3GT6A

Crystal structure of the hspa from xanthomonas axonopodis
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
100
structure length
100
Chain Sequence
TAQWVPRVDIKEEVNHFVLYADLPGIDPSQIEVQMDKGILSIRGERKSESSTETERFSRIERRYGSFHRRFALPDSADADGITAAGRNGVLEIRIPKRPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of Xanthomonas small heat shock protein provide a structural basis for an active molecular chaperone oligomer.
pubmed doi rcsb
source organism Xanthomonas axonopodis pv. citri
molecule tags Chaperone
molecule keywords Low molecular weight heat shock protein
total genus 17
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3gt6A00
1EJFA 3Q9PA 4YLBA 2O30A 2Y1YA 1WFIA 5DS2A 3QORC 4ELDA 2KLRA 2BOLA 4PBDA 4YL9A 3EUDA 3GLAA 2KMWA 1WH0A 1X5MA 2WJ5A 2Y22A 3QORD 4PCKA 3QORB 4YDZA 3N3EA 5DS1A 2N3JA 4YLCA 3GUFA 2K8QA 1WGVA 2CR0A 2XCMC 2N0KA 2JKIS 3AABA 2WJ7A 3L1GA 4JUSA 4FEIA 4MJHA 1RL1A 4ZJ9A 2RH0A 3J07A 4JUTA 3W1ZA 1GMEA 3IGFA 3AACA 4RZKA 5LUMA 3QORA 4YE0A 2CG9X 4I88A 4M5SA 4M5TA 2MNWA 3VQMA 3L1FA 2Y1ZA 3GT6A 3Q9QA 3L1EA 1SHSA 3VQLA
chains in the Genus database with same CATH superfamily
4CVXA 2QFRA 4NUGH 4AV4A 1NCOA 2YPVH 1D6VH 3VWKB 4F7CB 4RMRA 3NZHH 3PDOA 4DUVA 5LO7A 4OLUL 1X5MA 2G2NA 2FUTA 4I77L 1BW8A 1QUPA 1OCZB 4JQIA 2JTDA 1CF8H 2JI3A 3DA0A 2G5BB 1ZT7A 4HC1A 3CZEA 4PJ5D 1UUNA 1E4JA 1XGPA 4QXWA 1BEYH 2AABL 3FQ1A 5GS2D 2VITA 3DVGA 3WV0A 3FUDA 3NYKA 3SD2A 4DN3H 1XVSA 2R29A 3FTVA 3DMMA 2YAEA 1EMTH 1M7XA 4ECNA 1LP9E 4QRSB 4K3GA 3LKRA 2WLMA 4PN6A 2IPUG 3PQYB 1A1MB 3OAZK 4HA1A 4BSWA 5EEVA 5EF3A 4HEMA 3S6CA 1LE5A 1OTTD 3MLVH 3LD8C 3QQ3B 4Z7VB 2PMZA 1XGRA 1ZA6B 2OMXA 1JNNH 4ZFOB 4ZMPA 3IMBA 5CFHA 2HUHA 5I30H 1SF3A 4ALAL 3P3RA 4GG6A 1II4E 4YLQT 1SXNA 4WJ5B 5F8QC 2DWEA 1UJTA 4AYFB 4Z7NB 4U1JA 1GMIA 3GMMA 2P5WA 3WE6B 4KQ0A 4OH2A 5D9SA 5DD0H 3EJQA 3IFPA 1NGQL 4HJGA 1SXAA 1WF5A 1D6EB 4PCKA 4YHLH 2B1HH 4ABQA 1I1AA 1DBJL 5KBDA 4LQ1A 5EC1A 4BUGA 5E9DA 1YYLL 1JMZA 2FT7A 2DQIL 2BOCB 3GBNH 4PIRF 2EH7L 1JF5A 2W9LA 2XWTB 4JPSA 4ERSL 1CLYL 1KLUA 1HT6A 3LAFA 2MCAA 1I9IL 4UM8A 3KWWA 4M7JH 3HFML 2Z8VC 2NX5D 2X1XR 3FQTB 3PGFL 3TA4D 1PY0A 1UASA 1JPSL 1KBKA 1QAWA 3OMIB 4LSVH 4M1CC 2FEJA 3AWGA 2CKBA 1RU9H 2JKWA 3EOBA 3I6GB 2IGTA 5DZJA 3CIQA 1TZIB 3UTQB 2EICA 4P5TB 2NR6D 3RL2A 3D8MA 3WS3B 1YVLA 3NH7H 1A4AA 1Q0YL 3PHOB 5E1IA 4MMXA 5T5FA 2R8SL 1P7HL 3CDGB 2HXAA 5F9AC 5CCHE 4HWBL 2FJFB 4GAGL 2AQPA 4OD3H 1T3FB 3STZB 4NQDA 1Y18B 4MAUL 1ULVA 2BSTB 2Z92B 5HY9B 4NT6B 2R0KH 3OX8A 3UYOD 1FG9C 4MJIA 4FTDA 4YDLC 3AM8C 5HGAA 5EZPA 3HZKB 3LOWA 4CGUB 3L4VA 2F61A 2VR6A 4WEMB 2JIXD 3PYCA 1GYWA 1IGTB 2B3RA 4ZOEA 1JZ7A 5MEQA 5F1NB 1IBZA 3CLEH 4QHKJ 3S96A 3LEVL 2Q10A 2HUEA 3Q1SH 1KDIA 3ZTDC 3II1A 3TH3T 1JDAA 2BDNL 3BJ91 4IRZL 4XBPA 4POYA 4HFUL 1TPXB 1OSPH 1P69B 2IBGA 1E5BA 4GAAA 4P0DA 1NANH 2NXZD 3KPOB 4PRPA 1NMCB 4CADB 5IIEB 2OJZH 3DIFA 1H3PH 2NMSA 2G2PA 4FKHA 3TEYA 2WXNA 4K8RD 2O5YL 3MO1B 3LN9A 4NC2B 4TUOA 4JR9L 3A4EA 3QXVA 5DURD 2H6PB 1KYOK 1FFOB 1MEXH 5EFIA 3H7BA 2Z35B 4YO0A 3NA9H 5K93A 5H94B 4UAOC 2CA3A 5B39G 2IADB 4AL8L 1DBKL 3HRZB 1OCOB 1YDPA 1XR8B 4X4ZA 1L6PA 1NDMA 4JLRB 5GGQL 1JF1A 3QJSB 4XRCA 1ZJBA 3EJSA 4KK8C 4LL4A 1KTKE 5DDHB 4QHKI 4DGYL 3CQQA 3V4LA 4AV0A 4EOWL 5LWYL 3GYRA 1ZHBB 4NFBA 3Q9PA 4QHUA 1LWRA 3BP4B 1F3DJ 1HE7A 4QCIB 1J9QA 2R56L 1HSBA 3FB5A 1VA9A 4R0LB 4XPTH 5HVFB 4Y2OB 4UTBL 1OGTA 2OLDA 2BP5M 2QKIA 3OR6A 4GUPA 3NIFF 3HC4H 1SHWA 1BZDA 1XB6A 2ZSVA 4JFYB 4A2HA 1SBSL 2P4AB 3QHZL 1ET7A 1T1YB 4X7DC 1JNNL 2KQMA 2B77A 1BF2A 5MP6L 5MEPB 3T6ZA 2ZUQB 2PP7A 1KC5L 2K3TA 3ECUA 4KK5D 5EU6D 5T1JA 4XMLL 1SEBB 1J5CA 4N2FA 4ELMA 2Q2EB 1LL1A 2FGWL 4P23B 3ARSA 3UH8A 2A74B 1J1XH 2AJXL 2NT0A 3O3EB 4FXGA 2BH0A 2IQ9L 2G2RB 5GISL 1ZPLA 3KPLA 2CBOA 2IG2H 1JOIA 2BFVL 2R27A 3CCHB 4FA7B 1NTDA 2NY5C 2E59A 4XPFL 3O0RH 2XQ0A 4K9JA 4RQQA 5F7DA 1X7QB 4MSWB 4HCRH 1NEZG 4PJ6A 2E7MA 2ESVA 5JUEH 4KRMB 1HQ4B 4AUYA 2E7LA 5D96C 5K9OA 3EJZD 1JNJA 5AOLA 4FL4B 2FGWH 3NA4A 4YHNA 2BWIA 3V4PB 1KEGL 2JVUA 1CF1A 4XMVA 2H4EA 1JNHB 4I5BA 2B4CH 4MXVE 3D4CA 1TQUA 3OKNB 3IKKA 1U8QB 4M8VA 4PJFA 4DEPB 3OKKA 2AXFB 4OLZL 3SDAC 2IH8A 1NBYB 5E2TL 3C8KA 1QLFA 3G5XB 1DBMH 3MFGB 4JGMA 4WWKB 4X4YA 4G8GD 1P6WA 5FYJU 5HD8D 4ZX6A 1M3JA 4IS6B 4ZUSB 2B1AH 4X5LA 4BQ9A 1NLDH 2WANA 1P6FA 3FQXB 1NCDL 5D1QC 4J3OF 4AGNA 2H32A 1RK1B 1YYML 1OO2A 2FEEI 3I9PA 4LKCB 5TTRA 4PQXA 3KLSA 1MRCH 3N44B 2E7LC 2VL4A 4U3HA 4GEJA 1Y0LA 5JDSA 4U1GC 4JN1H 4CC1A 2GCYA 2BNQA 2TRYA 3KGTA 1FSKB 1X5HA 2BZ7A 2QSCH 5L4IA 1N5YH 1Z6JT 5DYOB 4Y1TA 3U79A 3PXLA 2WUCH 4YX2L 3AWFA 1G7JB 2N7BA 2MFNA 4MA7H 4B9IA 1H3UA 2BSSB 5IVXE 2CLVA 1PG7H 1NCAH 4TQ8A 3C5XA 5IQOA 2J88H 1JUFA 4XBGA 1KXVC 3RVVD 4LVOC 3TO4C 1PZ5A 4KJPD 4Z7QF 4MHHG 3QIUD 2I60H 4HIIB 3A67H 1HXYA 1ECZA 1AO7B 2CRYA 4CW1B 1XB3A 1CLVA 1CR9L 2E27L 1S4IA 1Z9NA 3STZA 4NUJB 3VGEA 4EUPG 1AXIB 4PS4H 1PNDA 1YNLL 1WCBB 1E2ZA 3PWPA 1QFUH 1S9WA 1P5UB 4LDEB 5FGRA 5DUJA 4PP2B 1OGAE 1NGWA 1FZKA 3E38A 3HOGA 3EH1A 1IZJA 1DVTA 2FT6A 4U4IA 5ACMA 2R0ZH 2ZOKA 5IFHL 5HHMB 2DJUA 1QBLL 3WKQA 2ZNXA 4KX8A 5DJDB 1CU4L 3GIZH 2YPLE 3MRMB 2GYSA 