3GT6A

Crystal structure of the hspa from xanthomonas axonopodis
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
100
structure length
100
Chain Sequence
TAQWVPRVDIKEEVNHFVLYADLPGIDPSQIEVQMDKGILSIRGERKSESSTETERFSRIERRYGSFHRRFALPDSADADGITAAGRNGVLEIRIPKRPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of Xanthomonas small heat shock protein provide a structural basis for an active molecular chaperone oligomer.
pubmed doi rcsb
source organism Xanthomonas axonopodis pv. citri
molecule tags Chaperone
molecule keywords Low molecular weight heat shock protein
total genus 17
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3gt6A00
3L1GA 2Y1ZA 2N0KA 1RL1A 1WGVA 3J07A 2KMWA 2CG9X 3AACA 4JUSA 3QORD 4YLCA 2Y22A 4I88A 3GUFA 3W1ZA 2RH0A 2BOLA 3Q9PA 4M5SA 2MNWA 3GLAA 3L1FA 4RZKA 2WJ7A 3IGFA 1EJFA 2K8QA 3QORC 2JKIS 4YL9A 1X5MA 3VQLA 5DS1A 4MJHA 3VQMA 4FEIA 4ELDA 3GT6A 4M5TA 5DS2A 3AABA 2O30A 5LUMA 3QORB 2N3JA 3QORA 1GMEA 3EUDA 4JUTA 4PBDA 4YLBA 3N3EA 4YDZA 2CR0A 3Q9QA 1WFIA 4YE0A 2Y1YA 2XCMC 1SHSA 2WJ5A 4PCKA 3L1EA 4ZJ9A 1WH0A 2KLRA
chains in the Genus database with same CATH superfamily
1KV3A 3L7EB 4G8AC 2IALA 3BSHA 5C09E 1ZE3C 3ZKSD 2Q76B 3O6KL 2BHFA 3MLRL 3D06A 3K80A 2QLYA 3MRIA 3RB7A 3V95A 4CC0A 2FX9H 4N1EA 2H6OA 4C47A 2XQ0A 3VXSA 3VRIB 3WUWB 2QSVA 1RIUH 1ZE3H 1JYVA 4ZUVB 5ELIA 1DBKH 2JH2A 1A6TA 3D08A 2VABB 4GQ9L 5H4YA 5AB0A 5GZNC 1F1AA 4F2MA 3U83A 2DH3A 4WSJA 1RPUA 2ZXWB 3DURB 1OQXA 3WN5A 3GGWB 3IRCA 3QUXA 1ACZA 3N5AA 3T8VA 4BK5C 1IGCH 1KEGH 2WXOA 2OP4L 1T2QH 2HRHA 2DWSA 3OB0K 4KK8D 4A7VA 3FOMA 2QGDA 3CCHA 4N8VB 1QRND 1W72A 3L9RA 2W9EL 3QUHA 2HN7A 3I02A 2WXHA 3KPQA 2EZ0D 2EYRA 2NY4D 3L48A 3LN5B 1T7ZA 5IB3B 3GSNH 1M2OA 3NESA 4XP5L 3T4AC 1OF2A 2J71A 2DQUH 4C83A 3VXMA 1A4AA 1CVRA 3GEFA 1HNFA 1WCBA 3ZN6A 3LH2H 3QUYA 1N0XH 5F21B 1EANA 1FVEB 5B4MD 3MNMA 4P49A 1I7TB 1EHKB 1NGYB 5D6DC 3SZ6A 1S7SA 3BESR 4GEIA 4X8JA 5EA0H 5IFAH 1J1XH 3VFUA 5LQBH 4PJFB 3D18B 5CGMA 1FYTA 3B2PA 4M6NH 1F6AB 2I27N 2Q20A 3QSKB 5JHDE 1FNSL 1L6ZA 4KXCA 3TX4A 3VXRB 4EI5D 1YQVL 3LZRA 2EDYA 3QCVH 4OD1L 3ZKMD 4QRSB 5KYWB 2VXQA 5D4QA 3AU1A 5CJQL 2VR4A 1EZUA 2UWEA 3ULUD 3DO4A 2IH3B 1HH9B 4FXKB 2HKFH 3G5WA 3C5JA 3CFQA 3S97C 3DROB 4DGYL 4ZFGH 3TCLA 2R0WH 1ACYL 3DBXA 3HB3C 5IR1B 1FZOB 3ULUF 5DMIL 4ZXBC 1CPUA 1T5WA 2PWGA 2BHZA 4PP2B 3V6OE 4HUXA 3VCLB 2F53A 2ZXBA 3CFJA 4G7RB 4LEXL 3OGCA 1YEDB 3T8XB 3LH2L 5HDQL 1OO2A 4AL8C 5JHDB 3NIFB 4X5QA 4BSVB 2VM9A 5CHNB 1IU1A 4KKAD 3RTQA 4J3TA 5LXGL 1JTTA 1G6RB 2W95A 2QKIA 2BNUA 2RB8A 1IM3D 2L4OA 3KPNA 1TQWA 2K8MA 5C0BE 3BSZL 2PETA 5K9KA 4PH8A 5FW8A 3VD0A 3LHPL 4A2HA 3HI5L 4GW4A 1P9MA 2O5ZH 4U1IB 1KTBA 2VDKH 1IAMA 1OW0A 2CCWA 3B5HA 1KJ2A 4ZD3L 2RACA 5J11B 4OCXL 1HYSC 1T0NA 2PWDA 4G70B 1UM4H 3QEGL 4LE8A 3GS0A 4DP6X 4M3JA 3N55A 1SY6H 4KNQA 4U1GC 2ZT9C 4CVXA 1MCOL 4H13C 4R96A 2XFXB 1JCKA 3ELQA 4H7VA 4QEGA 4OF5A 5CN3A 3IT8D 1V7ML 3L54A 2NQDA 4DCQB 4Y4HA 1S7XA 1KEML 4DVBA 3FONA 4E5XB 4CA4A 1KV7A 2P80A 4DWHA 5CEYB 3HMWL 4GSXA 4N2BA 2CDFA 4NI6A 3ATDA 2ITCA 3MLSH 2MSPA 2YK1H 1D5IL 2O5XH 3TJPA 3WG7B 3TESA 5JQ6H 2WSPA 3GMMB 4FZEH 2NSXA 2AITA 3FUNA 1AGBA 2X6UA 4HFUH 1LEGA 2IG2L 4K71B 4KRPB 5HVHB 3AAZB 3TBYA 5JHDA 1HVXA 1NDMA 4PRIA 1MRDH 1TJHL 2J3SA 1AMYA 1TNMA 5KSBF 3LIZL 3GMMA 2NYYD 2FYYA 2JCCE 3VM7A 1H3WM 2GQHA 3D4CA 1NGPH 2DQFA 1WC7A 1M1XB 3BP5B 2I7SA 4KI5C 4PYHA 4HXBL 3E7JA 1QSZA 1E9OA 1RXLA 1ZMYA 15C8H 3K4AA 4YHZH 5F44A 4JFPA 1JPGA 4N8CH 2Q10A 3ERXA 3T0XA 2AK4D 2WXRA 4J4PD 3CLFH 3L1GA 3GKWH 3WTVA 4XZUA 5JNYB 1NCAL 3VXME 3ESNA 3ARZA 4FNQA 3D50A 4K0OA 4OCSL 5AOZA 3CSYB 3MLSL 4MJIB 3UIZA 2P5EA 4XN8A 2GJRA 2TRHA 3EF7A 2X89A 3FFCA 2NSMA 1NC4A 1CGTA 4XZUB 5JNYA 4OFYD 2BSRB 4YDJA 5B38G 1FFOA 3S3DB 4CSSA 5B7EA 1V7MH 2R4SH 4FFZL 1SEQH 5ITBH 4MXWH 3D51A 5JORA 4ZW6A 4ZFOB 4CMMA 1D3CA 2JTDA 2Q9OA 4FL4C 1MELA 1P7BA 1J48A 2QVIA 3DIFB 5EO0B 1PX8A 4LLAA 4ICWA 5AWNL 1NWOA 2HLAA 1X44A 5AD0A 3P1VA 2OL3B 1FNGA 4JY4B 5ID1B 5LHDA 3HBGA 4ZPVB 4L29A 4MDIB 4GT7A 4M62H 5TE6L 1TIUA 1B4JH 1EZSA 3WJJA 4U4BA 3DYMA 3MJ7A 3OLIA 4OFKA 4OQTH 4JFOB 3KZ8A 4U7MA 3RVVD 1CCZA 4ODVH 3CFEB 3BUDA 2NW3A 5JDSB 1YNTF 5DUML 5KYNA 2NUPB 5ESVA 2AZUA 1S6NA 1TKWB 2KBGA 4GY4A 4MMYA 1UXMA 4UCFA 6CGTA 3C2AL 3MJ9A 1BQLL 5KSUA 3WFBL 1FFTB 1KG0B 2I85A 1NM9A 4RH4A 5GGTL 1I8KB 2ADIA 2X4PB 5GRUH 1GHFL 5B1KA 4AXWA 3GMLA 4OCMC 4NIKB 5ESAB 3UTTB 2SODB 3FT0A 1CN4A 3ESOA 5K9JH 4JO2H 3KLDA 4NENB 4LSTL 1X4YA 1WBZB 4TUKL 2OMUB 5FDWB 3AM8C 5JOFA 3B1UA 1IILE 1VPOH 4UAHA 2DYRB 2ZG2A 4JFPB 5F1NB 1AY1L 4L4JA 4L8SC 3H9SE 4JG0L 2ATKB 3NT0A 4N87A 1WZMA 2YQ3A 3MFFA 1SBSH 3UMTA 1SHXA 1L3NA 1KJ2B 2L0DA 4GRWF 3G6DH 4WI5A 4NZTH 2JKJA 2P44B 3CK0H 4AG4L 4JFDE 1SQMA 5SWZA 4PS3A 2VLME 3T6XA 4D0CA 1BVNP 4I48A 3QCVL 1UA3A 2VAJA 4JFFA 4JY6B 1RIVL 1YQVH 2JFCA 5I16A 3S48A 2DIJA 3X1NA 2YWYA 3VG9B 3UL4A 3NCJL 1XR8B 1JYXA 1R5IA 5KN5A 4X8GA 5IB1B 5FGCB 4JDVB 1MW2A 5FOBB 2JI1A 2VLKA 1CDIA 3P4OB 4PB0H 3OJDB 4KJYB 4J3OH 3TFKC 1MIMH 1D6EA 1BZ9B 2GPZA 3CCHB 1T1WB 4HC1L 1EWHA 2FHCA 4N8VA 5T3XL 1UH2A 2C3VA 2WUCH 5F3HB 3ZT5A 1SUHA 1U8MB 1LQBC 2VL4A 4I85A 