4EUPG 1JFHA 4YQXL 3RTQA 4MCYA 2BM3A 1WFJA 1XF4B 5CGYC 2UYLA 4DN3H 2YGVA 2FYYB 2WNXA 3ES6A 2Q76A 1WUZA 1QEWA 2P5EB 2RFXA 2ZICA 1J0YA 2YEZA 3DJRA 3UIYA 4JKPH 4NENB 4MNQA 3LPFA 5F7KC 4HPOH 5IK3B 4ZMVA 3KDPB 3PHQB 5KBNC 2HMIC 5MEQA 1Z5YD 1G5AA 2VDOB 3ECBA 1SHWA 1U8CA 3I6GA 3JWNE 1X7QA 3OLIA 1G7PA 4MDRA 1KB5A 2K78A 1XEUA 4P2RE 1AZCA 3ARDD 4LSRH 4NT6B 1QATA 4XI5C 1YMMA 2OULB 1ZEAL 1U30A 1BM7A 2VM4A 4IBYA 1WPCA 2NY1B 3KVQA 4LB8A 4TUKH 1ZLVK 4L3EB 5DQJB 2Q10A 3BEVB 5EU3B 5EBLB 3LN4A 2CKBB 4PS7A 5E1QA 1QMUA 4Q9QL 4K7PY 3L5XH 4KK8D 2X2YA 3PWVA 2VDRL 4BGDA 4TLUA 4G6FD 4JRXA 5FO9A 3C8DA 4B9KC 3MRMB 1ZKAA 3H85A 2AQ3A 4HOMA 1VEPA 4UTBA 2DQGL 2GTQA 3HE6A 4M1DL 5HHMB 3CSBA 3G5XB 1NZRA 1MCPH 3SQBB 4F58H 5F7HA 2ZD0A 5AB9A 1ASOA 3ZYOA 4LCIH 1LDPL 4IHBA 1N5YH 2BIMA 3O2DL 1HH9B 4AITA 4HPHA 4UBDC 1IEBA 4H5SA 3D4YA 5C0BA 3MNDA 3PGFH 5JIKA 1K72A 2GK0B 4M1GL 3M8OL 1DVUA 4GMSL 5SWQB 2JB6B 3WTSA 3A4AA 2X87A 2KUTA 1AVAA 3SKJH 1DVFA 3LDBB 2NZIA 1YEHH 4FNLL 3ECWA 3QRFM 4Y9GA 3MDJA 1S6NA 3VRIA 3ESPA 4XT1C 4U1IB 2CO3A 2DTSA 5D7IF 4CW1B 3AAZA 5CF3A 2H0EA 1NCBL 5FGRA 4KZDH 5ECJE 3NIGF 4JM4L 2QPSA 1AP2B 2UY7A 4LLWA 4QWWD 3MRDA 1V8HA 3JZYA 3II1A 3WS6C 3OKMB 4UT6A 3CH1B 1BZ7A 2VDLH 3VFOA 2F2HA 3KPLA 1F02I 4MCNA 5F7BA 5H94B 4N2GA 4KJYB 5EU5B 5FYKU 4NQCE 3WNIA 3SGKC 4XTRC 3BQUB 2L4OA 3FTZA 5I0VA 4U6YB 1Q1JL 4O02H 3AW5A 4Y16B 3IDYC 3QR2A 4ELMB 3I84A 3TYFA 4G42B 1MOEA 2BP0B 3LQMA 3RWIA 3EG9A 3P0YL 4XP6H 5LN8A 5J1TC 3ULVF 2XV6B 4LSDA 4UIMB 4KKBC 3EOBA 1P69B 4P9HC 5L4MA 1UXMA 2YSSA 1JZJA 3GSNB 2X44D 3D39E 5HI3C 2YUVA 2DQDH 5JDSA 5CEZL 2JCCE 1OWRM 5FA4A 2HFFA 4O9HH 5KJRL 