1FWXA 4F7TA 4DP1X 4NO3A 3GKWH 2CA4A 1A7QL 1DANT 1OV8A 3AT9A 4OT1L 3UACA 5TGBA 4AMXA 4NJ9L 1TZAA 2BSDA 4XMKH 4ZS6D 3ULVC 2OAAA 3V55A 5EORL 1GZPA 2F15A 4BH8B 4HUVA 4DUXA 3PIQA 5FO8A 4MAUH 1MJUH 2VDKB 4WFHE 1J8KA 2P49B 5IB1B 3CZGA 5I74C 4GO9A 4D7PA 4JDEB 2WAQA 1F13A 1FFOA 3TCXA 5KS9A 1CDIA 3MRHB 1BFVL 4FJZA 4OJFL 4M93B 5IJVB 4QRRB 1AZRA 3NZ8B 5GRVK 2FBRA 3NSFA 4KNQA 5FX3A 1RZJL 5C08D 3P9LA 4ZW5A 3EAKA 3ZT5A 3P4NA 2HPOA 3OPUA 2VL5B 1I82A 4M6OH 2O93L 1QSEE 4JM0A 5EU4B 5CEZD 5E8NA 2XCMC 2ZYRA 4MDIB 1DBJH 5HI4C 1HH9A 4FQCL 3WY1A 4F8QA 1XH2A 3R7RA 1AOZA 2K9UA 5GS1B 1A9EA 1PLGH 1KYDA 3JV4B 4EZLA 4LBEA 2ATKB 1CLYH 5BO1L 2DH3A 5DHYA 4RMVA 4HP5A 3US9A 3MJ9A 5JW4Q 1JWMB 3ZIYA 3VFWB 1ZLWH 2O6FA 3LXBA 4PCYA 1NGQH 2CLRB 5BMFL 4L8CB 3IDUA 5MEPA 3B9KA 4FXKA 5D7HA 4A39A 4GRLD 4EZJA 1U9KA 3Q2NA 4NQDE 5CMAA 3RI5F 1I53A 4HJJH 2JB5L 3L5HA 4F1SA 4ZMLA 1CLOL 3KVPA 2G5BA 3NH7L 3ZT7A 1MIEL 5TE6H 1DBML 4HUXA 3A22A 5IMKB 1G9NH 2AV7A 3PWJA 1ZLDA 3TESA 1JWSA 4GQ9L 3S3SA 3DVGB 2UWEB 2X4QB 4GAGH 4DSYA 2F53E 4W9KC 1K6QL 1LO0H 2VCOA 1TNMA 5BXFA 2H26B 3IPEA 4IRZA 3TTSA 1YECH 1KBVA 1R6VA 3H7LA 1Q38A 3T0ED 4G5ZH 2KZWA 3AMKA 3PQYA 1HHHB 3SBQA 3MNZA 3DX7B 1MIEH 3MA7A 4WO4B 2APTA 5B8CA 1UUSA 3V6BR 1UYWH 5KJRH 4JZJC 2FJFA 4PV1C 1MWAL 3BAKA 2WTRA 4IEFA 4HLEA 1U8CB 3RL1B 1EZSA 1SMAA 4LNRB 1RIHL 2HFEA 3QNXB 2AXFA 1NMAL 4HT1H 1AHKA 1F6AB 2OTUB 3B9DA 1UT2A 2R2BB 4AOFA 1AMYA 3ARFD 5KVDE 4FQ1L 4ZUWB 4LPCA 2HT3C 3BPOB 2EQDA 4XX1G 5D2NE 4RISH 2Q6WB 1CFVL 3N40F 4JBSA 5HGBB 1W0WB 5EOCL 4YSQA 1YO4A 3Q8AA 2MCMA 4M7JL 1WBXA 3FQWA 4C83A 5DJZA 3H9HB 3T1WA 4KROC 1PQZA 2O5YH 3WLWD 4XAKD 1N6UA 4NHCL 5F1OB 5I73B 1ACYL 3NRPA 4W4NA 1FVEA 4PJCA 4WU5B 2NYYC 3WJLA 2WJ5A 5C0BB 1KSRA 4P5TA 3FU7B 1UH3A 1USQA 4IOIB 5ESVA 1G84A 1NGYA 2YC1A 4QUOA 3IYLW 4R96A 4YDVA 5JR1L 5EORH 3L9YA 1ZJAA 3W9EA 2AZAA 3MOAL 4NP4H 5JIHA 5HDBF 4UT7L 3FCTB 4XXWA 1UD6A 4KKCD 2YA1A 4OJDH 5CZRA 2PLTA 4JRYB 4N3UA 3GSXA 2G3XA 4L3CB 5D2NA 1FV1A 4JQIH 4OLWH 3O4OC 4UAHA 1BQSA 4XNUL 3SBWC 1KCLA 2BXZA 2BM3A 4K94L 4QCIA 4CVUA 3OKLB 3L3HB 5JOPE 3EYSH 2GY7B 1YN6A 4LLYA 2IPKA 4PJ9C 1F11B 1GY1A 3OR6B 1AY1H 3GPSA 3OG6B 5HYSA 4NKDA 5KSAC 2X3BA 3GHPA 2CDGB 3ALPA 1T1YA 3QK0A 4JFFA 5DJDA 3NZUA 1O6VA 3MRMA 1MFDH 5D7LD 2F58H 1KZYA 1KJMA 4YHZL 1JXJA 1UGKA 3MGAA 2X4SA 3DK0A 1ETZA 5C9JA 1HYRC 4PMEA 5KBKA 3QEGH 3DRTA 4HD5A 4R4BB 1GZHA 4U1IA 5T33L 4NBZB 3QFJE 4P2OA 3NPZB 4LU5L 4NPJA 1QABA 2CDFA 2D8KA 3M17B 4N2IA 3PGCB 4KKQA 2AK4A 3IGAB 1PIFA 4ABVA 1T5KA 2V7NB 2EKSA 4TUJB 4WK2B 4UTAL 4LCWA 4H8WC 1GW0A 4XN2A 4YZFE 4BKLA 4GSXA 1OE1A 1Z3RA 5C86A 4PJEF 1DJHA 4PWGA 2Z31C 3RB7A 15C8L 2NR6C 3CBJB 4MD4B 1G9EA 4GFXA 3UABA 1WUNT 4N1CA 1O9VA 4BCZA 3EO0A 4RRPG 4JL1A 3OD3A 1MLCA 3H85A 2EDJA 1ZEAH 4K7PL 4KDTC 5E4EB 2F54D 3HUJB 4Y2OA 3C08H 5AW1B 4JRXB 4M7KH 4R7NB 5DSCB 1IU1A 1UB5A 5B1JA 2ZSVB 3CLWA 4WWKA 4YR6A 3WFBL 5IR1A 2WCSA 3SPJA 4OCYL 4WWKD 3TBCA 4JPVL 3FFCB 2HAZA 4DZBB 2A6JA 1RZFL 4PJ9B 5HHVL 2KH2B 3BPNB 3LVTA 1KGIA 2XC8A 2APFA 2LFEA 2ICWI 5AW6B 4EN3C 5CUSL 2O1AA 1IM3D 1J0IA 2V2XB 2ZG2A 2PW1A 2FGZA 2ZOUA 3DUHA 2MOGA 2F7PA 4L9LB 1E30A 5B7MA 3WNNA 4C47A 1V7NH 4YFDB 3TNMA 4KITB 4MNGB 1UD3A 2QSVA 5FKPB 5CO1A 1B9KA 2WYHA 1J86A 2BCKB 5IHZB 1YG9A 2JKIS 1X7QA 2XVBA 2EADA 4PLKC 4KXAA 2B5IB 5CU5A 4Z77A 4UOW1 4X6CA 3U0PB 1S8DB 3HPLB 5EULV 4Z9KB 1FO0H 4MMZC 4YDKH 2H2PC 4LEXH 2C3VB 3BKYH 5I5MA 3MRDA 2WQ8A 5C0FB 2WNWA 1IL1B 4R8WL 1KELH 2CIIA 4JFXA 3ZTNH 4R2GB 5A16B 3RWFA 4E9LA 1OPGH 2YQ3A 1U93B 4JFQA 1X4ZA 3MGOA 1KPRB 3QNZA 4O00A 1QW9A 3UPAA 3QA3A 4ZUUA 3II2A 4OB5L 4JG0H 3LDBB 4HJ1A 2PPAA 4Z95H 4WGWB 5IREA 3SGJA 3FMGH 1KXHA 4GIAA 2NUTA 4MQTB 5HP5A 2Z7ZA 1SM3L 3I75A 3OLGA 4XB3A 3BESR 3MV8E 2K6YA 4NNXA 3HUJE 4OI9A 4YSDA 1LEIA 2QKIC 4JB9L 3KBFA 3F6JA 2AERT 1D5IL 3P30H 4LRNH 4OCRL 3FU5A 1PG7W 2DWSA 3CPUA 5KYYB 3NP4A 1UACH 1KXTA 2VWEC 3CMOH 1UH2A 4V2CB 4WO4C 4EIGB 5A2JH 2P8PA 3T4YA 3JYCA 3TYFB 4FQXB 5DYFA 3W1ZA 3ULSB 2YR3A 3MLWH 3HBZA 1X5JA 3OC8A 4OZIA 5KS9B 5TDOB 3VXRA 4AZ8B 3WXVL 2EIJB 2J8UF 2BY1A 3VFUB 1NC2B 1T6BX 4P5KB 3DOSA 2JCCE 3QFDB 3U1SL 5F3BB 5J5EA 1Q1PA 3BHBA 1E6JL 3HZYA 2BNRB 2OYLA 2XBDA 4FULA 4G6AC 3O2WL 2IG2L 2JMRA 4XO4A 3CSYA 3LN5B 4GB9A 4PYHA 4X9HA 4EBQL 4MB5A 4YHIA 4R26L 1FYTD 2JB5H 1UJ3A 1CWVA 1U91B 3L9RB 3L3DB 3ETBJ 5C0CB 4BCXA 4FG4A 4MMYA 4OQTL 3QWRD 3RVXD 2XY2A 4Z78A 1PAZA 1AR1C 5GRWA 3QUXA 1E6JH 1MWAA 1MFEL 3GO1L 4ZRGA 5IY5B 1LO2L 4L48A 3H56A 4D8PA 3ARZA 4P9HC 2I9LA 2D3NA 4MDJA 5D8JH 3HRZA 2X4PB 4NQCD 1KGJA 2WNGA 1Z5HA 1S7VB 4L1DA 1M1XA 2VTFA 2XBZA 3OGOE 3RKDC 4R4BA 4PY7B 1URZA 4NKMB 4N2NA 1H5BA 4MAYD 1MHEA 2X44D 3U2SA 1IGIH 3WFCL 5FKAA 1UB6B 2XV2A 1J9SA 3OB0H 3KYKL 2WLJA 1N3NB 2Y6TE 3RNKB 1JL8A 5E6IB 3VXUE 3MRHA 5IJVA 3FSZA 1J48A 2F1EA 3PP3K 2DAVA 1TT6A 3MX0A 4WWID 3KXFD 3SGKC 1YMMA 4QHLB 1BA9A 3BEWB 1KTDA 1K4CA 2QHRH 1ICTA 4UUJA 5T5NF 3UPRB 1CQKA 3NSJA 1RKRA 2WTOA 4YHLL 1JK9B 2NYYD 1IEAB 1SXSA 2OCFD 4J3OC 3WIIL 3JXAA 1LWJA 1P4IH 3PJLA 2ATPA 3RWGB 2KHAA 4QRTB 3SJVD 1NCBL 5E8DL 2A0LC 3EO0B 1WFOA 4ONGL 1PEZA 3K6FA 1KGCE 4AMKH 3BRFA 4X6DB 2COQA 3VI4F 4MNHB 4MA3B 2P28B 4JJHA 