3TVMA 3ZXAC 1WISA 1Z3GL 2Y69B 4FQLH 1PD6A 1I3RA 2JIXB 3CFBB 1GZHC 4F8PA 1BD2B 2Q1EA 4K3GA 4PRAB 2J55A 2QT6A 4W9GC 2HTLD 4I0PD 2QSCL 2VW4A 3HNVH 4JE0A 4CC4C 4LKCA 3IDUA 3LDBB 5C9JA 2JVUA 2X6CA 2H1XA 5DTFB 2FLRT 1CYGA 2AXGA 1MNUL 4ZYKA 4G9DA 4ANKA 1HH6B 3LZOA 1R75A 4XMTA 4PTTA 1DQMH 5E7BA 1BQRA 3EDFA 5EIQA 3SODB 2BINA 5T33L 1WT5A 1ADQL 1H15A 3EGDB 4DUWA 4MB5A 1EHNA 4KDWA 1D7BA 3GF8A 4AGNA 2AV7B 2MFNA 1XXDC 1KCUH 1NL0L 2JJSA 2YOAA 5DFTA 1CL7H 1OTTC 4KRMB 4W9ZA 1GH7A 2XWCA 1NMAH 3U6RA 5B1BB 1SYSA 2VMFA 4WTXA 2Y6SD 2WVSA 4FTVB 4HX1A 5AW4B 1RL1A 5IROD 4X0KA 5E9DE 5LBSL 1XCTB 5KUMA 2XZZA 1DSFL 2RH0A 4WTZG 2ZYIA 2NY1C 4NM4H 4PIBA 4Z7OB 3I02B 4P2RE 1I82A 4AH2A 3QDAA 5KSBA 5E7FA 4NRYA 2HTKC 4NUJA 1CFVL 1HTYA 1ZVSA 4IEFA 3FH5A 1ZV9A 3GSRB 4AWJC 1MHHB 1XSJA 3AY4C 2R51A 2YEVB 3BGAA 3LRSB 2ZOKA 5C09B 3FJTA 3N06B 2A9ML 4MMXC 3U0WL 4NO0D 3U0PB 3GMRB 4R0LC 4D7BA 1NCIA 1IBHA 4LCCA 4DPAX 1KN2H 3GI9L 4XR8C 1RIHH 4PJDA 3SE9H 1GGYA 1RHHB 1BYPA 3S98A 2IAMC 4HXAH 4XNAA 2DEXX 3DVIA 3I6KB 4WUUD 1T0MB 3DI2B 5E1GA 2VLJB 3D18A 4PP1D 3IGKA 4IKNA 3X11B 5IMKB 4J3SA 4M43L 2CLRA 3LS5L 4XOCA 2IALB 5AZEL 4Q4IA 2CDEB 2VC2H 5IHUH 3V9EA 3V55A 5FO7B 2WJ5A 2AK1L 5J1TC 4GI6A 1C16B 5BS0D 3BPLB 3HE6B 4GRLA 4PJIE 4ZTPL 5E8EA 3HR6A 3GSUA 2COVD 2BMKB 1A25A 1CIUA 1QRNE 1NJ9B 2YA2A 5E2UH 5IQNA 5TF1L 2C9XA 3SKMB 4YBQD 1A6ZB 5E5MB 3H9SA 3SQBB 4E0RB 5IHHA 5PAZA 1U4EA 4OGQC 1H5BC 1JUFA 2MNJB 3MO1B 3TXAA 3VCLA 4HUCA 5A2CA 4OCYH 3L95A 4ZW7A 5CEZH 5GGRA 1UQSA 3PRZA 4UQAA 2F7QA 2Z92A 2NMSA 3SE4C 3B2VL 4AC4A 3R0NA 4AGOA 4DP4X 3Q1SH 2XQYG 5FGCE 4Q9BA 4H88H 2ZUUA 4ADJA 2UWEB 4WWKB 1ZVSB 5FA3B 2YS4A 3DX9A 5E9DD 5C07D 3VSTA 2YGQA 1MCHA 4YSOA 3AB0C 3FUJA 4IRSD 4BWUA 3ZRFC 2BS9A 1SJXA 4BE5A 4LPCA 1LP9E 3T1WA 1ULVA 1KCRH 3PGFL 4MXVE 2EUXA 1J0JA 1MFCL 3L1OH 3QORB 2ZXAA 4G5ZL 3HIZA 4J2QA 5CEXB 1YEEL 1BV8A 5T1MA 5GGSY 5I73B 4ELMF 2G5RA 1K2DB 4C58B 2DKMA 2Q3XA 2PP8A 3N40P 4TNVF 1UA6H 4FHBD 2VR6A 4ZUWB 1U21A 1CG9A 1TCMA 4IKKA 2UWEE 1CO1A 4KRLB 4OTXL 2FX7H 3QZPA 1J8HD 4IIZA 4HCRA 3OKEA 5AKRA 3O11B 2IXQA 3GEWB 1FAKT 3CDFA 4G9DB 5D1ZA 1HIMH 1YDPA 3HZYB 5DJ0A 2R9HD 2ZKHL 3UYPA 1JZ2A 5ACMA 1NBZB 4HETA 2YSSB 1MI5E 3V7AE 4N6RB 2Q6WB 3IWVA 5CCKL 4ZDHA 4L5FE 2A99A 4UOJA 3T08A 5ADOL 4OF8A 5KS9B 2WWMC 2JJTC 3B1TA 4A55A 3US9A 3R4RA 5F0JB 5F9OH 3WXWH 4BFBD 4DO5A 1PZCA 1HHIA 2NXYB 3MO1A 1QLRB 2YN3A 3C09C 1OAYH 2WWKT 1G7MA 4P4KD 4ODTL 1RZKH 1P6WA 4PJ5B 4D9LL 4QJ5B 2GVYA 3QEUB 4PJDE 2VDOH 3VFNA 1T3FB 4EIZC 4HWBL 1Z3RA 3R8QA 4OF7A 1DBJL 4PJHB 1EFXB 3JWDC 4NC0B 4WWID 3MTXA 3DUUB 4WTQA 3GBNL 3T77B 3MCKB 4BFOA 5SX4I 1JZ3A 3GIZH 4M7JH 1RZIA 2BPBA 5SV3A 4RGOH 1DQTA 1ETJA 3T3PB 2F1EA 1FHNA 2DZEA 2QVFB 4HKZB 4PEEA 4IBLT 3DGGA 3O6LL 1KBGL 1J5OL 1WA0X 5I26A 3MCKA 2P5WA 1QBBA 1SEBA 1SUJA 1PYWA 3B9VA 5FCSH 3VXTB 1TZHB 1CICB 4BGDA 3L45A 3HCVA 1T0MA 4CU8A 1OQOA 1CBJA 4M7ZC 1Q0EA 2YRPA 5FKPA 5J4MA 3S3SA 2WO3B 1W72L 4JG1H 1UZGA 2BVTA 3MBEB 1CF1A 4AEEA 1AD9A 1TO5A 2F18A 4MB4A 4G71B 3HI6H 4W6YB 1A3RH 2DWXA 2L04A 5I1JL 1AQKL 4QHUB 3GFUA 4UQ2B 1R5VA 4BKTC 1I7RA 1YMMB 4UMSA 2LT9A 5GS3A 3BP6B 3OZ9H 4NP4L 1RZGA 3T3PE 3BMVA 1S7WB 3ZIYA 2IIJA 2N56A 2YR3A 1MSPA 2BOBA 4PBDA 5AG9A 1KB9K 4YDZA 2YSSA 5I1EH 5CGYD 4P5TB 4XMKH 3D30A 4P46A 3GSXA 3ISRA 1N6UA 3QIUB 2WNXA 4GAGL 1GW6A 2G60L 3K71A 1D2PA 2BRQA 4M00A 2BS8A 4UT6L 3B9KC 4JANB 1FNGB 3C8DA 4ALAH 2YPVH 5K93A 3U4KA 4OM1L 1MDAA 3FTGA 4HLZH 4EN3A 2AK4B 2XJLA 5TPWH 4G80A 1R5WB 5MEOA 2Y06H 3CPLA 4JHBA 2OSYA 4HF5L 1AGFA 2RJMA 2FGZA 4OFPA 2Z4QB 4JR9H 3TBCA 4JPVL 1FPTL 4B0MM 2Y25A 4E9QA 2OMTA 4AK1A 3L9EA 3MRPB 4WV1A 2J1YA 5T5FH 1OVZA 2B59A 2GTZB 1I8IA 4HT1H 2FEEL 2PYFA 2WYTA 5LJYH 1GPOL 2F7OA 4MMXA 4R4FH 4QF1A 5CR1A 3HZMA 4OLVH 3QGVA 4FNPA 3O6FB 1HDMB 3FF7A 2X0WA 4MA7H 3QG7L 4NHUA 4PJDF 2IH8A 3CSYA 3E0GA 3OGOE 2OR7A 3WKPA 5J57B 3VFVB 3VYOA 4JY5H 2Y3NA 2VDMH 3MJ8A 3CUPA 2YGOA 1WE5A 4NQDA 1W0YT 1UM6H 2GTQA 2G2PA 4XPBL 1IL1A 1NINA 2VQTA 3D39E 3HE7D 3O6MH 5JYLA 5KJRL 1B0GB 1FN4A 3PE9A 4HQQH 1LNUB 4PRPA 4UQ9A 3VFWA 5C0DA 3BKYL 4JLRA 4XNBA 4ZUTB 3P4OA 2WLIB 4FXGB 1EA9C 1K8DA 4YLCA 4LAQH 5EU6E 4LCCC 1ZT4A 1KXTB 3SY0B 1JZDC 4EN2A 3CDGA 3V7AG 3QIBA 5FM4A 1GC1C 2QADC 2IGTA 5JW4Q 1E50A 1E4KA 4X9BA 3G9AB 1P4LA 4ATWA 1ZT4B 1LDPL 5LNDA 1GSKA 2D7QA 1HI6A 2OMXA 5TH2A 4J2XA 1G7LB 4Q6IB 1D5BB 3OC8A 3MXVH 4RSVA 1XSKA 4LSQL 4W9JC 3WHXA 3PXLA 2YXWA 1LQSR 4OZGF 1Z7JA 2XWRA 1N70A 4CMHC 3KGUA 1KGUA 3L3KB 4L1DA 5DFAA 2E76C 4C4KO 4Q56A 3IGUA 2AVFA 4NM8H 2IFGA 5FM5M 3JTTA 2D2OA 2Q8AL 3DSNA 3E3QC 3WAJA 1CR9L 1NAMH 3N42B 3QHZH 2C3GA 1S5HA 2RHEA 4PD4K 5IQLA 3KWTA 4G42B 1EO8H 2D31B 2AJVH 1SHSA 3ZDXF 3CXHJ 3FKUS 2WBJD 2UZIL 3NIFF 4HPYL 4S1RH 5IG7A 3LHAA 3LH9A 4GP8B 2CK0L 3CGTA 2Y22A 3RUGE 4PWKA 4GKLA 1VFAB 2W07B 1LE5A 4D3CL 5KOVC 3NCYP 2XN9B 2AGJL 2OXGB 2ZOTA 4B96A 4DZBB 3ASWA 2VR7A 4HUWA 4PJGB 1KB3A 5EEZA 3PJSA 4KNSA 2XV2A 3KPRD 2Y7QA 5DZPA 3HBQA 1IC4L 3DMMB 1C12A 2CHDA 1Z5HA 4MJ6B 3U6RB 5EUOE 3QIBB 3ZDXB 3MZTA 1KTKE 4JY6A 1KZQA 3BDYH 1BBJB 5HHME 4YSDA 3UPAA 4HUWB 3WBDA 3MGTB 5AW9B 4WJKB 3HFFA 4IBZA 3WE6A 3ZRSA 1NIBA 5CLWA 4LHQB 3WV0A 5I24A 1QBLH 