2KI6A 1D5ZB 3VQ1C 4LCWE 4FL4B 2OJZH 2DQUL 4KKCC 1MAKA 2GTZB 3TESA 3FB5A 5E9DB 1QKZH 1MSPA 2X4TA 4YHPA 3TBSB 3A67H 4KI1A 4XP9H 3O6LL 4KK6C 1EWHA 4JPVH 4YXLL 1BWWA 3RVXC 4CVXA 2WQUA 3Q8CA 4K07A 4ZO8A 3FB6B 5C0FA 3OC8A 4F33A 2V8LA 1A4BA 3NJLA 3LRHA 4Z5RB 4U3SA 3CPUA 1NDGA 4KOCA 2G4EA 4MKMA 3R06B 2CAKA 5GIRA 2FATL 3GMLB 2G30A 3KEHA 1P53A 3JZ7A 5IESH 1AYRA 2WOBA 1A7NH 3PGCB 2BINA 3VW3L 2HT3D 2WM0A 4AV5A 2K8MA 2B20A 4LKCA 1S7WB 5GZNC 5EZIL 2ZUYA 1CLZL 3ZMNA 4ZFGH 4R97C 4FQ2H 1QLRA 1NL0L 1ULVA 1CLYH 2M2DA 5LBGA 2L7EA 1EXUB 3BMVA 4RZCB 5FOBB 4IRJB 3LS5L 5I1KL 4I0CC 4JRYD 4NJAH 2YLKA 4MAUL 4PGZA 2R1YB 3L9RA 4R0LC 5ALCH 4AM0Q 5DYOB 4G59C 3VQ2C 3UTTE 4OIIH 2I69A 5A40E 3KGUA 4TUJA 5FK9B 1FNHA 2BC4B 3FUIA 4R9HA 1DBJH 4O4YH 3RZCC 4RA3A 5I1JH 1MWAA 3R1GH 4YBQD 3IJYA 1G6VK 3NSDA 3CHPA 1RU9H 3EGXA 4QY8A 1OP3H 2OTUB 3T4AB 3MROB 1S8DA 3ZGIA 3IDGA 1CZ8H 4O58H 1A3LL 1MLBA 4MA7H 5F0JB 2EADA 1N9PA 3WLWD 1R46A 4GKSA 4DVRH 5BJTA 3FO1A 2DLFH 2ADFL 2DPKA 3ALPA 3W2DL 4QHLB 4NM8L 1YY8B 5D7KE 1CGUA 3C9NB 4JM2C 5CEXA 4NLHA 4XBEH 1BFOB 2MOVA 3QQ9D 3T6WA 1XGRB 4Y9BA 4MDJA 2Z35A 4YHYC 5AG8A 3QC6X 3ZTNH 4QRBA 5TDNA 4U6VH 4EDXB 1YVLA 2OI9B 4K55A 4UQAA 4DGVL 3CFKA 5EOCH 5JHLL 3KNBA 4QRUB 5J12C 4NAJA 2CDEB 2CIKA 3RUGA 3Q3GB 4ZMPA 4X6DA 5ALBH 4TQIA 1UQSB 3DSNB 4D0CA 2N56A 3OXRB 1D9KD 4NHCH 4JVUA 5SWSD 3GSOB 4WFHD 1IGML 15C8L 2WO2B 4FEMA 2ADJA 3MO1B 4YN3A 2APFA 3CN3A 1S2EA 2Q3AA 1G9MH 1U41A 3AU1A 2G5BB 2XVBA 1Z9OA 3CN0A 1XZWA 3KPOB 3MRRB 3GSUB 5DRXA 4ETQA 4LSPL 3EFDL 5F44A 1AG6A 1T0MA 1A6TA 3EFFA 1N6QL 5HYJB 3I9GL 3EJPA 3FN3A 5EDSA 1I7TA 4KI5C 4OTXL 2F54B 3ZSTA 3APDA 4PB9L