1J0JA 2ADIA 4QJ4B 4UNVA 4A7SA 1KJVB 3BAEL 1MREH 1HIMH 4M8RA 3ZQXA 3FCGA 3MA9L 2AFNA 2VC2H 4BQ6A 5I2IA 3EW3B 1AGDA 1HOCA 1MQKL 1MF2H 2F5BL 1QFHA 2FJHA 2MCPH 1KCVL 5CGYD 1HILB 1KTCA 3GHEH 1L5GA 1SN5A 5JO5A 1J12A 2X4QA 3MBXL 1ZV2A 1INQB 4HUUB 2DS4A 2NNFA 4G8GE 4JB9H 3MHZA 3BW9A 1ZY9A 7CGTA 3PU7A 4A38A 4U7SA 4N2OA 1GR7A 1Q0YH 4RWYH 1PVHA 3KYNA 3QXTA 4K94H 5IBTH 5IB3A 4LDCA 4K3HA 1AXSB 5I0XA 3B56A 1JK8A 2YRPA 3BDYH 4QNPF 1YY8B 3M8OL 3MKGA 3D07A 5IQ7L 4QHMB 1TVBB 4YAQB 4U1GB 3NQIA 4IEFB 5HDBB 1A7OL 1TMQA 4XBEL 1S3RA 3WS6A 4ZZFA 5HSFA 4G82A 1AKJB 2GFBA 4U3SB 4NKOB 4YFLI 1EDHA 4K7FA 5J6SA 3BWZA 5KEZA 5F6HJ 1D3CA 2NW3B 1A7RL 4J1UB 4G9FE 4Q6IB 3TVMA 1AD0B 3HC3H 4UCFA 1NGZB 3SBPA 3CXDL 3OKDA 2SEBA 3EGSB 4KKBC 1CD1A 4QKXB 4OCWH 1RL1A 5AAPA 1EGJL 4ZYKB 3U6RA 3OXRA 5HYQB 3Q2CA 1A6PA 5KYYA 3MV7A 1PD0A 1MCHA 4K2UH 4U1IB 5HPMB 3ULUH 1UVQA 5LWYH 5DXWA 4XP9L 3ZHDA 5IWLA 3T1FA 4J3UA 2YXVA 3ARQA 2E8YA 1ZIBA 4TSCH 3DV6B 1ACYH 1QRNA 4D94A 4HOZA 3ECBB 3PWPB 1NDTA 1I7RB 5LGJA 5E99H 2AEIT 2LU7A 1X5LA 3BD3A 4IKLA 3L7EA 3HRPA 1NLBH 1S7RA 5CIPB 3QFDA 5F3BA 4RIRB 1QATA 1KIUB 5HDRA 2QQQA 3OHXB 1AC6A 5EN2B 4KY1H 2ADJA 3GK8H 3ZKMC 3LZQA 2JJSC 3P30L 2R69L 3M7OA 4PRNB 4F7TB 2R4RH 2UX7A 3QJOA 1FV1B 4JKPH 1EZLA 2NNCA 4MASA 1HXKA 3VCLB 2DL2A 4ZUTA 4HIXH 1JXKA 1IVTA 3GB7B 2VSMB 1THAA 3FONB 1VKXA 1GTFA 3TEUA 1S9KC 3BEVB 1G7LB 2CO6B 5EIIA 1V7NL 2XPYA 4RETB 3OKEB 5ICZB 3IJEB 2Z91A 3SODB 2H3XC 2X6BA 5E8OA 3THML 1RULL 4CVXB 1PDKA 1JZ4A 1D7CA 3U25A 2VAJA 4E0RA 3L7FB 5AW9B 1IEBA 3ZDYF 3PDOB 4UZSA 1FQ9C 3UTZA 2DQTL 4AMKL 1DN0B 5DVLA 1XH3B 1DANU 2E0PA 4LCUA 1VACA 1ZA3B 4HWZA 4HIPA 1Y1UA 3MUUA 3PXHA 4LGSB 5AVTB 5ETUB 5C6WH 2X2IA 2CMRL 3LB6D 4P05A 3FKUS 5LCVH 1KYUA 1AMXA 4OUUA 4E41A 5KSVA 1B6UA 1I1YA 2YZ8A 2BS9A 4AL8H 4OFQA 4X0KB 1O6SB 2VDNH 3JV4A 5CZVL 2X4NA 3LRSB 1T80A 4BRJA 1D9KC 3EYUH 3B3BA 1CFVH 5DEFA 1I9IH 1MG3C 3EDKA 2OI9C 4HCIA 3SKMB 1T89A 4N2HA 1DJXA 1UWGL 3R06A 1FN4B 3GRBA 4JKKA 3WTSA 1ADWA 1A1NB 1ZGLP 3HG1A 4TULH 4PRIB 3TJEL 4PCTA 2GIXA 2P5EA 2FQEA 4NQQA 2O5ZH 4IBUA 1OW0A 1AP2B 2FTAA 4YSTA 2GI0A 3CDYA 2BSED 2WCGA 3EYUL 4KXBA 4Y1AB 3FRPG 3K6IA 2YLHA 1LD9B 4IDLA 4LL9A 1PLAA 2MCG1 3V0VB 2ZWZA 3ZOAA 3KPRA 1LP9B 3PWUA 5I2IB 4BFGA 3LZLA 3W11C 1VGKA 2WB7A 4P2QB 1PS3A 3MNVB 4FG6C 5I6LA 2CHZA 2E7DA 2FJHB 4G6FD 2R0KL 2G3NA 3BYTA 2AXJA 2IDCA 4MGXA 1SYVB 2OMUA 2DLGA 2H9GB 2Z6FA 3BGFB 4L1BA 3W11D 4EUPB 3MRIA 4X6CE 3KPPB 3V5KA 5IOKA 3RGHA 1I75A 3BUYA 1JPGA 3EYSL 1EBAA 4PJ7F 1M9WA 1QSVA 3U4EB 3DJSA 3D08A 3EOBB 4HFUH 3DO3A 4RGNE 3S5LA 1A6ZB 1TZIA 3UTQA 1E7UA 2IANE 4W9CC 5B1KA 2JWYA 4GP4B 1ID5I 3IFLL 1UA3A 2VW4A 5FYLH 1CGXA 2CJSA 4AC4A 5IESH 5KG9B 2YO3A 2J5WA 1CPUA 1BQRA 4H1LG 2ZUTA 5BQ7A 5E9DD 5LG6A 1DTUA 3NJFA 1GSKA 5AZUA 4NENB 4ZO6A 1ZT4A 1KPRA 2NPLX 3IF1B 3QNZB 4BEIA 2XRAL 1D6VL 3P0VL 3WEXB 4KC3B 4B9YA 2UXVA 1PYWB 5HY9A 5IJDC 3LH8A 3IM1A 2N0KA 4ONHB 3DVNB 2FEEL 2GY5A 3BVXA 3QXAB 5F7MC 5E4OA 1MCPL 3BXNB 4N6QA 2F53D 5A7EA 2AJZA 1GYCA 1MN4A 1FO0B 1JE6A 4XO3A 4DKTA 3H9YA 4OQTH 5DJZB 1IAKB 2BSEA 2UXTA 1A6UL 4PD4J 3AY4A 1BM7A 1PQZB 4APQD 4JFDD 1EQWA 1CFMA 1RZ8B 4YNYB 1XIWC 3FF8A 3G6JE 4LSDA 3LMJH 1TEYA 2VLKB 2J7LA 4XPAH 4OZIE 3O9WA 4L4JA 3QGVA 3MJ9H 3PPEA 4MRBA 4LF3A 2IPTL 4QRUA 3D3VA 5D1XA 5AZ2L 1HN1A 1NCUA 4IGBB 4OLYL 3O3DA 4FXKC 4HHAA 1OF2A 3FU8A 1I7RA 2YD6A 1RQ5A 3CFEB 3L3HA 4OD2A 3U7WL 1NCJA 4HX1B 2D0GA 3SY6A 3O6FD 1BZQK 4R7DA 5JTWA 2FH8A 4NN6C 3EZJB 5T1LB 4Z7WF 3C6LA 4ZX3A 3WJMB 2J8UE 1XGYL 5BO0D 4ALAH 4N28A 4U6YB 1T0MB 1E3FA 4WHTA 2VYRE 3X2QB 5EU6A 4U1NB 1OGPA 1NGXA 1SJVA 2WO4A 1X7TA 1Z3GH 4PJBA 2ZXAA 5F0PB 5GZOD 1BJ1J 3GI9H 4QIRA 4PGBA 4WW2A 4Z0BH 3ZMNA 1G7MA 4NBYB 2CIKB 2UY6A 4QRFA 3IB4A 1ZLUH 4LEXL 4M8QA 5EOCJ 4MKTA 4KPHH 2R83A 2FX9L 1P4LB 1FRGH 1IC4L 1BOYA 4PJXA 2AANA 4G8EA 3VRLF 3LPWA 4JY5L 4LHUG 4CKQA 1ETA1 4PIBA 2ADYA 2MCPL 2BIMA 4ERSH 4P57B 1GOGA 4BHUI 1YSOA 3RY6C 2BP8A 2Q3ZA 2X2HA 2ZKYA 3C60A 1JV5A 1WDAA 2F0CA 3P0GB 2C5DC 3O3EA 1DVFD 4HF5L 2V4LA 4D9RE 3LPGA 3DXAA 3GBML 3HE6D 1W72B 1FGNH 3D87B 2VDQH 1KLGA 5HI5C 2VO8A 1ZLWK 3WBDA 5LNDA 1FG2B 3X3GH 3ZN6A 4JEGB 2EDLA 2R23A 5D7JD 5FGBC 4X6EA 2AW2A 4RFEB 5C7XH 4YL4A 3C6SA 2F6AA 5DSCA 3VFMB 1RZJH 1FYTE 4FQ2L 4JANB 4QHNA 5ANMA 5H37H 1G9NC 3MV7E 1IAOA 2A6JB 25C8L 3QR0A 3WFCH 5IOPB 1Q1JH 1QFPA 2XN0A 3OKNA 1I85C 1AS6A 2J88L 1MW3A 4UQDA 1PNCA 1L3NA 4M61A 4QY8A 2KL6A 4TTDC 3FFDB 4U0QB 4ELMF 1A4JA 2JKXA 2QHRL 2NTFB 5I73C 2AJSL 2QGEA 4HXAH 5IVXA 1CI5A 3BN9C 5DLLA 5BV7B 3UJIH 1ZVSA 4HS3B 5LXGH 1CD1B 1YN7B 2RACA 3D9AL 2CALA 2FUQA 2YWZA 5DZNA 2WXLA 2HRHA 1JRHH 3HI6H 1Q0XH 1WZKA 4U6TA 2X6CA 4GOSA 1U92B 3FCSB 2NNAB 1SOSA 3A6BH 1DSYA 3SQBB 4BSWB 2XFGB 5AOKA 4FTVD 5GSRA 1VENA 5CJQL 5D4JA 3CFMA 3RWFB 5A16A 4JG9A 4NCC1 3T1FB 2HA1A 1FDLH 1FNEA 2YARA 1VADA 4JKPL 1YEDB 1RCYA 3DV6A 3H9ZA 4U7KA 2BWDA 4Q9QH 2ZP0T 4NRZB 1U3ZA 2VW7A 3KYNB 5D1XD 2J73A 4X80H 3WGUB 4PJFF 4H26A 4I18C 3GC3A 2QHLA 4QYAA 4E5XB 1EO8H 1SYSB 1NLBL 1S7RB 2MKWA 5I6PA 5DMIL 3O9WD 2EUWA 3HG1E 2BRRL 4CW1A 3QQ4B 1XO8A 3PV7A 5KSBF 5DQDH 5DU7A 4N68A 1Q72H 2D3VA 1OALA 1TU2B 4KVPA 1B4LA 3U1QA 2UWEE 4ORZC 