1G1KA 2BY3A 3SPIA 1B4LA 4PGJA 1WG3A 2FT6A 1IEAB 4ELDA 1KPUB 4GKSA 5EBMA 5GISL 2RD0A 4ZAKB 4U1LA 2VDNB 2WIMA 4OT1H 1OP3H 1WD8A 4I18B 2BIMA 2QKIC 4OGYL 4UIKH 1MAMH 2CPCA 3C5SB 5FYKH 5BOJA 4WFED 4QRUB 5CBAB 5HPMB 2H32B 2H9GA 3GXNA 3QULA 4P46D 3WIIH 2I26N 3QC5X 3CDZA 4M1GH 5EBWA 4XO3A 3WFZA 1AHWA 2P5WD 3BI9X 3MBWA 2CJ3A 2J5WA 5IVXA 3VD9A 3MLYL 1QHOA 4PJFA 5SWSA 5L8JB 3MDJA 4ZS7L 3UH8A 1NCCH 4XB7A 2XUWA 5D7IE 3GWJA 1CZ8L 5G4NA 3U7AA 2BVPB 1DUYA 5BNXD 4MHHG 1I1YA 5CNHA 4POZD 5DQJB 5DO2D 1IBDA 3FUMA 4ZUUB 2R29L 4P07A 5C0CD 4I4WA 5CN1A 2A6JB 2R0ZH 4BUGA 1TVDA 4L5FL 3IU3B 4LU5H 4Y4HC 3ABZA 3EFOA 5EG6C 4LL1A 1EUTA 4PRPE 4XMWA 1WTGT 4ISVB 3RURA 2OLDA 5ANHA 3CX5J 5G4OA 4PIRF 2CRIA 4KVNL 2ICES 4PVLA 1VJSA 4L3EE 5I1HH 1RKRA 3MCLH 3LCYA 1CGSL 4MQXC 3VWKB 4PWHA 2XNAA 25C8H 4MA3B 4LDCA 4NLAA 3TM6A 1NFKA 1DN0B 1MI5B 1ZXKA 2EXSA 5BS0E 3DPBA 3S6CA 4PBWD 5LAXB 1YMHA 1FFRA 4H5SB 5L8KB 4JPKH 1QPPA 5JZ7C 5TE4L 4GMTH 1OAJA 2ICEC 3NFPB 4K73A 1LK3H 2BOLA 2DJSA 3MUY1 3QG6B 5DD1H 4FJ6A 1IZJA 3CD4A 4I87A 4YSTA 4X6FA 1KLGB 1LO0H 4QXTA 3O81A 2WLYA 2XV6B 1M1XA 5DMYA 3IDIA 43C9A 2CRZA 4PJEA 5EUKA 1I85C 1M6UA 5DI8B 2UXGA 4HK3J 3ALPA 4XP9L 4ZQKA 3UG4A 1JTPA 4YH6A 2XG5A 4MNGB 2IOIA 2FH6A 4WFEE 2NUTA 5IOPB 2JJTA 5KVGE 4ODXA 3T6WA 8FABA 4JGUA 2MOQA 4XVJH 5IJVA 2BC4A 2CDGA 3FQTB 1JZ7A 2BSSA 3V6OC 1JZJA 1IFHL 3OPUA 4M5SA 3DYOA 4K94H 1HXYB 5HHXH 2VIRA 5EH1A 2C9VA 4FMKA 2WCPA 4C4UA 3QFJE 3BAJA 4J3BA 1FSKB 2GT9B 3MNZA 5C7ZA 2DMCA 1NAKH 2WHVA 4EN3C 3ZDYF 5B4MC 3DVFA 3WKYA 5HI4D 4EUPA 1FIGL 3A47A 1YNKL 2EDRA 3I3DA 4L4TD 1OM9A 3Q5OA 4UQ3B 1XH3B 1SHMA 5B38A 5I1IH 2OULB 2J8OA 2AABL 1SVZA 1JWMA 2X89D 4MVBD 4X4MA 4FAAB 2BP0A 2EABA 5DLLA 3MROA 1CU4L 1REIA 3GUFA 2IBZX 3WMQA 1EO7A 5TE4H 2HZHA 1JUFB 1NBYB 1EZVX 2CCLA 2JCWA 2DQIL 4J4PA 2WXPA 1AD9B 3U4AA 4QXGH 3UAEA 3DX8A 3KPLB 3KPRA 4J8QA 3GM8A 2IBGA 4JHZA 3C9NB 3FW6A 3QPKA 4FULA 5FIEA 4WFGE 3LXCA 4GG8B 4GW4B 4KI5F 4TM9A 3A6BL 4X99A 4Y1AD 5JPNB 4LKXA 4OVVA 4JFED 1FNAA 1U3HD 2QVKA 2DM3A 4YAQB 2B77A 3L5XH 4ZODA 4YSSA 5I18H 1NA8A 3DARA 4M7LH 5KYYB 4Q97A 1TQCC 5SWZD 3MRRA 3QPXL 4V1DE 1TQVA 3LN4A 3SKNA 5IJCC 1U8KA 3G5YA 1ZK9A 4JFUA 5HYJB 3ROOB 3FU6A 2QGEA 3QIUA 2AQ2A 3IDYB 4UT9H 3VXNB 2PCYA 2WXQA 3SIKA 1AZNA 5CGBA 1GC1H 3EHBC 3WN5C 4B97A 3GNMH 1B4RA 5KBPA 3QO0A 2FB4H 1IBZA 5H37H 2QV4A 5I1LA 2GJZB 1LM8V 4Z7UE 3V4PB 4YO0B 4GH7B 1MW3A 4UM8A 3NFNB 3EZJB 1KTJA 1C5CL 1W0WB 4XPFL 4J1UA 3UAJA 3STZA 1QQDB 1VFMA 4NRZB 1EHLH 2FNWA 2WBJA 3E38A 1Z1WA 1XH2A 1ZY9A 1FL5A 4QHNB 4K55A 4MZRA 1AR1B 2Z0UA 1KOAA 4WZ9A 3L95B 2Z1PA 2VDQL 5FDYA 9CGTA 3ECBA 3FHEA 4HSAC 2GC7C 4JDEA 1NIFA 1X5IA 2Y6TE 3C08H 3MV8D 4A38A 4EXPX 1XCQA 1N26A 1N4XH 4JL1A 4NP9A 1YMME 1T2JA 1QBLL 3QUYC 4U1MB 1NSNL 5D93B 4BDVB 3VX0A 1T7XA 3FU0A 5BMFH 1G7JB 3TWYA 5AUMB 1NCWL 3HHSA 3O9WD 4M8RA 2GJJA 4X7DC 4BKSC 1SQ2N 2YGNA 4LKXB 3T77A 3R1GL 2XXMB 5ICZA 1PLCA 1B4TA 2CDEA 5ALBL 3B2UC 1YPZF 4F9PA 5GS2D 2ALWA 5CEXA 3VFTB 4YSUA 3QIWB 4LOEA 2AXGB 2WWMD 1ZLUK 2HJFB 5AOIA 3PP4H 1JGUH 2PO6D 1JZGA 5D1ZI 3EO9H 4WI0A 1W91A 4CBPA 1J0ZA 1YEKH 4U1SA 5AYUH 3TA3C 4HUVA 5SWZE 3NP4A 1OXYA 3OAUH 5IR1A 4O2CA 2R27A 5I1AA 1OOWA 4NQED 1A8ZA 4JZNA 2MCPL 2BNRD 1U8HA 5K9QI 5EZOL 1HH9A 2DQMA 4EIBA 1BMZA 4PR5A 5D6CB 2ZPKH 1YPZB 4N4YB 4BH7A 1SGKA 4P59H 2HT2D 3B5GA 1INDL 2VXQH 3QW9A 1VZGA 5C0FA 5I17B 3QZWG 5I9QB 4ZX6A 3BQUD 5E1QA 4NDMA 5A2FA 4JQXC 1B90A 3GQFA 2NYKA 3BGMA 3OB0H 3PJLA 4X0KB 4EDWH 3VXUB 1QLEL 1WWCA 1RUPL 5AVRB 3BE1L 2M2DA 4RX4A 3LXBA 1Q1PA 4G8GB 4D9QD 4CVZB 1IO4C 5JIHA 4CNIB 5C86A 5LBVA 1Q9WA 3OKOB 4RWYH 2G5BB 4BFJA 1PZ2A 2ROYA 5F93C 4HAKA 2QQKL 3R06A 4M93B 5AVZB 4RRPA 3WNNA 2AKRB 2HFEA 1XCQB 1YZZA 4NUQA 1NMCC 4GRLD 5I75C 5L88H 5HYSG 4G83A 1GGBH 2ENYA 3HG1E 4NKMB 2WBXA 2WM0A 1SJHB 1MJ7L 5E94B 4DJMA 3IDXH 4ILDA 1QFOA 1BZ8A 4QRRB 3S9DB 3BEVA 3DRQA 3UTTA 1QLRA 4JRWA 3ZTNL 1A6UL 1WF5A 4H5SA 1D9KB 2BIIA 3BKYH 5CIPH 4WHCA 3GJFK 2CBMA 3B6SA 3FU3A 4ABWA 4IOIA 4BFNA 3TIDB 2XHNA 1RUAL 5AOJA 4PJBF 2DMHA 4GXVH 5IW1B 3KH4A 4KROB 5DJ2A 5FWRA 4M6MH 3DUHA 3CJJA 3D34A 2ADFL 1L9QA 5C0CA 3JTSB 3BWUC 1ZAGA 2MPVA 2CKBH 3NSFA 5D1QD 3QG7H 4HK3N 3MJGX 3SKMA 2AJYH 5JXEA 1T0PB 3NZHH 4OLVL 1GPOH 2HG0A 3ARSA 5FO9B 1TQTA 2MJWA 1LWRA 3RKPA 3TYFB 5KTEL 4WAFA 1TVHA 1BZQK 4N24A 2QJDA 2HXAA 2A9AA 1BZEA 4IBVA 1CDGA 3ULAB 1I1AA 1X6NA 3T0EB 3ZRCC 4XMXA 2XBTA 3A4AA 3U79A 3ALWA 4QCIA 3VH8G 4CVZA 4YC2C 1T20A 3WDHA 2XA8L 4KXAA 2I60H 2W94A 1IAOB 2HPOA 1D7FA 1MRFL 1ZIAA 2CXGA 5IVXB 4X4XA 1OTSD 3VI3E 2DQDL 43CAA 5HI5C 5EHFA 3K91A 4JHWH 4H8VA 1A9BA 4E36A 4RA0C 4LPYA 1FORH 3QWNA 1FL6B 5TK4A 5C3LD 2ZG3A 4I18A 1RZJL 1I3GH 2Q5BA 1E5CA 1YNTA 2XCMC 2XN9D 3VXSD 2DV6A 3JYCA 4H1LH 2WCSA 5HYSA 4JFWA 2J12B 3UABA 3EG9A 3RZCD 2WC7A 4XCEA 4XP6H 5AW5B 4N2DA 3B4NA 3QEQA 5BZZA 1U8MA 3AMKA 5I1JH 3MXWH 4KOCA 1M05B 3IJ8A 1RZ7L 3WIHL 3GB7A 1ZT1B 2DMKA 2H7WA 3PAYA 4FNRA 3OX8B 1F5WA 1UCBH 2EZ0C 1CIDA 4E9XA 5CKAA 3W38A 1R5IB 1J5HA 4PG2C 5HHPB 1PJWA 5J3HC 4LLDB 1OP5H 2I25N 3S0PA 3BKML 2E9GA 4HBCL 4LASL 4D9RD 1F4AA 4P4RA 1JGDB 1WGVA 1DQLH 3DIFA 3LRGA 3OF6A 4QOKD 3MX0B 4JJ5A 4OLZH 4URKA 4G7SB 43C9B 