4N3TA 3NJLA 5EC1B 4KUCD 1SJEB 3KVQA 4ILDA 5CGYC 1XFPA 4YLBA 5DJ6A 1BF8A 3MSPA 4CUCA 1N6QH 5GS0C 1TZGL 1FE8H 4OZ4A 3KWWB 1RZKL 5FV2A 3CGTA 5F9JA 4FQ1H 3OKDB 5IQ7H 1PG7L 5E8OB 3SJVB 2PW2A 3AQXA 1JHLH 3I6LD 3LEXA 4A6YB 1JZ2A 2BOBA 1BG9A 4DFIA 3VFVB 3IS0X 3L45A 2XYBA 3L5XL 5DO2C 3U6RB 3EH2A 3LPOA 4URTB 2EVHA 1YEEL 3LXCA 5DVPA 2X9XA 2HKHL 4AM0Q 1G6RB 5I8CB 1UXWB 2DOCA 2DMBA 3ZGIA 1GZPB 3ZZQA 2CR3A 3PIQB 2LLLA 3X1FA 3Q1SL 1Z2KA 2BNRA 4HGMA 4XMWA 4F92B 1KEGH 4LF3B 3GGWA 5E2VL 3OAWA 4UILL 3L3IB 4TVPE 1QRNB 3VXMD 5IHUL 3QDJD 3MA9H 1GS8A 2FCBA 1JHLL 2V2WB 3HB3D 1QSZA 2BLFA 1BOGA 3T2LA 4X4ME 3T08A 3Q0HA 2XTJD 3GMRB 3MLXL 4C8XA 1YRKA 3QJZA 2B9BA 4HWNA 2EXTA 3J8F7 3TBSB 2A6DB 5AB2A 1CI3M 3T65B 2XG5A 3B9VA 4GUOA 2HG5B 5KVEL 1MZYA 3TN0B 2MEJB 3K4DA 2GPZA 1JPSH 4POZD 4PRIA 1YYMH 1M9SA 2ZCHH 5D6DC 1IT9L 2EC9U 3GMLA 4Z7OF 1MEXL 5E7FA 4JDZB 4U1LA 4XODA 4PV8A 4TOYH 1OAUH 1X9QA 1ASPA 3NSCA 2VWEE 5B21A 2VMCA 2WKGA 4GW1B 4NP9A 4ZQKA 3LKPB 4AQ1A 1K8DB 3MJ7A 4RDQF 3W0WE 4YXLL 1JYWA 3L1OH 5F71A 1PDKB 5A7BA 1F8TH 3MBWB 4FXTA 1I4FA 2A9DA 2XA8L 3NJHA 1AQDB 4HLZG 1P4UA 2G4GA 1HCFX 4YO0B 4L8DA 4JFDB 1SHSA 1RMFL 3OZ9H 4Y16C 1YMMB 3CFBB 3BEWA 1HCVA 3QEUA 5KYNA 3UPRA 3CZUB 5D1ZI 3X11B 3SDXB 3PFUA 1MH5A 1UM4L 4G72B 4H88L 3CXFA 2ARWA 4XC3L 4WZ9A 4A6YH 4OIFA 5KANI 1XCTB 1M6UA 3LVEA 1N5AB 5LJYH 3FSOA 2XWBB 5C2BH 2HTLD 4KWUA 1QR1A 1WFTA 2VDNL 5DHMC 2WN2A 1XAUA 4F7KA 3JV5A 5JIIA 2EDKA 2WZ6A 4JFYA 4JS7A 5HI4D 3STLB 3WFDH 1SOKA 4DAGH 4YJZL 1FRGL 3EFOB 2FEDC 3MA7B 4JCWA 4P4KC 4WO4A 1IAOB 3NIGF 5JHDE 3SOTA 2CK0H 3DK2A 4MQXC 3STBA 4KNUA 4X42A 5C2UB 2DQJH 2VLME 2ZYIA 1ITBB 2WAHA 3CBRA 3ZE1E 1ZV9A 4B9CA 3R8QA 5EBMB 1F6AA 2OTUA 2Z7UA 5IROC 5JMRA 4OZGE 1S7UB 5AVZB 1G9MH 3AACA 2X1QA 1ILSA 3OSVA 5DZ9A 3WEAA 1RK0A 4UI2A 4GAYA 4C55A 2J6WA 3ME0B 4F33A 1WBZA 2NY7H 5I28A 3RB5A 4OCRH 5TF0A 4PWJA 2FX7H 2FNWA 3KLLA 5F7DB 2OSLA 1VZIA 4KKAD 1AZBA 5D70L 5KUMA 1N59B 3NCWA 2ZUXA 1E5CA 1D7DA 5J57B 1PZUB 4EN3A 1REIA 1X6LA 3DUUB 2XTLA 4LLQA 3BH8A 2NXYC 4F24A 3HVDA 4R26H 4IRJA 2NOYA 3UTOA 5KBPA 1PLBA 4KUZL 3KW7A 1G1YA 1W16A 1OAYH 3LEYL 3GXNA 3Q3GB 4UF7C 2EUVA 2WXMA 4JHUA 4B9ZA 2DDQL 3UG5A 3MV11 1M4KA 2YSTA 3BGMB 4LRIA 3KE0A 5FYLL 2LT9A 3QP3A 4FFZL 4LE8A 1IGTA 1DEDA 5BUPA 2YPVL 3F84A 2DD8H 2IBZY 2E6PA 3UL4A 1TU2A 1RZIA 3MODL 4PRAB 1GTNA 3WEMA 3DROB 1P5VB 3GSVB 1OP3K 1PYWA 1WUZA 4M6MH 3M1BB 4RSVA 3N1PC 4H25B 5GHWL 4BFNA 4PGEA 4AENA 1CDJA 1NA8A 1WGOA 2D3LA 5DWPA 2MHAA 3QZNA 4G9FA 5IESL 1F11A 4LVNB 5ESQB 2AAAA 1NCWL 2YN3A 3OHMB 4HC1H 5A3IC 5HYSB 1FFPA 1KB9K 1PLCA 1WWWX 3C5ZC 4JFFB 4I0PB 5K9KA 1R24A 2K3HA 3MO1A 3PUUA 3EYOA 3HAEA 2KDYA 3TBWB 5D7KE 2H6PA 4WFFE 2VQ1B 2Z35A 2NQDA 3N3EA 4ENED 3APFA 2X4UA 2EVIA 1BEYL 2AABH 4RNRB 3FUKA 2BP8B 3C60B 5AKSA 3RJQB 1JV2B 2IVFC 3WFBH 3LIUA 1ZCRA 5HDBE 2QPUA 5J12B 2ZWNA 3GZQA 3CZJA 4I18A 5I66B 4NUJA 2B1AL 1WIUA 1ZRUA 3QFJD 5E6IC 5SWSE 2WLZA 3HVNA 4UT6H 4RAUA 3ISRA 1P5UA 2PP9A 1SMDA 4MXWH 4W70A 3BIKB 1VKXB 1F56A 1HIML 4UV7L 4LNVA 5JHAA 3CWGA 1B4RA 1R5WB 4Z7UA 2L7JA 4G8GB 4X9BA 5AKTA 1TTUA 1D5RA 1UYWL 4A6YL 4IMLA 2XN9E 1NCCH 2H2SC 3QUXC 4PUBL 2DQIH 3GBNL 1B4TA 1PKQB 3FAWA 5L8JB 3PUCA 4JHZA 1KCVH 3HR6A 2MQCA 1QPPA 3RURA 2ARJA 4NOBA 4Y5XC 5EU6B 5EOCH 3IE9A 2EIKB 2RALA 3RIAK 5CILH 3C8DA 2CXGA 1QSFB 3HMXA 2QVMA 1S5IH 4KXDA 5EH1A 5IR1B 4YR6B 3VJ6B 4R8WH 5M94B 1H5BC 2KZKA 1D5BA 1GGCH 3AU0A 4M6OL 1M7IA 5I6XB 5KS9E 4F37F 4GT7A 2VZTA 3MFFB 4HPYH 5AVQB 3NZHL 1EPFA 1KTJA 3FZUD 3FRUA 1P5UC 4Q9QL 4CU8A 4AG4L 4PLOB 3QEQD 3KLHC 4Y5VA 1PD1A 4Y4FB 2DQMA 4HH9B 4S0TD 5D7LE 2IBZX 4RGND 3IAGC 4F5CE 4UOZA 4P2AA 1DE4B 3S8WA 4IKJA 4PB9H 4YUEH 5EU4A 2DQHH 5E8NB 3TFBA 2BY0A 4OLWL 1Z32X 3ZL1A 1T04B 3WNLA 1RZPA 4NAJA 1IMHC 5ID1B 2FECL 1VFUA 4FI7A 1AP2A 4HKBA 1UA7A 5SX4I 3INOA 3L3OC 4ZODA 5FHAL 1INEH 4XP6H 5J12C 5BVPH 2KDGA 3IU3B 5CD5D 4TL4A 3AB0C 4LXFA 1FGNL 3U0TA 1KYAA 4XXDB 2FR4A 2X09A 3N41F 4XOAA 4J2QA 5TE7H 2J57A 4NQTA 4UMGA 2BY3A 5F0MB 1AD9A 3CHPA 1AR1B 4AEHL 2JCWA 1G0YR 3T2OA 5D5MF 1AGEB 4JR9H 1J8HE 1U8LB 2P24A 1NAKL 5T3XH 5L6YL 4WFGE 2X05A 2F58L 3U2IA 3BLKA 4IBYA 5I16A 3IPFA 3ZMEA 4YE0A 2PCPB 5FWRA 3L5WB 4GRLC 4JQVA 3SKNB 1I3RB 2ITEA 3ZR5A 1GC1C 1OOWA 4AGLA 1FVDA 3I9IA 3BP6B 3MR9A 4G9DB 2R4RL 4S1RL 2A4ZA 4DVRH 1P9MA 2J3SA 4KK9C 4ICXA 1QQDB 4OZGF 1QLEH 4ZFZB 4ELDA 2DICA 5IKCA 4F2EA 2JIXA 3T0EA 1OAZL 1YPZA 3ABMB 3U6XS 3UAJD 4J8RA 5F1SA 5JPMB 4MJIE 2L7QA 2X1OA 4ODBD 5KN5B 5EF1A 4OV5B 4E9SA 4G7YH 4N8CL 2OMZB 2NX5B 4A7UA 3QG6A 1M7UA 3FF7A 3ERXA 4OD3L 1H9DA 1TG8A 3EFDH 4YN3A 4MJ2A 4JM4L 3LJ3A 4MNQB 4OF3A 4M5ZL 1R5IB 4JO4L 3V6ZB 1KYOJ 1XXDC 3MGTA 5F89A 4EF3A 4NQVB 2XKSA 3K6DA 4JDZA 4U1LB 3WFEH 3BFQG 1H3VA 5CCJA 1U91A 4C4KT 2DM2A 4Z3TA 5JYMA 3WTTA 3LRHA 2W0LA 4R5VA 3BISA 1MUJA 3VXUB 3CLEL 3KWTA 4Y4KC 1DVYA 2P44B 3TGXA 1P4IL 5F93C 4Q97A 4IGBA 4CU7A 3X13A 5AOMA 3K4AA 1HAWA 2QVKA 4EDWH 4OTXL 4XVUC 1AQDA 2DQEH 2Z4QB 3GF8A 5A2FA 3FU7A 2UZYA 1F4YL 2P7TA 3ES6B 5F2FA 3RWDB 2K9FB 5FCUL 3QJFB 3FT9A 1UT9A 2X4PA 3WN6A 1XZ0B 1JI1A 1U21A 2HFFB 2H6UA 4YHMH 2B4CL 4UIKL 1YEWA 3FCTA 4JDTL 4XX5A 3NEOA 4XC3H 3QDGE 4DKAA 3K6NA 4EIUA 4ACPA 1CTNA 5E2TH 1V27A 1RUML 1K8IB 4L4VD 3APDA 3JTTB 5IM7B 3EG9A 4WTZG 2HVJB 1I8LA 4PSPA 3BIKA 4K5NA 5A2IH 4B3VA 4GKSB 1KJ3L 1T7VA 4PGBB 4WW2B 3T65A 5B4MC 4HIJB 4X5RA 2GJRA 2RD0A 1TZ8A 3V95A 1QLEB 2G9HA 4KBPA 5EUOA 2CLRA 1Y6MR 1E8WA 1S7TA 4UINH 5GS3A 3QJXA 4LKXA 4JRYE 2R0WH 4N0YL 1K2DA 1KEML 1WISA 3EGXB 3FDWA 3QEQB 4TYUA 3BT0A 4XPTL 3VFOB 2IOIA 1YEJL 3HZ3A 3SYOA 3RGVA 3WIFB 3GSOB 2L04A 1AH1A 1WHPA 4MRCA 3L4WA 4P3WA 4FQQA 2ZCHL 2YRLA 1YEKL 2VXVL 1NCGA 4PG2C 5DVNA 1IAIM 2G3MA 2QMJA 5E5UB 4ZS7L 1A02N 4GINA 4PJDE 1I8LC 4P48A 1I8AA 1SZNA 1BM3H 3L4UA 4FFZH 1FZMA 4ZT1A 1E4XL 2Y07L 4UM9D 5E8DH 3CUPA 3KLDA 1RZFH 1MW0A 1LDPL 1TOXA 2H7WA 4L4TE 1JGIA 4EBQH 1T7ZA 2QJDA 2HCZX 2XA8H 1WV7T 3Q3GA 4OCLC 3RQ3A 3U7YH 5HYIA 2CK2A 4QRPA 5FPIA 1U2HA 4KXCA 4KJYB 1IE4A 2DLEA 3D39E 1TTBA 5EB9A 5BZDA 2C34A 4OZHA 1IE5A 1Z9LA 4KJQD 5C09A 4Q0XH 4XXWC 5I71C 3AC0A 4Y5XA 1Y7VA 4MB1A 5K39A 4OT1H 1MHCA 2J8UB 3W82A 4E9TA 5DJAA 3AUVA 2WKOA 1T20B 1R0AL 3BWAB 4L4VA 1IKFL 2ILLA 1U4EA 1E4HA 1HXMA 2I26N 4A2DA 3RFZA 3C5SA 2YA0A 2FJUB 4YZWA 4TQPA 3IGFA 1CGSL 3GMPA 3D2UB 1YEGL 3WHE0 3FYEB 3TNMB 3B2UC 2FBJL 3NCCB 1Z9SA 3FUMA 3L6FA 3ME0A 5CKAA 5J7CC 1ZGLM 3F04A 1Q9WB 2P24B 3ZXAC 3EUUA 1PG7X 4AK1A 3O4OB 3MXWL 1QKZH 3WNKA 2OA9A 2VN3A 5DWUL 4XP6L 3D39A 3I85A 5BVPL 2VDOB 2VKWA 3MV7B 3AAZA 2XPGB 2NYKA 1UZ8A 3DJRA 2ZWSA 1UTDA 4U1KA 3DUUA 4I8DA 1CUOA 4O2CB 2Z8RA 2GTQA 3BH8B 3I50L 4GP5B 3MYZA 4RWHA 1CDYA 4U3XA 3DX8B 2Q20A 4I18B 4M5YL 3O2VL 2PXYB 4WHYG 2FVNA 3V5DA 5JPMC 1MIML 1BQLH 2JI2A 1IGYA 2XVLA 5IHHA 2MQ3A 2DF3A 1DQJB 1NCNA 4UDTA 1LTXA 2YGPA 1NMBL 1WZ1H 4ZD3H 2OULB 4NZFA 5EN2A 3CN1A 4GIPD 5I0WA 5C0AE 3HC2A 3U0WH 2G60H 1X5ZA 3VSQA 3KGUA 3OJVC 4EXKA 4HG4J 3U46A 4XMPH 5T8IA 4QRPD 5HJ3A 4Q9CA 3VWKC 3H3PH 5FFLA 2FB4L 5ESQA 5EUKB 1WWCA 4I0PD 2VLRB 5EU3A 4I0PA 1A6UH 5F7BA 3JWDL 4F3FA 4DAGL 3VXQB 2X4RA 4WI2A 1IEBB 1A6AA 4PLJD 4RWYL 4KROD 5TDOA 1FC1A 2O5ZL 3DHPA 1RZKC 4JKLA 1XBDA 3UYRL 3D5OF 3WO4B 1JRHI 4BKLB 3FMGL 3UO1L 3D85D 5KSBB 1J5HA 1VACB 1A65A 1ZA3A 3B6SA 4HWZB 3ALXA 4NO2A 4PJAE 3BFWA 2HG5A 4WTQA 3VGFA 4PB9L 4N6RA 3H42H 5DZPA 5IVZB 1MWOA 1ZLUK 5GSVA 4ELKB 1E90A 1OAJA 3SN6N 5KSAB 3GSQB 5EO1B 1HHKA 4WEEA 2YQGA 2DWYA 2GJZB 3MRFA 4XI5D 5DEJA 2W0FB 4GRMA 1NBVH 4Z0XA 4QTIL 4PU2A 1OGSA 3L3DA 5C0CA 4PP1D 5L4JA 3QQ9C 1UATA 5A43C 3UX9B 4J39A 2X2JA 3SQRA 2AJYL 1A1NA 1KN2H 2ALWA 2MPVA 3S37H 4XXDA 3EYQD 3R19A 4PRIE 3ZZ1A 4O2EA 4F2MA 2QEJA 4Y4HD 3UBXB 4WUUA 3NCFB 3RNQB 4JO8A 2BHYA 5I15H 1ZTXH 3WYRA 3VXNA 1AO7E 4BZ1A 1E2VA 1GCYA 3WE1A 1CE1H 1A47A 1MFAH 4G1MA 3FK3A 1V3KA 2NSQA 4PY7A 1H5BB 3W9DB 3HG0A 3HLAB 1JAEA 1UZ6E 3FO9B 1VGKB 1XD0A 3PPSA 1IAMA 5JQ6H 5E5LA 4Y4KD 3JT2A 4J3OH 4QWWC 1IKNC 4AXWA 4IOFC 2BRRH 3EOAA 5FLUA 1KTDB 2BNUB 4L5FL 4S10A 3DX9A 4HKJB 4HF5H 1HZLA 4ZPVA 3DTDA 1FZMB 1KFGA 3FB6B 1JPGB 4FLRA 1DVUA 5CFAA 2YK1H 2LV4A 3HCVB 4YE4H 1QQDA 5EEZA 4AQAB 2H1PL 3JWOH 2PP8A 3UIZA 1L0PA 4DZ8A 3ZDWA 3OAYK 4KZDL 4U4BA 1B3JA 4EDXA 4E5XG 1E9PB 1CO1A 5BQ7B 1KACB 5DRZA 4G6KH 2QTVA 2VO5A 5C0CD 4K8RH 4QXUH 3U9PH 1Q94A 3MACH 3PDDA 4U1SB 5K39B 1AANA 3WUWG 2LHAA 1Z66A 2CR6A 5AVVB 1MHCB 1YMMD 1KCRH 2J8UA 2WW8A 5BW7C 1EHXA 5HHPB 2P80D 4HBCL 3QEGL 1Y6NR 4OFYA 3F7QA 5AVXB 4OM1H 4H20L 1SFHA 1C9SA 4Q74A 2HT4D 3DYOA 4A66A 3FN3A 4LMQI 1OOAA 1PX4A 3SY0B 5I26A 3SE6A 1LDPH 4OF0A 2LTQB 2ZNWA 3NFNA 4WSKA 4Y16D 3RDTA 4JW3A 1PZAA 3I9GL 3D48R 1LM8V 1Q9WA 2APSA 2PUQT 3MRRB 3RVUC 5CAYB 2FH6A 2NUPA 3GSWA 3MV7D 2C26A 1O6TA 2WXIA 32C2B 3MRKB 2IAAC 3RWDA 2E6JA 3MCKB 4Q0XL 1G0DA 4P5KA 5FYJD 2L8AA 4NO5A 4GNKB 4N5EC 4R7VA 2O26U 5EUOF 1RZ7L 4HJTA 2WLHA 1OT1A 2D0FA 1W8OA 5L2KE 4YQXH 3R7QA 3EO9H 3K72A 4NQUA 2ERJC 3QCTH 1ZWIB 3W57A 4HOXA 1OF2B 2DYPA 2K78A 1OEZW 1PIGA 3H0TA 4E2OA 5C3TA 5IMMA 1CLOH 3EG9B 4KUCF 3NQKA 3V0HA 2MHAB 3PWLA 3K2MC 4M48H 1LE5B 3SHSA 1WQVT 4QJ3B 1GGBL 3IMRA 4P9ML 3QQXA 4E41E 3NCYP 1H6EA 4YXKL 4AVKA 4KDWA 1LJMA 4M5ZH 3GXIA 3V6ZA 2W07B 3AG2B 3EOYG 4N0FB 3SKUD 2NR6A 5I9QB 3ARVA 3ARED 4LLMA 3AB0B 4XNYL 1NBVL 2HVKA 2LU3A 3PL6C 2MTPA 3LEVH 2EDFA 4C4UA 3X1GA 4OFYD 4Y9GA 3C60D 4H0IA 1B0RB 4F7MA 1G7MB 4H1LA 5AW3B 5CJBA 43CAA 1NLDL 3FCBA 2KLTA 1LO5B 4X5WB 2V2TB 5JXEC 1QNZH 3IJHB 4JDVB 4BK5C 1KCUL 4BFOA 1EXGA 3E8UL 3S3BB 3SGDI 3QISA 3QO0B 3VD3A 3K8MA 4Z7OB 5EC2B 4HT1L 5LGJB 4Q56A 2JQZA 2WPGA 2NLJB 5AWNH 3P4OB 5D5MA 2CU9A 5ADOL 5C0JB 1D7BA 1JYNA 4H7VA 5IV2A 1NFDF 4LLVB 4M43L 4RDBA 5JNYB 4LU5H 1HDMA 4P4KB 1EHAA 2FQFA 3RBSA 4FHJA 2F19L 3MOQA 3TOPA 2I07B 2ZSWB 2ZT9C 1I8KA 1NAKH 3OSKA 5I6XC 1AZCA 3OJDA 4XOEA 7FABH 5CCGE 3N85L 1J1PL 5MENA 4JHAH 1JBJA 5DR5L 4WJG3 2VN6A 2J21A 2V0AA 4Z7QE 1FNGA 2WLLB 4X7CC 4XGZB 1H15A 1PKOA 2IH3A 1FH5L 4I9WD 4PBVC 4JDTH 2NXYB 4Y5XB 2M1KA 4BXVA 5EA0L 2A74C 1MRFH 2XWJA 3KPSB 4J3SA 2AGJL 5T1DL 2WM0A 4A2EA 1YPZF 1MCOL 2Z31A 5DJXA 1RJLB 2WQVA 4Y19D 5FGSA 1ADQH 2GTWA 2JQAA 4KVCL 3HZKA 1OAUL 4FC3E 1ED3A 3P9WB 4P3DB 4UM9A 2RMNA 5FUCE 3MBEA 3Q8CA 4ENEC 1L9QA 3LQAL 4U2YA 1T1XB 4AW7A 4YXLH 5IVXB 3O6KH 5I1HL 3HLAA 5AUMB 1TO5A 1AHWA 3GM0A 4DT2A 4LASH 2ZUVA 5E1AA 1IBHA 5FYJL 3E80A 5E9DE 2P42B 1U95B 1UA6L 5T1LD 1N2RB 1KFAL 