4PB9H 3QZWA 3NPSB 5CLZA 1HL9A 1LE5B 1MQ8A 1WHOA 3SDXB 4ZNCD 5T5NF 1L9PA 2WLLA 3GIZL 4M7JL 2F1BA 3ULVH 2E0PA 3CAFA 1YJDH 4GMSH 4JRXD 4RAUA 4ZMNA 2J57A 3KLAB 3ZYJA 5T1KD 2XKSA 3WFDH 4OLXL 4LHUB 2EDQA 3S35H 1TPXB 3I6KA 4KV5F 3QH3A 1KIRB 3LZLA 4PRNA 4XBMA 3U30B 2FK9A 4H4NA 3U7WL 2YA1A 4JMNA 3K2UH 5DZJA 1F11B 3EO0B 3GMPB 3DPBB 1DBAL 1DSYA 2ZYHA 5KSAD 5I6LA 2NNXA 4ZJ9A 3JTTB 1W8OA 3II1A 3QXUA 5K39A 2PPDA 5DRXB 3QJUB 1TVBA 1A64A 4LHUA 5JUEH 4DAGH 3RIAF 1BFOA 2D9CA 2DLGA 4L3AA 2YD8A 2CR3A 2ADIB 2X4PA 1TTRA 3II3A 5K1VA 1OAZL 1SFHA 5SWQB 2E7MA 5ID0A 1CWVA 1X5XA 4R7XA 3VFGH 2NNCA 1XO8A 3OR6A 3CNKA 1J0KA 4JM2C 4F8NA 5F7AA 5FFGA 1JZ6A 3MLUH 2XQYA 5C0ND 1S9XB 4IMKC 4C56D 4PW9A 3X12A 4LSPH 1VADB 4APQC 1DJYA 1QR4A 5AW6B 4KKBD 5K9QG 2DDQH 2YD9A 1CXHA 1M53A 3I2CH 2F5BH 1E8YA 3BPCA 4R0LA 5F7EH 1BX2B 4PJAE 3PNWB 4AX3A 1U8LA 5ADPL 5E2VL 2QELA 3QCUL 5AD0B 4R7NA 2JKWA 4X6CE 3TV3H 2D3NA 4M5YL 3RL2B 5DUPH 3JVGA 5J6SA 3U9PH 5ACZA 5DMKB 5IW3A 1MUJA 4FQ1L 1MW0A 1NPUA 2VDRH 2J43A 3N50A 4LB8A 3LX9A 1MWAA 4DIXA 3V6ZB 4KK5C 4ZSOA 2H3XC 4MD0A 4AYGA 3LKPA 4FYSA 2B7DT 4LSSH 1KJ3H 2FWOB 4JFDA 3OL2A 3C8KA 1KYUA 5B1CA 4Y7MA 5CLXA 3WFHB 1EIBA 1XHHA 4NUGH 2HVBA 4KK6D 1I1FA 3RX9A 5IUCA 1I8KA 4AXWB 4FQ2H 4K7PX 2JJSC 1CF8L 3GSNB 4HDIB 1IQDB 1BD2A 1EZLA 3Q48A 1IAIH 1I85A 2WB7A 3LQAH 4JO1H 3C5ZD 1YA5A 3O9WC 2W60B 3SO3B 4WV1C 3ML8A 3OKKA 2C3VB 2WZPA 4XMPL 2K78A 3LB6C 5T1LB 3AC0A 4BFIB 5CEZL 4KMTH 5KW9H 3JVFC 3PY9A 1GSMA 4JFHD 3M88A 3HE7C 3TBVA 4QXUL 1PLGH 4I9XA 2JSFA 5GGQH 5F1IB 4G6MH 1K5NB 2Z0BA 5F88A 5ILTL 3SDCC 4NC2B 1MDTA 2NYZA 2XTJB 1GIGL 3PV6B 1JZFA 1NGWB 4CADB 2YD0A 5EUOB 2F15A 2IGLA 1A6PA 1YY8A 4IIQB 5DA4A 2FQFA 3RWIB 3BHBB 3UYRH 3EGXB 2X4UB 4ZQKB 4KKLC 4KX9A 3VGEA 2CO3A 1CBVH 3MREA 3QA3B 3WO4C 3AREC 3GGWA 1KWKA 3IN2A 4PUBH 2VM4A 2HKHL 1MCCA 2CG9X 3T4YA 4ZX4A 3FRPB 3QRLA 1B2YA 4N26A 4KUCF 2ZX9A 3JWNH 4M1CD 1S7TA 4V1DD 2A3TA 3RP1A 3S88H 4ZT1A 4QNPE 1FH5H 1X9RA 3BGFB 3CLEL 3KPOA 1G1OA 1OOAA 4LDOB 2X42A 4KTGA 2EAEA 1OB0A 3GXPA 3QDJA 1SDYA 4PGBB 1VFOA 2ZCHL 1Z9NA 2XWBA 3BWZA 3UCRA 2DW5A 4A2EA 2AKRA 2HFEB 2OMTB 1RSYA 5F3FA 1E28B 4YSCA 2WUBL 4PJ7F 1UG9A 3H0TB 3O4OB 3BFWA 5JXAL 2VR9A 4N2HA 2J8UB 5HJ3B 1KELH 2E3VA 5CD5D 1DTUA 4TLUA 4KK8C 5T1DH 2AK4A 3JWOL 4TQEL 4JQIA 3JV5A 2CHXA 2QMJA 3J8F7 3BD3A 2QL1A 4C83B 5LGKA 2EUZA 3TONA 3E1F1 4M61A 4D9RE 1NL0H 1XF2A 4FEMA 2ARJA 4LESA 1JRHI 3E6FB 4NUGL 4JLRB 2J88H 5FK9B 1L7TL 3D3VB 4XWOC 4F7TB 4JAMB 3ETTA 4L0YA 1BJ1J 3QQ3A 4FZ8L 2V2XB 1HAUA 1A4KA 3J7HA 5F7KC 4X98B 2GK0B 2WXKA 3BUYA 3TZVB 4A2FA 5E8PA 4P2OD 1Q0XL 3MPCA 3UPCA 5IB2A 3MLTB 5C07E 1UXLA 3BUTA 3U9PL 4W9FC 4NNXB 3T0VA 2XIIA 3UYPB 3HNVL 4X9IA 4FC3E 3RDTB 1HZHH 5FW7A 3VQ1C 1WK0A 3F7KA 4OY9A 4QRTB 4R8WH 3P0YL 4KQ0A 3M45A 1UGNA 3PLYA 4EPSA 4N90D 3O0LA 1M1SA 1WEJL 3WN6A 4TRPL 3SDAD 4OVUA 3F00A 7PAZA 2D03H 2VGLM 4EDXA 1Q72L 1SBBA 5IMOA 1DYZA 4H2CA 1RK1A 5CIPA 5BV7C 1QNZL 1DBBL 2B14A 3QPQD 4TV3A 3LPGA 1I7TA 2COQA 3WKQA 3OC5A 4E9RA 1EV2E 1OTSC 2AQ3A 4OFYA 4JCWA 4PS8A 3DJRA 1Y0LB 3D52A 4NN7B 4E42A 4YPGB 1JNJA 1CDBA 1A0QL 3F58H 4OUUA 1JRHH 4JRXA 4N5ED 3REWB 5G2NA 3W9DA 2V9TA 3GSXB 1WZ1H 3GSWA 3GXTA 4XNUL 1EDYA 1NCUA 4FN0A 5CILH 2V9UA 3ILPA 4O2EA 3ZE2E 3F7RA 3IVKB 1S9VB 1K9TA 3QEQB 5C70A 4QHLA 2OI9B 3KGSA 4UQDA 4L4VD 2NNFA 2ZF8A 4E5XA 4QTIL 1UWEH 2IH3A 5FYKE 5FUZL 3CUPB 3BLBA 3RHWK 1JF6A 4UM8B 5LN8A 4GMSL 1YEIH 4HUVB 2UY7A 4G7YH 3P0GB 4IRJD 1OSYA 4JO2L 4ODUA 5D7IB 4ZDHB 4F2ME 1HSAB 5KVDE 3HZMB 2R1WB 2ZSWA 1Z66A 3P3SA 3HZYA 4P9ML 4HYTB 2PYEB 3N9GH 3QI9B 1OM3L 3RLSA 1QPXA 3MV01 4G9FD 4BCYA 3B3IA 1G5AA 2V7HB 3L4UA 3Q8CA 2F08A 5CJOL 2WCGA 2C9QA 3LOWA 1UT1A 1A0QH 4M6OH 3WIHH 3KBHE 2HX7A 2OL3L 4JREC 4K9JA 4N9GA 1OAQL 3P11H 3LQZA 1I1AB 5DK2A 2O72A 4UM9B 4YSAA 4GG8A 2BM3A 4WWOA 1K2DA 1KCKA 1N12A 1G6RA 3PWUB 1CE1H 1U3JA 3VFPB 2IGFH 4KO5A 4L3EB 2H8PB 3E2HC 4AKPA 4F15C 4HPOH 5DJZA 4I9WE 4ONOA 2J8UE 5FEBA 1NKRA 5AWNH 3UJJL 5KJ7E 4FQXA 2DMGA 4L9LB 1CFQA 3LEVH 1EJFA 3IFOB 5D7IA 2ITEA 4NO3A 1CD9B 4JFDD 4Z3HA 4AMWA 4JRYA 1M2VB 4MXWL 4WU5B 5IVZA 1CFSB 4N0UB 5ENWA 4IOIB 3EJZD 3VVWA 1FQ9C 4IDLA 3CIQA 4AK2A 2JQZA 2KUTA 3P54A 1T66D 4PY8J 2NY6D 4XNMA 3B9KA 4ELKB 2EUWA 1OM3H 5F1KC 2FSEB 2VDMB 1GJIA 1A65A 2B08A 4NKMA 1FG2A 1AKJB 3PHQB 3UZVA 2CHNA 4N9OB 2O93L 3TLRA 3B37A 3OKEB 3HNSL 3SY6A 3KW7A 1A2YA 5IVXF 3GXUB 1HJBC 2H2PC 2F54D 4YN3A 5HGBB 4XNXH 1NUDA 4AYBA 3WY1A 4EKXA 1DO5A 1EAOA 1KLFA 2ARJQ 3QNZB 3UTTE 3LKQB 4WKZB 1NGPL 1WICA 1YYML 3C6LA 4G8GA 3STLA 3BFOA 1MCRA 3FB5A 2D0FA 2X38A 3C60A 5A7EA 1U8JA 1B2WH 1KBBA 1KYOK 1O9VA 2C9SA 1PZSA 4QYAA 5FYJE 1SLUA 4B27A 1T1YB 2AERT 1CLOL 3QAQA 4WY7H 4LFHG 5I0DA 1F42A 3G6JB 3HB3D 4A1RA 1ZKAA 5BJTB 4XNZB 3RZCB 4AJWA 3F58L 4QMEA 4Z7QF 5GQBA 1TJXA 1ZVYA 5HGDA 5AAWC 2EYSA 4XI5D 4FKEA 5E5UB 1DQVA 1MI5A 3BJ91 1W8NA 1SNRA 2WXNA 1A7BA 1A4JA 3FUDA 5DD0H 1TTFA 2KL6A 3TN0C 3CN3A 4GBXC 2D03L 4AQ1C 4AEIH 4UQ2A 5DHVA 1RJYA 1HKLH 4PUBL 4Y16C 3ZDXE 3MFGB 4FLSA 1FO0L 4HISA 4TN9A 4UYPA 1DVYA 5FUCC 4RWYL 1GAFL 2X4NB 2VE6B 5EU6D 4JKWA 3ILPB 1YDPB 4O2EB 2WYIA 3TNMA 3VXMD 3KL5A 4FMVA 4GXFA 2ITFA 4DEPC 3L7FB 