4N86A 5IB3B 1AI1H 4GLRI 5E2JA 5DI8B 2Z0UA 1U3YA 1AY1L 3OHXC 3OM3B 1G0XA 2QQLH 3DVIA 1HINH 3ZTJH 2OYMA 4GKZA 5JLZB 4M6ML 3SE4C 4M5YH 2DDQH 1ZK9A 3O2VH 4M6AA 1U8QA 1Q8MA 4NZTH 4PJFB 3UC2A 1WBYA 4MA8H 4LZKA 1SHXA 2ZYSA 3GT6A 4KK9D 2HKHH 4PGZA 4E9QA 5DVOA 4TVUA 2YZ1A 3ML8A 3GKZA 3GHBH 1Q4NX 4W6WB 4HEPA 2CPUA 3RIKA 1COBA 4WVRA 1IUZA 1TO4A 4BCYA 2QQLL 3KMDA 1FCCA 4FQCH 4Q2ZB 5IHUH 4GSRA 3RGBA 5JHLA 3VD0A 4QHUB 3BWAA 4L4VB 5D8JL 3MNVA 3AGWA 3EIFA 3IKCA 3IWVA 4UT6A 5DC2A 3AM8A 2A3TA 2CGRH 3OXRB 1ZS8B 4Y16B 3VGHA 1L9TA 1U3JA 2CJTA 4U1HB 2ZUYA 3MRIB 1BIIA 1W6LA 4N8VA 3TJHC 3EDEA 1JPFA 1Y1DA 3PQYE 3KXFA 3TO4B 4W9JC 5DGQA 1ZT1B 3QCVH 1G5GA 4FXLA 4ZS6C 2Y3NA 4M7LL 2EEFA 2X12A 3M07A 5C07E 3SZKC 1CIUA 2FX7L 3KDPB 3OQ3B 3QVAA 5C0BD 2YKKA 4K3JH 4K73A 2JIXB 3RX5A 1RIUH 3S2CA 2F8XC 3C2AH 4PWHA 1YPZB 3LIZA 3PL6B 5DWUH 5IT2H 3NDZE 5DD5H 1TJGL 2BHZA 1G6RA 5I8CA 1DVXA 4YEEA 1B2WH 1YEIH 4JVPA 4RIRA 1QBMH 4O2CA 3VXUD 3JWNE 5BOPA 4JRWA 1FLTX 3NJVA 1T5XB 4DKFL 3ABZA 4WNSA 2EO1A 2N1TE 2VZOA 3FN0H 5HYJA 4YSUA 3LEYH 3O41A 2JLPA 1F41A 1OL0A 4GMTH 1RIVL 4PG9B 4JFVA 3G9VA 3P77A 1RIUL 1NGWB 1Z9MA 3K91A 1NCCL 2IDUA 2GK0A 3VFTA 3S5LG 2P5WD 5EWIL 3ULVE 2IPTH 1QFUL 1UURA 4ZFFA 1TQWA 4NQCA 3CNKA 3GBEA 3ZK0A 1I1CA 1KIQA 2FNBA 2YXMA 3OKKB 4JO3H 4N8VG 2VB5A 1DBAH 3UTZB 4MMZB 3MLTA 1DN0A 3HRZC 3GS7A 4PJHF 2PWGA 1Z0NA 4ODHH 4GW1A 4GSUA 1UWYA 4HKXB 3PL6D 3ZRSA 1RJCA 2YK1L 3KLKA 5CINL 2ICCA 2F5BH 5B38G 3MLUL 2ZD0A 2X4RB 2VE6B 2WZPD 4E42A 1MFEH 4W1TA 1A6AB 1J8HD 5TDNB 3V6OE 2BC4A 4MA1C 5J06A 3QXWA 5C70A 3KPNB 3VXPB 4RDQG 4HAGA 3EJYD 5JDSB 3G6DH 2VZUA 3ASWA 4MD0A 1EUTA 4X99B 5CEYA 3TBYB 4F15C 4H40A 1ES0B 2NXZC 2B7DT 4YUEL 2BW5A 2G3ZA 3CFDB 1IGIL 2QPDB 1H3TA 1C7SA 3CC5B 2ZUQC 3C6LB 3HG1B 1U42A 5E7BA 2OTWB 4YZFF 2YQ2A 2ZSWA 1A9EB 4YEFA 2A9NL 3SDDD 2XQBH 1NC4B 3EGXA 3OJDB 2V7HA 4PLKD 3DBXB 3EJCA 2YD1A 1JXGA 1RP8A 5IGXH 3CSPA 4B6ZA 1TCMA 5I1DA 1U8HB 5A6MA 1N0LB 3B37A 1QBBA 2E86A 3EF4A 3NAAL 4OZFG 2Y1VA 3UADA 3KPRB 4KX9A 1SY6H 1WFNA 4H8QA 1WCBA 2W95A 3IFOB 3X3GL 3CFKB 1LMKA 2ZP8A 1IV8A 2VJ8A 2QV2A 3L95B 2GTWB 4UTAA 1J8RA 4X6FA 2AKRB 1L7IL 4L3EE 4L3AA 4TSBH 5AL8A 3WENA 2JK5A 4PBXA 2F19H 3W9DA 2WOBA 5BVJB 1MFNA 1MDAA 25C8H 3NA9L 2HH0H 5E5MB 5E1QA 4FNTA 3M88A 4DF9A 2EACA 2A9AA 4OIIL 7FABL 5KVGL 5AKVA 1QEWA 3M6DA 3B8YA 1NOLA 5IBUG 4B41A 1PF3A 4N0CD 3I6SA 3UC0H 4B50A 2BNQE 3V8OA 4QHPA 3D12B 5T33H 2CDEB 3B83A 3REWB 2GQHA 1OZUA 4HIXL 3SDAD 2APXA 3V4UH 3A5VA 5DJAB 2F2HA 4TSAH 3Q05A 4N0RA 1WBYB 4CVWA 2HFGH 5IMMB 1SBSH 3MUGA 4A2LA 3LZNA 3HW7A 3RWEA 1RSYA 2R2BA 4RESB 3WL9A 1BLNB 2MWCA 4TLTA 1XIWB 2NY6D 2IWFA 2XN9A 3I6KA 1BZ8A 5FM4A 2EDOA 4MDIA 1W72L 4KAQL 1P7QB 3TZVB 2OTPA 4TF4A 3QRFM 3WLBB 4KZDH 1U8PB 1ZHLB 4YNYA 4XNBA 4X5QA 4LLMB 1JFHA 4OV6F 4YHML 3AREB 4U1HA 4WW2C 1O5DT 1A2YB 3D7PA 2DMHA 4G7QB 4Z7WA 3EH3B 1JPFB 1B0RA 2L7EA 2VABA 5DHVB 5D55A 1ZAGA 4QXUL 5BPPA 4N2KA 3MRRA 2DQEL 4PHXA 1RAMA 1J5OH 1I1AC 1BMZA 1S9VB 3PWNA 1PTZA 2VUOA 5LCVA 4BA0A 3RFRA 2NZ9C 3LDBC 2YD8A 4JZOA 1Q1JL 3II3A 4H20H 4PRHD 3OLIA 2J25A 4WWOA 4PBDA 3TZVD 5BRPA 4HQQH 3IU4L 3HAEG 2CNZA 3K3QA 4FTVA 2VJXA 2CK0L 2X38A 2Y5QA 4LO9A 2AJSH 1E9OB 2XKUA 2YRBA 3GSXB 3KCPB 4FA6A 3WDJA 1SJEA 3O41B 1AGBB 3PWPD 1PCSA 1I31A 2FSEA 2X4OB 3M46A 5JDJA 2AI0L 3NUKA 3SBRA 3CVHH 4R97B 1R5WA 1VRSA 4Z7UB 3TIDB 3TIEB 1ERNA 5ISZE 1UFUA 1AXTL 3D69A 5FK9B 1J0ZA 1W8EA 2R0WL 4ZS7H 4LASL 5FYJH 1WFJA 2YBRA 4EKJA 4LNRA 4JG0L 3CFUA 1MCOH 1GOHA 2KT6A 1KZQA 2H1PH 3JWOL 2R1WB 2EO9A 2ZOLA 3BPNC 5GJTL 4DHLA 2RCSL 2Y7NA 3C9NA 2R8SH 5J13B 2ZQKA 3IMVA 4F7MB 4WF7A 3B6SB 2VQTA 3MBEB 4RFNB 1EO8L 3WN5A 3IGUA 4Q9BA 3CK0L 1XSKA 2D0HA 1OWRM 5LBSL 3ZDXE 4JAMA 5TDNA 1GKOA 3GSQA 5EO1A 1L6ZA 2BC4B 4HULB 1BVLA 4WFED 1YQVL 4V1DB 4YC2C 3E1F1 2FWUA 3D3VE 2PCFA 5AWNL 2DYSB 3NTCL 4Y5VB 1VCAA 3W39B 1JXDA 4HLJA 4YIQA 3H9HA 4LP4A 1BVKB 1NEZB 3I9AA 5H4YA 1FL6B 1RZKH 3NJMA 2YAFA 2XTJC 4WRLA 4Y5YA 3ZT6A 4C4BA 2DIAA 5F72S 3QWOB 4EQ3A 5IJKA 3ROLB 1DQTA 5LBSH 2WVTA 3GMLB 4WGKA 4KQ3L 4TUKH 3RX7A 3SYQA 5L88H 2G5RA 2NT1A 2DJSA 3O8XD 2ZAGA 3W2DL 1EO7A 4UT9H 1BXAA 3LKNA 3QPXL 4G8FA 4P2OD 3WTVA 1NKGA 2JJWA 1MFCH 4U3CA 4QXGH 4W9DC 3ZY7A 1CT8A 2MTAA 4HPYL 1UWFA 1BZOA 2L0DA 4DUWA 2VN5A 3WXWH 5D1XE 1ZEAL 4Z76A 5DMJB 1TFHA 1TLKA 4GKNA 4LQFL 1RJLA 4BQCA 4FABH 3A23A 4J3OD 2C9SA 1KB3A 2X41A 2X6UA 3IKCB 3VTMA 4PREA 4UB0H 3ZYJA 4QLWA 4MYPA 5L88L 5DJ2B 3VDCA 1WO2A 4ZPVB 5AZ2H 1GC1L 4N2MA 4XN9A 5IQ9A 2DMCA 5IJKC 1MFCL 3QUYA 5AUMA 4OJFH 4XP5H 5DMGC 1FNEB 2BJMH 4MNQE 2ZIDA 1JGEB 4P5TD 1E40A 1XGTB 4R84A 1M2VB 2WSDA 5LKNA 4KTYA 4CC4A 3K6SA 1UKTA 1MJUL 1KCWA 4GY4A 3LZPA 4Y2NA 2WXGA 4AYGA 1H0DB 5DZAA 3TPUA 3CZLA 2NY7L 4FJYA 3T0AA 3P0YH 4HOWA 4PJXE 5ILTL 5IKCB 4O02B 2VH5L 3CH8A 4L5FE 3F5WA 4MA8L 5E00A 1BG1A 2HRGA 1D9KB 1N67A 2VT0A 2NY3B 3UAFA 2HLAB 3EJTA 3RWEB 1IC5H 2DN7A 4WTZA 4WNQA 3X1NA 1NGPL 3VXME 3U0WL 3B3IA 2LU5A 4XNXH 2YMXH 1BV8A 3QDHA 3K46A 4PH8A 2EIDA 4NQCB 1P7QA 1XCQB 4LAQL 4XCEA 3UTTE 2EEXA 4KUZH 3IDNB 2XXCB 4O2FB 4S1DC 2OR9L 3U36A 5B3SB 3MV9E 4HPOH 5F8RC 3V0DA 3GSUB 4HZLB 3B9KD 4GQ9H 3BPOC 3MCKA 2IANB 2ED7A 4N8VB 1MHPH 