5C6PB 1T1YA 2EDKA 4WW1B 4A67A 1IKNA 5DQJA 5C7XH 4Q89A 1DVTA 4KDVA 5IJVB 3F12A 2X4TA 3LHPH 1GIGH 3C75A 2DYPB 4U3SA 4JB9H 2YD2A 3GSOA 4QRQA 1G1YA 5AUMA 3N85L 3NA4A 3FULA 1PCXA 3LKOA 2WJ7A 3LJ3A 5HHNA 4ZQTA 2R56L 4KC3B 3ZQ9A 2VR3A 2BZ7A 2J88L 4BQ8A 4PRDB 2XVLA 4AL8L 1BWMA 3W0WD 1CLZL 4MAYC 5SX4H 3ETBJ 4XPAL 1F6LL 1EHXA 4AEIL 2XDHA 4S1DC 1VFBB 1ZSDB 4YDVB 2QPFA 2LTQB 2X10A 2ZXEB 1U8IA 3MTRA 4QRUA 1NIEA 1G9MH 5IHLB 3DK0A 1ETA1 3T6VA 5I1CH 3O3BB 5FM5O 2B9AA 1RJLB 5F7DA 4TTDC 4GW1A 4F8QA 2QPUA 2VN6A 1HHKB 1KELL 3NAAL 2YAEA 4HWUA 3IBOA 4U1JB 4UILL 3KCWA 3R7QA 3V0JA 2WIIB 3AJ7A 5L2KA 1HYSD 4G9FA 3TH3T 1IBFA 1CYWA 1KJ3L 2H3KA 3B2XA 1ED3B 4R4NC 5DMGD 4LPXA 3MODL 4XVTL 1MHEB 4U6HA 1T1WA 1H0DA 4ZPTB 2IBZY 1NUFA 2IH1B 3EGXA 5ESQA 4FQIH 5EU7E 2RTTA 3CQFA 5E5MA 4Z6AT 2B1AL 4I0PC 1B2WL 2B0SL 5F6HI 1JDCA 1XCWA 1SYSB 2VDPB 5D1ZB 1AGDB 3IGAB 3TO4A 3ULVC 3A0OA 3QUGA 2VXSH 4DGUA 1ZLWH 1NFDB 5FO7A 1E3XA 1YEIL 4ZK8A 4F7PA 1L9NA 3KXFE 1IGYA 2OQJA 2XRAL 4YL9A 1EJ6A 2Y36L 1QBMH 1EXUA 1JPEA 2FBJL 2UY6A 4JRYD 4H8QA 1KCSL 2G0LA 4JVPA 2NR6A 2I9LB 3G6JF 4XO9A 3EYOA 4FRWA 1ONQA 2CNYA 4LOFA 3TASA 5K69A 3PREA 2XPZA 1E27B 4PS4H 4PCYA 1UM5L 3NIGF 1WBZA 1TT6A 1KULA 5DHVH 2FB4L 1O7DE 2UY7B 3RI5K 2W8CA 2P8LB 1N9PA 4LRIC 1QLFB 2XWZA 5I15H 3DJTA 3MBXH 4CRPA 2NQ3A 2EQDA 4P23C 5FA3A 4CILA 1U33A 4KMTL 3ZU8A 5KW9L 4F7TA 5KSUB 5C07B 2X4RA 3KS0J 3JV6A 1Q72H 5IVNA 2DQEH 2X05A 1BWWA 2WAQA 3FSOA 4U31A 4X7TB 1IAKA 2V5SA 2W1NA 3LNEA 1WEJH 2AAVA 4DEWA 4RZCA 3AS1A 1JP5A 2UZXA 5BQDA 3FUFA 2Y1VA 3P0YH 3QORD 4ZNEE 1JF5A 2FJHA 1N18A 5AFAA 1YCSA 1SN2A 2FO4A 4N1CA 5D7KE 3LN4B 3SKNB 1OSEA 3FTXA 5LVEA 1JNHA 1KB5B 1Q0XH 1TYEB 2E6QA 4FLOA 4P2QD 5BW7C 1KBPA 1LP9B 4GQZA 4HMEA 3I9AA 5F0LB 3V5HA 1UD5A 3FB8A 3OXSA 2GJ6E 3HMXL 4U7KA 2CLRB 3NCFB 3TEWA 1W6LA 2P80D 3MRGA 4MLIA 1K3IA 2ZYSA 3QS3A 2OYPA 1ZLDA 2BSRA 4N86A 3VXQA 3GHEH 4BRVA 5TDNB 5TGBB 3NFPA 1E4HA 5FKAB 2ZUVA 3IRPX 4HKBA 3EHBD 1S7TB 3S96B 3V4PH 5T3ZL 4X80L 5EIIG 5FUZH 4CVXB 1JTOA 2PO6B 4Z77A 2A9CA 2K7PA 3T4YB 2YBGA 2YXVA 4ONGL 4N0YH 4UU9B 4DUXA 1P53A 2X4SB 4HS6B 1IZKA 3FQWB 2WVUA 3SBRA 3KHQA 4LSUH 3CXDH 4NQEB 1UKTA 3B2UD 3B8YA 3B7UX 1T04A 2H0JA 2BNRB 3ZDZE 4Y1SA 2HUHA 4XVJL 4FA6A 3H2WA 3Q8EA 4N8PA 4BCZA 2VSKB 3OMAB 3ASOB 2F8IA 1FGVH 4JFOA 4JKPH 2AEIT 4N2LA 3NQIA 4KTDL 3DGDA 5JUEL 1X5HA 3HC4L 3RKDD 4LBEB 2OTWB 3C6LD 1LLAA 4FTVA 4HX1B 1LO0L 1EH9A 3K2UL 5CM1A 1RMFL 3VGAB 5DQ9A 3FUKA 1QNZH 1RK0A 2WY3B 3AAZA 3W0WA 4PWFA 3ALXA 2UYLB 4MZ3A 1TR7A 2O5YL 1QSEA 1FVDA 2F74B 2V7NB 3LZNA 2IANE 3MNVA 2O1AA 2R4RL 4FI6A 2Y36H 4Q6YA 4HUXB 4PTUA 5I76A 3ULVL 2J6WA 2VXSL 1V3MA 3IXAB 5A6IA 1B0GA 3BWUF 3FUEA 4L8DB 3P9LB 3IFNL 1CGSH 5FFOA 5C0BB 1OZUA 3HZKB 1HOCB 1IVTA 1M6OA 2Z34A 2V6HA 2YMOA 2OAAA 2AI0L 5KYWA 2PKDA 3GIVB 4L1SA 4L9DA 4MCZB 4R2GC 5DZOA 4EKJA 5ILTH 1UXSB 3OJMB 3MOAH 2NT1A 3CH1B 2GSIB 4WI9A 2CA4A 4KJPD 3MXWL 2IO5A 3QWOB 3OLDA 4F8LA 4KZEH 1L5GA 3N04A 4RAUB 2ZJSL 3DGGB 2W5PA 4ELMA 3BZEA 1G0XA 5LNEA 1G9ML 3MRLB 3OJDA 5GRJL 3ZJAA 3MCYA 1YY8B 5A2IH 3S5YA 3QNFA 3AG2B 1TFPA 1XZ0B 2D7MA 3ZE2F 2WKOF 1DSWA 5D1QB 1GY1A 4X9HA 4YBLC 5E2JA 2Y1YA 4OR1A 3UTSA 5GPRA 1JVKA 3FH7A 3QFJB 3RU8H 2OMYB 4A68A 2FJFA 3BX7C 3FZUD 3BPOC 3JTBA 5D4JA 2CDFB 3VG0H 5DEGB 3FK3A 2EH7L 3FQNB 4AJYV 2XY2A 2FX8H 2JXMA 1LMIA 5ID0B 3SPJA 3JSSA 5LGJA 3KYNB 2VOTA 3MA9L 3L3IA 1CE6A 1QTYT 1BEYL 2ZWLT 1XF3A 3MFFB 4IOFD 4FNLH 4AUYA 3TTSA 1U95B 4PCTA 4KDTA 3GDBA 1HWWA 2VITA 3SDDB 5CD3A 4TTGA 4QXWA 3QCUH 5IROC 1R5VB 1UB5B 4K7PH 4NWUH 1OAXL 4ANUA 2XACC 1YEHL 3C8KB 3VGBA 3WAKA 3KVPA 3U48A 1CURA 5J06A 4LEOA 3FN0H 4UM9D 5HGAB 2XI9A 4GKNB 4L3CB 4ZMYA 2XC8A 3ZR5A 4M6ML 1W2KT 4F9PC 2F9BT 1F56A 2O5NA 4TQPA 3A6OA 1J11A 1UZ6E 1G7HB 3FT3B 1XCXA 4HKZA 4WJ5B 1MHCB 4GRMA 3VVVA 2HT3C 3GRGA 3X14A 3OHXB 1RAMA 1JPTL 3N1QC 4FA7B 4ZXBA 2G9KA 5BZDA 1KTLA 3VI4F 4GAYB 1AG0A 2AJSL 4F57L 1T3FA 4XMPH 2DBLH 3VGGA 5GZNA 2HMID 4GAAA 4RZCB 5ISZB 1P7HL 2WQUA 5GGSA 2FO8A 2QR0B 2DIEA 5KG9B 4LRIA 2BRRH 2UZYB 4XCEB 1P2CB 3TIEA 5F9JA 4BH7B 1QI3A 2J1XA 3MR9B 2F58H 4P57B 4OI8A 4B9JA 1LO2L 2FH8A 2J8HA 5LXVA 4XXDA 1A6WH 2XV3A 5DMJB 3MXVL 2XFXA 5GGRB 3QVAA 1JPFA 1T6WA 2ITDB 2WZPD 4R97C 3CZFA 4JFXA 5L2JA 2HRLA 5D5ME 3T65B 3H9HA 3WUWA 3D85D 3KH3A 4IDJL 1I8IB 3V52L 3T1FA 5DS8B 9PCYA 5EO1B 4FTVD 1T89A 1ZHBA 3OKDA 4HULB 1AFVH 5F7FA 2Q76A 2QFPA 3TV3L 5ISZE 1QVOB 1WQVT 3FCSB 4XMZA 4U1KA 3TFKD 5EZOH 1X7SA 2X2JA 3LRKA 1SXSA 5D7IF 3TWCH 3ETBF 4GQRA 1PCSA 4P4RB 4JUSA 5KANG 3UJJH 5KSAC 5FWQA 2NXZB 3O6ML 5I6PA 1RZJH 3UJIH 1HXMB 1VF5C 4NO0B 2BVYA 4AKQA 5JQHC 4H20L 3EYSH 3KVQA 3A6BH 1YEDA 3T8XA 3UEQA 5FYJD 1CFBA 3DRTB 4IGBD 1I9IL 4PJ7A 2BWIA 1DANU 2XTSA 4GLRI 4PJGE 1KGIA 1IAKB 1RK7A 1QEWA 4X5LA 1IGFH 1W80A 3FCBA 4UNTA 1AI1L 5INCA 3N2JA 1HOEA 4KQ3L 4R26H 3GSRA 1NCGA 3B6SB 5C3IA 3IK2A 4JFHE 3SYPA 3NGBB 3I6GA 4NN5B 2AQNA 2WYHA 3QJHB 3TC9A 3U7WH 1E30A 4JZJB 4K5PA 1NSNH 4L4TA 3UTSE 2EXYD 1ZIBA 3NZUA 1JZEA 1A7NL 2WQSA 1MEXL 3NCYS 4XRCB 5IKCB 2BSEA 2OMWA 1BZDA 3JV4B 1GYAA 3CX2A 3NZHL 2N1KA 2BK8A 1X5KA 1W0VB 3MKKA 2FLBT 2AEPH 5DJ6A 2NR6C 3HFML 4FJZA 1MCBA 3QUXD 4F93B 4XB3A 2OBGA 