2F7IA 3CQPA 3SPGA 3F62A 1QLEL 3JZ7A 4E9RA 1P7KA 3EOTL 5F3FA 4DZBA 3SDYL 1TJMA 5IHBA 3VWKA 2AXWA 5D2LE 5GS1C 3X13B 2BPBA 3QORB 5EG6C 1FSKC 3IJYB 1RK7A 4QF1A 1QASA 3M7FB 1CFBA 3H4HA 3POHA 4J3OG 4NFDA 3S4SG 3S5YA 3WAKA 4G43A 1BMWA 1QSEB 4AG4H 4KKBD 4Z3IA 5B4MD 1ZT7B 1FIEA 2ITFA 2YN5A 2QL1A 4OW6A 3TO4D 4DEWA 4GXUM 1ZDQA 4X50A 4IRJD 3CFDA 1RIHH 2CRMA 4ZUVA 1I3UA 3L3OB 2BCKA 4FHBD 3BGAA 4Y9CA 5E6ZA 3VD2A 1FFNB 1F86A 4Y1AE 4WWKC 1CVSC 5SWZE 2EIMB 5IT2L 4D3CL 5K59E 2UZIL 3BN3B 2GIYA 2MIZA 4FQHB 5FFGA 4DEPC 4F8TA 1IL1A 2WV3A 1UCBH 4ZQKB 5LXGL 3VFTB 3DSFH 2NY1D 4DPCX 3ARWA 3S36H 2WUCL 1E43A 4LB8A 3D69B 3QIBD 5HJDA 3SYAA 4Y4FC 2EVFA 3GS0A 4L8SA 5EIQA 3HNTL 4HMCA 2YOCA 1NZRA 2XV6B 1U30A 1WFUA 5DTFB 2EYRA 1MHHB 3UJJL 2FYYB 4MXWL 5BO1H 4GAJH 1P7QD 4M1DL 3ZHKA 1S9YB 5B1JC 2RFXB 5D1QD 3OF6A 3V9EA 2B15A 1L7IH 4TSBL 3ECVA 4PRPE 5IV2B 2QZQA 2GK2A 1MH5B 4KPHL 4RAHA 1IKOP 1IM9A 2H6OA 2OW6A 5JQ6L 1XCTA 4N5ED 2H8PB 2NY2D 3IWUA 4PV9B 4IBZA 3F8UB 1A4KA 3KPNA 3QIUB 4M6NH 3FT3B 4TPRH 5DO8A 4I89A 3QUMA 4Q6YA 1RERA 4OVUA 1CVRA 1AZUA 4UUJB 1CDBA 2DTSA 2Y0SA 1HI6A 2IH3B 3JT0A 3CUPB 3K4ZA 1FL6A 3N50A 4DQOH 2UXGA 4QTHA 1Z5LB 4YL9A 3F7LA 4LDOB 3H55A 3B7YA 4XWGL 3VXRB 6PAZA 2I5YL 1Z9PA 3L3JA 5F96L 2X2UA 1GOFA 3BMWA 5I74B 2TSBA 3NGBB 4OZGB 1ED3B 1S7UA 5LDUA 5I1DB 3EBHA 1U8HA 4W9HC 3D39D 4KY1L 2C4XA 4H8PA 1FZJA 5GRVL 3TXAA 4JGNA 2BZCA 4Z3HA 2OR8A 3GJFB 1LK2B 3NFPA 5E03A 5FYLD 1U3HC 4P2RD 2YD9A 4CMHB 4X4XA 4DQOL 4J3VA 1S3KH 1SDAB 4IIZA 5E95B 1DR9A 5FECB 1F4YH 2MKLC 2DEYX 1PU0A 3LKOA 1E4XH 3AUWB 3GLAA 2ZXQA 4Y4FA 1D5MA 5SWZB 3HJEA 1JD7A 4HK0B 1QI3A 3CVIH 4JCMA 4ZSOB 5JO5B 3C5ZB 4Z78B 1Z9SB 3SBWA 4XNXL 3HAEH 4TNVK 3ARDD 2GSMB 4F7PB 3HMWH 2CKBH 1XR9B 2Y7LA 1XH0A 1JGEA 3ZDYB 1GPOH 2PO6D 4X6DE 2M8XA 5FCUH 3NSYA 1FF5A 2Y1ZA 2PWFA 4ZNEE 2P48B 1JK8B 3DGCR 3QB7C 3WXWL 3ZBMA 4UNTA 2UZXA 3PXJA 2DI7A 4P99A 4S1SH 4HUWB 4YHKL 4OCXL 3UJTL 3VXSE 2ADGB 1A6WL 3E0GA 5EO0A 3DX8A 5IBTL 5CINH 5ELIA 4HFWB 3N5AA 4X7TA 4EI6B 1XV8A 4CNIA 5JHDA 4Y2LA 1RSFA 5DFVC 2HFGL 1AS7A 3LV3B 5I1CH 4RMSA 4UOQA 1U8KB 4DGUA 4Q6IA 3TVMB 1WS8A 1KJ3H 3NVQA 3MOAH 1QNZL 1IEAA 2A38A 2H2PD 3GMNB 3KXFB 3FJTA 1XGRB 1ZA6A 4OZFH 4P59L 4K8RL 1CB4A 2XN9B 5DD6A 5DQDL 3BZFB 1JI2A 2XT1B 3VQLA 3VI3E 3ZTCC 2CM5A 3K0WA 3WO4C 4B9FA 4L1SA 5DD1H 5AAMA 3PNRB 4AYMC 1YZZA 2NSMA 3L2LA 5CJ8A 4OGYL 1YQVH 5I16B 1EJOH 5KBLA 4KKPA 4MNHA 3BQUC 2X28A 1I3RA 3CXDH 5HGHB 2QKIB 1VSCA 4MLIA 4KKAC 5HPMA 3JUYA 3QWNA 4YGVA 3ZDXB 4UIMA 5EU3B 4WQOA 2ZAHA 4ISVB 3ARBC 3FFOA 1KPUB 1ND0A 4JFWA 1DP0A 3HKZA 4M5TA 3QNYB 1T4KB 5C0ND 2ED8A 1G7PA 4LVNC 3BRDA 2MQ0A 4ATWA 3GDBA 3TCTA 2BXYA 3FU6A 2C9RA 3ARDC 2XIBA 2XXFA 3RE0A 1OF0A 4DETA 4GH7B 3Q6GH 1BVKA 2XQYG 3AJ7A 1IQDB 5BRZB 3BH9B 3HNSL 5IVZA 4HJEA 2A4CA 3ROLA 4JJOA 1R5IA 1HYSD 1XD1A 3N85H 5L2KB 3RL2B 1HQ4A 2ZJSH 3IRCA 1KELL 2J2ZB 3GNMH 1G7LA 1NMCC 2A77L 1CJYA 4KGJA 1YY8A 5HHOB 3PABA 3VJ6A 3ARRA 3IJEA 4JFED 4QGTA 3UIYA 3QI9B 4Z1PA 2B39A 2FJGB 4FQXC 3RVWC 4U6HB 3RYMA 2F5AL 4B27A 4RBPH 4KO6A 2Q2LA 3VFPA 4DEUA 3JWDC 1AKJA 2GFBB 4N4YB 1SM3H 3B1TA 4XNAA 2P7TB 1QOKA 5J3HC 4BUHA 3O3BA 3TASA 3CPLB 1YY9C 1FBIL 1A21A 3PDGA 4G1MB 4KI5D 5FW8A 1OAQL 3TBYA 4K5OA 3WD5H 2XFXB 1FFRA 4NM4L 1IM9B 1E42A 1FNHA 3GXFA 5GXBB 43C9B 5DVKA 3Q7JA 4KRNA 2C9PA 1BREA 4ZOAA 1XL6A 5HYQA 2RB8A 2X4NB 3LRSA 1R33A 3LMJL 4RH4A 4YBHA 4BH7B 4HSQA 4NZRL 2BNUA 4ADGA 2CRIA 1KY6A 4DNLA 4GMSL 2VJ0A 2VW6A 5JQHC 3X14A 3FB6A 5IFJA 4G2AA 5I1AB 1HHGB 5TH2A 3RHWK 1DSWA 4X6DF 1Z5LA 1JUFB 4JO2L 1J5OL 1IILE 1NAML 3UAAA 2IMNA 1DQLH 3L95A 3L3GA 4HC1L 5GRZA 1MVYA 1EJFA 3SE4A 3GLEA 4OZGA 1J11A 1MHPL 1X9UA 2ZX8A 3T71A 3IDGA 4LOFA 4YQXL 3HBGA 4OCXH 1M71B 5E24E 1MRFL 2Q8BH 2YPKA 3RY4A 3SPHA 1M42A 3F83A 4NRYB 2GJ6B 1TTFA 3R8BB 1N8OE 1GCFA 2C3HA 3K1KC 4N2EA 1FYHB 3C5ZD 2ICEA 5I23A 1FZKB 2YAPA 3TURA 5SWZA 4MWFA 4FZEH 2JF1A 3QZWA 2A6IB 2X7LA 5E56A 3ZKXB 4NUGL 3L1FA 2V5SA 4YBQD 1U8OB 4X5PA 3K6OA 2P8MB 1DO5A 2OMBA 4NC0B 3S3CB 1GZQB 1U8IB 2DPKA 3I74A 3QARA 4YPGB 4BM7A 4JRXE 2JELL 4UV4L 1QW8A 2Q3AA 4ZMWA 2H1LM 1EAPB 3SE8H 4F9PA 1QBML 4PJ7B 2JV6A 4Y19E 5C8JA 5GJTH 4ES9A 5CN3A 3V5HB 3A4DA 3NIGE 1EUUA 2YEZA 5E23A 4TNFA 3FQRB 2JJTC 4TM9A 2WLKA 5CD3B 3UZVA 4JFEE 3WG7B 2CXKA 2XPZA 4MSWA 4NIKB 3VFGL 3F5WB 1RZGB 3UMTA 3WLBA 1UD5A 1D9KA 1YEFH 5C0IA 1XT5A 4I48B 3NK4A 1F3JA 3AREA 5DD3L 3CZKA 5KSBE 1CE1L 1U8KA 2C1PA 3AS2A 4JO1L 4LOUD 1B0GA 1VEPA 4KK5C 4UQAA 1VFOA 1MUJB 4XO9A 3NTCH 3VXUA 1HVXA 4KV5F 1IAKA 3OKMB 3QW9A 3B7TA 4AQ8A 2G4EA 1T0NA 3PHSA 1CN4A 3NFSH 1WPCA 1G9HA 3VH8A 5D5ME 5KYUA 3RZCA 3F7KA 4M8UA 5BV7C 1U2YA 2MNJB 4NN6B 1DLHB 3ESMA 5J9PB 3BAEH 3DJTA 5EU7E 2RFXA 1XF3A 4WFHD 3MLUH 4LVHB 3W2DH 2VC2L 1FORL 2B59B 4ISVA 2DKUA 5SWZD 1LDSA 4P8QA 2EUXA 3FSAA 1Q9KA 2GBTA 1BQ5A 3TP4A 2WIMA 4LKCA 2QT6A 3NACL 5BRZE 2Y06L 1ROWA 3BPCA 4KI5F 5IM7A 3QO0A 2EDHA 1JGVH 4P4KD 3P4OA 4AGMA 5E6SB 3LN4A 2FSEB 4TVPD 3HZVB 3NAAH 1MCDA 3B5TA 4R7XA 1AG0A 4IOSA 3K71B 4ZFOA 2BSRA 2IH1B 5TE7L 4LCYA 2EDMA 2I69A 3BWSA 4XBGB 2EXYC 1P84J 4ZFGH 2Q76A 4FI6A 4WSGA 2P8LA 2J71A 4FLOA 4MXVF 1YNTB 4D3CH 1ODUA 4OZIF 1MRDL 3EYQC 3D0AA 1V54B 