2JB6B 5ABAA 1V54B 4M9PA 2JJVA 5I1EL 5T1LD 2EXTA 2P42B 3T0EA 4XAKD 4F7PB 5IK3A 2YJLA 2CUIA 1U0QA 2VZVA 1JRHL 5HYIA 4J23A 3OZ9L 3VD3A 3VXRE 5IBUG 3WFEH 1PKQB 1TQBC 4OB5H 1BW8A 2JKXA 4KGLA 2APVA 4XP6L 2NLJA 3S3PA 1KMGA 1NBYA 1IT9H 3K6FA 1MXGA 3FSWA 3HS0A 1DBBH 4NNPH 1Y6KR 1UB6A 4YXKH 4XRCA 4YHYC 5IKCA 3DBSA 4UV7H 1O6TA 1F2QA 4P9HL 5DGQA 2NXYC 2QQKH 1L9RA 3QUMA 4NCC1 2WYZA 4ZTOH 2JKSA 3NEOA 3ZOAA 5MEQA 1NZRA 3VXSE 3OKMA 4BWWA 1I3RB 2JIXA 2IANA 2VMJA 1VEOA 1X5MA 4UANA 2EXWD 2GSMB 4PYGA 5GHWL 3UO8B 1SDDB 1H3TA 1HZHL 3RRQA 1J5OH 3RWGB 3Q9QA 1SYVA 3RJDA 3ZHDA 4KPHL 1XF2B 1T4KA 1H9VA 4HZLA 4ACTA 3ARGA 5GS0D 4Y4KC 3VRJB 1MHPL 1XIWC 1INDH 4P99A 4Y5XB 4I13B 1ND0B 3VSVA 3BAIA 4I48B 4D9LH 2XWJA 1UWYA 3ARDC 3V8OA 4NAQA 3TGXA 4WU7A 3V7MA 3IXTB 4TKWA 5KTEH 4NZRH 4XC3H 2W88A 3T2NH 4F9LC 1GYWA 3FF8A 1S7QA 2XLLA 1FE8L 2WLNA 4ZMOA 3WU1A 1W0VA 3O2DL 4GFXA 1EVTC 1VB9A 2NY4B 4L3CA 5DVLA 4KTEH 4EQ3A 5E70A 1MAKA 3BZ4B 5HHXL 4PJCA 4ZW8A 1XGTB 3EDKA 2Q7YA 5MEPB 1JWUB 1IFHH 1YLBB 4N0RA 1E6JH 4I3RH 4GYBA 1EGJA 2WBKA 1MY5A 1J7VR 2BVOA 3G3LA 2V2WB 1NGZB 2OMZA 4MQTB 5E6YA 1BIIA 3L4WA 1A6UH 2XWTB 4I1NB 4P5TC 4PLJD 1H19A 3SBWC 2XNAB 4Z7VF 5KVDL 4GP4B 2P7TA 4RAHA 5CLTA 1FH5L 3VO0A 4GQQA 3EJJX 2IMNA 5GS0H 4KJYA 1INQA 1R3JA 5GGSB 1Q9OB 1QA9B 2YD7A 2AZAA 2H0EA 2H32H 4NFDA 3WNJA 4ABQA 3EOBB 1FNEA 1WAEA 3WOVA 1YN7A 4RZKA 2HKHH 1JV5B 2Y7LA 1P69B 3UTSB 1MFCH 3L1OL 4ZUUA 2IQ9L 2R69L 5CP3A 4YGVA 3CSTA 3EYVA 1KGYE 1U3HB 4GG6A 2FUQA 4MSWB 1OIOA 4ZUWA 5GXBB 1DUYB 2NY2C 2QHRL 5SWZB 5IB4A 3PPSA 5I19L 4NUPA 4N8UA 2FR4A 4R7VA 2F53D 5CO1A 5G5DA 5EDSA 4TLSA 5DSCA 3ZKNC 4X6DF 3OKDB 3SGJC 3POHA 2OFQA 2BVQB 3BT0A 3BLKA 2HAZA 5JHDD 5C3TA 5TFSH 4RGNE 5F1NA 5HGAA 1N6QH 4MJIE 1QUNB 2AJ3B 1GC1L 2ZPKL 2J56A 1FC2D 5CBAA 2HT2C 1XGPB 2BCMA 3EGSA 3MRQB 1GL4B 2DB8A 4LVHC 4WEBL 1MFEH 3OZLA 4XMLH 5CKGA 3IMRA 1F3DH 1PL3A 5D71L 3PWVA 1OHQA 2VL5B 2ZUQB 3IE9A 4N2MA 5B3NA 2GJPA 1KPRA 1F6FB 1DN0A 1XH3A 2X2YA 3MAWA 4EN3D 1J0HA 1IAIL 3LQAL 3DX2A 4JO1L 4MYPA 5B1JA 5G55A 1XB8A 3EZ8A 1AE6H 1WPCA 2P5WE 1KDIA 2YPLA 3D2TA 1PY9A 2CJUH 4MRCA 4XPTL 1E6OL 4OLWL 2IADA 4RMBA 1DLHA 2VDPH 3I75B 5C8JB 4Z0BH 4BZ1L 1P5UB 2WXFA 3GJEA 1MAML 2BSSB 1JIBA 3O6FD 2EDOA 1S7UA 1UCTA 1Y0LA 2MKLC 2PN5A 3VI3F 4YFEA 3RGVC 2WXIA 4QRRE 1ILUA 3A24A 3BWAB 3ES6A 4BZ1A 2DQHH 3T04D 1KJVA 4EZMA 4CMMB 2CHZA 2JK5B 1R3LA 1AXTL 4LLMA 4LBAA 4NI3A 4F7EA 1I8LC 3KS0H 2A4EA 3C9NA 1L3WA 5F7EL 3ZT7A 3IAQA 5E95B 7TAAA 3T5WA 4MYWB 3QB7C 2CIKB 2J5LB 3K4ZA 5FYJH 4L3ED 5DRXA 5B3SB 2HWZH 1UUSA 2R1WA 2K3HA 3RPKA 2J8UF 1UM6L 3MOQA 1E6JL 4I3RL 4JFXB 4HU8A 1KSRA 5JHAA 3S96A 1KYDA 3THML 4MAYD 1SF3A 4EOWH 2FWOA 2WLKA 5J56B 4S1DD 1AG6A 1G7IB 3H1ZA 5E8OB 4ZAKA 4KTEL 4FNSA 1MWOA 1Z9PA 3H56A 3HUJA 2C3HA 3ZTDC 3L3GA 3VDAA 2P47B 3AXLB 3HS9A 5GSRA 4MJ2A 4WHYH 3RIKA 1EO8L 4KHTL 5HXMA 2J44A 4IU2A 3VXUD 3EYFB 1SXAA 4OZGA 2H4EA 5I18L 2R8SH 2J6EH 3RTQB 4GMTL 4PJEE 1M7IA 3RWEB 3PXHA 1EJOH 4G8GD 4NN6B 1E7UA 1AANA 3V4VB 1TMQA 3L3OC 4WNQA 2VR5A 2PTVA 2NY0C 2YOCA 5L9DL 5D7EA 2ZKXA 5HJ3A 2Q87A 2ZUTA 1AR2A 5LO7A 4ONHB 4E41D 2F1AA 4ES8A 4IK6A 4GAGH 2HJLA 4XP4L 1RZQA 4Z7NF 2QSCH 1E28A 1XGRB 4LSQH 3DV6A 4GAJL 4F80A 3DV4B 4PQXA 3EG9B 4QPEA 3MBWB 5ALCL 2FQDA 5KBLA 3ISWA 1MJJB 1OW0C 2CBTA 4TSCL 5FR3A 2ZKYA 5A16A 4XPHH 3BUPA 4QRRD 4DTGL 4L5FH 2DWDB 5DEZA 4E9TA 2DRUA 1EVUA 5CZXC 2R9HC 3T3MF 4R96B 4WFHE 2EDJA 4RRPM 3MLTA 4F37K 4QYOB 5D2NC 5GJTH 2MCAA 3DOHA 4KH9A 1XGUB 3M7FB 4EJ1C 1JS4A 5A2LH 4HKBB 4XWGH 1G6RL 3K1DA 3QIBD 1NBCA 1P4IL 2XPGA 1AC0A 5HYFA 5DHDA 2R39A 4X4KA 1NAKL 1CE6B 4HD5A 4HJIA 3D69A 3QRFM 4HQQL 4WI3A 2LAAA 2XYCA 1CYXA 5CMAB 3VWJB 4GO6B 5LBSA 2LFEA 1S9YA 3F62A 3MNVB 2EH8L 4JM2D 1NGWA 4LQFL 2XXFA 2DLFL 4JY5L 2BNUB 4GQPH 4Z7OE 2FJUB 2JELL 5EU6B 5AENA 2IMMA 3QC6X 1GR7A 3EYFA 1S7UB 4G43B 1RFDH 1TETL 2P28B 4R4FL 5GS1B 3LN5A 4OT1L 1NBQA 1ES0B 2H1LM 4MJJA 3K81A 4CW1A 4GO8A 1T5KA 1X3DA 4FQQA 3MRLA 2FRGP 1E0OB 4ERSH 4M5ZH 1XTLA 3D5OF 1K8DB 4OAWA 4RFNC 4WDIA 3OKKB 1NLDH 2E27H 4YWGH 2OKMA 5SWSB 5I5RA 1MLBB 4MLSA 5DWPA 1MNNA 3ZHNA 1PTZA 4B9PA 1IBYA 1JV2B 3AM8A 5TPWL 4Z7VA 1U8OA 3Q3GA 4X5XA 5AVYB 1MLCB 4FXKA 3ARBB 3ARGD 3TL5A 1RJLA 5F7DB 4ALAL 4UT6H 1J8RA 1GGTA 2RALA 4ODVL 4U33A 1I9IH 1KY6A 2PW2A 3FQRB 4XMVA 4B7LA 4Y9BA 3VXSB 3K6IA 3CBKB 3HZKA 5MP6L 2W9DH 1MLCA 5C0AA 1IJ9A 2CJTA 5HDWA 2AXFB 4MVBC 3SPCA 3GO1L 2PXYA 4A7SA 4YE0A 3GRWL 3S5LG 1NC2A 2WZ5A 5DMKA 5ACZB 2N7AA 1TF4A 4HHGA 1MIEL 4ODSL 4Y5VC 4M3HA 5L7XL 4I1RA 2UZIH 1H3PL 3EJQA 2YKLL 4PHZA 4JM4H 3ZDYE 1ZGLP 1KLFB 3UJTH 4LVNB 3OKLB 1UT9A 4QRPA 1NFDA 4MJ6A 4YXLL 1C5BH 4EIUA 4KK5D 5LKNA 1ORQB 3FU8A 4FMFA 4RFOH 4GUQA 2P8MB 1T4KB 4JG1L 3ZE1E 3DETD 4RCAA 4NQCE 3VB8A 3AWGA 3TNMB 3QWRA 5LGYA 3CVIH 4YUEH 2XN2A 2E4FA 2YPLB 4G5ZH 2O6FA 3T2OA 5BPPA 5GSRB 4YDLC 1E5YA 4XODA 3O6LH 3OG6B 4P2QA 5D7JB 5GRZA 3BH4A 4FI7A 4ONFH 3TIDA 3TVMD 2A7BA 5MEQB 3M1BB 1QSFA 1AGEB 2PWFA 5BRPA 1ET5A 1KXHA 3NMEA 1TMCB 1S3RA 3IMTA 3NZ8B 1XR9A 2Z8VC 3FDWA 3D39B 2Q8BL 3P4NB 4K2UH 5DUBB 1D5ZA 2VXUL 4P59L 5MEPA 3IMSA 4QO1B 3ZE1B 1VFBA 1ZSDA 3X13A 1H8LA 4Z7UB 1SXCA 1O6SA 1J0YA 3VU1A 3GHPA 1HHHA 2GY7B 2QTEA 1JGLL 3OAUL 3VXTA 1KT2A 3AACA 2YGVA 1XBRA 4KKAC 1ZV5A 5JQ6L 5E2UL 5ICXA 5TF1H 1U8CA 3MLZL 5H35A 5K59E 1D5IH 4GS7C 3SQOH 3L1FA 4O4YH 3W11C 1N5YH 2EP6A 3EBGA 1ZLVK 2CUMA 3BEWA 4IHBA 3C5ZA 4KFMA 2R59A 2X4TB 2WXLA 4ZMZA 2CIIA 3KD4A 1VKXB 5I1KH 3NYKA 3QUZC 3NDYE 5FO8B 1BFSA 1THCA 3QFGA 3QDGA 4NO2A 1SN5A 4S0HA 4P5TA 2CR6A 3VMNA 1NOFA 1WUZA 5KJ4A 4YNYB 3U1SL 3LV3B 2A0LC 3VXRD 3MV9D 1G7MB 1S78D 1SY6L 2AJVL 3ZE0E 1AR1C 4NSKB 4JVWA 3JV6B 3LKNA 4PCSA 1UA6L 5L2KB 3FFDA 2YPVA 4F92B 3BP6A 4OCXH 4JR9L 3PP3H 3GMOB 4JFEB 5JXEC 1XT5A 2A9NH 3KLHC 1ZLEA 3EXLA 2VDKL 2ZAHA 4HIIA 5J0BA 4RBPK 5ENWB 3FTVA 3HI5H 3N3EA 2NX5B 1FUNA 2YPVL 4PSPA 3PGFH 1F11A 3GMPA 3IEAA 4N6RA 2Q6WA 3D48R 3IN0A 3KXFB 2BIPA 2NY3C 2ZCZA 3S2AA 5E4AA 5HYJD 4PPTA 2IWFA 1MFNA 3Q2WA 5D5MA 5D96B 2PYFB 1BQKA 4NKQB 5SV4A 5DJZB 1PYWB 3P69A 5LXGH 3VTMA 3UTPE 5C97A 2YPKA 1JZ8A 4N20A 4XXCA 1K8IA 3GUTB 1LDPH 5BRZB 3KAAA 5HDQH 2PLTA 3FTWA 4TLKA 1T5XB 3MUGA 4HV8B 4AY0A 2PCXA 1ECYA 2WLZA 3VB9A 4KVCH 4MSWA 1X4XA 3IDNA 3KPNB 5ICXB 3GNML 4IRSB 2YQ2A 2YUWA 4MZIA 3ZTCC 1O6SB 5D72H 4MDJB 1AR1D 4P04A 1OCWL 4PRHA 2VN4A 1P5UA 3MUHL 4XO8A 1HYRC 5EC2A 1BD2E 3BT2L 4JJHA 1ACCA 2AHIA 3MV8B 4J3VA 4Z95H 4ZTPH 5FYLL 3S8WA 4OH2A 3LH8A 2MRYA 4LIQH 2AK1H 3BZ5A 1FNSH 4ELKA 5EOTB 5J9PA 3TEYA 3FPXA 1MFDL 4F27A 3C2SA 2GB2A 5I1DB 2OSLB 4BGLA 3VFMA 4UTBL 3GZQA 3E8UH 4ENED 1ZHNA 3G04A 5C71A 4HWEL 4FQLL 1FL6A 2HPTA 4XN5A 1M7DB 4TMPA 1CU4H 2F5AL 2MPAH 2WTRA 2YQGA 4FF9A 3KWWA 5IQMA 1XGZA 4QY8B 2H1PH 3WENA 5KVEH 4W70A 4UI2A 3WTWA 5I75B 1XF5B 2XG5B 4MNGA 1CUOA 5EU3A 1FVEA 4B53A 5B8CA 2X1PA 3DX7B 1GJUA 2EDHA 2OP4H 4HFWB 1WSST 5IY5B 3CXDL 4LSUL 4HEMA 3CFKA 2AMGA 3BDBA 4UQIM 4LLQB 4NZTL 2EINB 4NQUA 1N5AA 2ZOLB 4QRTA 4TNGA 3JBG7 2CO4A 4H40A 2E59A 4X4YB 3M6DA 1TJGH 2R0LH 4XPGL 5E6IA 2WINB 4NC1E 4H0LC 3NACL 3NK3A 1IBGH 4X98A 1UA7A 3N1GC 4WW2C 2IPUG 5I6NA 3UDWA 4ES9A 4P2OB 3IU4L 1JWMB 1R17A 1KBWA 3LPOA 5E03A 4DP1X 4ABUA 2ED6A 1I53A 2P8PA 2ZP8A 2O4EA 3RY4A 4Z7WB 1W72H 2UV3A 1HHJA 1YN6B 3SDDD 3FCTA 3PGCB 4WWPA 1U8PB 3QUKA 1XGQA 1E67A 1NC2D 2JE8A 4ISVA 5KSBB 2OK0H 3ATEA 3MACL 2JI2A 4XP1H 3LV3A 4BFRA 2MHAA 3IJSB 1S2EA 2A5UA 3RNKB 2H8PA 5CP3H 5F7YC 3ZUNC 3U4EA 2QSTA 5J13C 1VCAA 2VUKA 1KYOJ 1KY7A 4YDKH 4AYID 1YC7A 2DJMA 4HCGA 4K8RC 4IM8A 1P7QA 5F8QC 5EF1A 4V33A 4FFYL 3STBA 1TCRB 1Z9SB 2EE9A 4UYQA 2G0KA 3GBNH 5FGBC 1BM3H 4XN4A 5IIEB 3MV9A 2B1OA 4OD2B 2ISDA 5DI8A 3S5LB 4YK4B 1IC7L 2QADD 3X3FL 3V5DB 4GPVA 1ZS8B 4ODTH 5JMRA 4LNRA 2ERJB 5C0AB 5HTSA 1LD9A 3JV4A 1C1EL 3UC0L 4DGWC 1Q8MA 3DWTA 4IJ3C 2K45A 3DHUA 4NPYB 1V5JA 2GC4C 2VRAA 2XJKA 2MOVA 3C5SA 5CSGA 3QEHA 5TQ0H 2K1MA 5E24E 1JXFA 1J05B 3L3HA 5EF2A 1IM3A 1ESOA 3OQRA 3NABH 4Y9EA 4ZSOB 4OCSH 4Z5RB 3VI3A 3D07A 4HKJB 2ZCLL 3GKWL 4AEFA 2IAND 3MREB 2X44D 3QA3A 4DP8X 3F04A 5JPMB 4G6JH 4G8FA 4U3CA 5IHZA 3PHAA 3RWCA 4M43H 3CC1A 1IMHC 3MGTA 3V0HA 4YHZL 3ARFC 1ZVHA 3V4VH 4WVRA 3KWXA 2AJXH 5ACLA 3QXAB 5DRWA 3NBNA 2APXA 4TPRL 5MI0C 3G5YB 3A3YB 2GYSA 5IJDC 4N2CA 3MLXL 3ZT6A 2G3ZA 1OK0A 4O02H 2B0SH 3D4ZA 1YAZA 1I1AD 2PP7A 2HTKD 1CS6A 4MHHI 2Z3FA 4PRPD 4C55A 4X99B 1TJIL 2DLTA 3U30C 3SDYL 1NMBL 1IC5H 3H0TA 4MXQD 2LVCA 1TSHA 3RWJB 1HCVA 2FWUA 4CJ0A 3HPJB 3K8KA 1RZFL 4G42A 4JBSA 4HS3B 3H9HB 4ZUSB 2GSIA 5E6RB 5B1AB 4XC1H 1BXUA 4U0RC 4H88L 1E8XA 5LGHH 4QIRA 1NAMB 3P4LA 4KV5E 3UXFA 4I5BA 4X6BA 5JHLA 3ECVA 1AHWC 4X5PA 5FX3A 1HNGA 1QQDA 2QQQA 2V3EA 3BP4A 4WEEA 4DOHE 4OCYL 1KC5L 4W9CC 3ZX1A 4PGEA 3NFNA 1BPVA 1X6LA 2UZYA 1KJMA 1WFNA 3IXAA 4APQB 3QZWB 3QQXA 4KKPA 5JIPA 2QZQA 1PJ9A 3E9UA 2YGPA 4UUJB 3BWAA 2A1WL 2GY5A 2A83B 3ES6B 1EGJL 4A7TA 2F2HA 2K0RA 2O5ZL 3AVEA 4FQQB 1RURL 2VXVL 2X4OA 5AOLA 4XN7A 4W81A 4YPGA 2AMUA 3PP3K 5SWSD 5TF0A 2P5ED 4Y89A 4GRMB 1KIQB 3K0WA 2GIYA 3VWKD 5IHUL 4WI4A 4LCUA 5IQ7H 4A04A 4JFVA 4FADA 1A14L 1FO0H 4WNSA 5EUKB 2YC1A 5IT2L 1U8QB 5DJXB 4BWTA 4RMTA 1QVOA 2WUCL 3FCSA 3H3BC 3Q1EA 4HIEA 3UFIA 3TS8A 3SZKC 1T04B 3RVWD 3ESVF 2XZAH 3FQ4A 2N0KA 3MRKB 3HG2A 5E8OA 5CXPA 4LPVA 4HJ0C 1EUUA 5FLVA 4KAQH 3LVEA 1C08A 3S3JA 4MD5A 1JN6A 3P2BA 3ZBMA 4XBGB 5I8EA 1ZEAH 4WSKA 2I5YH 4JPIA 4NQXB 1F0LA 4KQ4L 4XPBH 3GBDA 4WY7L 5F8RC 1KIUA 1CFTB 3MR9A 2PWHA 3CK0L 4LLVB 4NOFA 4U0QB 4AG4H 5LBSH 3G08A 1MCDA 2AJUH 4JN2A 2FT8A 1KEMH 4FJYA 4XX1E 3RVXD 3M7OA 1TEYA 3D7PA 1YYMH 4MX7A 2OMVB 4JG0H 1ZDQA 1M71A 3MNWB 1OF0A 5FHAL 4I3SH 4BXVA 4M48L 5BQ7A 1YY9C 2C1OA 2YO3A 4LLDA 4ODHH 5H94B 4JPWH 4ZI8A 2FEDD 4PREB 1JFHA 3QDGE 1YO4A 4HCIA 4TL4A 4JO4H 2GG1A 5EO0A 3HNSH 1XZ0A 3D0LB 3VRLF 7FABH 1FPTH 1GHFH 4PW4A 2MTPA 4UQCA 3V5KB 4ZD3H 5DQDL 3DOSA 2IDQA 4XP5H 3ZGHA 3RWCB 1S46A 1QO3A 4L18A 4OM1H 3NSJA 1OTUD 5DUMH 5B8CC 5MEND 5D1XA 4PGBA 3GKZA 4N2AA 1KTDA 4NQVA 1I7RB 4PJGF 3ZL1A 4YEFA 1OT4A 4TOYL 5GGUA 4KNTA 2E47A 5E9AA 3MJ8B 3OJ2C 5HHVH 3FT4B 1TJMA 2AEQL 5K39B 3WFHA 2H3NB 3FQXB 3LD8C 4KKCD 4PJAA 2F19L 1Z3GH 4G8IB 1KGWA 4HJTA 4DK3A 3IDJA 5D55A 3JZ7A 1UVQB 1JPSL 1BQHB 2OZ4H 5TDPA 1QSFE 2E6PA 3A21A 3NJNA 4Z3TA 3OHMB 1QYGL 3JUYA 2OCCB 3JWNC 5F0PB 1HHGB 1T1XA 4IU3A 3LEXB 3B7RL 4Z78A 2R2BB 1EEUA 2XWJB 4AYMC 1BBJA 1Z9SA 2X2HA 4OF6A 5MEOB 3HRZB 3IS0X 