3QJVB 3KL0A 4IW4C 1JCKA 2CO1A 3PP3H 3K74B 4OGZA 3RTQB 1F42A 2YGOA 4RGMC 3VI3A 5LAXA 3AWEA 1AAJA 5JIPA 1SF5A 3KPRD 4PJCE 1MXGA 1QWHA 3FTYA 3DOHA 3MACL 4TXVB 1MFVA 3BVUA 4ETYA 3SDDA 2Z31B 3B2PA 4MJJA 3E8VA 4V1DA 2PCFB 4BFIB 5GJSH 1Y6KR 1KCKA 3Q8FA 35C8H 3IFNL 2ZX6A 1EFXA 1MRDH 5ICYA 4ZPTA 3GSNL 2KUTA 1WA1X 4KI5C 5J6HA 2Q86B 3ZDXF 1TITA 5GSVB 4ELKA 5B1CA 5AENA 4L8BA 2VDML 1E4WL 3FN9A 2DJ4A 3RIFK 2GJZA 3GNML 5EOTA 1I7UA 2ITCA 2C9VA 2GBUA 3L5XH 1SLUA 4Q9RL 3CHRA 2C9XA 4HPOL 4AIZB 3VFMA 4M48L 4Z7IA 5EU7C 4FF9A 1LO0L 3OJ2C 3V0GA 3FQUA 5AW0B 1QG3A 5AYUL 5JHBA 4J23A 3CFJB 1T5WB 4EI5C 3NCJL 2WOYA 2Z0BA 2CHWA 3DHUA 4PP1C 3JWDH 5IW1A 4Y4KB 3UBXA 4GXVH 4ICWA 1X3DA 2MQGA 3RNQA 1W0VB 4ZI8A 4PI2A 1WAPA 2X9YA 3N40P 3MLRH 1Q0EA 3VM5A 4PJGA 2WLIB 1OPOA 1KIPA 5IB4A 1U6AH 3ZHLA 2JKNA 3BAXA 2IPUK 1DO6A 2R69H 5FO9A 1XF4B 1SN2A 2NXZB 2F53B 3DX4A 3L6FB 3GRGA 2AK4E 5T1LA 4Z7AA 2NW2A 2W9DH 1HH9B 2Y36H 4I3SH 4L3CA 5EZOH 4P23D 4AEIH 1KJ2A 4X4XB 4I0CC 4EIZC 1BAGA 4MA1B 2UVFA 3WKMH 5LAPA 2OMVB 4Y8AA 5F96H 3FCSA 1KGXA 3KPOA 3N43F 1YEHH 3AAZB 1QBAA 5CHNA 3RHWF 3JWOC 4NO0B 4BGLA 4OCSH 1MPAH 1PAMA 1A4CA 5ABDE 3RJDA 1RUQL 3DYMA 4UWQB 3HG5A 4L8CA 4XO5A 1ORSA 1U6AL 4YDMA 4WO0A 4G8EB 4AQAA 1KCRL 3IN2A 4HU8A 4YWGH 3A6BL 4JO3L 3W5NA 3OXSB 2W9EL 3TT1H 1G1CA 1E3ZA 4CN1A 4H5SB 1UWXH 1XR8A 3TA3B 2B20A 3UC0L 4Y9EA 2HLAA 4IMKA 1JF1B 5ERWA 3CN2A 1TSHA 5INDB 1RPUA 1QRND 1UXMA 3GIVA 2J43A 3M17A 3N91A 3QQ4A 1XF1A 4LVOB 4YHKH 5D1XC 3UJTH 3GXTA 5DRNB 3Q06A 5MHSE 1N70A 2BERA 3EH4B 5BXFB 5C09E 3VD5A 4MQSB 3U46B 2EH8H 4X6EB 2AEOA 1QFWI 5D7IA 1NEPA 2FIKA 4RZCA 3WJJC 3BH4A 1FZOA 2ID5A 3FT4A 3QBTB 3QE5A 3KGRA 2PPDA 1ZSHA 3TLRA 3V4VB 4L4VE 3TCLB 5D7SH 1RXLA 4LSPL 4ZDHB 1UD2A 3O6KL 4U49A 3SIKA 4KX7A 4JZJB 1YJDL 4QD2E 1LQSR 4HAKA 3CTTA 2N7SA 3RL1A 1MCWM 1NIFA 2BOBB 4NDMA 4RAVB 5D6CB 4BWUA 2WMPA 1OB1A 5FA4B 3TNNA 3KG5A 5I8KL 5KYUB 1MW1A 5IK3A 4JN2A 2J8OA 4KVCH 3CN3A 5T1MB 3O3BB 1DQQB 3P1VA 2NTFA 2E7HA 4B5EA 1NCDH 1OCRB 2DLIA 1CDGA 1UD8A 3GXUB 4GFTB 3EJYC 5EN3A 3H4FA 4N6RB 1B9ZA 2DWTA 2VE6A 2XWDA 4Q7DA 4WHCA 1KB5B 3ZHNA 1HHKB 1OT2A 3IJ9A 5JHLL 3BPCB 1AFVL 3NT0A 5AALA 1R3HB 1TVDA 1W0WA 2LE9A 2R9HC 2X88A 1BD2B 4RBPK 2P45B 4XTRC 3SCMD 1A22B 3LN4B 1ORQA 3HC3L 5FDYA 1FUNA 4FQJH 3IEAA 4LCIH 1KV7A 3GM8A 3IT8D 3WKNA 1INDL 3T2NL 4ZMAT 3U7YL 1PCXA 5D2LB 5DK3A 1KCUH 1KULA 5B3JE 2W07A 4N0FA 4NZTL 5JW5A 2IOOA 5FM8A 2ZJSL 1GYVA 2DTMH 4KKLC 4KZCA 3B2VL 1AFVH 1N19A 3G5XA 4G7SB 1JHTA 5GRUL 1X4YA 1BJMA 1OLZA 3RG1C 2YGNA 5FO7A 3SDCB 4OGXH 1RZ7H 2APVA 3BKJL 3DHMA 3VFPB 3UEZA 3CHQA 3T2NH 2D3JA 3EO1B 2PPFA 3G6DL 3Q1EA 4X6FB 3BGFC 4EE2A 3D50A 1P2CB 2NNXA 4JNXA 1HCYA 2J1YA 3JWNC 3T2PA 1OARH 3FO1A 3VWJD 2ZX9A 3L2MA 4RGNB 2BZDA 3X11A 3OPZL 1BPVA 1AC0A 5JNYA 3KPSD 1TQCB 4TLSA 5D7EA 1MY5A 5EZIL 3SJVA 3WNOA 3MXWH 2YSSA 1JSYA 2KPNA 3G08B 1A7BA 1BQLL 1CFSB 1EZVY 1TJXA 3ZMRA 4BWWA 4J4PD 1YEFL 3UZQB 2G75A 1UGNA 4J4PA 3WFEL 3VG9C 3MJ9L 3ZVVA 3MROA 4HGWA 5CGTA 1QA9B 1NFKA 4OZHE 4PJ7A 2J44A 3MREB 1TQBC 4W6XB 1SVCP 1FNGB 1CFQA 2WLLA 2VLJA 1SFDA 1VB9A 2OR9H 1PSKL 4P4RB 3L3IA 2WBJB 3RU8L 3KM1A 2AMUA 5D1QE 5HHME 3HFFA 3RWHB 2WP3T 3O4LA 4TQHA 5FDWB 4UAOB 3QSKB 1WAEA 1KFAH 5CZXC 1JDCA 1OGAB 1FFTB 2HFTA 3DUSB 2HJFA 3LPPA 3ZYZA 2DW5A 3VDAA 5MEND 2XG5B 1R3LB 1K5NA 3D30A 4MD4A 2F53A 1J18A 2VDMH 3HN3A 3V4PL 3UCQA 5D2NC 1ZGLA 3FU3A 3QDJA 1U95A 2Z3FA 1UJ3B 5D4QA 3HE7A 5ITFA 3NEXA 2IJ0C 1JPST 3UROR 1W91A 4UB0L 2CGYA 3HE7D 4JRXA 2XBTA 3WMSA 3KLQA 4HWEH 7PAZA 5I1IH 5IFHH 1SXBA 3LKPA 3CFTA 4AQ1B 1FL5B 3LRLA 2ODIA 3MUHL 5EU6E 1YJDC 1O7VA 1I4FB 2KI6A 1U8IA 2OMNA 3VFNA 3NBNA 2P3YA 5F7FA 1VEMA 1A25A 2AGJH 3F65A 1WICA 3MLRL 3S4SB 1FIGH 2OR7A 4IJ3C 4R0LC 4L9LA 1S7VA 1ZTMA 3S36L 4AMWA 3S37L 4IOFD 3ZW3A 3DYPA 4HWEL 1L9PA 3H1ZA 1OP3H 3SGDH 5GRXG 3UG4A 3TS8A 3Q13A 5ECJE 5C0EA 4M1DH 1YEKH 4GEIA 1YC8A 4XNQA 5I1HH 5G4MA 4QXTA 3SDAB 5EEYA 1F18A 1A1MA 1HE8A 5KJRL 4Y89A 3RKPA 4FQJL 3STLA 3BP5A 3TIEA 3EFOA 5CIPH 4JG5A 4DP9X 1OT4A 3HI6L 3ZE0B 1HINL 4LGRB 3DV4B 4ZO9A 3CN4A 2AQNA 1TMCB 1UWEH 1N4XL 4NN7B 3RUGA 1OB1B 2HP4A 2NNRA 3PV6B 5AVSB 5FW7A 2YD5A 3VFSB 4APQC 3KPMB 4Y1SA 3PL6A 1WD8A 1CICD 4FNUA 3ZR6A 4M1CD 4FYRA 1OD9A 5C0JA 4Z0BL 1QTPA 1JWSB 5I1LB 3EKCA 3IFPB 1RK0B 4W9GC 2B59A 3WHE1 3FTXA 2FD6H 1IQDA 4I2XB 4MZIA 3L9EA 2AITA 4AL8C 4MYWB 5DZOA 1Q9KB 2F7QA 2HLEB 4WDIB 4M6NL 3T3PE 1D7FA 2JQMA 4L8BB 3RKDD 2DQFA 1KJ2L 1OP4A 4P23C 4MXQC 1BX2A 4YDLB 5EZLB 2FO4A 1EV2E 5DHXB 1XWVA 3VVVA 5FXCH 1NM4A 4EN3B 1L7TH 4S1RH 3T4YB 4BKTC 4F20A 3RAJL 4L8SC 2EDQA 3CAFA 3HR5A 1E8ZA 4F2ME 2R29H 1LE9B 2HFEB 1BZ9B 4MX7A 3TX4A 1JWUA 4J8QA 2XTSA 3PHOA 3MLVL 5AQ0A 3RRQA 3DOSB 3Q5TA 1L0YA 1SHMA 1QSFA 4FQ2H 5I17B 3DURB 3D06A 1NFDE 4WKXA 2IH9A 3W3BA 2VIRB 3P0YL 1MI5B 4E42B 1AHWB 1IC1A 2OZ4A 4YWGL 1S7SA 4AE1A 5A6LA 3EO1A 2K7QA 4H44C 4POZC 5IEKB 2CBQA 3COOA 1X44A 4PAZA 3I3BA 4ZXBA 2H1XA 2ENSA 3ESNA 1AD0A 1INDH 3IAPA 1JZJA 1XEDA 3MNWB 3Q01A 1R5VB 4UILH 4CDGC 1ACCA 5BCAA 3ARTA 2GSGA 1TDQA 3BT2H 2V17H 5DJ0A 1T83A 2NZIA 3TBWA 4PJDF 4X8CA 4FQIH 3O6MH 2HB0A 3ETTA 3GTNA 5FIEA 1VGEH 4LVEA 4GAFB 2W9EH 3KPTA 4Q9RH 2DYRB