2FJFB 5CJQH 5TDOB 5FYLD 4GG6B 3TTYA 3TO4B 3DMMA 4Z3JA 3VXUA 3TO2A 4A63A 3FT2B 4OZGB 5BQ7B 1PG7W 2E4TA 3REVA 2CAKA 2YRBA 3C5XA 4XNQA 2FIRT 1AD0B 4M8VA 5D7SH 5AEAA 1E8ZA 1Z0MA 1ZJAA 2ZONA 4YXHL 2ADGA 3MYJB 3QPQC 3PGCA 1QACA 5BV7L 5DZNA 5BVPH 2DQGL 1L5GB 1BQSA 2NY0D 4G7VH 5DXWA 4P2OA 4UBDD 1M7UA 1FAIH 3X17A 4X4ZA 5TD4A 1JK9A 4X6EA 1K4DB 4Y1AE 1RZKL 5GGTH 4V1DA 1F4YL 4JMXA 4QRRA 4BINA 4XXWA 1YEWA 1ZA6B 4PY7B 1I7ZB 3GSNL 3EH2A 4POZC 4JJOA 3ARUA 2D73A 4PJ9B 3VJ6A 4YX2L 1C7TA 5L4JA 3QJTB 2XSKA 1EFXD 1EGJH 2NY7L 1DQJB 1XQ4A 3IFPA 3NG5A 4HAFA 4WSGA 3LTVA 4EZLA 5CCKH 1PGRB 1A22B 12E8H 2BWQA 4FABH 4LVOB 1WV7T 4XCCL 2ALAA 1XZWA 1SY6A 1QR1B 1DL7L 2OJEB 4RMRA 2YN5A 3PWPB 5DYOB 4HGMA 5M95B 3TZVD 2EDWA 4OD3L 1J12A 1YQ2A 3IM1A 5IFHL 2BDNL 3ZE1F 1CICD 4WW2A 4FDWA 3W1ZA 4LZKA 1HX0A 4UV4L 4XCCH 2FWSA 4XC1L 2Q86B 4F8OA 4PWEA 3DIDA 4IKLA 2CGRL 4X9GA 3HBZA 3IAPA 3LRLA 5I6OA 2JF1A 3CXFA 2XTJE 3AMLA 1CQKA 2AF2A 1SDDA 1YEEH 1AKPA 5EV7A 2NY3D 1N0LA 3A5VA 3WUWG 2DTMH 3WSQH 2FWLB 1BECA 2IDFA 3G5XB 3PWVB 4W4NA 4AQEA 2X9XA 3EHBB 1BQUA 3EOAB 5D8JL 3GJFA 1NCBH 5T5FA 1P0SE 4BZ2L 2YIHA 2J2ZB 2XXCB 2QPDB 1HK6A 3QO1B 2LR4A 5KWYC 4HKXB 4IJTA 2YWZA 2GJ6B 4MJ4A 4O02L 4PJBB 2HTLC 3VSUA 2YD5A 4Y0GA 4HXBH 4UOW1 3VA2C 1ZS8A 2A73A 1I1AC 4KJWD 4LP4A 4X83A 1QAWA 1YSOA 2C4XA 1T83C 3AWEA 1ROCA 4D0BB 3LS4H 4F7EB 4QRQB 1A7QL 2C1PA 3ECUA 3LIZA 3RA7L 3SPVA 4EZJA 4D0DB 3KPPB 1OWRM 1ASPA 1M9WA 2ETWA 5EWIH 4G6JL 2JCCF 3A4FA 5JMOC 1AIFB 5IEHA 1BYOA 1SF5A 2ORBH 1PX4A 4E9WA 3PAVA 3A6CH 4NHCH 3W2DL 2A9DA 1GKEA 1BXXA 1LO4L 4YLQT 2FL5A 5J6GB 3T0BA 2XIDA 2JKLA 4FQXD 4IBWA 3ARFA 5AW8B 3QJQB 2V17H 4HZAA 2ODIA 5C08E 2TRYA 1HSAA 2L3BA 4Z7OF 3KEHA 3NFSH 2XKNA 3B83A 1GMEA 3BXNB 2G3NA 5EO9A 3O41B 3MLPA 4BUHA 2P7TB 4HIHB 4G9FB 1JWSB 5EA0L 3CVHA 1U91A 1KYFA 4BFFA 1MCOH 3L9BA 4UNIA 3U2IA 4N3TA 4IEFB 1JXKA 1IC7H 5E6IB 3FU9A 3OAWA 4N0FB 3FAWA 1N0XL 1TYJA 2WGXA 3IJYB 1PNCA 4AH2B 3UOAB 2ZSVA 2M26A 3UYRL 1RUML 4NIYE 5C0GB 3H2QA 2GT9A 3TA3B 2VAAB 3GI9H 5DD3H 1G9MC 1S7RB 4G1EB 1X5ZA 4GW5B 4NXSA 3GS4A 5C08B 3A4EA 3ECQA 4J4PC 4DP0X 3HPJA 2VZSA 5JOPE 4MJ5B 1EEYA 2ZAIA 1JDDA 1QFWI 2LV4A 2Y3AA 3S37H 1V10A 3WKNA 8FABB 3RIFF 3MJ9L 2AANA 3Q44A 1EDQA 4FQXC 2UY6B 1LVEA 5FGRA 1EXUB 1IGCL 4MZ2A 3SN6N 2EILB 2G3MA 1DSFH 4TQIA 2DKSA 3WHE1 2BIHA 1UZ8A 3VFSB 1WCBB 3EGDA 3FTGB 4WWNA 1ETZB 1U93B 2EICA 4PLNC 3APNA 3TYFA 3BVDB 3VD7A 3NH7L 5CWSA 4BFGA 4P46C 3CMOH 1R0AH 3DTUB 4BK5A 4LFHD 2VLJA 1AKJD 1MCQA 2FX9L 1SYVB 3D87B 3TCTA 2HN7B 3MLRH 1WLHA 5I17A 4UDTA 1HQ4A 3KCPB 1OT1A 4EVNA 4WEUD 2C8NA 1YEFH 1WZAA 3PABA 4ZXBD 2BJML 1WBYA 1KGCD 1I31A 3AY2A 3HHRB 2TAAA 5T33H 3C5ZC 1A4KB 2Y5EA 4J1UB 3IJEB 1CT8B 1O7SA 3QUZA 3MV7A 5EN2A 1R3KA 2NY1B 4GNKB 2EE6A 2BFVH 1VESA 5DUPL 4Y8DC 4MQ7B 3SGEI 3RHWF 3PDDA 4GEJA 4KUZH 2KLSA 2X9YA 3BOVA 4HIJB 4Y4HD 1W6WA 2YQBA 4J8RB 2VN3A 3MOBH 3TJHC 3EH4B 2ZUYA 4WO4C 4R2GD 4Y19E 5I30L 3NPZB 1SEBB 3DMMD 2CRMA 3VTAA 3LQZB 4I7ZC 5T3XH 1KN4L 3DYPA 4I2XA 1ET7A 5HY9B 1MHCA 2P26A 3PWNB 1HEHC 3RE0A 3II2A 3ZDZF 1UHVA 4PJFE 1J5CA 3VYPA 3IDIB 2R23B 3MSPA 3TT3H 2CLZB 4BZYA 2AVGA 1H15B 1OAZH 1D5RA 2XWBB 1Z5LA 3F7VB 1MFUA 1VZIA 3LNDA 3NFSL 1RVFH 2VQ1B 2H45A 1MCPH 3HAEG 2BW5A 2V17L 1ZHLB 1BEXA 5DS8A 3EJZC 1I9JH 3O3DB 2VW6A 3RY6A 1WD9A 1DBAH 2Y07L 1HQRA 4WHDA 3MUZ1 5IV2A 3QHFH 3G6DL 1WCQA 1IGML 2FTAA 3K72B 1KJ2L 1MF2L 2WKOA 3FXIC 5IW6B 3BUYB 3TZVA 4GQ9H 2HCZX 1U8HB 5D72L 1G9NC 4YHPB 1AY1H 4Y5YB 5EIIA 1QFWM 4C4KT 1M42A 2L8AA 3G9VA 2YD1A 2EIDA 1T6BX 4JRLA 4QRFA 1JGVL 5IBTL 2GEQA 3O3UN 5D1XC 1CK0L 2CGZA 3D39D 1ORSB 2CMRH 1E9PB 4HCRL 4UT6A 3ULSB 4MMZC 2YMXL 1F3JB 4LPUA 3W0WB 2A38A 3S8FB 1RZFH 3DLQR 3VUAA 1MJUL 1MCIA 2JJWA 2C1OB 3BEWB 3MRBA 3SDYH 1TU2B 2AV1B 4PV8A 8CGTA 5L0QC 2WQWA 4MCYB 3FB5B 1BGXL 4OGXH 5CJ5A 4GG6E 3KYOB 4J28A 4R5TA 1MVYA 4GKZA 4F7KA 3WSQL 1IQWL 2VM3A 5E8DH 2DQTL 2XIBA 1HL4A 4IS6B 3SE6A 3BSZA 2CE6A 3KBPA 5IMKA 4BH8B 2X87A 2AQTA 4AVJA 1HT6A 4X6DA 1W15A 4N5UA 3LQMA 2EVIA 3GLEA 3IAGC 3UYOD 5MERB 4MB1A 4G1EA 4GW5A 4NQXA 4GOSA 4TPRH 3GK8L 3PXJA 2WO2B 4Y5VA 3DA0A 4KKZA 1UXSA 3UGUA 1XR9B 3NPSC 3OV6A 5B39B 1VDGA 4RDQF 1MCJA 3X3GL 1FL5B 3AW5A 3IMWA 3HC3L 3PJNA 2R4SL 4HEME 4BJLA 2ICWB 2ZCLH 3I6GB 1AXIB 2CBOA 2NTSP 3QZNA 3P9LA 4MAUL 3HJEA 2XA8H 3WHE0 4PLJC 4CUCA 3Q7JA 2K9UA 4MTMA 3AS2A 3EH5B 3EJRA 2DQFB 1IIKA 1A1NA 5HI3C 3Q2VA 5TQ0L 4YX2H 2XKNB 3BXNA 4IRJC 5EO9B 2J4WL 1LO4H 3DDFA 5IESH 4OZFH 1NCAH 1ZLWK 4LCYB 4UT9A 3WS3A 3RPIB 2W59A 2OMYA 2D2CC 5EORH 4LGPB 6TAAA 1IGIL 2IPTH 2BC4B 2TSBA 1GGCL 1FP5A 1M57B 2CIIB 2I07A 3VFPA 4AGLA 15C8L 3DJZA 3SY0A 4ETQA 4UF7C 1DUZA 1J0IA 2AJYL 2YAQA 3O0RH 3QK0A 1T7VA 3NN8B 1A3LL 3FAXA 1A8JH 3V0VB 2PR9A 3ZO9A 3HS8A 1E4WH 1RK1B 1YEJL 2VDOB 4Y2DC 5CIPB 1Q90A 1UC6A 2JNZA 4NAMA 3R0MA 1KT2B 5HDLA 2DQGH 5I5IA 1AQ8A 2JI3A 5JR1H 1RUKL 5IBLD 2X4RB 3NIDE 5DMGC 3VJ6B 4X0NA 3DJSA 1DEEA 5T3ZE 5AYQA 3GI8H 1XAKA 2FATL 3TH4T 3FS9A 4MRBA 2JQMA 3ZSSA 2ED9A 4C4BA 1SPDA 4PN6A 4XP1L 3QZLA 3EYUH 1D5ZB 3D9AL 1H3UA 3N42F 3QO1A 3OD3A 4KMQA 5E08L 2NY5H 2XZCH 1MFMA 4HS3A 2X09A 1AIZA 1AP2B 4NS0A 2B59B 5DJAB 3WE1A 1XF3B 4LEEA 4JHAL 2PTTA